2WSCC

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determination and Improved Model of Plant Photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 4
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wscC00
1FRHA 1JB0C 2GMJA 2FJBB 2O01C 4OMFG 3MM7A 1FRIA 1DAXA 2V2KA 3MMBB 3EXYA 2FD2A 1IR0A 1B0VA 1FDAA 1GTEA 3EUNA 1BC6A 2PMZD 1SJ1A 1GTHA 1BWEA 1C4AA 2WSEC 1Y5IB 2V4JA 1GT8A 1AXQA 1PC5A 2WSCC 3MMCB 3IR6B 2C3OA 1KEKA 1CLFA 1BLUA 2C3UA 4DHVA 2IVFB 3MMBA 1B0TA 1BD6A 1PC4A 2PDAA 2VPXB 1H7WA 2FJDB 1FEHA 2WSFC 1FCAA 1C4CA 1FRXA 2FJAB 3GYXB 3MMCA 2FGOA 4YDDB 1B0PA 1DFDA 3MMAA 1FDNA 1FF2A 2UZAA 4CI0B 3OR1A 5CH7B 4KT0C 1FXDA 3MM9B 4OV1A 1FTCA 1H7XA 1XERA 2GMHA 2WAQD 7FDRA 1FXRA 5BYQA 5BYSA 1G3OA 1BQXA 3C8YA 1KQGB 1JNRB 3OR2A 1IQZA 2VPYB 3HKZD 3OR1B 1FRMA 3MMAB 1HFEL 4XK8C 1WTFA 2XSJB 4L6V3 1KQFB 2V4JB 2PA8D 2ZVSA 6FDRA 1FRKA 1A6LA 3MM6A 5FD1A 1GAOA 2Y0SD 1FD2A 2Z8QA 1DURA 3MM8B 2VPZB 1G6BA 3IR7B 1Q16B 5L8RC 2WB1D 3MM8A 1FRJA 5BYRA 1Y4ZB 1JNZB 2FDNA 1F5CA 3MM5A 2VKRA 1RGVA 1R27B 2C3MA 2FJEB 6FD1A 2XSJA 2C3YA 4XDDA 1VJWA 1F2GA 2C3PA 1FRLA 5CHCB 4AYBD 7FD1A 1H0HB 1SIWB 3MM7B 1Y5LB 3OR2B 1ROFA 4RKUC 1D3WA 3MM5B 3EGWB 3PNIA 1F5BA 4ID8A 4XDCA 2C42A 3MM6B 1FDDA 5E7OB 1FERA 1SIZA 2VPWB 3IR5B 1FDBA 1Y5NB 1H98A 4Y28C 1K0TA 3LW5C 3MM9A
chains in the Genus database with same CATH superfamily
4OV6A 3H7HB 1SUQA 1RLCL 4WF9Q 4RO0A 4F0HA 2FJBB 1JLAB 3NS6A 4XTTA 5DG7A 3UE2A 4RL1A 2BVZA 4H4MB 3TNVA 3VAFA 1VHIA 4N5SA 5GAEI 1TKXA 5L9XA 1CJUA 1PO6A 1FNOA 1NO8A 1WEZA 4WYWA 2R2UA 1X4GA 3L9ZA 1EKRA 1IKYA 2CIMA 5CYMA 2VA2A 4ZLPA 5KT5A 3W1YC 1SJ1A 5F41A 4USUA 1GTHA 2IRUA 1J5OA 1ITPA 4FF2A 3HHDA 3T6JA 1OPZA 3V4IB 4DL2A 1GEHA 3GU0A 1N52B 1X4DA 1B3TA 3AD7C 3LUYA 4KKOA 3NG8A 4ZPTR 5KFZA 1MWQA 2AZ1A 2OLWA 1B4SA 2RE1A 4C3KA 3J81U 1KBRA 3JB9k 3AD8C 4DFMA 2X51A 3CJ2A 2K3IA 3ILOA 2ZOFA 1MW7A 4S0MA 1GMWD 4URQU 3V5RA 2CPHA 5EDWA 4Z2XA 2VD3A 2EKYA 1S6QB 5DLGA 5K20B 3KLGA 2I9SA 1FCAA 2X1GA 2JC0A 1HMVA 2YKQA 3LP1A 3R5BA 2HFSA 1HD0A 4OYWA 4TLQA 1NPRA 1I94J 4TNOA 4KKOB 2CA9A 3OW2R 3E01B 4DQSA 2K06A 3TVKA 4UZCA 3Q24A 1SQGA 2PN6A 2V63A 2EFGA 3BGRB 2ATCB 2V6AA 3PFOA 2CJKA 2H5EA 5CYQB 3GB0A 4LF8F 1TL4A 1Q7LB 2QT7A 2ZOGA 2VASA 4OIXA 9ATCB 1U4BA 4H4KC 1VQNS 5DRKA 3CDBA 2AHOB 1OO0B 2F9DA 2IJFA 3OJSA 3LH2S 1H2TZ 4KPCA 2EC0A 2R2SA 5E3PA 1UETA 5BYSA 3HSGA 3ETMA 2HPUA 2VOPA 4ZP7A 5DG9A 2QLWA 1X9SA 2QFIA 1SJQA 1TAQA 3PW4A 4NASA 2BOAA 4ENOA 2A1BA 1NSPA 2CPZA 3BBBA 2Y3YA 5IM0A 1NPPA 4LQ9A 5F8JA 2VBXA 2DNZA 1RZMA 4NEZA 3OVSA 3LPYA 2HNYB 1KSPA 5KFDA 2E9ZA 3HSJA 3UD3P 1HQEA 1HQEB 2CG8A 2HLUA 2KI2A 2W1BA 3D6MB 1QAJA 3HT0A 5JXSA 4C8LA 2KVIA 2CXEA 4G1QA 1C0TB 2AYGA 4ZN3A 2VODA 3M8ZA 1S1UB 4NLYA 1CJKA 1FEEA 3M2UB 3UN5A 3OTOF 3CC7S 2XG8A 4AD6A 4DV7J 3IM8A 2HHTA 3KLEA 3KNAA 5E33A 3DLGB 1PAUB 1JJ2R 1IR2A 4IH7A 2LP4A 3QLHB 4ATNA 3PR4A 5LXRA 3ILJA 1DLOB 4C3MA 2P9GA 4QCLA 4PQAA 4ECQA 2MKHA 2V0NA 4TKTA 5DS7A 4ZHRB 1S0NA 2BM1A 2C2KB 4CWBA 3AJDA 4PWUA 1ELOA 2FGCA 3GCXP 2AQ4A 4LFCF 4P52A 1S1WA 1WC5A 3P8BB 2DGXA 2UUTA 3C6TB 3DI6A 1Q5VA 3TANA 5KFHA 1QY7A 1RT2A 4TY9A 4B9VA 1ROFA 4ZLNA 3R9LA 1RK8A 4PXDA 2UXCF 1NDLA 2ILYA 2JLFA 3BGRA 4CLYA 2V34A 4J5OA 4C7QA 3LGHA 4GMKA 4OX7A 4Q44A 4ED6A 2KM8C 4ILMA 4FS2A 5E3AA 2B7CB 3BGFA 2QRRA 1HIYA 4OJ1A 4J91A 4M5MA 3ITHB 5HI7A 3CC2S 2CWKA 2VB6A 3RYLA 1AZSB 1WHVA 5HMWA 1EAYC 1RTIA 3PYFA 4A46A 1XR7A 5B0CA 2P6SA 4X64J 4E98A 4DR4F 4YDXA 3I4HX 5K14B 1IKXB 3C6UB 1VRUB 3AA8A 4OZLA 2BBEA 3B78A 4ZPBA 4OYBA 2YWGA 1OYDA 2JFKA 3CIMA 1BE4A 3QO9B 5A6PA 2OH2A 2DRAA 4QYZJ 5HANA 1LFPA 2DCUB 4O3NA 3WDOA 1N36F 5DM6Q 4ICLA 2JVRA 3NRBA 4K5RA 2M4MA 2WSCC 3MMCB 3HFKA 4HTJA 4LBPA 4CP5A 5B0GA 4DZDA 5KFNA 3T1AA 1TK5A 4IOAQ 2VG5A 3QO9A 4K2JA 4OYXA 1WD6A 4DPXA 3DLEA 2W9CA 1Z4UA 4ZVQB 2W25A 3GE9A 1AT1B 1C4CA 3M2RA 4KY3A 3THPA 3BO4A 2VF3A 5ITHA 3BYRA 1GH8A 2ZHOA 3NAHA 3BSCA 1NB2A 2OPRB 1VBYA 4FXVA 1BY9A 1FVQA 1MMLA 1CS4B 2W9AA 2R3VA 1YHQS 1S77D 1U0HA 3EWGA 2UVVA 2R7TA 3KK2A 4HHHA 4FKXA 2DJWA 1UW9A 4I4BA 5IV4A 5KFYA 3ICLA 1S6PB 1MN7A 1RTJA 3BYPA 1NHUA 3DDIA 1Q0NA 4ELTA 4UUXA 5I3UB 4WIIA 2V50A 3KWMA 1VQYA 1IBKF 1VLYA 2O67A 1D9AA 4B3MJ 3HK2A 3S1TA 4W92B 4F3OA 2GS8A 2Q1LA 3D3BJ 2E7VA 2CPIA 1D9FA 1S1TA 4ID5A 5AXNA 1AB8A 2COLA 2FHKA 4CCHA 3JTPA 1F9EB 1GNKA 2V4JB 4OJHA 2JH3A 1KQFB 1QVGR 4DPOA 2XS7A 4ZP8A 3DLBA 1TELA 2RNEA 4UOHA 4JUZA 5DQIA 3HVAA 2HVDA 1G4CA 3KG0A 3MEGA 2C2NA 5FD1A 3M9NB 1UPMB 3UR3C 4N8OA 4HI1A 4KYZA 4I7FA 4I7FB 1RSCA 4QIFA 5DDRC 4HEA9 1W25A 2D41A 5GAGU 5K8NA 1HNVA 3OSNA 1R0CB 5KFTA 2YXLA 1WSRA 2IFXA 3FNNA 3D2WA 4LBHA 2ZBRA 3R1LA 1RT7B 4Q2LA 3TX0A 3KHGA 4DV7F 1DRZA 2J5AA 4ECXA 1EARA 1FO1A 2HRYA 2W2OP 3KJNB 4NZ6A 2IC3A 5J2NB 3ULHA 5LMNJ 3HHLC 1ZAVA 3M30B 2H3EB 3BPDA 2U2FA 4UTGA 1U49A 1HHQA 1Q8IA 1T3OA 1QE1B 2NZCA 3PHTA 2RAQA 2YVSA 4FNHA 5J1EB 1VQOS 1VCTA 1NK5A 4CRJA 1NSAA 4MKVA 3GMGA 3FK4A 1UEUA 2AEFA 1RCXB 4R8UB 2MQNA 4OZ1A 4DS5A 2UUCJ 3OR2B 4BLGA 5EWFA 4J9QA 5J2NA 3M8QB 2HWIA 2IRYA 1OY8A 1TVRA 4DFKA 2CQHA 1T3NA 3D7SB 5G4DA 3KK2B 1EB0A 3ONQA 1N5VA 2GNKA 3HO1A 2C2EA 3HSZA 4K4ZA 1UP1A 2MKJA 4AL6A 2M7SA 2C28A 2IRXA 1CC7A 5CYQA 4DL0C 2OMLA 1DQAA 3IAS9 2J8AA 2V67A 1VS3A 2DR9A 1RUSA 1WKLA 1NU4A 3OTCA 1W2IA 3IS9A 3WZ0A 1RT4A 1EX8A 1YK9A 1HWIA 2OEJA 4GO5X 3NS5A 2ACMA 1G2EA 2UUBF 1YRUA 3EICA 2GQCA 2ZE2A 1AA1B 3I9V9 5HMYA 2HK3A 4B02A 4LF5J 4DR4J 5FJ4A 2YNHA 3SQGA 1LV5A 3CJ5A 4ICLB 2CNLB 5HP1B 3TVYA 1LKZA 4DPTA 4IH5A 5THWA 1S5ZA 2BKOA 3LOUA 2MLZA 5FIIA 4H4OA 3PACA 5IM0B 2B7BB 1EJ7L 4C48A 4L3KA 1S1UA 2HLTA 2WCXA 5HK4A 4DR6J 5A8WA 5KFXA 1KEKA 1NDPA 1BLUA 1QUVA 4JB8B 3MD3A 2UV8A 2I5JB 2ZH3A 3BQ0A 2F8HA 3RTVA 2AP6A 1NK7A 3C15A 1B7FA 4LF9J 2H5JB 4I67A 2BYCA 4RWXA 4KTQA 4QR2A 3D0GE 4N76A 2KDOA 3M6XA 2LXUA 1UEVA 2BQUA 1RT5B 2DGOA 2XQCA 2YH1A 3P45B 3TA2A 3TQEA 4F3QA 4JV5F 1RT3A 1DFDA 3BR9A 3UCGA 4BWJA 1R0AA 4I68A 1KONA 5KG2A 3LWLA 2XLJA 3RB6A 3BV8A 4OI4A 3TUZC 1R8HA 4IDKB 5D4OA 1XERA 1Y3KA 3WC0A 2WAQD 1NDKA 3Q8SB 3RRHA 3FCVA 4KGMA 5BYQA 3V6KA 4WTOB 1JJ4A 1XTZA 1GX5A 1BWVA 2XEXA 2XMWA 3DLHA 2YX1A 2BABA 3QRRA 5B0FA 1YTYA 3DRSA 2GVZB 5ETVA 2MKCA 2QLXA 1UVNA 2J6TA 2MZQA 2VUGA 3RR7A 3AQOA 2H5IB 1U47A 1Q7YT 4N41A 2QZ8A 1RBOB 2RQMA 3OFFA 4DQQA 5B0AA 3EZ5A 3CTRA 2HGMA 2HQFA 2HSEB 3OT9A 4ZLLA 5C5JA 5KFIA 3AXMA 2EI5A 2VOOA 4U7UD 4ZOSA 2HZCA 4DQPA 1NK0A 2BE9B 3IR7B 4WJBA 3ITHA 1RAFB 3AODA 2DHSA 2VQEJ 1PGZA 2M9KA 4JI3J 2PO4A 5A8KA 2XLKA 3CCZA 3IRXA 4JI1F 2KYZA 1RYSA 2HZAA 5IT4A 3RB4A 2F4VJ 4Y00A 1RYRA 2VG5B 4WFZA 3PYGA 2AV5A 4LIWA 2RILA 4F7VA 3LP0B 4J9RA 2FY1A 1RWXB 4KO0A 3OPKA 5HAOA 4WXOA 3H40A 3D54A 2AIRB 4Q7AA 2CRLA 5FLXU 1HBOA 4P6QA 3CJTA 4XDDA 3RUBL 3HHKA 5IV3A 3NGDA 4B9LA 2EK1A 2HWTA 3U27A 1TK8A 3GPAA 1TVRB 5E3RA 4X4QA 1TK0A 2DHGA 1S7IA 2GFFA 4LUBA 2SXLA 4LF6J 3D5MA 1UPPA 3H42A 1BQMB 3MTJA 2OP5A 1P27B 1RTDB 2KFZA 2DXEA 3M8YA 4E8UA 1RI7A 3EGWB 2KKHA 1HPZA 1RJJA 2HHPA 3I9ZA 4DX8H 3CCJS 5C2CA 1S4EA 4OX8A 2ZNZA 2CQGA 5B7WA 4X2BA 2VPWB 5I3UA 4BBYA 2HS0A 1E6YB 4MIAA 3DLKB 4DV0F 2H9ZA 2XBPA 1XR5A 3H5YA 5GMKa 4QWEA 2CKWA 2LQ8A 4Y2AA 1HQ2A 4ECTA 2OIHA 4E2FB 2GMJA 5E2QA 3ZTSA 3M05A 2K3KA 4DR2F 1RHKB 4ECYA 3HMJG 3TEGA 4NLWA 1TUWA 2CPFA 3KLIA 1X60A 3THTA 5RUBA 3Q89A 3BO2A 5I42A 4LF5F 5LM7E 2IJNA 4RUCA 4AFFA 3QYYA 4OJGA 2UUBJ 4PWDA 1HYSA 1WG1A 1U2RA 2F8MA 1Q78A 4WFBQ 4F36A 3H5UA 3TYTA 4WKRA 1N33F 2HNZB 4LRAA 3SBMA 3G4SS 2HS4A 2Y1RI 3HVTA 3NOCA 2B9XA 3H2UB 1ZZNA 3OV7A 2V4JA 2CQ4A 2EBEA 3CF5Q 2DNOA 2XZWA 3D1QA 3DOKA 4A4JA 1DLOA 4FVCA 1S1TB 1LNQA 1PJ5A 1X4AA 4DHVA 4DSLA 2H54B 2BQ3A 1CJUB 4PPDA 3I56S 1FJGJ 5DJBA 2DXDA 4CLPA 2M5YA 3HFZB 3W2WA 3KK3B 4K4XA 1VHFA 1REGX 2XSFA 3CULA 5D4PA 2UVRA 4FS1A 5B08A 4RW7B 4AXIA 3F0NA 3N5BA 3LWMA 2CUYA 3FBBA 1SH3A 2E5HA 1S6QA 3KLGB 4URSA 3B8HA 1HNWF 4F4ZA 3S01A 5LSOA 4ZCIA 2PE8A 3JSMB 2GMHA 3RU0A 3CJ0A 4F2RA 2UXDF 1FTRA 3DRSB 3PW2A 1FKAF 3NNHA 2MQLA 3TAQA 4MIWA 3ZTPA 2WRMA 2XY6A 1X0FA 4Y0FA 1C1BA 1RT1A 3PEHA 3EMTA 4F4WA 1UA0A 5C24A 3OVBA 1LW0A 4XK8C 2VBWA 1FESA 1HKAA 3FVYA 2RVJA 1NJIT 4PG4A 2MB0B 2ZE2B 2ZVSA 4NLPA 2YKMB 3ZTOA 2HGLA 4OJ3A 3G96A 2C2DA 2GGPB 1VQ4S 4E0DA 2DY9A 4CDIA 4USJC 5DGAA 3OJUA 2AGQA 2HRTA 2Z56B 2HAIA 3N28A 4EWTA 4IG0B 1L3VA 4NCBA 3DFEA 3N79A 4ZPDA 3W5YA 1NDCA 5LJ5Y 5D0HA 1S0OA 4LR9A 3QJLA 2KRBA 2DGTA 2VG7A 1FI4A 2IVMA 2I1RA 2YKMA 5AXMA 3MR3A 5B0DA 1F5CA 1YIJS 1IVZA 2HKEA 1SV5A 5CZXA 4MK9A 2MQQA 2KXFA 1RA6A 1N36J 3DMJA 3TUIC 2UU9F 4DSJA 3NGTA 1X31C 3CO9A 4JI4F 3JSBA 3SYZA 1C1CB 2J9CA 4JI6F 4CH1A 1R43A 5LSRA 1CJVB 2RUGA 3M2UA 2WTFA 2E1CA 2NXNA 2M70A 3FBEA 5AT1B 4OFZA 2OPSB 3WC2A 1WKJA 4Q8EA 1HPZB 2OI2A 3Q8RB 2GX8A 3KLFA 7FD1A 3VCDA 2RB7A 2W4CA 3I31A 1VYAA 1D3WA 2KXHA 4RKUC 1MMNA 4XDCA 1HHTP 4OHVA 1FDDA 5HVFA 3K8WA 1U0HB 3OSPA 3OL7A 2AWZA 1QTNB 4ZN1A 2DNQA 4ED2A 2EW9A 1SKUB 1WDTA 4HHJA 2G4BA 1HL6A 1M1HA 2FZGB 1UL3A 2F8EX 3MM9A 3DCAA 1GMWA 2DK2A 2EFNA 3D28A 1DQ9A 3D67A 4EGLA 3TZXA 4OMFG 3H0PA 4X66J 2Z2ZA 2PFFB 1YLXA 3D4JA 2V5HG 4JI2F 4KIAA 5EGYA 2LEBA 3J81Y 3H4DA 1FNMA 1YITS 2BW7A 2CYYA 2DGWA 3EXYA 4Y34A 5D0GA 2YPZA 2VJVA 1LWXA 3LO3A 2YNIA 5DDPC 2EFQA 4DQRA 3T5KA 2HBYB 1VI7A 2LFVA 3Q2TC 1DTTA 3C46A 3HHLD 3MR7A 4PYAA 3K0JA 3CJSA 2IYGA 3HD1A 4NPOA 4DV5J 1BWEA 3DGPA 1WORA 1YJRA 3CD6S 3A8KA 3GP9A 2XZTB 1OJ4A 1PBAA 3W2VA 1GT8A 1OY9A 4LRCA 2D9PA 2YQ0A 4N77A 4C6AA 3R2DJ 2OSQA 2AYEA 3MHYA 4MK8A 5D3GB 1U1MA 1IJFB 4FYDA 1X7VA 4P73A 3R97A 1PC4A 4Z7CA 4KJIA 3GJRB 4IOBA 1QM9A 3ZNUA 4YQWA 2FJDB 2WVEA 2W24A 1KC8T 4ZPCA 4DX7A 3R5JB 1O0PA 4LSLB 2J6UA 1JWWA 1FWKA 3R27A 1RWOB 3SV4A 3GV5B 5KFUA 4K4UA 2C2ZB 4USTA 1FWLA 4YDDB 1R3NA 2D1CA 2V8PA 3CJ4A 4YEAA 2W8LA 4J37A 1ZAWA 3DU5A 2QV6A 2MLXA 4I69A 4K4YA 3W8PA 3CMAS 2E5GA 3W9JA 1XIQA 4L3NA 4NWBA 4UUWA 4YN3B 4YFUA 1HNWJ 3CJQA 1VRTB 1VRTA 1VK3A 5LSLA 2XO7A 2PEHA 3NEKA 1HQUB 3IA0A 5DO2A 1BQXA 5M2RA 3PKMA 3AY0A 4DL6A 1H2UX 1EQMA 1RT4B 2RS8A 4QIEA 1XNRF 2UXDJ 2B6AA 1LK7A 3DDNA 1HBUA 3T9NA 4ALZA 1S4FA 3SSRA 1TL7B 3T6BA 2DIVA 4DG1B 4ECWA 2R7VA 5H9FK 5IC4B 2KJWA 1VQSA 1FK9B 1FT8A 2W2NP 3KLIB 1NBEB 2C2RA 1KLNA 3V81B 3E01A 1U2FA 3PTWA 2UVUA 2AJQA 1S1XA 1MLAA 4FPIA 2MZJA 4UOGA 3TO8A 2B9WA 2V2QA 6FDRA 2ASJA 2JEJA 1FJCA 1SQEA 2DRBA 4B3RF 3PYDA 2ASDA 1ZBTA 4CLUA 1YVFA 2N3OA 4WXWA 2VZ9A 3SQOP 1FRJA 3IMQJ 1HBNB 1Y3JA 1AROP 2CQPA 2YQ3A 3HVWA 2HQDA 3PJ9A 4PXBA 4Y3CA 5KG7A 5L1LA 2Y1JA 4F02A 4NYOA 2E1RA 1U0SA 4M1KA 2AJFE 3SCIE 3LA0A 3B54A 5D15A 1N5YA 4C4WA 4HACB 1R8PA 5KFFA 1KTVA 2HYIB 1ZM4A 3PIPQ 1XMOF 3CCQS 2R9LA 3MPUB 1HA1A 2DNMA 2F40A 3CGIA 4KFBA 2I6WA 3ZZYA 4CLWA 5KFKA 2ZHBA 2HQIA 2XSJA 5CCLA 4MKYA 4M5HA 4ZVUB 2AW0A 2E44A 2HNZA 2XMTA 4C0HA 3CSKA 4NRTA 4IFYA 3ZTRA 4DPYA 4IOCQ 1N5YB 1Q95G 3TZWA 3TI0A 2G2ZA 3DLGA 3MM7B 3TA0A 2W01A 3DRXA 1SCJB 1R6YA 5E0OA 3K8VA 2OHDA 3KUEA 3O1LA 2ZM6F 2C42A 1MU2B 2MJUA 2V9KA 4ED4A 2JLGA 4ECSA 2RDJA 4Q43A 3CXCR 3M1VA 3RAXA 4OHXA 2CADA 2GVDA 2NYIA 2KT2A 4M5JA 3QT7A 2QL7B 1B7YB 2GCFA 2BRKA 2DISA 3ET6A 4NA2A 4WCEQ 3G6VA 1HNIB 1H3DA 4N7TA 4GKJJ 1FD8A 3GIRA 3MUMP 1WC0A 4YUDA 1RE1B 2NR0A 3AD9C 1DAXA 4X4VA 4NLVA 1DY3A 4RNNA 4X4OA 4EZ6A 1FKOA 1EP4B 1FKPB 3HCXA 1WC3A 2CQ3A 2BJDA 2J9DA 2WZ1A 3M1VB 3MPVA 4IR9A 3X1LB 6AT1B 4QOTA 4QYZK 3MEEA 4A8KA 1TV6B 4HT5A 4X62F 2D9OA 5HL7Q 4OLPA 2EVZA 3MR5A 2ZZNA 4U7CA 5ETLA 4O4RA 4RW9B 1WUUA 4ITSA 2QIFA 3I32A 2FPHX 5KG3A 3N01A 2IIHA 1YI2S 2XMMA 3I96A 3CJKA 4UQGA 1KTQA 2J0XA 4DX5A 3TQ1A 1E6VB 3NWGA 3KLHA 4NCAA 1R31A 3EGVA 1T9WA 3PYEA 3VZIA 2RMLA 3E2EA 2NLWA 2B43A 5D4NA 2HRUA 5E5NA 1K44A 3AB4B 3HVTB 1MG7A 2PI5A 3Q8YA 3PM9A 1HNZF 4MFBA 3I5BA 3VWSA 3LGMA 5A76A 4I56A 1KS2A 5J1NA 4IG0A 3N6MA 4KBIA 3VAKA 3OL8A 1VJQA 2FVCA 3MEKA 4AL7A 1A0OB 1H7WA 5J2QA 1T03B 4DF4A 4AL5A 1GK8A 1KFDA 1LK5A 1RHRB 3EE3A 3O5TB 3Q86A 3CC4S 4RBUA 4JV0A 3MMCA 2KFNA 3NKYA 1SL1A 1IKVA 4DV2F 4Q5VA 4CO2A 3GJTB 4HLBA 4N47A 2I5JA 1P1TA 2YPYA 1F0XA 3IBFB 1X5SA 4YS2A 2ZH8A 1QAIA 5ETKA 1N0VC 1X5OA 3BEGB 4Q8FA 1WC4A 1XBWA 5AE1A 4A8SA 3PY8A 1RB0A 1RU1A 4DU8A 5LXYA 3GIKA 1RACB 2AX1A 2DR7A 1FTCA 1S6UA 2A3JA 2LDYA 2HHSA 2D74B 3T5HA 4N56A 3SCKE 4J9MA 2MY7A 4X4PA 2HFNA 2UUCF 3CCMS 1TL7A 1T7PA 3AOBA 3PG9A 1SC4B 1S6PA 3BN7A 3C8YA 3QRQA 1X5PA 4O0NA 1VQLS 5L1KA 2VHGA 1WACA 2FVPA 3D6HB 1HW8A 4IDKA 1W26A 4U7UK 3ZTQA 1KVKA 3AXKA 4R25A 1OWXA 4RW6A 1HBOB 5KOXA 4J9SA 4MMOA 2BM0A 2LA4A 2NPFA 2POKA 4DJBA 5KT2A 1FWPA 3W9HA 1VQ6S 1UCNA 1FD2A 2ROPA 1XK8A 2L9NA 1XQIA 2H4YB 2JDJA 2QJ3A 2Z57B 3LPEA 5L38A 1HARA 5KFVA 1EKSA 5L8RC 2ZH9A 3C14B 2LECA 5D78A 3MEGB 1QSLA 4UY85 3OXGA 1SC6A 2CNKB 2V8GA 3MFIA 5J1PA 4GC7A 1AFJA 2H4WB 5K9FA 2CPJA 3W60A 2UUAJ 1S76D 3ISZA 5L1JA 3O3LA 4ZVOB 1RGVA 3IC1A 3LP0A 6FD1A 3NNCA 3GONA 1YRXA 3M9OB 2WW4A 3E8OA 4DUZF 1S99A 2MTLA 4KB7A 1PBUA 5GAHU 4DV3F 4F4KA 2BEFA 1IKWB 2PMWA 3F41A 3BSAA 4DR5F 1VJWA 3POTA 2NCKL 4WE1B 1TL5A 2C3PA 2KO1A 2M2BA 5DETA 2J0QD 1L5UA 4TYBA 4C8NA 1LOUA 2MQMA 2WVCA 3MCNA 2XGQA 3PZPA 4NCGB 4LF1A 4LF9F 3U1MA 3VAGA 1R7IA 3V2UC 3NBPA 1RHJB 3L4BC 3W5XA 4EZ9A 2MMYA 4ANCA 2DCLA 4ZVPB 1N32J 1NEEA 4O0IA 1TU0B 5KT6A 3M32A 4NYZA 3ELHA 2L3MA 2JL9A 2GHPA 3K59A 3HHNB 2K8GA 1KOOA 2CQCA 3BKFA 4WKYA 1T9UA 2O5DA 3GSIA 4DR1F 4YB5A 3HT3A 5D77A 1GQEA 4I6YA 3DN9A 4A8FA 2G9OA 1VLOA 3SCLE 1RWVB 1NSQA 3D0IE 3QJPA 1T05A 1YDLA 4CLTA 3GIJA 4RU2A 1VFJA 4X62J 4BCAA 2MZRA 4DV6F 5I4MA 1Q53A 1XC9A 2F1FA 3Q2SC 4NLDA 5FDLA 1IWAA 3H20A 3GIMA 4ED7A 1SKRA 2DKOB 1ZPWX 4UZBA 3RGIA 2DVIA 1IBMF 3CMQA 2V2VA 1CVJA 3FMBA 3MWBA 5HJXA 2DH7A 1TMMA 2NQPA 1CLFA 4FF1A 1SH0A 3LQVA 1RTIB 3RBDA 2M3DA 1BD6A 1M5KC 1MSWD 2RD5C 1BGXT 4U6PA 4CO1A 3A8JA 1HR0J 4K0KF 2QA2A 5DG8A 4C11B 3HF5A 2AGOA 2WONA 3K2YA 5JVGQ 2FGOA 2GO8A 2L9DA 3BQ2A 2F63A 2XGPA 3HXMA 2LU2A 3KDNA 5A2QU 3QMQA 4YY3J 2FB0A 1W2BR 4DV2J 2UU9J 1JLEA 1JLEB 4F50A 2B8PA 4JI4J 3ISND 3N6NA 2M8DB 4OQJA 4TQRA 3FZBA 4FNIA 3ZZZA 4L76A 1PAEX 3EPGA 2FHMA 4QBUA 1M1KT 4LF6F 4K4SA 3GTYX 3MEDA 1YX2A 3OTBA 5DDQC 1A9NB 2VC1A 1TL1A 3VGVA 1JNRB 1U7LA 3KG1A 5J2PB 1NK6A 3OR2A 1IQZA 1YBUA 1YWXA 2CVEA 2ZVIA 3M8WA 4J90A 2I8EA 2YH0A 3KNGA 2G0JA 4QPTA 3W63A 3TP2A 1NMEB 4YOEA 2ZFHA 2DT9A 1FFGB 1H2VZ 1CJTA 5C25A 3MAQA 2W4PA 2R8HA 1KVJA 1SC1B 2RHSB 1U8SA 3I6PA 5KTQA 2RJZA 1TV6A 1SB6A 1JX4A 4ZVSB 3DGVA 2RUSA 1WEYA 4B3OA 3D6FB 3SV3A 5KFJA 2RDDA 1VQPS 2DGVA 2GIQA 2QTWA 3RBXA 1W7WA 2MZTA 2GZOA 3FEZA 2ZJQQ 5HP1A 1XNQJ 2XO6A 2E5JA 3BKTA 1G6BA 3F56A 3HD2A 3EYZA 3PW5A 4A8YA 2WB1D 1UVLA 2VU5A 2IAJB 2VG7B 3LAKA 5KFRA 2YNFB 1YZ7A 2V9WA 2NZ4A 3W62A 1FVSA 3ENWA 4DV5F 2AJ0A 1N33J 3W9IA 2Z30B 2BR0A 4EBDA 1UJ5A 1R27B 2JFDA 1S12A 2ROEA 3PX4A 2D3UA 3C16A 2D3OR 1RISA 1RHQB 3FKBA 3JQMA 2NXJA 4BC9A 3CDEA 1S0VA 1AYEA 2R4FA 3HJFA 2VKZG 2R7UA 2Q6BA 4NOHA 2YNIB 1RAGB 1VK8A 2O66A 1RTZA 2AX0A 3NMAA 3P5BP 2ZJRQ 3SEOA 1SI9A 2J7KA 4G1PA 1H0HB 3PO4A 1LFWA 2X1AA 1A7GE 1LW2A 4RWWA 3SSQA 1K47A 4ID8A 3GJSB 2ZH7A 1R0AB 3ZO7A 1URNA 4X4UA 4D3GA 5C42A 2ZUGA 5E7OB 2Z2LA 1KVIA 1KKHA 1U1PA 1K73T 2QLBB 3K5LA 2LEAA 2BA9A 4Q45A 1O51A 1RT5A 2VFUA 3UD5A 3VF0B 3VGUA 2X3DA 3THVA 2XNRA 2AJ4A 2L9WA 2IC3B 1FX4A 1OIAA 3MECB 1FRHA 4WFAQ 4C3LA 8ATCB 4WP8A 2OEKA 3NGSA 3R2CJ 1FRIA 1RP5A 3Q23A 3NGUA 1S1XB 4DR1J 3JSYA 5LMUF 1GMUA 2AU0A 3HVRA 3H90A 4Z7YA 2KRRA 1RU2A 2H65B 3BM7A 4OYMA 2RF2B 5EX3A 1FK9A 3CB4A 4LQ3A 2AD9A 3C6TA 3HHEA 4OZ3A 2G2OA 3PRVA 2DPIA 1NLKL 4DCPB 3FMWA 1APSA 2W7PA 3RBEA 2OFGX 1X4CA 3R6LB 2ZITA 5CYMB 4F25A 3UW1A 2DNHA 1PSDA 2RT3A 4PPZA 4X84A 1XEZA 3OL6A 3A3NB 1CEZA 3L3CA 2RKIA 3R7BB 3SDEB 3SDEA 2MSSA 3T1YF 1NKEA 1JLBB 2QN6B 3I0RA 4IH6A 2QSFA 2PT0A 3QZ7A 1NK8A 4B3SF 4QU7A 2R8JA 2MQOA 3RZAA 1KRPA 4ILRA 3QQCD 1AW0A 4AT1B 4P10A 2FJWA 4CH7A 3Q83A 1HHSA 1JIHA 4LBIA 3HP6A 4N8NA 4JI7J 4PABA 2ASYA 1DTQB 3OR1A 4TVAB 3I55S 1XMOJ 2XB2D 1TTHB 3ET6B 4NXNF 2J76E 2J7WA 3N5FA 4R0EA 3J7Z5 1LXJA 3L7OA 4WK3A 3WQPA 3GR1A 1F6TA 3D6TB 4DMZA 5CD4H 3BS9A 3EJMA 2LU1A 3G87A 4UOCA 4A8WA 3DM2B 4EMDA 3DU6A 3TJ9A 3BJYA 1RTDA 1DTQA 3OR1B 3OQ2A 4ED0A 3M8SA 2ZM6J 2HHHF 1RTHB 3QATA 1I94F 2V94A 1NZAA 3GFHA 4TU8A 3MECA 1CS4A 1HNIA 3DI6B 1RAOA 2B4UA 2QA4S 3VGTA 3ZZPA 1U6BA 1NHVA 4A8XA 3IAM9 2R8IA 3MTKA 2MKSA 2ASLA 4CLSA 5IT9U 2LCWA 4X66F 2CQDA 2CJXB 2Z8QA 4DU7A 1TMJA 1Z2ZA 2Y1LB 5B09A 2CPYA 2NYHA 3PJWA 1JLFB 1UWAA 2ZOMA 4DV1F 1U02A 3U1NA 2RF2A 3IP0A 4CLZA 2B8QA 3BDPA 3TUPA 3KHHA 3D3CJ 5D8HB 3J7ZT 1Y4ZB 3TRGA 3H59A 3W3SA 3BB5A 4AUKA 1YJ7A 1WWHA 1ZS6A 4UT4A 4DV4J 2HFOA 3CD0A 4O44A 9RUBA 4LT6A 1AZSA 4WPAA 3SMZA 2DD8S 4NA3A 1IM6A 3KOAA 5HQMA 1H6KX 1N5QA 4PG6A 5G0RA 5A8WB 2HHVA 2RH3A 4QWBA 3S7RA 3IBWA 5F8GA 2QG9B 2WB4A 4ZIVA 3MEEB 1HNZJ 3GILA 2OUGA 3VV2B 3FSYA 4QIGA 1FRLA 4F3MA 1IKWA 1G1XA 3CJ3A 1RBAA 4YR0A 1VQ9S 1S48A 3N9UC 4ZPWR 5G0RB 1K0VA 5JUMA 3DMJB 1WC1A 4ZCLA 1IQTA 3MI7X 4LRDA 2KZMA 2E1PA 3OTOJ 5F8MA 2HHUA 1C0UA 1C2PA 1OY6A 2QX0A 4TN2A 3TAMA 2GVDB 3R7NB 3GZ7A 2LVWA 3I0SB 2HS3A 1JXVA 1PKUA 3MR6A 2P6TA 2JZ5A 2CAJA 3M2RB 3QSIA 4LR7A 5L46A 2O01C 2DR5A 5AXKA 1S1VA 2L48A 4FPRA 4LFCJ 1U26A 1LEOA 1U1NA 3FC9A 3TAMB 3A3OB 3MDFA 1CJKB 3CPWR 3T5LA 2NREA 2A18A 4P7VA 3PR5B 4BS2A 2BJEA 3Q8VA 1HMVB 4DN0A 4FYYB 1Q8BA 2KT3A 3G8SA 2HZVA 2CQ0A 1KDNA 3OL9A 2IDLA 4NMXA 4EBEA 1JLGB 2E5IA 1WF2A 3OHAA 3H5XA 1UFWA 4KV8B 2OKQA 4MJKA 1OMSA 4HHUA 4WTYA 4Y2CA 3UWTA 4QW8A 3QFWA 5SZTA 1BQNB 1PC5A 3RR8A 5K8PA 2PGCA 3D0HE 4CNZA 2C3OA 1OQ6A 3NXZA 3CCES 1M0SA 3Q8QB 2C3UA 4JOUA 3PO5A 4KH0B 2QLFB 2EKNA 4HL9A 2JOQA 4J9UE 1V5VA 3QBCA 2MLYA 3A8IA 2CZ4A 2BE7D 3HFVA 4IKAA 3RAMA 2HNDB 2V8DA 1OS5A 4X4RA 4DDFA 4ETZA 1PJ7A 4KGVB 4NYPA 5K5MA 3IWLA 3UVJB 2Y8YA 2XYGB 2E5LJ 2KXNB 4B3SJ 5KOWA 1K9MT 1F60B 4URGA 1FJEB 4DFJA 4DUTA 4F4AA 1JMTA 4HYKA 3PIOQ 1PILA 3FSIA 3ADAC 4ZDNA 1HI8A 1S9GB 5J2QB 4P2XA 1T95A 1HI0P 1Q79A 2A0FB 2FYXA 2GIRA 2HWHA 1JKHB 4MKAA 4MYTA 4C8ZA 3NCQA 2VBYA 2FLPA 4UF4A 3CJRA 2BXJA 3PEJA 1RTHA 2N3LA 5BR8F 4C8YA 4ZMMA 3FFIB 1KQGB 2ZBQA 1ICEB 2RQ4A 1LWCA 4G1IA 4DLEA 4ED3A 4ED8A 3QGGA 2DH8A 7AT1B 1F9HA 1I1GA 1F5AA 1S7HA 1H72C 4JI8F 5L1IA 1N32F 1YGYA 2VL1A 1IR1A 2K2PA 3BGLA 4A48A 4ANDA 2CFXA 1RTJB 1WTFA 2DGUA 2WVFA 5CQGA 5CA5A 3VAMA 3BBFA 3GCWP 3ILIA 3BH6B 4M5DB 4GKJF 4DOZA 2QA4G 2PD1A 2GJ2A 2QE5A 4OYIA 1NHKL 1ACMB 5HVHA 2KTQA 4HDGA 3OLAA 5K8MA 3MXHP 1KR4A 1QJHA 1NZ8A 2VPZB 2LDIA 4OYAA 3L95X 3J80Y 4RNOA 2HMIA 4O44B 2IM1A 4GVLA 4ZPVR 5BYRA 3TZYA 5IT9Y 1YZ6A 2APOA 2KJVA 2V2ZA 5IQQA 2WHOA 3DLKA 3G6ES 2HW3A 4TY8A 3M9MB 4QPXA 1WHXA 3IS9B 4DV4F 1N5SA 2J9EA 2YNGB 3DRPB 2B56A 4OLOA 2HFUA 2LMIA 4R0JA 3PJXA 4WU2A 3UNYA 4CLLA 2FLOA 3NLCA 4DG1A 4WZMA 2LYVA 3DOKB 3TR5A 3UI3A 3BQ1A 1VBXA 2FC8A 4MYUA 1RT7A 1VGYA 2AF6A 2OSRA 1D8ZA 2GV1A 1B64A 2HGNA 4G65A 4DPUA 2QFJA 4DUYJ 4WP3A 3EM1A 2QGFB 1TZ0A 4C0BA 3C14A 3QT5A 2AZ3A 4KFBB 5CHCB 2DPJA 2NSCA 4MTPA 4JYAF 2NXUA 3C6UA 3MOJB 1LWFB 1NCLA 2MYFA 1CQNA 5GADI 1P9YA 1SIZA 2AGPA 3POTB 4O3PA 2BW2A 5AJ3J 4CH0S 1NNDA 5GMEA 1NJZA 3V4MA 4YY3F 5ETPA 2W2PP 3IG1A 4LR8A 1JB0C 1OYEA 4M5IA 4RBTA 3ZZ0A 2YKOA 5ETOA 3CE8A 5B0BA 3K58A 1VQ8S 4PYDA 1X4BA 4FYXB 2V2KA 3U02A 4LSNB 5CABA 5IFMA 2GQ2A 4H4KA 2FVQA 3JSMA 1H38A 2G0IA 3EUNA 3SZ2A 5I3QA 4NEYA 4J9NA 5HVGA 1LQ9A 2QMXA 2PMZD 3A13A 5JJBA 3V4IA 1BC6A 2DITA 1FFSB 3LAMA 5EHHA 2CJBA 1X4FA 4PQUB 1C4AA 4FDFA 2LQ9A 3AT1B 3BREA 3MPDA 3PDNA 5KG6A 3X3UA 4CT8A 3OFHA 4JP8A 2YNHB 1UZDA 3KUGA 3QAEA 1WELA 2A6MA 3IWXA 1RA7A 4USVA 3W5ZA 4LF8J 5JMNA 4O3SA 4NLUA 2QA1A 4NZ7A 4KGKA 3R7SB 1V6HA 3K5NA 1L3TA 2ZD1A 1N0UA 3HI9A 1URRA 3PW0A 2K1RA 1Q4RA 2D3ZA 2ZWOA 3FCHA 4DL3A 2FVRA 3US5A 4RW9A 4TXSA 3CDWA 5E41A 5KT3A 2VONA 4LMZA 4ZK7M 4CM0A 4KHRA 4IQXA 1ZM2A 1HBNA 4LVNP 4IG3A 2W8KA 2DNYA 2OAUA 3L7UA 4I2QA 2I0XA 2BJ7A 2JHEA 3C15B 2CNNB 1WI6A 4F4XA 2E5LF 2RHQB 2LA6A 1VOMA 4RZRA 1U1RA 1T9VA 2YX4A 3QIDA 4M5NA 3JAMU 2CPEA 3HPOA 4R5PA 1PYTA 2XYHB 3Q8UA 2HBZB 2VFTA 4O23A 2V68A 4CO5A 3QIPB 4HR2A 4UQTA 5ETNA 3OVAA 3IN5A 3W61A 4H4OB 2MEWA 4KRWA 2P5VA 4CM2A 1U09A 1KHWA 2OPQA 3HZEA 2HHXA 2A2CA 3UDEA 5FLXY 1P8GA 1RWKB 3ILLA 1J5OB 1D8YA 1X8DA 4M94A 3DHXA 1NH8A 2RU3A 2W9CB 2CZVC 2XMJA 1U1KA 4RW4B 2KN4A 5J2PA 3IO1A 1UJ4A 4CO3A 4DN9A 5KG1A 5BR8J 4DF8A 1RT2B 2ATLA 4JI0J 4JV2A 3BF4A 3NOGA 4RW7A 1NUEA 5H1SV 3BSNA 1NK4A 2OD6A 1JLQA 4J9VA 1MROB 2Z0GA 4JV5J 3A1YG 5GMDA 4ZVHA 3FBCA 1RXOB 3GFXA 3VAIA 1MU2A 5KAKA 5KFSA 4KSEB 1GX6A 4ECZA 2KU7A 1YJ9S 1RT3B 4GKKF 1WTBA 2IJRA 5U47A 4K2XA 4DR3J 3T1YJ 3KUHA 5DLFA 1DJ0A 2DBBA 3KLEB 5HMXA 1RWNB 3QT6A 4L74A 2EEYA 3CT9A 1YBAA 2HEKA 2BE2A 2PC6A 4H54A 4ZP9A 3G71S 2RQKA 2BJ3A 3Q22A 4FVMA 3MM5A 4RW8B 5H9FJ 2N7CA 4ZHRA 3LP2A 3CD5A 1AUSL 3PRDA 2Q66A 2MZ1A 3MR2A 2FJEB 2YWEA 4B9MA 1K1SA 4MH8A 2F5GA 3HHLB 2BANA 3KLVA 4ELUA 5T7LA 4ECVA 3NMRA 2QYCA 1RQ0A 3IRWP 1BQNA 4NX9A 2ADBA 1HYSB 5GAHI 2X1FA 2UUWA 2OELA 1F2GA 3G6XA 3KTQA 4YB7A 1J2VA 1PYSB 4X64F 3V6HA 4KGXB 4I1TA 2VG6B 2D69A 4K0KJ 3HHLA 1VQKS 3TJ8A 2DYAA 5A2QY 1IN0A 4NI2A 3MD1A 5T41A 3TWZA 2HG4A 2V4RA 2C22A 4JI3F 2IMOA 1FJ7A 4GC6A 1DBDA 4B08A 3TEHB 5IQ6A 3CDAA 2IMWP 3TVZA 1Z2LA 5A0YB 4IO9Q 2OPRA 4ZVFA 3ZZRA 1R0BG 5AJ3F 4OYPA 2R7WA 2R7XA 2KB2A 1LW2B 2YQ1A 2DB1A 2CDRB 1B70B 2VH7A 3PRBA 3MPYA 3W7BA 2ZH6A 2FZCB 3RB0A 1FXLA 4P2MA 4ZKAA 2J6SA 3K5OA 1F2HA 4U96A 3KHRA 4IFYB 4YMEA 2XMKA 2XI2A 3MMBB 3FGVA 2DHAA 1UVKA 5A8KB 2GMLA 3VVUA 1S59A 1B0VA 2GW8A 4QZVB 1GTEA 2ZZMA 1DHMA 4RPFA 1WF0A 1Y7PA 2BZ2A 3MF5A 4IFVA 1MROA 2LQJA 2ZEJA 4FKYA 2QL9B 4I2PB 4K7QA 3KHLA 1ZETA 4P74A 5KFAA 5KFGA 1T9TA 3GQCA 4C97A 3VALA 1EZZB 4OYOA 4CTAA 2MKIA 2FLNA 1VC5A 1D1UA 2MGZB 3IWNC 4FYVB 1NKCA 2DY1A 2XMAA 4B9NA 3TOQA 3V6DB 1XNQF 2IVFB 1TKDA 3D1HA 4DPWA 1WOPA 4BC7A 1HBUB 3FDSA 3OFGA 4M5GA 2ALZA 4IRKA 4M95A 3HM9A 4B3TJ 2DIUA 5KFLA 1PYOB 4PRFA 2BX6A 2JJ4D 2XHWA 2RSQA 5GADU 2AJ2A 2GO9A 3GG1A 1HNVB 3R5AA 3OXFA 5KFQA 3TW0A 1R8BA 5IS2A 1SL2A 4LF4J 2M88A 4HT7A 4DX6A 5L39A 2RKIB 1JLAA 1RWUA 2VC0A 1I5OB 1ZOTA 3CDUA 3OBIA 4OZJA 4CI0B 4PG8A 3GV7B 4DLGA 4KT0C 5F8IA 3M8PB 3W2WB 3KK3A 3JYTB 3GJQB 1QSYA 2B0GA 4OV1A 2OTJS 3AAWB 1Y00A 2KH9A 4WFYA 1IKYB 2YX7A 3M32B 3IFEA 3VVTA 4C11A 1WSVA 4X4SA 1FXRA 2N7YA 1FJGF 3CVKA 2LQ5A 3TZZA 3QWUA 1SPBP 1J27A 1NH7A 3KXDA 1KLMA 4W98A 3HKZD 2CQ2A 3OHBA 4IQMA 4R8UA 1CQMA 3JSRA 4ZP6A 1YRTA 4WZQA 3QGIA 2FJVA 3RRGA 2VQFJ 2A6OA 3BBCA 2X1BA 1QE1A 2WONB 1M5SA 4QR0A 5HROB 2KVQE 1N48A 4ERDA 1VMBA 1RBLA 3O6QA 3DYAB 2QO3A 1RLDA 3CCWA 3NAIA 4ZVTB 2CQBA 3ZXWA 4IUFA 4QU6A 2EWHA 2XM3A 1SJFA 2V8HA 4KE5A 3DXSX 4TYAA 5LMUJ 1L3UA 1P1LA 3I4PA 4IFVB 4KGZB 5GVQA 2ZC4A 3GWCA 4O3QA 4CT9A 3Q0AA 2LKZA 3IG1B 4ILLA 5KFMA 1HD1A 4OI0A 4PCQA 3QGPA 3JTNA 1ZPVA 3D68A 3EVOA 3QZ8A 1S9EB 3TA1A 3H25A 4IR1A 1VDHA 2F3JA 4KV8A 4V19X 1XWLA 5F8NA 2RU9A 3A8EA 3GYNA 2HQGA 3QT8A 2BDPA 4ES1A 2JSXA 2P9CA 2BMBA 1Y11A 4WK1A 4DSIA 4PXEA 4OYZA 3QSYB 3TX8A 1RWWB 4LJMA 3EDRB 4PKDB 1M90T 1N5TA 5DGBA 2YY3A 3P6YC 4LFBJ 3C16B 1GXLA 1XJWB 1XR6A 3R5GA 2VV5A 5H9EK 2WK4A 4NI2B 3O44A 1T0TV 3UQSA 3CCSS 3B6BA 4AYBD 1JKHA 2ABYA 5ADZA 2ZDOA 3AOAA 4JV1A 1IM4A 1OQ3A 3CIZA 4OI3A 3NP5A 1XMQJ 1F5BA 2OPSA 3MM6B 3PX6A 1FERA 1NSKL 4NLXA 4RUAA 4P2FA 1JXLA 3RB3A 1VRQC 1G7CB 1S57A 2YNFA 4ZIWA 2B4VA 3SXLA 3AOCA 5IXUA 1NRKA 1N54B 1RADB 2HNYA 5F0UA 4QQBA 4DR6F 4K50A 3EDQB 4NMLA 2C2MB 1NAQA 2DNRA 3EGNA 4NXNJ 1WC6A 2B5JB 5D0EA 4OX9J 4C8MA 4DV6J 4EU0A 2XY7A 1Q82T 1YBTA 1R6VA 2BQRA 4M5LA 1CJTB 4TLRA 3MPWA 5C25B 1ZYQA 3KMSA 1IR0A 3IBCB 2GJFA 3W66A 1ZM3A 4FBTA 2XYPB 1YJVA 1X9WA 3FQLA 4JI8J 2OEMA 4M5KA 2W7OA 2JLEA 2ZZTA 3UO0A 1F1BB 5HN0A 3RJMB 1REVB 2DNNA 5HBMA 2VJUA 4EYIB 1UFKA 3B4MA 2HQCA 4PR6A 5HSPA 5K8OA 3VAHA 1LWEB 1GXUA 2EPIA 1EETA 8RUCA 3JXOA 2WW8A 1Q5YA 3ETOA 5KFEA 2MHEA 3T3FA 1U6FA 4B9TA 4P71A 3GLJA 4RW6B 1SKSA 3KKFA 1VQMS 3FRZA 2EXUA 1U6ZA 2H1YA 2HIYA 2WOMB 2ZWPA 4QWAA 4LFAJ 3KJVA 4DV1J 1REVA 4B17A 5HBMB 2A2DA 2ZC3A 4CIOA 1KHVA 2MSTA 3CEDA 2FHJD 4PWDB 2EC2A 1FRXA 1SUQB 4B3TF 2AT1B 4FYWB 2PIIA 5AE2A 2HFZA 2E7WA 4Y2IA 1FNXH 3NWRA 1EP4A 1FKPA 4NZ0A 2QMUB 3W65A 3VTIA 3GFYA 4ID5B 4LSZB 4YP3A 5CXTA 2EBGA 1YJTA 4LF4F 1I3OB 3MMAA 1FDNA 1SQFA 5IWAJ 1WJ9A 3M6VA 5CH7B 5CCMA 1JK9B 2M8HA 1FXDA 2OGUA 4J7CA 1KFSA 2MHNA 2OPPA 4OZ2A 2GAHC 4UY8T 5K14A 2DEJA 1V5IB 2Z58B 3MGJA 4PG7A 3H4BA 1NM2A 4WE1A 4J9LA 2DEIA 3JS9A 1PIEA 2AKWB 4JI1J 2XC9A 3M30A 2KFYA 1N56A 2VBZA 1Y0HA 2VPYB 1EQ0A 3DGPB 3K57A 4FXDA 3G82A 1VQ7S 3VHQA 2YWKA 4K4VA 1UMJA 1HI1A 1TL3B 1HWJA 2IHR1 1RAEB 1Q8KA 1KOHA 4L6V3 4O3OA 5KFPA 1S79A 2WBRA 3K17A 4IYQA 5C42B 2IDEA 3J80U 1GAOA 1PJ6A 2WVDA 3HJVA 3MM8B 4CO4A 1T11A 3W8GA 2CG4A 4NRUA 3KFWX 4DR7F 4ZVGA 3D1OA 3VAJA 4TU7A 4Y2KA 2MY8A 1S9EA 2BUNA 2CNOB 2ZD1B 3NNAA 2IY5B 4DI6A 1NXIA 2C2OB 1QSSA 4C98A 1RABB 1XNRJ 1HBMB 3KK1A 3V6JA 1M5VC 2Y8WA 2LEPA 4I64A 4DV0J 5L9NA 1KP6A 2Z2YB 1VBZA 4M63A 3VQSA 5EUHA 1UWBB 2RIJA 4B3OB 4DR2J 2MGZA 4L72B 2KG0A 5FDLB 2RRAA 3V81A 2DXFA 3SSSA 2R42A 3SIPB 4B3RJ 5H9EJ 2XWXA 3FSXA 5KFOA 1SXLA 1Q86T 1ZAXA 4LFBF 5B0EA 3DHWC 2MDAA 2AJ1A 1PCAA 1SIWB 2V4QA 5IOLA 4DR5J 1DTTB 3BR8A 4FF4A 3B4DA 3PNIA 1R8AA 5D0RA 3T9ZA 2UXBF 1EHWA 3D66A 1H74A 4EO6A 2CJ9A 2J9DE 5KFBA 2R7RA 1VC0A 2IA6A 4EUVA 2ZJPQ 1Q1KA 3FJ2A 4DL7A 3NCPA 5KG4A 1TKZB 2RS2A 1FE4A 1R89A 5HATA 3CD7A 1S72S 2IPOB 3H8YA 1MN9A 3I82A 3MM7A 1S10A 2FIUA 1TL1B 2J8SA 2XWYA 3DC2A 5KG5A 4I6AA 2B9YA 4OX9F 2VA3A 1O5JA 2AEMA 4DEZA 3C19A 2R8KA 2YBVA 4CZCA 4P75A 2QSWA 4X4NA 3NBPB 3UN2A 2KL8A 5EWGA 1JLQB 4UOFA 1EETB 3S6EA 3SFUA 4HACA 3AA9A 1SL0A 3K5PA 5DQHA 3TJAA 5AE3A 2PI4A 4PQUA 1UA1A 4QYRA 4ED5A 1X4HA 4DCJB 3A12A 1YJWS 2F7VA 3PKYA 2ACYA 3EVWA 3G86A 2RRNA 4GKKJ 3K89A 3TAPA 1TFWA 2V8VA 2E9RX 3LP1B 2XCAA 3UD4P 4DBQA 4LSNA 4ED1A 2KHDA 1WHYA 4KHPF 1IWGA 3H2VE 2NSBA 3DOMA 4PAAA 4RW8A 3IM9A 1SVDA 1FEHA 2NS1B 2HFVA 2VFVA 2WSFC 3T41A 1IBLF 4NXMJ 2CJYB 1XMBA 1N4LA 5LOQA 5DM7Q 4RLEA 3J7A1 3R8YA 5IT0A 2IVYA 1TKTB 4Y6IA 1WKKA 1T03A 3IGNA 3T5JA 2ERRA 1I6JA 4KPYA 2L08A 2OFHX 3LANA 4NLRA 1NB7A 4MFBB 1JLGA 1UJ6A 3DKDA 4ZCMA 4DUYF 3DRYA 2DNLA 2GJIA 1XN9A 1TQLA 1RAAB 2K1RB 5I3PA 1D09B 2EFPA 1VIOA 2HVZA 1U8WA 2RRBA 2OJ3A 3CCTA 3UVJA 3G9CA 1C1BB 1RT1B 2ROGA 3ISNC 4LRBA 1G3OA 1RAJA 2VFRA 3OLBA 4F0KA 3MUVP 2HVIA 2ZKUA 3E51A 4RW4A 4D3HA 3EZUA 3BGOP 3I5AA 4OI2A 5F3TA 3CJ8A 4RNHA 4RBVA 2B51A 3MFHA 1JQGA 1ZA2B 2FUG9 2VDIA 3QPIA 2FQQB 1YQHA 4P72A 3I0SA 3UR0A 3J7AN 5F3ZA 5IC6B 2FY8A 4JI6J 3DXBA 5A8RB 1VISA 3F44A 4PEOA 1C0TA 2BJ9A 1ZZFA 3CMES 2ZNYA 2MKYA 2B5JA 4LRFA 4ER8A 2O3DA 1E6YA 4ES2A 1SV5B 1UZHA 1WOSA 1YSJA 2AMCB 4A47A 4ES3A 1JJCB 3RBZA 4F26A 3J81j 3T1HJ 3V6DA 4RR5A 1SJ3P 2XLIA 1TUVA 4L75A 3H5SA 5A8RA 2FDNA 3IGVA 3OUYB 1NJWA 4M5DA 4EK2A 3MAAB 2IM3A 3C2PA 2VKRA 3FRYA 5KFCA 2Y9HA 4BDPA 1R8CA 3UDVA 1ZTTA 3CCUS 2GIFA 3M8RA 1V9OA 3M6WA 2C3MA 2W9BA 2JEIA 4HKQA 2GVZA 4EBCA 5GAEU 4C8KA 2RQCA 2MKKA 5HO4A 1SBRA 2Z4PA 5DQGA 1T05B 1J5EJ 4HDHA 4PUOA 4U9RA 4PUOB 1X5TA 3PHEA 1RKJA 1P6TA 5C2GA 4C8OA 1WNEA 1LW0B 1UW4A 3HULA 4GO7X 4PWWA 3BO3A 1U1LA 1WHWA 2KT5A 1UFLA 2ZDPA 3A3PB 2CWXA 2YKNB 1O8BA 4FXWA 1MMDA 4AQYF 2YWHA 3EZOA 1TKZA 3GSDA 4USKA 2K7JA 1N88A 4MK7A 4NLQA 2UUAF 5HLFA 2C1EB 5KT4A 1KN6A 3IRXB 4KQZA 1UKUA 3MCMA 4HH0A 5T7LB 2IAJA 3OTDA 1HWKA 2Z2MA 3CNQP 3R5DA 3WX8A 2EG2A 5ETTA 2B4OA 5F9LA 5ETMA 3DDKA 4USMA 1LXNA 3NY0A 1UAWA 4K5SA 2YTCA 4AXJA 1KNZA 2FD2A 4Y65A 4DCOB 1AUDA 1FX2A 1TFYA 3GR0A 3QGHA 4RJVA 3W64A 5J2MB 4Q0BA 4USWA 1KD1T 3AJ1A 2F65A 4P9SA 2JEFA 4DQIA 4QR1A 4UW2A 4A8OA 2CDQA 3GIIA 3BGUA 2PA3A 4U95A 4RX6A 1Y5IB 2F4FA 1IUJA 3WHIA 1Y9OA 2CZ9A 2IM0A 3KG4A 4ETXA 4WYLA 4LIRA 3OTEA 4YR2A 2R2TA 1QAXA 4DR3F 1S49A 3MMBA 4XAKA 4CNYA 1B0TA 1RCOB 2NUUG 2YNGA 3BPSP 3P96A 2PDAA 5CZVA 3MAAA 4OZ0A 4U67Q 4P2SA 2WOMA 3MMJA 4LVOP 2P2CB 1ZA1B 1VR6A 3JQKA 3L7PA 2CJQA 4I0WA 3R6GB 1RHUB 4K4WA 1IBLJ 4NXMF 4K8RA 3EXCX 3GYXB 3PFEA 1CULB 2DO4A 1O6XA 1QD1A 4OZNA 3AJ2A 2RDIA 2I38A 5C24B 5CYJA 3I87A 2YWWA 2CQIA 1P9QC 4NLTA 2JVOA 3CJKB 5IZHA 3OFEA 2HHQA 2UZAA 3L09A 4OHWA 3AH6A 3M8QA 2L41A 1U1QA 2FVSA 2ADCA 4GVBA 3R3TA 2U1AA 3QFHA 5HMZA 2KYXA 4RUBA 4DWIA 4KC5A 3M4XA 7FDRA 2FC9A 1JLBA 3I0RB 3RAQA 3QIPA 3K7RA 4QJVA 4JI7F 2H51B 2N4DA 1KLMB 1C1CA 2FTRA 1XMQF 4CLFA 1FRMA 4ZJLA 4USHA 1FE0A 3MCSA 1CG2A 3MEDB 3HKWA 4LREA 2DRDA 1KQSR 1RKIA 3AHPA 4RUHA 4U8YA 4ZJOA 2BV3A 2XSJB 4I2QB 3UPFA 1SJRA 3UFCX 4DS4A 2PA8D 4H4MA 3ZNJ1 2OD4A 3M8PA 3JYTA 2R8GA 1S9GA 5DZ7A 1K8AT 5D6GA 3PXGa 3QAUA 4PZVA 3BDEA 3S8SA 3NS7B 2PEBA 3JTOA 4P7TA 4W90B 2MPUA 5F8LA 3JQJA 1N6QB 1N6QA 1RWPB 2GHWA 1SJ4P 1HWLA 1Q16B 4DZ6A 2PSZA 3DNCA 4HH1A 3MM8A 4Q0BB 1B99A 4WFNQ 3MZIA 4JI0F 4NLGA 3VQTA 3T1HF 2PFDA 5ETRA 2BJ1A 4JI5F 1BXNA 2YWFA 2Y0BB 3TARA 4QIVA 1DARA 1KQKA 3KYLA 1D0EA 2A10A 3CCRS 2VICA 3SI8A 3EVMA 4HVZA 5J1EA 4X65J 4YB1P 2ZH1A 1YKWA 3DYAA 3FEXB 2PMHA 3C66A 4Q2MA 4EI2A 2X3GA 3BSOA 4WFXA 1J5EF 4OZ5A 1UWBA 4QWCA 3ENVA 4LFAF 4NA1A 1ULRA 3CUNA 3FBFA 2GQQA 4OI6A 2OPPB 1IBKJ 1T9YA 2K7KA 4KR0B 2UVWA 3N0VA 5ETQA 1RT6B 1TR0A 3VZHA 4XPEA 3MUTP 1CC8A 4WWSA 2DR6A 2JEGA 2QLJB 1OSDA 2IBOA 1VBKA 1UVMA 1Y5NB 1H98A 2FHJA 4Y28C 3PVXA 1JLCA 4WP9A 5LL6d 3LTOA 1K0TA 5A6WA 4V1Ak 3M7VA 2EG1A 4QIWD 2J0WA 3P3DA 4IG3B 4G3IA 2E1MC 3KJQB 5MLCV 1WF1A 3QLHA 3U1LA 1S0MA 1D9DA 4ZCKA 2YKPA 2I2YA 2HBRB 1JJHA 2W2MP 2HVEA 2HAFA 5HQLA 2ALYB 5LJ3Y 3NGKA 3N4WA 5EWEA 3CCLS 3OXLA 3G6YA 2LXFA 3KMQA 1CPZA 4ECUA 1T8EA 4USIA 2HVHA 4WBFA 3DRRB 2HIQA 2Q3PA 1E6VA 1TL3A 2VG6A 3R5CA 5KT7A 3KLHB 3BZQA 4CQ1A 5F8HA 2KG1A 2VQFF 4PG5A 4OL8A 2VIHA 4F4YA 4B9UA 1M5PC 3WIVA 1FA0A 4FZVA 3O2IA 1NKBA 1CJVA 2DTJA 1V3RA 2DHHA 3NL0A 3DM2A 2XS5A 3BH7B 1AXQA 3ZZOA 5M2PA 1VIXA 4M8LA 1X4EA 3SCJE 3BKUA 3CCVS 2HMIB 1RAIB 3CO0P 2DNPA 2W7AA 5CAAA 3LP2B 2XY5A 1IJEB 3NCRA 2VPXB 3KK1B 2DR8A 1NPKA 1CULA 2M52A 4NE9C 4Z37A 2CJAA 4KHMA 2P8IA 1U1OA 2BE2B 1CSJA 3VGSA 2NPIA 2MXYA 2Y1IA 3TUJC 1HNXF 2UXCJ 3EX7B 1M1GA 3DLJA 4TU9A 2BJ8A 2M0GB 3Q8PB 3A4TA 1JLFA 2DH9A 2E7XA 4EO8A 3J7YU 4ZS6A 3T19A 4ZJQA 1B0PA 4JYAJ 3VR1A 3NGRA 3UDLA 3R1HA 4I2PA 1L3SA 4LF7F 4DSKA 2NXCA 3GV8B 2JX2A 2P9EA 4IO1A 5M2UA 1S97A 1FFWB 3MM9B 4PXCA 3QJJA 1WG5A 2DHXA 3C3LA 2HURA 1RWMB 1UEKA 2MJNA 3BN4A 3KJVB 2KZZA 2GA7A 4K4TA 2QYGA 1YG0A 2ZUAA 3AB2B 3EPIA 3J7YI 2Q6CA 1BUXA 1MWYA 2DNGA 3P5TL 4NCGA 4KO0B 1IKXA 1ZM9A 4YB6A 4JBCA 1HFEL 4OHZA 2VDHA 2D3O1 1N34F 1DZ5A 3UDCA 1X9MA 4IRDA 5I42B 2ZHAA 2XS2A 4MAKA 2HHHJ 4QW9A 4LSLA 4DUZJ 2CQ1A 4BHQA 4DV3J 2XTJP 2EFVA 3M2VB 4FN5A 5BJRA 1FRKA 2HNDA 2ILZA 1U24A 2B3TB 1WOOA 3CW2C 4DL4A 1S6OA 3FCWA 5D4LA 2Y0SD 4CLKA 4A8MP 3RW7A 1DURA 1S9FA 2B4PA 2B9EA 1X0PA 4CYUB 4CYUA 3IXQA 2IYIA 3DRRA 4MKBA 3RRKA 5D3GA 3CWJA 3ZZUA 5C7PA 1NJXA 2OTLS 2MQPA 4IRCA 1ZH5A 2IM2A 3AFGA 1JNZB 1HLWA 3H98A 1YJNS 1WG4A 3M2VA 2BOPA 1QVFR 3DLEB 4ZLJA 3MURP 4WIQA 1MWZA 4YHHJ 2XULA 3LALA 2DO0A 4JI5J 1RAHB 2F9JA 3QWPA 4C2MA 2ZH2A 2AYMA 1SC3B 1PG5B 1MNEA 2JNJA 2HHWA 3D9BA 4ZVRB 5GAGI 2IBKA 3PW7A 1QLNA 1LWCB 4U8VA 4X65F 3I5CA 2D7SA 4GRSA 3MAHA 2G1HA 2C3YA 1HQUA 4FP9A 8AT1B 3GG0A 1RHMB 2N4CA 4AE5A 4XO0A 3RG6A 4EYHB 3ENQA 3FEYB 2XMUA 2BRLA 2G1DA 4B3MF 2AYBA 5CD4A 4RNMA 2LQBA 1Y5LB 3JAMY 1VC6A 3EGZA 4HI2A 4TY8B 3WX4A 1HWUA 2GGPA 3M6UA 1SH2A 4O4GB 3FZ2A 3DRPA 4MIBA 4ZPAA 3K5MA 2EK6A 5JVHQ 2FJXA 1IBCB 2Q79A 1N8RT 2HBQB 2N82B 2HK2A 1QAYA 2YKAA 4NLSA 5DZ6A 3LW5C 5IWAF 1NK9A 2BANB 1WI8A 2OO4A 2W4DA 2ZKTA 3E3XA 3SFGA 5DDOC 1IBMJ 2CPXA 2FHOB 4DSFA 3DOMB 1Y10A 2BKNA 1IKVB 1TP7A 2XZDB 4ELVA 1F9FA 4V19J 4ZVEA 4A8QA 2FLLA 1Z1ZA 3DLLQ 1FDAA 2OPQB 3GFZA 4BWMA 5HROA 1HR0F 2E66A 3RW6A 5LT5A 2ZH5A 2O1PA 2UV8G 4GVBB 3QNWB 2E1AA 5SUHA 1V3ZA 4C9DA 2QL5B 3PV8A 4NLOA 4R5PB 1U45A 5F9NA 2F4VF 1S1WB 2WSEC 2OMOA 3MOZA 2H48B 1BMQB 3MCOA 4Y2MA 2GAGC 4RU9A 2KM8B 2J0SD 4ECRA 5E3QA 3FFIA 5EX0A 2R7OA 5LMNF 4J9PA 3ZC4A 3FQKA 3IR6B 1T02A 4O3RA 5AXLA 2HQ3A 1OSCA 5F0WA 1LWEA 2G0CA 4KAIA 5HJYA 3N6LA 4DR7J 1EIYB 2QC3A 4J9OA 3F73A 4YR3A 4JI2J 4OHYA 1S1VB 1WEXA 4HTIA 1OPIA 1UTAA 2MQ8A 1GMVA 4DXLA 1GXTA 2ZBPA 1IXKA 2FJAB 3UCUP 3ZFVA 3DOLA 2R7SA 2W2QP 1TKTA 2XNQA 1HNXJ 3KDOA 4FBUA 3P49B 4DL5A 2NUHA 2AEJA 1UVIA 2FZKB 4F8RA 2UP1A 3P4UB 3ZZTA 2ZBCA 1FF2A 5E3CA 2R2RA 2VQEF 1AFIA 1RT6A 2ZBIA 1H73A 2E29A 1VRUA 5BXIA 4LF7J 1RDRA 2MZSA 2LLZA 2WVBA 1H7XA 3B82A 2JRSA 3DOLB 3HX9A 3LF0A 5KG0A 3UN3A 2JWNA 2JC1A 5HQ8A 1CBKA 4XIUA 2Q43A 4O4GA 2X7IA 1FKOB 5MAOA 1Q8LA 2EFOA 1U2CA 3W2VB 5T14A 2BACA 1M5HA 4KH1B 5ETSA 1M5OC 1F3VA 4AQYJ 4NL5A 3MMAB 2NXEA 4OI1A 2DGQA 4B9SA 5EN1A 4F2SA 4FF3A 1Q81T 1SKWA 2CVIA 3KJFB 3SQGB 1N34J 3HZGA 4EFAC 4OX6A 4I6WA 1YJUA 3G8QA 1A6LA 2XHCA 3MM6A 2XCPA 4J9KA 3OD2A 1LWFA 1TAUA 2J7UA 3G2XA 2QEXS 3UNGC 1T9XA 2GHVC 2YKNA 1U25A 4G6VB 3G8TA 3QRPA 4DSEA 3HLUA 1JLCB 1QTMA 2BKPA 1BHNA 1KWMA 5J2MA 4C0OC 2R7QA 3LGNA 4ANEA 4L73A 4F67A 2ZH4A 2GC8A 1U48A 2DNKA 5A0YA 2QMWA 4QWDA 4G1QB 3PCOB 4CO0A 1C0UB 2WBMA 5KFWA 3PX0A 1QDUB 4YHHF 1UVJA 3HDSA 1F3FA 4LF2A 2W9BB 1DQ8A 1K1QA 1JXEA 2V69A 3G82B 3FUYA 4F04B 1TUGB 2IA0A 1I51B 4TQSA 1V3SA 2VFSA 3KLFB 1L3KA 4CTAB 3OUYA 4EEYA 2DGSA 3ENAA 2G13A 4KHPJ 4ZITA 4F0MA 1VQ5S 2LXIA 2CPDA 3HSDA 4RNFA 3WIUA 1T94A 2XI3A 3H2LA 4MT1A 3UCZP 1ZTWA 1BQMA 4WU3A 3U7JA 2B6AB 4DFPA 3MM5B 4K59A 2KHCA 1WDDA 1HW9A 2UXBJ 4X4TA 4ZA1A 3O8WA 2E9TA 3WBZA 1TKXB 5HLFB 3IR5B 1FDBA 4W4MA 4XPCA 1HBMA 2XMVA 1FHTA 3GYGA 2G2YA 3AQPA 1NJYA 1GFWB 1QUPA
chains in the Genus database with same CATH topology
1SUQA 4WF9Q 2FJBB 1JLAB 3NS6A 5DG7A 3UE2A 3TNVA 2BVZA 4H4MB 3VAFA 4N5SA 5GAEI 1TKXA 5L9XA 1PO6A 1FNOA 1NO8A 1WEZA 4WYWA 2R2UA 1X4GA 5CYMA 1IKYA 2CIMA 2VA2A 4ZLPA 5KT5A 1SJ1A 5F41A 1GTHA 2IRUA 1J5OA 4FF2A 3HHDA 3T6JA 1OPZA 3V4IB 4DL2A 1N52B 1X4DA 4KKOA 3LUYA 4ZPTR 3NG8A 4C3KA 5KFZA 2OLWA 2RE1A 3JB9k 4DFMA 2X51A 3CJ2A 2K3IA 2ZOFA 1MW7A 4URQU 3V5RA 2CPHA 5EDWA 4Z2XA 2VD3A 2EKYA 1S6QB 5DLGA 3KLGA 2I9SA 1FCAA 2X1GA 2JC0A 1HMVA 2YKQA 3LP1A 3R5BA 4JI2F 1HD0A 4TLQA 4TNOA 4KKOB 3OW2R 3E01B 4DQSA 3TVKA 3Q24A 2PN6A 2EFGA 3BGRB 3PFOA 2CJKA 2H5EA 5CYQB 3GB0A 4LF8F 1TL4A 1Q7LB 2QT7A 2ZOGA 2VASA 4OIXA 1U4BA 1VQNS 4H4KC 5DRKA 3CDBA 2F9DA 1OO0B 2IJFA 3OJSA 2EC0A 3LH2S 1H2TZ 2R2SA 5E3PA 1UETA 5BYSA 2HPUA 2VOPA 4ZP7A 5DG9A 2QLWA 1X9SA 1SJQA 1TAQA 3PW4A 2A1BA 2CPZA 5IM0A 4LQ9A 5F8JA 2VBXA 2DNZA 3OVSA 3LPYA 2HNYB 1KSPA 5KFDA 2E9ZA 3UD3P 1HQEA 1HQEB 2HLUA 2KI2A 1QAJA 4C8LA 5JXSA 2KVIA 4G1QA 1C0TB 2AYGA 2VODA 1S1UB 4NLYA 1FEEA 3CC7S 3M2UB 3OTOF 2HHTA 2XG8A 3KLEA 3KNAA 5E33A 3DLGB 1JJ2R 4IH7A 3QLHB 4ATNA 3PR4A 1DLOB 4C3MA 2P9GA 4QCLA 4PQAA 2MKHA 2V0NA 4TKTA 5DS7A 4ZHRB 1S0NA 2BM1A 4PWUA 1ELOA 2FGCA 2AQ4A 4LFCF 1S1WA 2DGXA 2UUTA 3C6TB 3DI6A 3TANA 5KFHA 1QY7A 1RT2A 4TY9A 4B9VA 1ROFA 1RK8A 4PXDA 2UXCF 2ILYA 2JLFA 3BGRA 4J5OA 4C7QA 4GMKA 4OX7A 4Q44A 4ED6A 4ILMA 2KM8C 4FS2A 5E3AA 2B7CB 3BGFA 2QRRA 4OJ1A 3ITHB 5HI7A 3CC2S 2VB6A 3RYLA 1WHVA 5HMWA 1RTIA 4A46A 1XR7A 5B0CA 2P6SA 4E98A 4DR4F 4YDXA 3I4HX 5K14B 1IKXB 3C6UB 1VRUB 3AA8A 4OZLA 2BBEA 3B78A 4ZPBA 2YWGA 3CIMA 2JFKA 3QO9B 5A6PA 2OH2A 2DRAA 4QYZJ 1LFPA 2DCUB 4O3NA 3WDOA 1N36F 5DM6Q 4ICLA 2JVRA 3NRBA 4K5RA 2M4MA 2WSCC 3MMCB 3HFKA 4HTJA 5B0GA 5KFNA 3T1AA 1TK5A 4IOAQ 2VG5A 3QO9A 1WD6A 3DLEA 2W9CA 1Z4UA 3THPA 2W25A 3GE9A 1NK4A 1C4CA 3M2RA 3BO4A 1GH8A 5ITHA 2ZHOA 3NAHA 3BSCA 2OPRB 1VBYA 4FXVA 1BY9A 1FVQA 1MMLA 2W9AA 1YHQS 2R7TA 2UVVA 3KK2A 2DJWA 4I4BA 5KFYA 3ICLA 1S6PB 1RTJA 1NHUA 4ELTA 4UUXA 5I3UB 4WIIA 3KWMA 1VQYA 1IBKF 1VLYA 2O67A 1D9AA 3HK2A 3S1TA 4W92B 4F3OA 2Q1LA 2CPIA 1D9FA 1S1TA 4ID5A 5AXNA 2COLA 2FHKA 4CCHA 3JTPA 2XS7A 1GNKA 2V4JB 4OJHA 2JH3A 1KQFB 1QVGR 4DPOA 4ZP8A 3DLBA 2RNEA 5DQIA 4JUZA 3M9NB 3HVAA 3KG0A 5FD1A 3MEGA 3UR3C 4N8OA 4HI1A 4I7FA 4I7FB 4QIFA 5DDRC 4HEA9 1W25A 2D41A 5GAGU 5K8NA 1HNVA 3OSNA 5KFTA 2IFXA 3FNNA 3D2WA 3R1LA 1RT7B 4Q2LA 3KHGA 4DV7F 1DRZA 2J5AA 4ECXA 1FO1A 2HRYA 4NZ6A 5J2NB 2IC3A 3ULHA 3HHLC 1ZAVA 3M30B 1U49A 2U2FA 1T3OA 1Q8IA 1QE1B 4FNHA 2YVSA 5J1EB 1VQOS 1NK5A 3GMGA 1UEUA 4R8UB 4DS5A 2MQNA 4OZ1A 3OR2B 5EWFA 4J9QA 5J2NA 3M8QB 2HWIA 2IRYA 1TVRA 4DFKA 2CQHA 1T3NA 5G4DA 3KK2B 3ONQA 1N5VA 2GNKA 3HO1A 2C2EA 4K4ZA 1UP1A 2MKJA 4AL6A 2M7SA 2C28A 2IRXA 1CC7A 5CYQA 4DL0C 2OMLA 1DQAA 3IAS9 2J8AA 2DR9A 1VS3A 2OTLS 4ED1A 1NU4A 3OTCA 1W2IA 3IS9A 3WZ0A 1RT4A 1HWIA 4GO5X 3NS5A 1G2EA 2UUBF 1YRUA 2GQCA 2ZE2A 3I9V9 5HMYA 4B02A 2YNHA 3SQGA 1LV5A 3CJ5A 4ICLB 5HP1B 3TVYA 1LKZA 4IH5A 5THWA 3LOUA 5FIIA 4H4OA 3PACA 5IM0B 2B7BB 1S1UA 2HLTA 2WCXA 5A8WA 5KFXA 1KEKA 1BLUA 1QUVA 3MD3A 2UV8A 2I5JB 3BQ0A 2F8HA 3RTVA 2AP6A 1NK7A 1B7FA 4I67A 2BYCA 4RWXA 4KTQA 4QR2A 3D0GE 4N76A 2KDOA 3M6XA 2LXUA 1UEVA 2BQUA 1RT5B 2DGOA 2YH1A 4JV5F 3TA2A 4F3QA 1RT3A 1DFDA 3BR9A 3UCGA 4BWJA 1R0AA 4I68A 1KONA 5KG2A 3LWLA 2XLJA 3RB6A 4OI4A 3TUZC 1R8HA 4IDKB 5D4OA 1XERA 1Y3KA 3WC0A 2WAQD 3Q8SB 3RRHA 1AW0A 4KGMA 5BYQA 3V6KA 1JJ4A 1XTZA 1GX5A 2XEXA 2XMWA 3DLHA 2YX1A 2BABA 5B0FA 1YTYA 3DRSA 2MKCA 2QLXA 1UVNA 2MZQA 2VUGA 3RR7A 3AQOA 1U47A 1Q7YT 4N41A 2QZ8A 2RQMA 3OFFA 4DQQA 5B0AA 3EZ5A 3CTRA 2HGMA 5C5JA 5KFIA 2EI5A 2VOOA 4ZOSA 2HZCA 4DQPA 1NK0A 3IR7B 4WJBA 3ITHA 2DHSA 1PGZA 2M9KA 2XLKA 2PO4A 5A8KA 3CCZA 3IRXA 4JI1F 2KYZA 1RYSA 5IT4A 3RB4A 4Y00A 1RYRA 2VG5B 4WFZA 2AV5A 4LIWA 2RILA 4J9RA 3LP0B 2FY1A 4KO0A 3OPKA 4WXOA 3H40A 3D54A 4Q7AA 2CRLA 1HBOA 4P6QA 4XDDA 3NGDA 3HHKA 4B9LA 2EK1A 2HWTA 3U27A 1TK8A 1TVRB 5E3RA 4X4QA 1TK0A 2DHGA 2GFFA 4LUBA 2SXLA 3D5MA 1BQMB 3MTJA 2OP5A 1P27B 1RTDB 2KFZA 4E8UA 1RI7A 3EGWB 2KKHA 1HPZA 1RJJA 2HHPA 3I9ZA 4DX8H 3CCJS 4OX8A 2ZNZA 2CQGA 5B7WA 4X2BA 2VPWB 5I3UA 4BBYA 2HS0A 1E6YB 4MIAA 3DLKB 4DV0F 2H9ZA 2XBPA 1XR5A 3H5YA 5GMKa 4QWEA 2CKWA 4Y2AA 2OIHA 4ECTA 2GMJA 5E2QA 4ECYA 3M05A 2K3KA 4DR2F 3HMJG 4NLWA 2CPFA 3KLIA 3THTA 3BO2A 5I42A 4RUCA 2IJNA 4AFFA 3QYYA 4OJGA 4PWDA 1HYSA 1WG1A 1U2RA 2F8MA 1Q78A 4WFBQ 3H5UA 3TYTA 4WKRA 1N33F 2HNZB 3G4SS 2HS4A 2Y1RI 3HVTA 2B9XA 3H2UB 1ZZNA 3OV7A 2V4JA 2CQ4A 2EBEA 3CF5Q 2DNOA 2XZWA 3D1QA 3DOKA 4A4JA 1DLOA 4FVCA 1S1TB 1X4AA 4DHVA 4DSLA 2BQ3A 4PPDA 3I56S 5DJBA 2M5YA 3W2WA 3KK3B 4K4XA 1VHFA 2XSFA 3CULA 5D4PA 2UVRA 4FS1A 5B08A 4RW7B 4AXIA 3N5BA 3LWMA 1SH3A 2E5HA 1S6QA 3KLGB 4URSA 3B8HA 1HNWF 4F4ZA 3S01A 5LSOA 4ZCIA 2PE8A 3JSMB 2GMHA 3RU0A 3CJ0A 4F2RA 2UXDF 1FTRA 3DRSB 3NNHA 1FKAF 2MQLA 3TAQA 4MIWA 2WRMA 2XY6A 1X0FA 4Y0FA 1C1BA 1RT1A 3PEHA 1UA0A 4F4WA 5C24A 3OVBA 1LW0A 4XK8C 2VBWA 1FESA 3FVYA 2RVJA 1NJIT 4PG4A 2MB0B 2ZE2B 2ZVSA 4NLPA 2YKMB 3G96A 2HGLA 4OJ3A 2C2DA 1VQ4S 2GGPB 4E0DA 4USJC 5DGAA 3OJUA 2AGQA 2HAIA 3N28A 4EWTA 4IG0B 1L3VA 4NCBA 3DFEA 3N79A 4ZPDA 5LJ5Y 1S0OA 3QJLA 2KRBA 2DGTA 2VG7A 2IVMA 2I1RA 2YKMA 5AXMA 3MR3A 5B0DA 1F5CA 1YIJS 1SV5A 5CZXA 4MK9A 2MQQA 2KXFA 1RA6A 3DMJA 3TUIC 2UU9F 4DSJA 3CO9A 4JI4F 3JSBA 3SYZA 1C1CB 2J9CA 4JI6F 4CH1A 1R43A 5LSRA 2RUGA 3M2UA 2WTFA 2E1CA 2M70A 4OFZA 2OPSB 3WC2A 4Q8EA 1HPZB 3Q8RB 2GX8A 3KLFA 7FD1A 3VCDA 2RB7A 2W4CA 3I31A 4RKUC 1D3WA 2KXHA 1HHTP 1MMNA 4XDCA 4OHVA 1FDDA 3K8WA 3OSPA 3OL7A 2AWZA 4ED2A 2DNQA 2EW9A 4HHJA 2G4BA 1HL6A 1UL3A 2F8EX 3MM9A 3DCAA 2DK2A 2EFNA 3D28A 1DQ9A 4EGLA 4OMFG 2PFFB 2V5HG 5EGYA 4KIAA 2LEBA 1YITS 3J81Y 3H4DA 1FNMA 2DGWA 2CYYA 3EXYA 4Y34A 1FXLA 3T5KA 3LO3A 2YNIA 5DDPC 2EFQA 4DQRA 1VI7A 3Q2TC 1DTTA 3C46A 3HHLD 3K0JA 4NPOA 2IYGA 1BWEA 3DGPA 1YJRA 3CD6S 3W2VA 1GT8A 2D9PA 4N77A 2OSQA 2AYEA 3MHYA 4MK8A 5D3GB 1U1MA 1IJFB 4FYDA 1X7VA 1PC4A 4KJIA 4IOBA 4YQWA 1QM9A 2FJDB 2W24A 1KC8T 4ZPCA 1O0PA 4LSLB 2J6UA 1JWWA 3R27A 3SV4A 3GV5B 5KFUA 4K4UA 4YDDB 1R3NA 2D1CA 3CJ4A 4YEAA 2W8LA 4J37A 1ZAWA 3DU5A 2QV6A 4I69A 4K4YA 3CMAS 2E5GA 4YFUA 4L3NA 4NWBA 4UUWA 1VRTB 1VRTA 1VK3A 5LSLA 2XO7A 2PEHA 1HQUB 3IA0A 5DO2A 1BQXA 5M2RA 3PKMA 3AY0A 4DL6A 1H2UX 1RT4B 2RS8A 4QIEA 1XNRF 2B6AA 1LK7A 3DDNA 1HBUA 3T9NA 4ALZA 1S4FA 3SSRA 3T6BA 4ECWA 2DIVA 4DG1B 2R7VA 2KJWA 1VQSA 1FK9B 1FT8A 3KLIB 1KLNA 2C2RA 3V81B 3E01A 1U2FA 2UVUA 2AJQA 1S1XA 2MZJA 6FDRA 3TO8A 2B9WA 2ASJA 2JEJA 1FJCA 1SQEA 2DRBA 4B3RF 2ASDA 1ZBTA 1YVFA 2N3OA 4WXWA 2VZ9A 1FRJA 1HBNB 1Y3JA 1AROP 2CQPA 2YQ3A 3HVWA 4PXBA 4Y3CA 5KG7A 5L1LA 2Y1JA 4F02A 4NYOA 2E1RA 4M1KA 2AJFE 3SCIE 1N5YA 4C4WA 1R8PA 5KFFA 1KTVA 2HYIB 1ZM4A 3PIPQ 1XMOF 3CCQS 2R9LA 1HA1A 2DNMA 2F40A 3CGIA 4KFBA 3ZZYA 5KFKA 2ZHBA 4MKYA 1AFJA 2HQIA 2XSJA 5CCLA 2AW0A 2E44A 2HNZA 2XMTA 4C0HA 3CSKA 4NRTA 4IFYA 4IOCQ 1N5YB 3TI0A 3TA0A 3DLGA 3MM7B 3DRXA 1R6YA 5E0OA 3K8VA 3O1LA 2ZM6F 2C42A 1MU2B 2MJUA 2JLGA 4ECSA 2RDJA 4Q43A 3CXCR 3M1VA 3RAXA 4OHXA 2NYIA 2KT2A 4WCEQ 2GCFA 2BRKA 2DISA 3G6VA 4NA2A 1HNIB 1H3DA 1FD8A 3MUMP 4YUDA 2NR0A 1DAXA 4X4VA 4NLVA 4RNNA 4X4OA 4EZ6A 1FKOA 1EP4B 1FKPB 4IR9A 2CQ3A 3M1VB 2BJDA 2J9DA 3MPVA 4QOTA 3MEEA 4A8KA 1TV6B 4HT5A 4X62F 2D9OA 5HL7Q 4OLPA 2EVZA 3MR5A 2ZZNA 4U7CA 4O4RA 4RW9B 4ITSA 2QIFA 3I32A 2FPHX 5KG3A 3N01A 1YI2S 2XMMA 3I96A 3CJKA 4UQGA 1KTQA 2J0XA 3TQ1A 1E6VB 3NWGA 3KLHA 4NCAA 1R31A 3E2EA 3VZIA 2RMLA 2NLWA 2B43A 5D4NA 2HRUA 5E5NA 3AB4B 3HVTB 2PI5A 1HNZF 3PM9A 4MFBA 3I5BA 3VWSA 3LGMA 4I56A 1KS2A 5J1NA 4IG0A 3N6MA 4KBIA 3VAKA 3OL8A 3MEKA 2FVCA 4AL7A 1T03B 1H7WA 5J2QA 4AL5A 4DF4A 1KFDA 1LK5A 3CC4S 3O5TB 4RBUA 4JV0A 3MMCA 2KFNA 3NKYA 1SL1A 1IKVA 4DV2F 4Q5VA 4CO2A 4HLBA 4N47A 2I5JA 1P1TA