2WSCF

Improved model of plant photosystem i
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure Determination and Improved Model of Plant Photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 20
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2wscF00
2WSFF 2WSCF 4RKUF 4XK8F 5L8RF 3LW5F 4Y28F 2O01F 4L6V6 1JB0F 4KT0F 2WSEF
chains in the Genus database with same CATH superfamily
2UXCM 3E46A 2OOBA 1VEKA 4MGYE 8CATA 3GP1A 4GHLA 3RFWA 4LF4M 1VEJA 4GRIA 1NJGA 3K9PA 4LRSA 2KZSA 4CGYB 2CWBA 3GLFB 1TH2A 2MROB 3U6EA 4L16A 2FE8A 4OU7A 3C9PA 1A5TA 1G41A 5JI2E 2KNZA 2XZFA 2JP7A 1L2BA 1LTMA 1EFUB 5ITXE 2JXNA 2EA0A 1OFHA 4DR1M 4BLCA 2B3TA 1GJSA 2KRKA 4IBDA 4LJ9A 3C3DA 4AW4A 4ZPXA 4JI8M 1DGHA 3U6LA 1Z5BA 4FD2A 2Z3XA 2DVWB 2YR0A 3GQ4A 5ITUA 1QVRA 4LY6A 4ANRA 5DYIA 4QOZC 4P16A 3R9XB 2RGHA 1IN7A 2K6BA 2UXDM 2V6ZM 1OIPA 3VDPA 5GKNA 1VEGA 1Z6TA 5ITYA 1XHBA 5A2QS 4HL4A 3A42A 1NNJA 3RGPA 1I94M 1MN3A 3M7GA 4RNAA 4DR2M 3M0EA 1WJ7A 1IY2A 4EIWA 3GQ3A 7CATA 2VQEM 2C9OA 1IN8A 1OTRA 4LJ4A 3SMSA 3ZC7B 3WHKA 1IBLM 2KZUA 3T1YM 1ZMUA 4JI2M 2BWBA 1NHGC 4LGYA 2DAEA 1MX0A 2DHYA 3NBXX 4LF5M 2DZNB 1DO0A 4DV6M 2BJVA 3AOGA 3CF2A 3TE6A 3U60B 3J7BA 4II7A 3FYCA 3AOEA 3K9OA 5KPZA 2VQFM 3HJ8A 3GRVA 1NJFA 1T6OA 3HU1A 5E6JA 1N36M 2LXEA 1HNXM 1JB0F 2FFJA 3HZJA 3U6SA 4ITQA 1TTEA 1QDTA 3KOZE 1ZMWA 1GL6A 1VQ1A 1N34M 1FNNA 2N35A 3IECA 3L28A 3F92A 1G4AE 1XB2B 4I4LA 1D0LA 3A45A 1VDDA 1YLAA 4WP2A 3FE3A 3HU3A 4RKUF 3THGA 2KA6B 2A5YB 4A3VB 2V1CA 4RF1A 1NY6A 3K8ZA 1VDLA 2D7EA 4KHPM 2DI0A 1XXHE 3SC3A 3ZQJA 4Z6YA 4G4QA 4OX9M 1R4GA 2WSFF 1HQYE 3WHLA 3B7QA 4L15A 4DV4M 1SXJC 1HNZM 4TUWA 3L29A 4LFBM 3B74A 3SHGB 2R4EA 2RRUA 2DWZB 2JY6B 3CTWB 4BBAA 4AG6A 3GLGB 5EXXA 1WXQA 1VG5A 3GLHA 2Z8YM 4KLNA 1IFYA 2HKJA 1OIZA 1AIPC 1D0KA 1RU3A 3LW5F 3VLFB 3GLIE 2JZ1A 2K47A 2FS1A 1L1ZA 5FSWA 1DGGA 3W0LB 3HJQA 2BJWA 4AKGA 3HU2A 1GKIA 4JN6A 4X66M 1N32M 4L4UA 4QHSA 5C18A 1XXHA 3SFZA 5KPRA 3J80S 2XLJA 2ZM6M 3HHXA 2LH0A 3IG5A 3MK6A 4BB9A 4FCWA 2RGOA 4LJ7A 4GH9A 2F5QA 1GVNA 3I4YA 1G8PA 1F4IA 3AL0C 5EP3A 1KSFX 4IBCA 2LBCA 3K92A 4IJEA 4XBOA 5EXSA 2XFSA 1DGBA 4NRWA 1SXJB 4B3RM 2C5RA 3I01M 3PNVA 2ZANA 3DA1A 2J5YA 3L27A 3MJ5A 2X8AA 4YY3M 4NXNM 3SMPA 3VDUA 5FLXS 4IBFA 2ZAMA 3FUXA 2LVNC 4MB7A 3ZCBB 4F1IA 3FUVA 5EXTA 4PDIA 3AKZA 3FUTA 4XK8F 1JR3A 3PFIA 4MH0E 4JI6M 3Q8XA 4MGHA 4PD2A 2Y0QA 1KYIA 5FTKA 4GKKM 1WHCA 1DV0A 3GRRA 1T3TA 3HKPA 3T38A 2W82A 2DAGA 3HJSA 2LHGA 1OAOC 2C98A 3U6MA 4LG2A 4HLQA 4GITA 3FRIA 4LJAA 1QAQA 2DKLA 5IT9S 1PJQA 4LGMA 4R7GA 1QANA 2CRUA 2R62A 4KT0F 2ZTDA 4B7FA 3GPYA 4CIZA 4NOOB 2J7NA 2XEPA 3BOSA 2G3QA 2G5GX 3LCVB 2QP9X 1CUKA 4GKJM 2YFQA 1X37A 1W5SA 4JI0M 2EJSA 2WSCF 4FWDA 5EP1A 2Y21A 2XZUA 4B3TM 5EP4A 4G6ZA 2DWNA 2XSZA 1G59A 2OPFA 5IWAM 1HNWM 2MH8A 2Y0TA 4UN2B 2C9CA 3SHFA 2DWMA 4FCVA 1QUSA 2D7HA 4GC5A 4I8OA 3JAMS 4B08A 2DZLA 4JXJA 4OVZB 2G8LA 4QHTA 4NSOB 3SYLA 1GLNA 2DNAA 4KODA 2I7PA 4FCTA 1QUTA 1TF0B 4JYAM 2JY5A 1LV7A 4AQYM 1N33M 1OAIA 3U61B 2R4JA 1GL7A 1QAOA 1W5TA 3AFHA 3QAUA 3RE8A 4JV5M 2QNJA 1PJTA 3U5ZB 1XMQM 1PGYA 2CV1A 2C99A 3TL4X 4CHTB 1ZAEA 2JA2A 3PXGA 2L09A 1IXSB 2ZAOA 2HWJA 3V76A 4MGZE 3U6CA 1IY0A 4MM3B 1H6UA 2GQFA 2XH9A 2QENA 3LVWA 1Q02A 4M0DA 4CJ6A 2L7HA 4PCZA 2HHHM 1TH3A 3GLGA 2DHRA 3DFZA 1C7YA 4LJ5A 3FTEA 2UXBM 4FWHA 2JY7A 4GMQA 2HCBA 3E21A 1K3XA 2X4AA 3HHYA 4DR4M 2LHCA 2R65A 2VIIA 3GPXA 1PJJA 4IJFA 3SAUA 3GRUA 1JR3D 1V34A 2KXEA 3TWLA 4DV2M 1IN6A 1TDHA 2KNVA 4GIPA 4JI4M 4LRTA 1V92A 1R7RA 3FTFA 2J7OA 3FUUA 2JWSA 1NV9A 2Q2EB 5FTNA 4NL4H 2XFTA 2NQ8C 2UUAM 2L4EA 2EUCA 1Q39A 1SXJA 3PNYA 3GLHE 3NWLA 3VFDA 3H4JA 5FTJA 1NNUC 1PRBA 5KQ8A 4NXMM 4DBGB 1QAMA 3U6OA 3FTDA 2CP8A 4Q7JA 3VK7A 1HQCA 3KSXA 4LFAM 2CV0A 4LJ6A 3TWKA 2MJ5B 1WGNA 1E9RA 1E9SA 1WIVA 1XMOM 1IN5A 3B9PA 4RF0A 1K3WA 1DGHB 2XSZD 4X62M 2CFOA 2LVPC 3E9SA 3ILKA 4CISA 4PDGA 1IXZA 1IN4A 2CUZA 1E94E 1NHWC 3KVWA 4QNRA 2QBYB 1L1TA 1DGFA 3J27B 2Z7JA 2VF7A 4DUYM 4DR5M 2MGWA 3C3EA 2UU9M 4D82A 2CHQA 3B7NA 4FWGA 3GLFA 3QYEA 2LTUA 5EXPA 2EKFA 1JR3E 3QWLA 3MHVC 2JUJA 4B3MM 1FJGM 2RKOA 4HEOA 1V33A 3K1JA 4KO8A 5KQDA 4NC6A 2X49A 3H4MA 2KEBA 1QYRA 2DZOB 2DAMA 2KHHA 3A46A 4G4RA 2Y20A 1UFZA 1QZEA 3HGIA 2APLA 3KOWE 5ITRA 1DO2A 3C58A 2R0IA 2DAKA 4IBIA 4P17A 3KS8A 5LMNM 2YQZA 4IBGA 5KPTA 2LNHC 1PM5A 1N77A 4OVZA 2F5SA 4YHHM 3J7AS 3IG8A 3GPUA 5BPVA 1TH4A 3VK8A 1C1KA 1AUAA 2CHGA 3HX3A 3U61A 1XC8A 1XNQM 2UUBM 3KSJA 2H1RA 3U5ZA 3DZDA 2C96A 3TPZA 1IQPA 3IHPA 1L2DA 4FW9A 4LFCM 1WGLA 1ZMVA 4K0KM 1HJPA 4AG5A 1Z5AA 3LMMA 1IXSA 4JI7M 3NBIA 4DV7M 4IIWA 5BR8M 2WZJA 3EIHA 4LJ8A 1UM8A 4G3OA 4JI5M 1SXJD 1YSYA 3FKEA 3R8FA 3HY5A 4AZFA 2GNOA 3OTOM 2F5PA 3LQQA 4JI3M 2LVQD 2L2DA 3B7ZA 4DUZM 4QOSA 2F5OA 1PJIA 2F5NA 3VKHA 3SAVA 3KDSE 3U60A 3JR5A 3PVSA 4M9ZA 3FD9A 1OJLA 2R44A 3BXWA 2H5XA 2JZ0A 1HT1E 1NVMA 2YNMD 3KW6A 2WSEF 4DR6M 1D2NA 4G4NA 1EIJA 1IBKM 2EKKA 3TQSA 3BBZA 3D8BA 2QZ4A 3E4RA 4GC9A 1XXHB 2OOAA 4DR7M 1NY5A 2QSFX 1XWIA 1D0MA 1Q3BA 1T43A 3HHZA 2I7NA 4L78A 3GLGE 1R6BX 2QHOB 4REZA 3L25A 1ZQ9A 1J7KA 4X65M 2R6FA 4R3DA 4LF6M 1XNRM 4PT5A 3B89A 3KOYE 5EQTA 2EO2A 3GLIB 2OQ4A 2V1UA 2F4VM 2O5RA 2CV2A 4QNMA 4D80A 3LQRA 2JY8A 3W68A 3UJNA 3I51A 3EIEA 3J81S 1IBMM 3SASA 2HL7A 3HHWA 1G3IA 2CEAA 2KW0A 4AKHA 4WURA 5IZ7D 3KOXE 3ZH9B 1G71A 1E32A 5IREB 1R2ZA 4G4OA 4B7GA 1GJTA 5ITTA 2VDBB 2P5TA 2QBYA 1SXJE 3K2LA 2O25A 2QPAA 4NSRA 2K9DA 3KS4A 3T15A 4AI6A 2M60A 3Q8GA 3UGJA 3UK6A 4JI1M 5ITXA 2OO9A 5EP2A 1N75A 2K0BX 4X64M 5LMUM 1QDRA 2ERCA 4B3SM 2XGNA 3CF0A 2VF8A 1QQWA 3HWSA 1EE8A 4IBEA 1K82A 5DFLA 2DWLA 3KXEC 3UZUA 1OQYA 3U6QA 4LCBA 3SYKA 2HAKA 2CHVA 3W67A 1YUBA 5FTMA 1OKSA 3KFUG 3SAWA 1YE9A 5C1BA 1L2CA 1MU5A 2XF3A 1NO1A 4LZJA 2ZTCA 4NRVA 1BVSA 3VKGA 1PJSA 4DR3M 3FUWA 3T1HM 2LWXA 2MR9A 3GLFE 3AJIB 3GPPA 1Y8GA 5F3WA 4AKIA 2D7GA 2R18A 1NV8A 2L7IA 4OW0A 4IBKA 4B7HA 3AOEC 3UMMA 3J2PB 3JR4A 1MJGM 3SBJA 1KFVA 2BNKA 4DV0M 1IM2A 4R71A 3SATA 1N78A 2ZBKB 4IBJA 4M9XA 3TWMA 1TDZA 1J09A 3DOAA 2JNHA 3D8LA 4DV1M 3FTCA 5DYGA 1WR1B 2FOIC 1Z59A 3RGSA 1QZMA 3L2AA 5JI3E 2L6OA 3CGWA 2DENA 4L8RC 3I4VA 1ORYB 1GABA 1TR8A 4GEWA 1TGUA 1HR0M 5DNYA 4LF7M 3CF6E 2QQ8A 4FVMA 2L4FA 1Q3CA 2E5LM 3FRHA 5ITQA 1J5EM 2FNAA 3GO8A 1Z5CA 3L26A 4LZZA 2UUCM 4XGIA 1JQJC 1SG9A 2DXIA 5L8RF 3SARA 1IXRC 4GHAA 3GRYA 4I81A 3GQ5A 4Y28F 2AHMA 2R45A 4W5WA 2BWEA 4IBBA 1R2YA 4S12A 4DV3M 2FH0A 4M0WA 4MGIE 2Z4SA 3GLIA 4DV5M 1S3SA 3AV0A 3U6DA 3MMPA 4I5SA 4LF9M 1HT2E 1L8QA 2DAIA 3A98B 1P3QQ 5FTLA 2KRUA 2LVAA 3KP0E 4MGKE 3U6PA 1OFIA 3W0FA 1I4WA 2M5ZA 4Z8XA 3M6AA 3LVVA 1NSFA 1IY1A 3I04M 1ZV1A 3QYBA 2O01F 2R46A 2CE7A 2LVOC 4D81A 2Z4RA 5E26A 3FYDA 4L6V6 4M9SA 3GLHB 4F2LA 2KNAA 5H37D 1GO5A 5EJCA 2QCUA 3LCUA 3T6PA 2KDLA 4LF8M 5KO3A 4WW0A 1R5LA 3KP1E
chains in the Genus database with same CATH topology
2WSFF 2WSCF 4RKUF 4XK8F 5L8RF 3LW5F 4Y28F 2O01F 4L6V6 1JB0F 4KT0F 2WSEF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF F;  2WSC F;  4RKU F;  4XK8 F;  5L8R F;  3LW5 F;  4Y28 F;  2O01 F;  4L6V 6;  1JB0 F;  4KT0 F;  2WSE F; 
#chains in the Genus database with same CATH topology
 2UXC M;  3E46 A;  2OOB A;  1VEK A;  4MGY E;  8CAT A;  3GP1 A;  4GHL A;  3RFW A;  4LF4 M;  1VEJ A;  4GRI A;  1NJG A;  3K9P A;  4LRS A;  2KZS A;  4CGY B;  2CWB A;  3GLF B;  1TH2 A;  2MRO B;  3U6E A;  4L16 A;  2FE8 A;  4OU7 A;  3C9P A;  1A5T A;  1G41 A;  5JI2 E;  2KNZ A;  2XZF A;  2JP7 A;  1L2B A;  1LTM A;  1EFU B;  5ITX E;  2JXN A;  2EA0 A;  1OFH A;  4DR1 M;  4BLC A;  2B3T A;  1GJS A;  2KRK A;  4IBD A;  4LJ9 A;  3C3D A;  4AW4 A;  4ZPX A;  4JI8 M;  1DGH A;  3U6L A;  1Z5B A;  4FD2 A;  2Z3X A;  2DVW B;  2YR0 A;  3GQ4 A;  5ITU A;  1QVR A;  4LY6 A;  4ANR A;  5DYI A;  4QOZ C;  4P16 A;  3R9X B;  2RGH A;  1IN7 A;  2K6B A;  2UXD M;  2V6Z M;  1OIP A;  3VDP A;  5GKN A;  1VEG A;  1Z6T A;  5ITY A;  1XHB A;  5A2Q S;  4HL4 A;  3A42 A;  1NNJ A;  3RGP A;  1I94 M;  1MN3 A;  3M7G A;  4RNA A;  4DR2 M;  3M0E A;  1WJ7 A;  1IY2 A;  4EIW A;  3GQ3 A;  7CAT A;  2VQE M;  2C9O A;  1IN8 A;  1OTR A;  4LJ4 A;  3SMS A;  3ZC7 B;  3WHK A;  1IBL M;  2KZU A;  3T1Y M;  1ZMU A;  4JI2 M;  2BWB A;  1NHG C;  4LGY A;  2DAE A;  1MX0 A;  2DHY A;  3NBX X;  4LF5 M;  2DZN B;  1DO0 A;  4DV6 M;  2BJV A;  3AOG A;  3CF2 A;  3TE6 A;  3U60 B;  3J7B A;  4II7 A;  3FYC A;  3AOE A;  3K9O A;  5KPZ A;  2VQF M;  3HJ8 A;  3GRV A;  1NJF A;  1T6O A;  3HU1 A;  5E6J A;  1N36 M;  2LXE A;  1HNX M;  1JB0 F;  2FFJ A;  3HZJ A;  3U6S A;  4ITQ A;  1TTE A;  1QDT A;  3KOZ E;  1ZMW A;  1GL6 A;  1VQ1 A;  1N34 M;  1FNN A;  2N35 A;  3IEC A;  3L28 A;  3F92 A;  1G4A E;  1XB2 B;  4I4L A;  1D0L A;  3A45 A;  1VDD A;  1YLA A;  4WP2 A;  3FE3 A;  3HU3 A;  4RKU F;  3THG A;  2KA6 B;  2A5Y B;  4A3V B;  2V1C A;  4RF1 A;  1NY6 A;  3K8Z A;  1VDL A;  2D7E A;  4KHP M;  2DI0 A;  1XXH E;  3SC3 A;  3ZQJ A;  4Z6Y A;  4G4Q A;  4OX9 M;  1R4G A;  2WSF F;  1HQY E;  3WHL A;  3B7Q A;  4L15 A;  4DV4 M;  1SXJ C;  1HNZ M;  4TUW A;  3L29 A;  4LFB M;  3B74 A;  3SHG B;  2R4E A;  2RRU A;  2DWZ B;  2JY6 B;  3CTW B;  4BBA A;  4AG6 A;  3GLG B;  5EXX A;  1WXQ A;  1VG5 A;  3GLH A;  2Z8Y M;  4KLN A;  1IFY A;  2HKJ A;  1OIZ A;  1AIP C;  1D0K A;  1RU3 A;  3LW5 F;  3VLF B;  3GLI E;  2JZ1 A;  2K47 A;  2FS1 A;  1L1Z A;  5FSW A;  1DGG A;  3W0L B;  3HJQ A;  2BJW A;  4AKG A;  3HU2 A;  1GKI A;  4JN6 A;  4X66 M;  1N32 M;  4L4U A;  4QHS A;  5C18 A;  1XXH A;  3SFZ A;  5KPR A;  3J80 S;  2XLJ A;  2ZM6 M;  3HHX A;  2LH0 A;  3IG5 A;  3MK6 A;  4BB9 A;  4FCW A;  2RGO A;  4LJ7 A;  4GH9 A;  2F5Q A;  1GVN A;  3I4Y A;  1G8P A;  1F4I A;  3AL0 C;  5EP3 A;  1KSF X;  4IBC A;  2LBC A;  3K92 A;  4IJE A;  4XBO A;  5EXS A;  2XFS A;  1DGB A;  4NRW A;  1SXJ B;  4B3R M;  2C5R A;  3I01 M;  3PNV A;  2ZAN A;  3DA1 A;  2J5Y A;  3L27 A;  3MJ5 A;  2X8A A;  4YY3 M;  4NXN M;  3SMP A;  3VDU A;  5FLX S;  4IBF A;  2ZAM A;  3FUX A;  2LVN C;  4MB7 A;  3ZCB B;  4F1I A;  3FUV A;  5EXT A;  4PDI A;  3AKZ A;  3FUT A;  4XK8 F;  1JR3 A;  3PFI A;  4MH0 E;  4JI6 M;  3Q8X A;  4MGH A;  4PD2 A;  2Y0Q A;  1KYI A;  5FTK A;  4GKK M;  1WHC A;  1DV0 A;  3GRR A;  1T3T A;  3HKP A;  3T38 A;  2W82 A;  2DAG A;  3HJS A;  2LHG A;  1OAO C;  2C98 A;  3U6M A;  4LG2 A;  4HLQ A;  4GIT A;  3FRI A;  4LJA A;  1QAQ A;  2DKL A;  5IT9 S;  1PJQ A;  4LGM A;  4R7G A;  1QAN A;  2CRU A;  2R62 A;  4KT0 F;  2ZTD A;  4B7F A;  3GPY A;  4CIZ A;  4NOO B;  2J7N A;  2XEP A;  3BOS A;  2G3Q A;  2G5G X;  3LCV B;  2QP9 X;  1CUK A;  4GKJ M;  2YFQ A;  1X37 A;  1W5S A;  4JI0 M;  2EJS A;  2WSC F;  4FWD A;  5EP1 A;  2Y21 A;  2XZU A;  4B3T M;  5EP4 A;  4G6Z A;  2DWN A;  2XSZ A;  1G59 A;  2OPF A;  5IWA M;  1HNW M;  2MH8 A;  2Y0T A;  4UN2 B;  2C9C A;  3SHF A;  2DWM A;  4FCV A;  1QUS A;  2D7H A;  4GC5 A;  4I8O A;  3JAM S;  4B08 A;  2DZL A;  4JXJ A;  4OVZ B;  2G8L A;  4QHT A;  4NSO B;  3SYL A;  1GLN A;  2DNA A;  4KOD A;  2I7P A;  4FCT A;  1QUT A;  1TF0 B;  4JYA M;  2JY5 A;  1LV7 A;  4AQY M;  1N33 M;  1OAI A;  3U61 B;  2R4J A;  1GL7 A;  1QAO A;  1W5T A;  3AFH A;  3QAU A;  3RE8 A;  4JV5 M;  2QNJ A;  1PJT A;  3U5Z B;  1XMQ M;  1PGY A;  2CV1 A;  2C99 A;  3TL4 X;  4CHT B;  1ZAE A;  2JA2 A;  3PXG A;  2L09 A;  1IXS B;  2ZAO A;  2HWJ A;  3V76 A;  4MGZ E;  3U6C A;  1IY0 A;  4MM3 B;  1H6U A;  2GQF A;  2XH9 A;  2QEN A;  3LVW A;  1Q02 A;  4M0D A;  4CJ6 A;  2L7H A;  4PCZ A;  2HHH M;  1TH3 A;  3GLG A;  2DHR A;  3DFZ A;  1C7Y A;  4LJ5 A;  3FTE A;  2UXB M;  4FWH A;  2JY7 A;  4GMQ A;  2HCB A;  3E21 A;  1K3X A;  2X4A A;  3HHY A;  4DR4 M;  2LHC A;  2R65 A;  2VII A;  3GPX A;  1PJJ A;  4IJF A;  3SAU A;  3GRU A;  1JR3 D;  1V34 A;  2KXE A;  3TWL A;  4DV2 M;  1IN6 A;  1TDH A;  2KNV A;  4GIP A;  4JI4 M;  4LRT A;  1V92 A;  1R7R A;  3FTF A;  2J7O A;  3FUU A;  2JWS A;  1NV9 A;  2Q2E B;  5FTN A;  4NL4 H;  2XFT A;  2NQ8 C;  2UUA M;  2L4E A;  2EUC A;  1Q39 A;  1SXJ A;  3PNY A;  3GLH E;  3NWL A;  3VFD A;  3H4J A;  5FTJ A;  1NNU C;  1PRB A;  5KQ8 A;  4NXM M;  4DBG B;  1QAM A;  3U6O A;  3FTD A;  2CP8 A;  4Q7J A;  3VK7 A;  1HQC A;  3KSX A;  4LFA M;  2CV0 A;  4LJ6 A;  3TWK A;  2MJ5 B;  1WGN A;  1E9R A;  1E9S A;  1WIV A;  1XMO M;  1IN5 A;  3B9P A;  4RF0 A;  1K3W A;  1DGH B;  2XSZ D;  4X62 M;  2CFO A;  2LVP C;  3E9S A;  3ILK A;  4CIS A;  4PDG A;  1IXZ A;  1IN4 A;  2CUZ A;  1E94 E;  1NHW C;  3KVW A;  4QNR A;  2QBY B;  1L1T A;  1DGF A;  3J27 B;  2Z7J A;  2VF7 A;  4DUY M;  4DR5 M;  2MGW A;  3C3E A;  2UU9 M;  4D82 A;  2CHQ A;  3B7N A;  4FWG A;  3GLF A;  3QYE A;  2LTU A;  5EXP A;  2EKF A;  1JR3 E;  3QWL A;  3MHV C;  2JUJ A;  4B3M M;  1FJG M;  2RKO A;  4HEO A;  1V33 A;  3K1J A;  4KO8 A;  5KQD A;  4NC6 A;  2X49 A;  3H4M A;  2KEB A;  1QYR A;  2DZO B;  2DAM A;  2KHH A;  3A46 A;  4G4R A;  2Y20 A;  1UFZ A;  1QZE A;  3HGI A;  2APL A;  3KOW E;  5ITR A;  1DO2 A;  3C58 A;  2R0I A;  2DAK A;  4IBI A;  4P17 A;  3KS8 A;  5LMN M;  2YQZ A;  4IBG A;  5KPT A;  2LNH C;  1PM5 A;  1N77 A;  4OVZ A;  2F5S A;  4YHH M;  3J7A S;  3IG8 A;  3GPU A;  5BPV A;  1TH4 A;  3VK8 A;  1C1K A;  1AUA A;  2CHG A;  3HX3 A;  3U61 A;  1XC8 A;  1XNQ M;  2UUB M;  3KSJ A;  2H1R A;  3U5Z A;  3DZD A;  2C96 A;  3TPZ A;  1IQP A;  3IHP A;  1L2D A;  4FW9 A;  4LFC M;  1WGL A;  1ZMV A;  4K0K M;  1HJP A;  4AG5 A;  1Z5A A;  3LMM A;  1IXS A;  4JI7 M;  3NBI A;  4DV7 M;  4IIW A;  5BR8 M;  2WZJ A;  3EIH A;  4LJ8 A;  1UM8 A;  4G3O A;  4JI5 M;  1SXJ D;  1YSY A;  3FKE A;  3R8F A;  3HY5 A;  4AZF A;  2GNO A;  3OTO M;  2F5P A;  3LQQ A;  4JI3 M;  2LVQ D;  2L2D A;  3B7Z A;  4DUZ M;  4QOS A;  2F5O A;  1PJI A;  2F5N A;  3VKH A;  3SAV A;  3KDS E;  3U60 A;  3JR5 A;  3PVS A;  4M9Z A;  3FD9 A;  1OJL A;  2R44 A;  3BXW A;  2H5X A;  2JZ0 A;  1HT1 E;  1NVM A;  2YNM D;  3KW6 A;  2WSE F;  4DR6 M;  1D2N A;  4G4N A;  1EIJ A;  1IBK M;  2EKK A;  3TQS A;  3BBZ A;  3D8B A;  2QZ4 A;  3E4R A;  4GC9 A;  1XXH B;  2OOA A;  4DR7 M;  1NY5 A;  2QSF X;  1XWI A;  1D0M A;  1Q3B A;  1T43 A;  3HHZ A;  2I7N A;  4L78 A;  3GLG E;  1R6B X;  2QHO B;  4REZ A;  3L25 A;  1ZQ9 A;  1J7K A;  4X65 M;  2R6F A;  4R3D A;  4LF6 M;  1XNR M;  4PT5 A;  3B89 A;  3KOY E;  5EQT A;  2EO2 A;  3GLI B;  2OQ4 A;  2V1U A;  2F4V M;  2O5R A;  2CV2 A;  4QNM A;  4D80 A;  3LQR A;  2JY8 A;  3W68 A;  3UJN A;  3I51 A;  3EIE A;  3J81 S;  1IBM M;  3SAS A;  2HL7 A;  3HHW A;  1G3I A;  2CEA A;  2KW0 A;  4AKH A;  4WUR A;  5IZ7 D;  3KOX E;  3ZH9 B;  1G71 A;  1E32 A;  5IRE B;  1R2Z A;  4G4O A;  4B7G A;  1GJT A;  5ITT A;  2VDB B;  2P5T A;  2QBY A;  1SXJ E;  3K2L A;  2O25 A;  2QPA A;  4NSR A;  2K9D A;  3KS4 A;  3T15 A;  4AI6 A;  2M60 A;  3Q8G A;  3UGJ A;  3UK6 A;  4JI1 M;  5ITX A;  2OO9 A;  5EP2 A;  1N75 A;  2K0B X;  4X64 M;  5LMU M;  1QDR A;  2ERC A;  4B3S M;  2XGN A;  3CF0 A;  2VF8 A;  1QQW A;  3HWS A;  1EE8 A;  4IBE A;  1K82 A;  5DFL A;  2DWL A;  3KXE C;  3UZU A;  1OQY A;  3U6Q A;  4LCB A;  3SYK A;  2HAK A;  2CHV A;  3W67 A;  1YUB A;  5FTM A;  1OKS A;  3KFU G;  3SAW A;  1YE9 A;  5C1B A;  1L2C A;  1MU5 A;  2XF3 A;  1NO1 A;  4LZJ A;  2ZTC A;  4NRV A;  1BVS A;  3VKG A;  1PJS A;  4DR3 M;  3FUW A;  3T1H M;  2LWX A;  2MR9 A;  3GLF E;  3AJI B;  3GPP A;  1Y8G A;  5F3W A;  4AKI A;  2D7G A;  2R18 A;  1NV8 A;  2L7I A;  4OW0 A;  4IBK A;  4B7H A;  3AOE C;  3UMM A;  3J2P B;  3JR4 A;  1MJG M;  3SBJ A;  1KFV A;  2BNK A;  4DV0 M;  1IM2 A;  4R71 A;  3SAT A;  1N78 A;  2ZBK B;  4IBJ A;  4M9X A;  3TWM A;  1TDZ A;  1J09 A;  3DOA A;  2JNH A;  3D8L A;  4DV1 M;  3FTC A;  5DYG A;  1WR1 B;  2FOI C;  1Z59 A;  3RGS A;  1QZM A;  3L2A A;  5JI3 E;  2L6O A;  3CGW A;  2DEN A;  4L8R C;  3I4V A;  1ORY B;  1GAB A;  1TR8 A;  4GEW A;  1TGU A;  1HR0 M;  5DNY A;  4LF7 M;  3CF6 E;  2QQ8 A;  4FVM A;  2L4F A;  1Q3C A;  2E5L M;  3FRH A;  5ITQ A;  1J5E M;  2FNA A;  3GO8 A;  1Z5C A;  3L26 A;  4LZZ A;  2UUC M;  4XGI A;  1JQJ C;  1SG9 A;  2DXI A;  5L8R F;  3SAR A;  1IXR C;  4GHA A;  3GRY A;  4I81 A;  3GQ5 A;  4Y28 F;  2AHM A;  2R45 A;  4W5W A;  2BWE A;  4IBB A;  1R2Y A;  4S12 A;  4DV3 M;  2FH0 A;  4M0W A;  4MGI E;  2Z4S A;  3GLI A;  4DV5 M;  1S3S A;  3AV0 A;  3U6D A;  3MMP A;  4I5S A;  4LF9 M;  1HT2 E;  1L8Q A;  2DAI A;  3A98 B;  1P3Q Q;  5FTL A;  2KRU A;  2LVA A;  3KP0 E;  4MGK E;  3U6P A;  1OFI A;  3W0F A;  1I4W A;  2M5Z A;  4Z8X A;  3M6A A;  3LVV A;  1NSF A;  1IY1 A;  3I04 M;  1ZV1 A;  3QYB A;  2O01 F;  2R46 A;  2CE7 A;  2LVO C;  4D81 A;  2Z4R A;  5E26 A;  3FYD A;  4L6V 6;  4M9S A;  3GLH B;  4F2L A;  2KNA A;  5H37 D;  1GO5 A;  5EJC A;  2QCU A;  3LCU A;  3T6P A;  2KDL A;  4LF8 M;  5KO3 A;  4WW0 A;  1R5L A;  3KP1 E; 
#chains in the Genus database with same CATH homology
 2WSF F;  2WSC F;  4RKU F;  4XK8 F;  5L8R F;  3LW5 F;  4Y28 F;  2O01 F;  4L6V 6;  1JB0 F;  4KT0 F;  2WSE F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...