2WSCJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure Determination and Improved Model of Plant Photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wscJ00
2QIWA 2WSFJ 1JB0J 3C8VA 4H44B 4OGQB 4I7ZB 1Q90D 1VF5B 2E75B 2WSEJ 2ZT9B 1ZRTE 4IL6X 5L8RJ 4KT0J 2D2CB 4RKUJ 2E76B 2QJKC 2WPVB 2WSCJ 2QSIA 2QJPC 2K9YA 4H0LB 2YIUC 3LW5J 1S5LX 4H13B 5KLIC 4Y28J 2FYNC 5KKZC 2O01J 4PV1B 2QJYC 2E74B
chains in the Genus database with same CATH superfamily
1KQFB 1SP4A 3A7OA 3V2QA 1PP9E 5GTIE 1EDLA 1RY3A 3L71J 5AW3B 3JSVC 3GHGA 2PGDA 2XDJA 1J1DB 3MUDC 2Q1KA 1IO4A 1L0LJ 4TT3H 1SQVE 3C9IA 2NPSB 3U59A 2V4HA 4IL6E 3CXHE 2YIUB 1W2EA 3FGAD 2Q7CA 1DX7A 5TJHA 2Y0DA 3L75E 2B87B 1K04A 3AEEC 2Q3EA 2D2CC 1AV1A 2PFXA 3ITKA 3V2RA 1SQBG 1PZQA 2ZVOB 4PD4D 2WPRA 5BU5A 4UB8E 2WSFH 1KYOH 3PTZA 1P84I 5AVXB 1M56D 1S5LH 2QM8A 3H1LG 4EYYQ 1JTHB 1JOCA 4JYCA 3KDPB 2MJZA 1VF5C 1H0TB 3AE9C 4YPCA 4C7RA 2M8RA 1LTJC 2C9NY 1NTKE 2OYHC 1IK9A 1HBWA 1Y9BA 3H32B 2FYNC 3VMXA 3MGNA 3L72G 3C8VA 3MIWA 1IZNB 3M0DC 2AEFA 4XE5B 3ZDMA 1PFIA 1PGPA 5KAFE 2FBWC 2CK3H 2IYPA 2W90A 2KLVA 1JY2P 3WUUA 3AEDC 1GW4A 1LJ2A 3KZIH 1BE3E 2V7QJ 3B5NA 5GTIH 3CCUP 1YBKA 1SQXG 1URQD 2GA1A 3D70A 2FYUJ 3H1IE 1NJIQ 1FJPA 2XNDH 1SQXK 1DEEG 5C39A 2XV5A 1NU1D 2HLOA 2P7JA 3WUVA 3CCLP 1VQ8P 2K3RA 3CL3D 1YJWP 1M1JC 4DJGA 3MTUE 3CC4P 3HUSA 1LWUA 1FDOA 2CPSA 2BEZF 2QM7A 4IFMA 5K5GB 2I1JA 1FOSE 2NRGA 3LW5J 3L74G 1N73C 1FS0E 1J2JB 2KSJA 1RE3C 1FZEA 3HE4A 2C9LY 1XTCC 4I1LA 1SQQD 4I7ZC 1RQVA 2R3SA 4HKZH 3FXDA 2WTYA 3FWNA 1JY3O 5B66H 1GL2D 3H1KD 3L70E 1GMJA 3BCCD 1XTGB 2WPVB 1JCDA 1KD1Q 1X0TA 4JPZB 1L4AC 2B89A 3S9OA 2E5TA 3RL0C 3S4RA 1P84E 1PP9D 2XU6A 2R3CA 1JCCA 2WZ7A 1U7MA 1ZMEC 1SQPJ 2XZRA 2BCCD 1MFTA 3TGUJ 1NTZJ 2YXRB 2RN0A 2FXOA 3M06A 1QL2A 3II6A 1PIXA 2QIWA 2L91A 5E79H 4W7ZA 1MUUA 1EXJA 1RE4A 2MKVA 1ZXGA 1YIJP 3RGUA 3CCRP 3Q5RA 2N1TD 2ZVNB 4GOFA 1BCCJ 4NPDA 3OJAB 2E76B 5CHXA 3JC22 1SFCC 4ASWA 2Q3IA 4H0LC 4D6TG 3B5ND 3HRNA 1IK7A 1BGYG 4OGQB 1LTAC 4WBAA 2E76D 1KILA 1L0NK 1PGOA 1AJYA 2R5BA 1NTMK 3VP9A 1WT6A 3E1IA 4EI2A 2KXPB 5CCHA 1Q82Q 2E74B 4H44B 2OTJP 1HUCA 3AEGC 3L71E 1IFIA 3HUSB 1LWUB 3HD7D 3V6IA 1EDIA 2E74D 1NU1G 3EQ2A 2KSEA 5APTA 3G71P 3IR9A 4GIFA 1JEKA 2O01H 1MV8A 1EZVE 1J1DC 4XA4A 1L0LE 3HE4B 1IFDA 3P8MC 1KC8Q 1SQBJ 1VQ7P 5AW0B 2IX7C 1M1KQ 1KORA 3R4YA 1M8OB 2NPSC 1OW7A 1A02F 1T8ZA 1USDA 4DCKA 2IBZI 4NPFX 2YIUC 3KXDA 1VQOP 3M0AA 2K9JA 2FY8A 3QH9A 4DT0A 4IL6X 2UWJE 4BWNA 3MZWB 4HJGH 3FX0A 3BCCG 1T3JA 3CX5D 1L0NE 2QJPB 1VQ4P 3O6QA 2JDIH 2M3BA 1T3UA 3G9RA 1NTME 1PP9G 3L72J 1W5CE 3H1LD 3BASA 2E42A 1E5WA 2IYOA 1GDTA 3VMAA 1GU4A 1KYOE 3B4SA 3H25A 3I55P 3CCSP 2QRXA 1S5LE 5KJ7D 1SQVG 4DZOA 2LXCB 3RBXA 3BRTB 1HF9A 4U3FE 3CWBJ 2ZYGA 5KLVG 3L72D 1KILB 2ZYDA 3L75G 3W67A 1S3JA 4K3AA 2A06E 3H1JG 5KLVK 5APVA 2KS1A 1E79H 3MP7B 1GD2E 2O1JA 1G1JA 2JWDA 2KZJA 3N7NA 2QVAA 1Q90D 1P84D 5CCHD 2KNCA 3SFEC 3T97A 3FWLA 3OA7A 5AW6B 3L35A 1U57A 1SQXD 2H43A 2O3JA 1HGZA 1KB9E 1CZQA 1S2EA 1T2KD 3KZIE 3AECC 1CI6A 2OTLP 1W2BO 2YO3A 3L74J 5KAIH 1URQA 2YKQA 2DW3A 1NTKG 4WWIA 1QVGO 2WVRA 2ZT9D 4UB6H 1ZR2A 1S4XA 3B71A 1DD4A 2QJKB 4N6JA 2K9JB 1OWAA 2K37A 1NTKK 1LTTC 2NZ2A 3O8ZA 2W8ZA 3AE3C 2ZFCA 3NTNA 2OTKE 2J5UA 5CCGA 4GKGA 4LLHA 3TNUA 1VQPP 1DH3A 2IBZE 4ZMDA 1PPJG 3L74D 3O6QB 1Q81Q 2C0WA 1NKNA 1H89A 5KLVE 1BE3G 4ZKUA 3SWFA 1OW8A 2GUSA 4YTPC 1RF0A 1HGVA 3H1JE 4YXWH 3A0HH 2KLUA 1N86A 1K73Q 2YNYA 4B86A 3H1IG 1GL2A 1LTBC 1LTSC 1FDMA 3WUTA 3MUDA 3LIEA 1LTIC 5B66E 2J59M 5BU8B 1NTZE 3GW6A 2O1KA 1FAVA 3B8EB 3K5BA 1S1CX 4IFFA 5EFWB 3CCQP 1KFNA 1LTGC 2XKMA 2JWAA 1JY2O 1JY3N 3RK3B 5AW8B 3M9HA 1BGYJ 2KS1B 1FOSF 3D6YA 1AVYA 1DD3A 4R4LA 3RK3D 2L5GB 2WMMA 3L4FA 5AVYB 1BSNA 3P7KA 4KHXA 3VMZA 2RKLA 1MFZA 1BCCE 1HJBA 1JMMA 2KK7A 2V7QH 2R44A 1AFOA 3LIDA 1M57D 2KNCB 4I6MC 3T97B 1ZN5A 5E79E 3L70G 3OW2O 2E76C 1RHZB 5AVSB 2N1TA 1RF1B 4JQ0D 4D6TD 1NU1J 2W6AA 1PPJE 1CI6B 1KB9H 4OGQC 1BGYD 4IFDK 1OVRA 2WSEJ 1URQB 1LT1A 1QL1A 1FBMA 4RKUJ 3GHGB 3UIAA 2Z4EA 3EWKA 2AXCA 2YXQB 2E74C 3PJSK 3H1HE 4H44C 1N7SD 3HUSC 1LWUC 1HWTC 3PLNA 1NH4A 4L76A 3ABVC 1SQQJ 3VYIA 3LW5H 3TNUB 2KZIA 2PRRA 1EZVI 2HYNA 1BDDA 3SFDC 4MN4C 2IZ1A 3H1KJ 1TU3F 3HD7A 2FFDA 1FC2C 1X22A 4L73A 1ZR4A 3BCCJ 5CCGD 3FXEA 2AXTH 2Y0CA 2GM4A 1ZW0A 2B9BA 2OYOA 2YO2A 1PP9J 1QX8A 1GL2B 2BCCJ 3P8CE 5TISH 4PJ0H 4EDFA 1VQMP 3AE5C 3BRVB 1GK6A 4LGDE 1KQSO 4N78E 1S9KD 1GW3A 1SQVJ 2QJPC 3VOPA 1QLED 4XFJA 5AW7B 1R5LA 2OYIA 3L71G 4OVNF 3RL0g 2WPSA 5CBOA 2WSCH 3V4WA 1RE4C 5APYA 1EDKA 3L75J 1KILE 1YQ4C 1KYOI 1EZVG 3KHUA 2CPBA 1L0LG 4PV1B 1RE3A 4WB4A 1NAFA 1SLQA 4L74A 1NVOA 1WRGA 1ZLLA 1FU1A 3L73E 1OW6A 1NGMB 3CPWO 1SQVD 1L0LK 3GG2A 3RK2B 4PV1D 1Y8AA 3CWBE 3P32A 4OH8B 3NMDA 1K05A 2N1TB 2WSCJ 4WVZA 4A7PA 2QSIA 3CXHD 2ZXEB 1VPCA 1S5LX 3RK2D 5KJ7A 5KLVD 1KILC 2G8YA 3L75D 2N9BA 1G2CA 4RO0A 2M0BA 2OARA 1KQLA 3H1JD 3B5NB 1VF5D 1NWQA 1L0NG 4JYBA 5CCHC 3IFMA 4R4MA 4Y28J 4IOIH 2K1AA 2IFMA 1HH0A 1NTMG 2JO1A 1YI2P 1YYCA 1YJ9P 3Q5PA 4BXLA 2KI7B 2WITA 2J58A 1KB9I 3HD7B 2FFDB 5KKZB 1YTZI 2KYVA 2FKWB 2E75B 2ZXXA 5B5EH 2OQQA 1NTKD 1BE3J 3CCJP 1X9VA 2QJKC 2E75D 4U3FG 1NO4A 2YMYA 4RJTA 3HE5A 2R5DA 3NFQA 3WU2E 2HR3A 5KAIE 1J1EB 2M5AA 2XNXA 2A06G 2WQYC 3H1IJ 1LNQA 3TSIA 4UB6E 2YKOA 2WWWA 1PPJD 1FJKA 3H1LJ 1R5SA 2HODA 2OYIB 2IPPA 2FXMA 1JO5A 1BE3D 5APWA 2WPQA 2LKMA 1LT9A 1MZ9A 2E43A 1OZHA 2FYUG 3IN6A 1G1IA 3GF3A 1JM0A 3GLMA 2QA4P 3H1ID 2FYUK 1U7JA 3VN0A 1BDCA 5APQA 3A0HE 1AVOA 1PL5A 1QEXA 1FZCA 2QEXP 1BSHA 4AQRD 1EXIA 1X79B 2P10A 4H13B 3L70J 3A0BH 2ZAEB 3PP5A 3AE4C 2M3EA 3RK3C 4DOJA 1G2CB 1DEBA 1IFJA 4WY4A 3CC2P 4H13D 1ZOYC 1YTZT 5APSA 3RL0D 2IBZG 4W7YA 2FXPA 1YHQP 5AW9B 3P8CD 1SQXJ 5AVWB 3L70D 1RF1C 1YQ3C 3U1AA 3G4SP 2H89C 3CMEP 3VP8A 3G3ZA 1SQPG 1URQC 2I1KA 1VQKP 1M7LA 1VQNP 1NTZG 5H2FH 3AE8C 5CBNA 2JP3A 3GHGC 3CC7P 1SQPK 1R8EA 2FYUE 4Y99B 3H32A 1NTZK 3JCUE 4PD4H 1KMIZ 3IAOA 1IFPA 2SPZA 1IFMA 1SFCD 2ZT9B 2M5AB 3WU2H 3CCMP 4ASVA 4H0LD 2I8DA 5CCGC 3H1KE 3V2NA 3IF4A 3VTPC 1N7SA 4K35A 1GK4A 2HODB 1BCCG 2YKPA 1LT9B 1RF0C 1OVVA 1JNMA 2A45H 1VQ9P 1LP1A 2BCCE 1X8YA 1FZGA 3L37A 4GT1A 5AVZB 3QWOC 1GL2C 3GMAA 2AXTE 1EDJA 3EFGA 1NKZB 4C7NA 2Z5HA 5AVUB 4O9BA 5L8RJ 1FZCB 3Q5SA 3H6PA 3H1HG 2KUBA 2NPSD 5TISE 3OAKA 4PJ0E 2BEQD 3L71D 1SQPE 4WY4B 3TGUE 3Q3DA 5GTHE 2IZ0A 2H8PD 4I2LC 1SS1A 3R2PA 5M1BA 1KV4A 1Q86Q 4WY4D 1EZVD 2Q5UA 4PV1C 1L0LD 2QJYB 5APUA 1SQBK 1L0NJ 1VQ5P 3AEFC 2N9YB 1KN7A 3RK2C 3PH0A 4D6TJ 3TF5A 1NTMJ 1RH5B 5AW4B 1FZFA 2N1TC 3CLQA 3V2PA 2POHA 4JF7A 5KLIB 2ITAA 2WSEH 4M3LA 2WSFJ 2RMZA 3TK1A 3AE7C 3CD6P 3I56P 3B5NC 2Q9IA 1HTLC 4JBZA 1L0ND 1FE6A 3JCUH 2YMKA 1NAYA 2Y9YA 1NTMD 4U3FJ 3BATA 1UIIA 2B88A 5AVTB 3I5CA 4C46A 4CPGA 2P67A 1ZP0C 1LTJA 1N7SB 3U1CA 1IJDB 2Z5IA 1KYOD 3HD7C 2OYHA 1LGHB 2FFDC 5KKZC 1Q2NA 4GOEA 4ZKPA 1A02J 3L73G 1OXZA 2E75C 5BVZA 2Q6QA 1ZRTE 4N3YB 3M0DA 3CWBG 1N7LA 1LP1B 2W27A 2G3AA 4PD4I 1SQBE 1GU5A 1JMBA 3Q2YA 4U3FD 3CX5E 3L36A 1WMKA 1J1EC 4C7NB 3KQGA 3GF7A 5B5EE 1VL2A 2A06D 4OWFA 2JJLA 3H1LE 2P1JA 1KFMA 4ZNCA 1GZLA 1L2PA 2JR8A 2W6BA 4IL6H 3CXHH 1NYHA 1OX3A 2OYIC 1NHLA 2W6JH 2KOGA 5AW1B 2A45I 5AW5B 2H88C 3D71A 1OIPA 5KTBA 4HB1A 5GTHH 2FYUD 2WT7A 1PGJA 1KB9D 3CI9A 2OGUA 4UB8H 3L72E 1M1JA 1K8AQ 3D6ZA 2RH0A 2C0XA 3F89A 3AE1C 5KLVJ 3W68A 2QE7H 2QG4A 3CMAP 1NOHA 3KYQA 2D2CB 2JEEA 5KJ7C 4H13C 3AEAC 3H1JJ 1VDFA 3E1RA 3SWYA 2K88A 1N73A 2BASA 5AVRB 1OVUA 1QGKB 2D2CD 2FYZA 2ZYAA 3CCEP 3M91A 5DJTB 4HYTB 4NPEA 5AW2B 4EOTA 1SQXE 2Y0EA 2IBZD 3A0BE 4L75A 3HTKA 1JY3P 3USSA 4RESB 3TYYA 1N2DC 1SVFA 2A45G 4W80A 1VF5B 1L4AA 5AVVB 3MD0A 1RQUA 2R32A 1AQ5A 4BRYA 4AYCA 1LTJB 2HFED 5KAFH 1K9MQ 4GODA 5CMZA 2OYHB 1NTKJ 2FYNB 1M90Q 4U7JA 3CCVP 1SQPD 4AUWA 3S1KA 3SSUA 4Z1MH 3NXSA 4GDOA 3V4QA 3TGUD 1QVFO 1NTZD 1T2KC 2KIKA 3RBZA 3F5HA 1KZUB 1PGQA 4YXDC 4EIJA 4Y99C 3L74E 3PHLA 2P58A 3CX5H 2AEMA 2ZT9C 1VQ6P 3N4XA 3VMYA 3C1LA 1Y47A 5H2FE 4OGQD 1AQTA 1KQGB 4PD4E 1SFCA 1S72P 1KTMA 1FDIA 1BCCD 1Q7YQ 1LT9C 1HVVA 3H1HJ 4KJMA 4H44D 4KT0J 5APXA 1VQLP 2WT7B 5CJ4A 1GTWA 2AEJA 2HPCA 1AA0A 1PV3A 1NU1K 1OFCX 1M1JB 1T6AA 1UIXA 3AE2C 2W83C 1FZCC 3CXHI 2LR2A 3M9BA 1DIPA 2E5YA 2K9YA 2WSSH 3RK3E 2PP6A 2O01J 1N73B 3H1HD 1USEA 1SQQG 1Z56A 2ZJSE 1HJ0A 4I7ZB 3KPEA 4WY4C 1ZRTD 2P2UA 3E7KA 1CW5A 1CSBA 3MHVA 1P84H 3Q1MA 3H1KG 1EQ7A 1YJNP 1SQQK 2PAJA 3BVHA 2GUVA 2NPSA 1SQBD 5CJ0A 1N8RQ 3HTKB 4D6TE 1D7MA 2QJYC 1BGYE 2IFNA 1L4AB 1EC5A 2Y9ZA 3RL0B 2B87A 3A5TA 4BRYB 3EFFK 4HH2A 2BCCG 1ZV8A 1L4AD 3AE6C 2IDBA 3AEBC 3A3YB 5KLIC 5AVQB 2O01N 2H7HA 3A2AA 1JB0J 5DJUB 1FZBA 2LXBA 1JUNA 1OMIA 4QMAA 3V5BA 3L73J 3WMM0 4N78D 1NU1E 1JTHA 3M9QA 1FZAA 1SQVK 3TDKA 1JY2N 1H0TA 3G6EP 1MKMA 3TGUG 1N7SC 1KILD 1SFCB 4H0LB 3SWKA 3HE5B 3PRJA 2KP8A 1SQQE 3L73D 2JKVA 2HG5D 1IFNA 3CWBD 1YITP 2VRSA 4TLFA 1IC2A 4LC1A 1S9KE 3BCCE 1H8AA 3CX5I 1RF1A 2HPCB 2KB7P 1H88A
chains in the Genus database with same CATH topology
2YMKA 1KQFB 3D6ZA 1VF5C 1Q90D 2ZT9C 1OW6A 1NGMB 3AE9C 4IL6X 1FDOA 3AE1C 3ABVC 2BEZF 2WQYC 4PV1D 3SFEC 5L8RJ 1S1CX 1ZP0C 1K05A 4OGQD 3Q5SA 1KQGB 2D2CB 2E76B 1YQ3C 2WSCJ 4H44C 1U57A 2QSIA 4H13C 1Y9BA 3AE6C 2IDBA 3LW5J 1S5LX 3AEBC 3AEAC 3SFDC 5KLIC 2FYNC 5KKZC 3O6QA 4H0LC 1TU3F 2H89C 1KTMA 1IK7A 3AECC 4I7ZC 1JB0J 3C8VA 1FDIA 1RQVA 3G9RA 4OGQB 2BEQD 2D2CD 2E75C 2E76D 2G8YA 1ZRTE 4TT3H 1AJYA 1OMIA 3Q3DA 2FBWC 3AE8C 2JP3A 4H44D 3D6YA 1GMJA 1DD3A 4KT0J 2G3AA 3IN6A 2WPVB 1VF5D 2ZT9D 1R8EA 3B71A 4R4LA 1DD4A 5M1BA 3Q2YA 4R4MA 3GF3A 4PV1C 3AEDC 4Y28J 1WMKA 3GLMA 1KMIZ 3H25A 3IAOA 1PV3A 2E74B 3FGAD 4H44B 2JO1A 3AEGC 3S9OA 2NZ2A 3AEFC 1VF5B 2ZT9B 3GF7A 3AE5C 1MKMA 1VL2A 1RQUA 1UIXA 3AE3C 3T97B 3Q5PA 1K04A 4H0LD 3AEEC 3AE2C 1ZMEC 2V7QJ 2J5UA 2E74D 2D2CC 2E76C 1PL5A 1EXIA 1HF9A 1DIPA 2K9YA 2QJPC 2P10A 3RK3E 4H13B 1NYHA 2O01J 1PIXA 4H0LB 4XFJA 3AE4C 4OGQC 2QIWA 3D70A 2WSFJ 4U7JA 1HJ0A 4I7ZB 3GMAA 3AE7C 2H88C 2E75B 2WSEJ 4Z1MH 3RL0g 4GDOA 3D71A 1KORA 4H13D 1ZOYC 2OQQA 1OW8A 3R4YA 4YTPC 3Q1MA 1OW7A 4YXDC 1KILE 1YQ4C 1EXJA 4RKUJ 2QJKC 2E75D 2MKVA 2YIUC 2FXPA 3EWKA 4PV1B 2E74C 2QJYC 3Q5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIW A;  2WSF J;  1JB0 J;  3C8V A;  4H44 B;  4OGQ B;  4I7Z B;  1Q90 D;  1VF5 B;  2E75 B;  2WSE J;  2ZT9 B;  1ZRT E;  4IL6 X;  5L8R J;  4KT0 J;  2D2C B;  4RKU J;  2E76 B;  2QJK C;  2WPV B;  2WSC J;  2QSI A;  2QJP C;  2K9Y A;  4H0L B;  2YIU C;  3LW5 J;  1S5L X;  4H13 B;  5KLI C;  4Y28 J;  2FYN C;  5KKZ C;  2O01 J;  4PV1 B;  2QJY C;  2E74 B; 
#chains in the Genus database with same CATH topology
 1KQF B;  1SP4 A;  3A7O A;  3V2Q A;  1PP9 E;  5GTI E;  1EDL A;  1RY3 A;  3L71 J;  5AW3 B;  3JSV C;  3GHG A;  2PGD A;  2XDJ A;  1J1D B;  3MUD C;  2Q1K A;  1IO4 A;  1L0L J;  4TT3 H;  1SQV E;  3C9I A;  2NPS B;  3U59 A;  2V4H A;  4IL6 E;  3CXH E;  2YIU B;  1W2E A;  3FGA D;  2Q7C A;  1DX7 A;  5TJH A;  2Y0D A;  3L75 E;  2B87 B;  1K04 A;  3AEE C;  2Q3E A;  2D2C C;  1AV1 A;  2PFX A;  3ITK A;  3V2R A;  1SQB G;  1PZQ A;  2ZVO B;  4PD4 D;  2WPR A;  5BU5 A;  4UB8 E;  2WSF H;  1KYO H;  3PTZ A;  1P84 I;  5AVX B;  1M56 D;  1S5L H;  2QM8 A;  3H1L G;  4EYY Q;  1JTH B;  1JOC A;  4JYC A;  3KDP B;  2MJZ A;  1VF5 C;  1H0T B;  3AE9 C;  4YPC A;  4C7R A;  2M8R A;  1LTJ C;  2C9N Y;  1NTK E;  2OYH C;  1IK9 A;  1HBW A;  1Y9B A;  3H32 B;  2FYN C;  3VMX A;  3MGN A;  3L72 G;  3C8V A;  3MIW A;  1IZN B;  3M0D C;  2AEF A;  4XE5 B;  3ZDM A;  1PFI A;  1PGP A;  5KAF E;  2FBW C;  2CK3 H;  2IYP A;  2W90 A;  2KLV A;  1JY2 P;  3WUU A;  3AED C;  1GW4 A;  1LJ2 A;  3KZI H;  1BE3 E;  2V7Q J;  3B5N A;  5GTI H;  3CCU P;  1YBK A;  1SQX G;  1URQ D;  2GA1 A;  3D70 A;  2FYU J;  3H1I E;  1NJI Q;  1FJP A;  2XND H;  1SQX K;  1DEE G;  5C39 A;  2XV5 A;  1NU1 D;  2HLO A;  2P7J A;  3WUV A;  3CCL P;  1VQ8 P;  2K3R A;  3CL3 D;  1YJW P;  1M1J C;  4DJG A;  3MTU E;  3CC4 P;  3HUS A;  1LWU A;  1FDO A;  2CPS A;  2BEZ F;  2QM7 A;  4IFM A;  5K5G B;  2I1J A;  1FOS E;  2NRG A;  3LW5 J;  3L74 G;  1N73 C;  1FS0 E;  1J2J B;  2KSJ A;  1RE3 C;  1FZE A;  3HE4 A;  2C9L Y;  1XTC C;  4I1L A;  1SQQ D;  4I7Z C;  1RQV A;  2R3S A;  4HKZ H;  3FXD A;  2WTY A;  3FWN A;  1JY3 O;  5B66 H;  1GL2 D;  3H1K D;  3L70 E;  1GMJ A;  3BCC D;  1XTG B;  2WPV B;  1JCD A;  1KD1 Q;  1X0T A;  4JPZ B;  1L4A C;  2B89 A;  3S9O A;  2E5T A;  3RL0 C;  3S4R A;  1P84 E;  1PP9 D;  2XU6 A;  2R3C A;  1JCC A;  2WZ7 A;  1U7M A;  1ZME C;  1SQP J;  2XZR A;  2BCC D;  1MFT A;  3TGU J;  1NTZ J;  2YXR B;  2RN0 A;  2FXO A;  3M06 A;  1QL2 A;  3II6 A;  1PIX A;  2QIW A;  2L91 A;  5E79 H;  4W7Z A;  1MUU A;  1EXJ A;  1RE4 A;  2MKV A;  1ZXG A;  1YIJ P;  3RGU A;  3CCR P;  3Q5R A;  2N1T D;  2ZVN B;  4GOF A;  1BCC J;  4NPD A;  3OJA B;  2E76 B;  5CHX A;  3JC2 2;  1SFC C;  4ASW A;  2Q3I A;  4H0L C;  4D6T G;  3B5N D;  3HRN A;  1IK7 A;  1BGY G;  4OGQ B;  1LTA C;  4WBA A;  2E76 D;  1KIL A;  1L0N K;  1PGO A;  1AJY A;  2R5B A;  1NTM K;  3VP9 A;  1WT6 A;  3E1I A;  4EI2 A;  2KXP B;  5CCH A;  1Q82 Q;  2E74 B;  4H44 B;  2OTJ P;  1HUC A;  3AEG C;  3L71 E;  1IFI A;  3HUS B;  1LWU B;  3HD7 D;  3V6I A;  1EDI A;  2E74 D;  1NU1 G;  3EQ2 A;  2KSE A;  5APT A;  3G71 P;  3IR9 A;  4GIF A;  1JEK A;  2O01 H;  1MV8 A;  1EZV E;  1J1D C;  4XA4 A;  1L0L E;  3HE4 B;  1IFD A;  3P8M C;  1KC8 Q;  1SQB J;  1VQ7 P;  5AW0 B;  2IX7 C;  1M1K Q;  1KOR A;  3R4Y A;  1M8O B;  2NPS C;  1OW7 A;  1A02 F;  1T8Z A;  1USD A;  4DCK A;  2IBZ I;  4NPF X;  2YIU C;  3KXD A;  1VQO P;  3M0A A;  2K9J A;  2FY8 A;  3QH9 A;  4DT0 A;  4IL6 X;  2UWJ E;  4BWN A;  3MZW B;  4HJG H;  3FX0 A;  3BCC G;  1T3J A;  3CX5 D;  1L0N E;  2QJP B;  1VQ4 P;  3O6Q A;  2JDI H;  2M3B A;  1T3U A;  3G9R A;  1NTM E;  1PP9 G;  3L72 J;  1W5C E;  3H1L D;  3BAS A;  2E42 A;  1E5W A;  2IYO A;  1GDT A;  3VMA A;  1GU4 A;  1KYO E;  3B4S A;  3H25 A;  3I55 P;  3CCS P;  2QRX A;  1S5L E;  5KJ7 D;  1SQV G;  4DZO A;  2LXC B;  3RBX A;  3BRT B;  1HF9 A;  4U3F E;  3CWB J;  2ZYG A;  5KLV G;  3L72 D;  1KIL B;  2ZYD A;  3L75 G;  3W67 A;  1S3J A;  4K3A A;  2A06 E;  3H1J G;  5KLV K;  5APV A;  2KS1 A;  1E79 H;  3MP7 B;  1GD2 E;  2O1J A;  1G1J A;  2JWD A;  2KZJ A;  3N7N A;  2QVA A;  1Q90 D;  1P84 D;  5CCH D;  2KNC A;  3SFE C;  3T97 A;  3FWL A;  3OA7 A;  5AW6 B;  3L35 A;  1U57 A;  1SQX D;  2H43 A;  2O3J A;  1HGZ A;  1KB9 E;  1CZQ A;  1S2E A;  1T2K D;  3KZI E;  3AEC C;  1CI6 A;  2OTL P;  1W2B O;  2YO3 A;  3L74 J;  5KAI H;  1URQ A;  2YKQ A;  2DW3 A;  1NTK G;  4WWI A;  1QVG O;  2WVR A;  2ZT9 D;  4UB6 H;  1ZR2 A;  1S4X A;  3B71 A;  1DD4 A;  2QJK B;  4N6J A;  2K9J B;  1OWA A;  2K37 A;  1NTK K;  1LTT C;  2NZ2 A;  3O8Z A;  2W8Z A;  3AE3 C;  2ZFC A;  3NTN A;  2OTK E;  2J5U A;  5CCG A;  4GKG A;  4LLH A;  3TNU A;  1VQP P;  1DH3 A;  2IBZ E;  4ZMD A;  1PPJ G;  3L74 D;  3O6Q B;  1Q81 Q;  2C0W A;  1NKN A;  1H89 A;  5KLV E;  1BE3 G;  4ZKU A;  3SWF A;  1OW8 A;  2GUS A;  4YTP C;  1RF0 A;  1HGV A;  3H1J E;  4YXW H;  3A0H H;  2KLU A;  1N86 A;  1K73 Q;  2YNY A;  4B86 A;  3H1I G;  1GL2 A;  1LTB C;  1LTS C;  1FDM A;  3WUT A;  3MUD A;  3LIE A;  1LTI C;  5B66 E;  2J59 M;  5BU8 B;  1NTZ E;  3GW6 A;  2O1K A;  1FAV A;  3B8E B;  3K5B A;  1S1C X;  4IFF A;  5EFW B;  3CCQ P;  1KFN A;  1LTG C;  2XKM A;  2JWA A;  1JY2 O;  1JY3 N;  3RK3 B;  5AW8 B;  3M9H A;  1BGY J;  2KS1 B;  1FOS F;  3D6Y A;  1AVY A;  1DD3 A;  4R4L A;  3RK3 D;  2L5G B;  2WMM A;  3L4F A;  5AVY B;  1BSN A;  3P7K A;  4KHX A;  3VMZ A;  2RKL A;  1MFZ A;  1BCC E;  1HJB A;  1JMM A;  2KK7 A;  2V7Q H;  2R44 A;  1AFO A;  3LID A;  1M57 D;  2KNC B;  4I6M C;  3T97 B;  1ZN5 A;  5E79 E;  3L70 G;  3OW2 O;  2E76 C;  1RHZ B;  5AVS B;  2N1T A;  1RF1 B;  4JQ0 D;  4D6T D;  1NU1 J;  2W6A A;  1PPJ E;  1CI6 B;  1KB9 H;  4OGQ C;  1BGY D;  4IFD K;  1OVR A;  2WSE J;  1URQ B;  1LT1 A;  1QL1 A;  1FBM A;  4RKU J;  3GHG B;  3UIA A;  2Z4E A;  3EWK A;  2AXC A;  2YXQ B;  2E74 C;  3PJS K;  3H1H E;  4H44 C;  1N7S D;  3HUS C;  1LWU C;  1HWT C;  3PLN A;  1NH4 A;  4L76 A;  3ABV C;  1SQQ J;  3VYI A;  3LW5 H;  3TNU B;  2KZI A;  2PRR A;  1EZV I;  2HYN A;  1BDD A;  3SFD C;  4MN4 C;  2IZ1 A;  3H1K J;  1TU3 F;  3HD7 A;  2FFD A;  1FC2 C;  1X22 A;  4L73 A;  1ZR4 A;  3BCC J;  5CCG D;  3FXE A;  2AXT H;  2Y0C A;  2GM4 A;  1ZW0 A;  2B9B A;  2OYO A;  2YO2 A;  1PP9 J;  1QX8 A;  1GL2 B;  2BCC J;  3P8C E;  5TIS H;  4PJ0 H;  4EDF A;  1VQM P;  3AE5 C;  3BRV B;  1GK6 A;  4LGD E;  1KQS O;  4N78 E;  1S9K D;  1GW3 A;  1SQV J;  2QJP C;  3VOP A;  1QLE D;  4XFJ A;  5AW7 B;  1R5L A;  2OYI A;  3L71 G;  4OVN F;  3RL0 g;  2WPS A;  5CBO A;  2WSC H;  3V4W A;  1RE4 C;  5APY A;  1EDK A;  3L75 J;  1KIL E;  1YQ4 C;  1KYO I;  1EZV G;  3KHU A;  2CPB A;  1L0L G;  4PV1 B;  1RE3 A;  4WB4 A;  1NAF A;  1SLQ A;  4L74 A;  1NVO A;  1WRG A;  1ZLL A;  1FU1 A;  3L73 E;  1OW6 A;  1NGM B;  3CPW O;  1SQV D;  1L0L K;  3GG2 A;  3RK2 B;  4PV1 D;  1Y8A A;  3CWB E;  3P32 A;  4OH8 B;  3NMD A;  1K05 A;  2N1T B;  2WSC J;  4WVZ A;  4A7P A;  2QSI A;  3CXH D;  2ZXE B;  1VPC A;  1S5L X;  3RK2 D;  5KJ7 A;  5KLV D;  1KIL C;  2G8Y A;  3L75 D;  2N9B A;  1G2C A;  4RO0 A;  2M0B A;  2OAR A;  1KQL A;  3H1J D;  3B5N B;  1VF5 D;  1NWQ A;  1L0N G;  4JYB A;  5CCH C;  3IFM A;  4R4M A;  4Y28 J;  4IOI H;  2K1A A;  2IFM A;  1HH0 A;  1NTM G;  2JO1 A;  1YI2 P;  1YYC A;  1YJ9 P;  3Q5P A;  4BXL A;  2KI7 B;  2WIT A;  2J58 A;  1KB9 I;  3HD7 B;  2FFD B;  5KKZ B;  1YTZ I;  2KYV A;  2FKW B;  2E75 B;  2ZXX A;  5B5E H;  2OQQ A;  1NTK D;  1BE3 J;  3CCJ P;  1X9V A;  2QJK C;  2E75 D;  4U3F G;  1NO4 A;  2YMY A;  4RJT A;  3HE5 A;  2R5D A;  3NFQ A;  3WU2 E;  2HR3 A;  5KAI E;  1J1E B;  2M5A A;  2XNX A;  2A06 G;  2WQY C;  3H1I J;  1LNQ A;  3TSI A;  4UB6 E;  2YKO A;  2WWW A;  1PPJ D;  1FJK A;  3H1L J;  1R5S A;  2HOD A;  2OYI B;  2IPP A;  2FXM A;  1JO5 A;  1BE3 D;  5APW A;  2WPQ A;  2LKM A;  1LT9 A;  1MZ9 A;  2E43 A;  1OZH A;  2FYU G;  3IN6 A;  1G1I A;  3GF3 A;  1JM0 A;  3GLM A;  2QA4 P;  3H1I D;  2FYU K;  1U7J A;  3VN0 A;  1BDC A;  5APQ A;  3A0H E;  1AVO A;  1PL5 A;  1QEX A;  1FZC A;  2QEX P;  1BSH A;  4AQR D;  1EXI A;  1X79 B;  2P10 A;  4H13 B;  3L70 J;  3A0B H;  2ZAE B;  3PP5 A;  3AE4 C;  2M3E A;  3RK3 C;  4DOJ A;  1G2C B;  1DEB A;  1IFJ A;  4WY4 A;  3CC2 P;  4H13 D;  1ZOY C;  1YTZ T;  5APS A;  3RL0 D;  2IBZ G;  4W7Y A;  2FXP A;  1YHQ P;  5AW9 B;  3P8C D;  1SQX J;  5AVW B;  3L70 D;  1RF1 C;  1YQ3 C;  3U1A A;  3G4S P;  2H89 C;  3CME P;  3VP8 A;  3G3Z A;  1SQP G;  1URQ C;  2I1K A;  1VQK P;  1M7L A;  1VQN P;  1NTZ G;  5H2F H;  3AE8 C;  5CBN A;  2JP3 A;  3GHG C;  3CC7 P;  1SQP K;  1R8E A;  2FYU E;  4Y99 B;  3H32 A;  1NTZ K;  3JCU E;  4PD4 H;  1KMI Z;  3IAO A;  1IFP A;  2SPZ A;  1IFM A;  1SFC D;  2ZT9 B;  2M5A B;  3WU2 H;  3CCM P;  4ASV A;  4H0L D;  2I8D A;  5CCG C;  3H1K E;  3V2N A;  3IF4 A;  3VTP C;  1N7S A;  4K35 A;  1GK4 A;  2HOD B;  1BCC G;  2YKP A;  1LT9 B;  1RF0 C;  1OVV A;  1JNM A;  2A45 H;  1VQ9 P;  1LP1 A;  2BCC E;  1X8Y A;  1FZG A;  3L37 A;  4GT1 A;  5AVZ B;  3QWO C;  1GL2 C;  3GMA A;  2AXT E;  1EDJ A;  3EFG A;  1NKZ B;  4C7N A;  2Z5H A;  5AVU B;  4O9B A;  5L8R J;  1FZC B;  3Q5S A;  3H6P A;  3H1H G;  2KUB A;  2NPS D;  5TIS E;  3OAK A;  4PJ0 E;  2BEQ D;  3L71 D;  1SQP E;  4WY4 B;  3TGU E;  3Q3D A;  5GTH E;  2IZ0 A;  2H8P D;  4I2L C;  1SS1 A;  3R2P A;  5M1B A;  1KV4 A;  1Q86 Q;  4WY4 D;  1EZV D;  2Q5U A;  4PV1 C;  1L0L D;  2QJY B;  5APU A;  1SQB K;  1L0N J;  1VQ5 P;  3AEF C;  2N9Y B;  1KN7 A;  3RK2 C;  3PH0 A;  4D6T J;  3TF5 A;  1NTM J;  1RH5 B;  5AW4 B;  1FZF A;  2N1T C;  3CLQ A;  3V2P A;  2POH A;  4JF7 A;  5KLI B;  2ITA A;  2WSE H;  4M3L A;  2WSF J;  2RMZ A;  3TK1 A;  3AE7 C;  3CD6 P;  3I56 P;  3B5N C;  2Q9I A;  1HTL C;  4JBZ A;  1L0N D;  1FE6 A;  3JCU H;  2YMK A;  1NAY A;  2Y9Y A;  1NTM D;  4U3F J;  3BAT A;  1UII A;  2B88 A;  5AVT B;  3I5C A;  4C46 A;  4CPG A;  2P67 A;  1ZP0 C;  1LTJ A;  1N7S B;  3U1C A;  1IJD B;  2Z5I A;  1KYO D;  3HD7 C;  2OYH A;  1LGH B;  2FFD C;  5KKZ C;  1Q2N A;  4GOE A;  4ZKP A;  1A02 J;  3L73 G;  1OXZ A;  2E75 C;  5BVZ A;  2Q6Q A;  1ZRT E;  4N3Y B;  3M0D A;  3CWB G;  1N7L A;  1LP1 B;  2W27 A;  2G3A A;  4PD4 I;  1SQB E;  1GU5 A;  1JMB A;  3Q2Y A;  4U3F D;  3CX5 E;  3L36 A;  1WMK A;  1J1E C;  4C7N B;  3KQG A;  3GF7 A;  5B5E E;  1VL2 A;  2A06 D;  4OWF A;  2JJL A;  3H1L E;  2P1J A;  1KFM A;  4ZNC A;  1GZL A;  1L2P A;  2JR8 A;  2W6B A;  4IL6 H;  3CXH H;  1NYH A;  1OX3 A;  2OYI C;  1NHL A;  2W6J H;  2KOG A;  5AW1 B;  2A45 I;  5AW5 B;  2H88 C;  3D71 A;  1OIP A;  5KTB A;  4HB1 A;  5GTH H;  2FYU D;  2WT7 A;  1PGJ A;  1KB9 D;  3CI9 A;  2OGU A;  4UB8 H;  3L72 E;  1M1J A;  1K8A Q;  3D6Z A;  2RH0 A;  2C0X A;  3F89 A;  3AE1 C;  5KLV J;  3W68 A;  2QE7 H;  2QG4 A;  3CMA P;  1NOH A;  3KYQ A;  2D2C B;  2JEE A;  5KJ7 C;  4H13 C;  3AEA C;  3H1J J;  1VDF A;  3E1R A;  3SWY A;  2K88 A;  1N73 A;  2BAS A;  5AVR B;  1OVU A;  1QGK B;  2D2C D;  2FYZ A;  2ZYA A;  3CCE P;  3M91 A;  5DJT B;  4HYT B;  4NPE A;  5AW2 B;  4EOT A;  1SQX E;  2Y0E A;  2IBZ D;  3A0B E;  4L75 A;  3HTK A;  1JY3 P;  3USS A;  4RES B;  3TYY A;  1N2D C;  1SVF A;  2A45 G;  4W80 A;  1VF5 B;  1L4A A;  5AVV B;  3MD0 A;  1RQU A;  2R32 A;  1AQ5 A;  4BRY A;  4AYC A;  1LTJ B;  2HFE D;  5KAF H;  1K9M Q;  4GOD A;  5CMZ A;  2OYH B;  1NTK J;  2FYN B;  1M90 Q;  4U7J A;  3CCV P;  1SQP D;  4AUW A;  3S1K A;  3SSU A;  4Z1M H;  3NXS A;  4GDO A;  3V4Q A;  3TGU D;  1QVF O;  1NTZ D;  1T2K C;  2KIK A;  3RBZ A;  3F5H A;  1KZU B;  1PGQ A;  4YXD C;  4EIJ A;  4Y99 C;  3L74 E;  3PHL A;  2P58 A;  3CX5 H;  2AEM A;  2ZT9 C;  1VQ6 P;  3N4X A;  3VMY A;  3C1L A;  1Y47 A;  5H2F E;  4OGQ D;  1AQT A;  1KQG B;  4PD4 E;  1SFC A;  1S72 P;  1KTM A;  1FDI A;  1BCC D;  1Q7Y Q;  1LT9 C;  1HVV A;  3H1H J;  4KJM A;  4H44 D;  4KT0 J;  5APX A;  1VQL P;  2WT7 B;  5CJ4 A;  1GTW A;  2AEJ A;  2HPC A;  1AA0 A;  1PV3 A;  1NU1 K;  1OFC X;  1M1J B;  1T6A A;  1UIX A;  3AE2 C;  2W83 C;  1FZC C;  3CXH I;  2LR2 A;  3M9B A;  1DIP A;  2E5Y A;  2K9Y A;  2WSS H;  3RK3 E;  2PP6 A;  2O01 J;  1N73 B;  3H1H D;  1USE A;  1SQQ G;  1Z56 A;  2ZJS E;  1HJ0 A;  4I7Z B;  3KPE A;  4WY4 C;  1ZRT D;  2P2U A;  3E7K A;  1CW5 A;  1CSB A;  3MHV A;  1P84 H;  3Q1M A;  3H1K G;  1EQ7 A;  1YJN P;  1SQQ K;  2PAJ A;  3BVH A;  2GUV A;  2NPS A;  1SQB D;  5CJ0 A;  1N8R Q;  3HTK B;  4D6T E;  1D7M A;  2QJY C;  1BGY E;  2IFN A;  1L4A B;  1EC5 A;  2Y9Z A;  3RL0 B;  2B87 A;  3A5T A;  4BRY B;  3EFF K;  4HH2 A;  2BCC G;  1ZV8 A;  1L4A D;  3AE6 C;  2IDB A;  3AEB C;  3A3Y B;  5KLI C;  5AVQ B;  2O01 N;  2H7H A;  3A2A A;  1JB0 J;  5DJU B;  1FZB A;  2LXB A;  1JUN A;  1OMI A;  4QMA A;  3V5B A;  3L73 J;  3WMM 0;  4N78 D;  1NU1 E;  1JTH A;  3M9Q A;  1FZA A;  1SQV K;  3TDK A;  1JY2 N;  1H0T A;  3G6E P;  1MKM A;  3TGU G;  1N7S C;  1KIL D;  1SFC B;  4H0L B;  3SWK A;  3HE5 B;  3PRJ A;  2KP8 A;  1SQQ E;  3L73 D;  2JKV A;  2HG5 D;  1IFN A;  3CWB D;  1YIT P;  2VRS A;  4TLF A;  1IC2 A;  4LC1 A;  1S9K E;  3BCC E;  1H8A A;  3CX5 I;  1RF1 A;  2HPC B;  2KB7 P;  1H88 A; 
#chains in the Genus database with same CATH homology
 2YMK A;  1KQF B;  3D6Z A;  1VF5 C;  1Q90 D;  2ZT9 C;  1OW6 A;  1NGM B;  3AE9 C;  4IL6 X;  1FDO A;  3AE1 C;  3ABV C;  2BEZ F;  2WQY C;  4PV1 D;  3SFE C;  5L8R J;  1S1C X;  1ZP0 C;  1K05 A;  4OGQ D;  3Q5S A;  1KQG B;  2D2C B;  2E76 B;  1YQ3 C;  2WSC J;  4H44 C;  1U57 A;  2QSI A;  4H13 C;  1Y9B A;  3AE6 C;  2IDB A;  3LW5 J;  1S5L X;  3AEB C;  3AEA C;  3SFD C;  5KLI C;  2FYN C;  5KKZ C;  3O6Q A;  4H0L C;  1TU3 F;  2H89 C;  1KTM A;  1IK7 A;  3AEC C;  4I7Z C;  1JB0 J;  3C8V A;  1FDI A;  1RQV A;  3G9R A;  4OGQ B;  2BEQ D;  2D2C D;  2E75 C;  2E76 D;  2G8Y A;  1ZRT E;  4TT3 H;  1AJY A;  1OMI A;  3Q3D A;  2FBW C;  3AE8 C;  2JP3 A;  4H44 D;  3D6Y A;  1GMJ A;  1DD3 A;  4KT0 J;  2G3A A;  3IN6 A;  2WPV B;  1VF5 D;  2ZT9 D;  1R8E A;  3B71 A;  4R4L A;  1DD4 A;  5M1B A;  3Q2Y A;  4R4M A;  3GF3 A;  4PV1 C;  3AED C;  4Y28 J;  1WMK A;  3GLM A;  1KMI Z;  3H25 A;  3IAO A;  1PV3 A;  2E74 B;  3FGA D;  4H44 B;  2JO1 A;  3AEG C;  3S9O A;  2NZ2 A;  3AEF C;  1VF5 B;  2ZT9 B;  3GF7 A;  3AE5 C;  1MKM A;  1VL2 A;  1RQU A;  1UIX A;  3AE3 C;  3T97 B;  3Q5P A;  1K04 A;  4H0L D;  3AEE C;  3AE2 C;  1ZME C;  2V7Q J;  2J5U A;  2E74 D;  2D2C C;  2E76 C;  1PL5 A;  1EXI A;  1HF9 A;  1DIP A;  2K9Y A;  2QJP C;  2P10 A;  3RK3 E;  4H13 B;  1NYH A;  2O01 J;  1PIX A;  4H0L B;  4XFJ A;  3AE4 C;  4OGQ C;  2QIW A;  3D70 A;  2WSF J;  4U7J A;  1HJ0 A;  4I7Z B;  3GMA A;  3AE7 C;  2H88 C;  2E75 B;  2WSE J;  4Z1M H;  3RL0 g;  4GDO A;  3D71 A;  1KOR A;  4H13 D;  1ZOY C;  2OQQ A;  1OW8 A;  3R4Y A;  4YTP C;  3Q1M A;  1OW7 A;  4YXD C;  1KIL E;  1YQ4 C;  1EXJ A;  4RKU J;  2QJK C;  2E75 D;  2MKV A;  2YIU C;  2FXP A;  3EWK A;  4PV1 B;  2E74 C;  2QJY C;  3Q5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...