2WSCJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure Determination and Improved Model of Plant Photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wscJ00
3LW5J 4H13B 2E76B 1VF5B 2QJYC 4RKUJ 4IL6X 2QJKC 4OGQB 2YIUC 5KLIC 2E75B 2WPVB 2D2CB 2K9YA 2QIWA 2QSIA 4Y28J 4H44B 1Q90D 5L8RJ 5KKZC 2FYNC 4I7ZB 2WSFJ 3C8VA 2ZT9B 1ZRTE 4KT0J 4H0LB 2WSCJ 2WSEJ 1S5LX 2O01J 2QJPC 4PV1B 2E74B 1JB0J
chains in the Genus database with same CATH superfamily
1MFTA 2SPZA 2K1AA 3P7KA 5AVVB 1KTMA 4I2LC 2W6AA 3E1IA 1VQ8P 3CWBE 3NTNA 1W2EA 3MUDA 3N4XA 3CCSP 1FS0E 3WUUA 2V7QJ 2NRGA 5AW8B 2Q7CA 1JB0J 4K3AA 1VDFA 4C7RA 2WTYA 1GW3A 2IDBA 1OWAA 5CBOA 4ZKUA 2H8PD 3FGAD 2PFXA 4L73A 3RL0C 1GL2B 1CSBA 2A06E 3G9RA 1SQQE 1KILB 3H1JG 5KTBA 3G71P 3TNUB 2R32A 1Y8AA 2BCCD 1NTZJ 1EZVI 2K88A 3FXEA 3K5BA 1CI6B 1VPCA 4JYCA 1DD4A 2OYIA 1YJWP 2FYUJ 2IFMA 1S72P 2QM8A 3GF3A 3T97B 1L0NG 3JC22 2B87A 2D2CD 1PGOA 1URQC 3E1RA 1CZQA 1HBWA 3HD7D 5KLVE 2WSFH 1VQ4P 4JQ0D 2WSCH 1BGYE 2IBZG 2YIUB 3Q3DA 1JCCA 1NKNA 3EQ2A 4I6MC 3M9QA 4WBAA 2E75C 1N8RQ 4PD4E 2YMYA 4HJGH 2E74D 1S9KE 1X8YA 5GTHH 3I5CA 3O6QA 3V5BA 4Y28J 3USSA 4W7ZA 4C46A 3VP9A 3M0DC 2FFDB 3U1CA 2HPCB 4EIJA 2BEQD 2PAJA 3RL0g 1QGKB 1OX3A 1PP9D 1SQBK 2AEJA 3RGUA 3O8ZA 1NU1G 2YKQA 3IFMA 3L73J 3SWKA 4U3FD 3B8EB 1K8AQ 3BCCJ 1SQPE 2R5BA 2ZT9B 2JDIH 1RF1C 1L0NE 1P84D 4H44C 1XTGB 3G4SP 1GW4A 4UB8H 2KSJA 4YTPC 1GTWA 5AW7B 1RQVA 5TISE 3TGUG 5AVWB 1N7SD 3AEAC 1LWUA 1M56D 1FOSF 4IFDK 4QMAA 5AW5B 4D6TG 2O01H 3CC2P 5APVA 3L71G 1SVFA 5AVRB 1ZMEC 3AE4C 3H1ID 2FXMA 4L76A 1BE3G 3UIAA 2POHA 3HTKA 1RF1A 1L0LK 4R4LA 2YXQB 2FXPA 2ZJSE 4H0LC 4HYTB 2Z4EA 2OYIB 2YMKA 1VQ6P 5B5EH 5M1BA 3A3YB 5CCHD 1EQ7A 3H32A 2I1KA 3AEDC 2KNCA 3L70G 5CCGD 1E5WA 4WY4A 2I8DA 3V6IA 2OYOA 1SQVK 1JY2N 1JMMA 3C8VA 1M7LA 4YXWH 1X0TA 2WSCJ 2KSEA 4JBZA 2Y9YA 5KAIE 1HGZA 3NFQA 1A02J 2BCCE 1Q86Q 4L74A 1WT6A 2R3CA 4PD4I 3OW2O 3L36A 1R5SA 5C39A 4HH2A 1Q81Q 3KDPB 2ZXXA 5KAFH 1OVRA 2AXTE 1IO4A 3H1JJ 1BDCA 3KZIH 4PV1C 2JWAA 1FJPA 2CK3H 1TU3F 1KYOD 2J59M 3FXDA 2Y0CA 4BRYB 2B88A 1OVVA 4RO0A 4HB1A 2FYZA 4WVZA 2O01N 1XTCC 1KQFB 2M0BA 1Y47A 2OYHC 4LGDE 1KQGB 1SQBD 1QLED 5AW9B 2E75B 2IZ0A 4A7PA 1GU5A 2WQYC 3TF5A 2PGDA 3L72D 2YKPA 1SQXG 3VMAA 1L4AA 1S4XA 4RESB 5GTIE 1LWUB 3NMDA 1PV3A 2IBZI 1S2EA 3AECC 3CXHH 2N9BA 3A2AA 2VRSA 3AE8C 1K9MQ 5DJUB 1PP9E 2O01J 1M57D 1NTMG 2JJLA 2OTLP 2ZVNB 1S5LE 4H13D 3TSIA 3U1AA 4U3FE 3BRVB 3HTKB 1BCCG 1KZUB 1RF1B 1LNQA 2KLVA 2OQQA 1Q2NA 4H44B 1P84E 1L2PA 2YO2A 1HVVA 2K9JA 4OVNF 1ZR4A 3CCLP 1L0LD 3H32B 3H25A 1KORA 3AEEC 3A0BE 1NGMB 2WVRA 3IR9A 1JY3N 1NU1J 4WY4B 2D2CC 4O9BA 1ZXGA 3HD7C 3H1IE 1EDKA 2H89C 2JKVA 1NTKK 1PGQA 1G1JA 4AQRD 3H1LG 2W90A 1SQVD 1KFMA 3IN6A 4KHXA 3T97A 2KK7A 4H0LB 5CHXA 1KB9D 2H43A 3TGUJ 5AVYB 1JEKA 1Q82Q 2E74C 2KYVA 4EOTA 2FBWC 1EC5A 5KKZC 3CX5I 3L71J 3TK1A 3CCJP 2P58A 1G2CB 2AEFA 4AYCA 5CJ0A 2W83C 2E76B 3NXSA 2A06G 1EDJA 1K73Q 1BE3J 3ABVC 1SQQG 4DZOA 3ITKA 1IK9A 1J1DC 4GOFA 1NHLA 5AW6B 4I7ZC 4NPDA 1FZCA 3MIWA 1L4AB 1YTZI 2KZJA 2IYOA 2LKMA 3VMZA 2RKLA 1FU1A 1LTBC 1FDMA 3L75D 3L70J 3OAKA 1N7SC 4KJMA 1OXZA 1JMBA 4PV1B 2AEMA 1VQMP 5CMZA 1AVOA 2MJZA 5TJHA 1OIPA 1EDIA 2QRXA 3B5ND 5KLVG 1KYOE 1L0LG 3H1HG 1BGYG 1FDIA 1OW8A 1VL2A 2FYNC 2OYHB 2P10A 3B71A 3MTUE 3L35A 1SQBE 1FZBA 4L75A 2XKMA 3SWFA 2FY8A 2W6BA 4RKUJ 1RF0A 1P84I 1EXJA 3WU2H 1LTSC 3M0AA 2K9JB 1JUNA 3L72E 1FBMA 2JEEA 2XZRA 1HF9A 1NTZK 3WUVA 4K35A 2QEXP 1N73C 2R44A 1GMJA 1JY2O 5AVTB 3RK3D 5CCHC 2FYUK 4WB4A 1DEEG 4NPFX 4XA4A 4JF7A 1M1JC 5CCGC 5EFWB 1YITP 2GM4A 2Q3EA 1FE6A 2E5YA 1NAFA 1RH5B 1SQPG 1SQXJ 2QJKC 4BXLA 4GOEA 1NTKD 3GW6A 3GMAA 5AVXB 1SP4A 2LXBA 2E43A 3VN0A 1RE4C 1JTHA 1NH4A 2W27A 4TT3H 1L0LE 3H1HE 3E7KA 3JSVC 4N6JA 3JCUH 4N78D 2HFED 2D2CB 1NTMJ 2G8YA 4C7NA 3HD7B 4Y99B 5CCGA 1ZV8A 3AEBC 3U59A 2C0WA 1BCCJ 3R2PA 4PD4H 1ZRTD 4PJ0E 4DOJA 1U7MA 5AW2B 1YIJP 1SQVE 2HG5D 1D7MA 3L74D 1FZCB 1KB9E 3CI9A 3CMEP 5KJ7D 4ZNCA 3H1KJ 3AEFC 3IF4A 1URQA 3TDKA 3P8CD 1FAVA 2P1JA 2E74B 5APQA 4XE5B 2NPSD 2WITA 3V2NA 5KKZB 4BRYA 3WUTA 3CXHD 1YJ9P 3M06A 4R4MA 1VQ5P 1GDTA 3H1LJ 1J1DB 3D6ZA 1KYOI 1T8ZA 1USEA 1RY3A 1N2DC 3D71A 1T2KD 2HR3A 5AVQB 4H13C 5CJ4A 5DJTB 4IOIH 2J58A 5TISH 1EXIA 3CWBJ 2V4HA 2BCCG 1UIXA 1KQLA 1GD2E 1JY2P 3OJAB 3RBXA 3M0DA 1JY3O 3PLNA 1W2BO 2AXCA 2O1JA 4YPCA 3L75E 1N7SB 4UB6E 2C9LY 3PJSK 1LTGC 1NTZD 1SLQA 2YKOA 2IYPA 1SQQJ 3P8MC 1FZGA 1IZNB 3AE6C 5AW3B 1EZVD 2FYUD 4YXDC 1IK7A 1DX7A 4ASVA 5L8RJ 1LTTC 2Y9ZA 4KT0J 2GA1A 3L37A 3RL0B 4U7JA 1FDOA 1JTHB 3LW5H 2K9YA 2KXPB 1VQNP 3RK3E 3PH0A 3GHGC 1HWTC 4C7NB 3CL3D 1BGYJ 3LIDA 1M1JB 1EDLA 3CCMP 3LIEA 5APWA 2QG4A 2KLUA 4TLFA 5KLIC 1PP9G 3PP5A 5H2FE 1U57A 1VF5C 3S9OA 2RH0A 4GIFA 4U3FG 1LTJC 3H1KD 3S4RA 1KN7A 1YQ4C 4EDFA 3WMM0 1KB9I 3CX5H 1NTKE 3Q5PA 2AXTH 2JWDA 1URQB 5BU5A 3CD6P 3L73D 1G2CA 5E79H 4DCKA 3BCCD 1L0NK 1MFZA 2WMMA 4N78E 1PPJD 3A5TA 1CW5A 4B86A 1FZFA 2QIWA 1Q90D 2Q9IA 3B5NC 4GDOA 2E5TA 3H1IG 3VP8A 1SQPJ 2ZYAA 3AE2C 1ZRTE 1L0NJ 1JY3P 3L4FA 2YO3A 1AVYA 2WPQA 1LTJA 3L74E 2I1JA 1LT9C 5GTIH 4IL6X 1NYHA 1HH0A 2N9YB 1LTAC 1Q7YQ 1OW7A 3P8CE 5APYA 4Z1MH 3S1KA 1GL2C 1PGJA 3A7OA 3HE4B 2WZ7A 4DJGA 3PHLA 3W67A 1NVOA 2M8RA 1RQUA 3RK3C 3RK2D 1NWQA 4OGQD 1S5LH 2OYHA 3VMXA 2P7JA 4LC1A 1HGVA 1P84H 1NU1K 1RE3C 1AJYA 2A45G 3CCRP 4H13B 2WPRA 1IFNA 1OW6A 2N1TD 1LT9A 2HODA 3A0BH 1NKZB 5BVZA 3FX0A 3CCQP 3GLMA 3LW5J 2PRRA 1NTZE 4GT1A 2FYUE 1OFCX 2MKVA 3CCVP 3SSUA 3CCUP 3HUSC 5AVZB 1K05A 1KV4A 3II6A 2BCCJ 1PPJG 1GU4A 1LGHB 3H1JD 1SFCD 2BASA 1KC8Q 1SQBG 3GF7A 4D6TJ 3A0HE 1AFOA 3KXDA 2IFNA 1YHQP 3BRTB 2XNXA 5KJ7C 3L72G 2FFDC 3SWYA 3IAOA 5AW4B 2QE7H 1MUUA 2E76D 2IX7C 1VF5D 3HD7A 2NPSC 1ZP0C 3GHGB 3EFFK 2QSIA 1R5LA 3HE5A 2WSSH 5K5GB 2WT7A 5KLIB 1L0ND 2ZT9C 5AW0B 1JOCA 1QL1A 1FOSE 5B66E 4IL6E 3MUDC 1LTJB 3SFEC 2ZAEB 1T2KC 2IBZD 1YI2P 3VMYA 3M9BA 1USDA 3L73E 3PRJA 2GUVA 3AE3C 3R4YA 1YBKA 3BCCE 2Q5UA 1AQTA 1KYOH 2ITAA 3AEGC 1VQKP 4M3LA 1PGPA 1PPJE 3H6PA 5CBNA 2R5DA 3V4WA 2H7HA 1X79B 3GG2A 2QJYC 3B5NB 2RN0A 4U3FJ 1GL2D 2Q1KA 2YXRB 2OYIC 3KQGA 1LT9B 1KILD 5AVUB 1SQVG 1NU1D 2HODB 3WU2E 1N7SA 1SS1A 2Q6QA 1PFIA 1NAYA 2G3AA 1SQXK 3KHUA 1YTZT 5APXA 4XFJA 3Q1MA 2ZFCA 1BDDA 1KFNA 3RK3B 3Q5RA 2QJPC 3AE1C 2E42A 3EFGA 4ZKPA 1OMIA 2CPBA 3TGUD 3H1IJ 2L5GB 1VQ9P 1NTMK 4ASWA 4D6TD 4WWIA 2J5UA 3D6YA 3L71D 4ZMDA 4GKGA 1AA0A 1N73A 1IFPA 3CX5D 2HLOA 5CCHA 1YYCA 1BE3D 2OARA 4AUWA 2M5AA 2CPSA 3RBZA 3KYQA 1M1JA 3L75G 1QL2A 3JCUE 1M1KQ 1IFDA 3HE5B 4GODA 2A45I 2WPSA 3BATA 2XNDH 4PJ0H 2WT7B 3VYIA 3QH9A 2XU6A 4IFMA 1IJDB 1KB9H 3HUSB 3L70D 1FZAA 1RE4A 1S1CX 2Y0DA 1VQ7P 3CPWO 5GTHE 3H1JE 2IPPA 1WMKA 3V4QA 3P32A 3M9HA 1LWUC 2OTKE 1GK6A 1BSHA 2K37A 2KB7P 2ZT9D 2UWJE 2NPSB 1NJIQ 1MKMA 2B89A 1IFJA 1VQPP 1JNMA 3RK2C 2JP3A 4OGQC 1LP1A 2QA4P 4NPEA 4I7ZB 4EI2A 3W68A 1SQQK 3G6EP 4RJTA 4UB8E 1SQBJ 3C1LA 3AE9C 3V2RA 4MN4C 2OGUA 2IBZE 3HE4A 3L72J 2N1TC 4UB6H 1MV8A 5APSA 4N3YB 1J1EC 5APUA 1NTKG 1Y9BA 2WSEH 1PZQA 4WY4C 3TYYA 1JM0A 1QX8A 4EYYQ 2FYNB 3VTPC 3PTZA 1SQXD 1Z56A 4JPZB 3MP7B 2QM7A 1GZLA 3KPEA 2IZ1A 2QJYB 1S5LX 5KLVK 3RL0D 1PL5A 3CLQA 2KS1A 5B5EE 1ZN5A 1NO4A 1N73B 1IFIA 1KILE 2QVAA 3L74G 1NTMD 1NU1E 1SFCC 2N1TA 2B87B 1R8EA 1W5CE 5KLVJ 1L0LJ 3H1HJ 2C9NY 2M5AB 3B4SA 1BCCD 5KAIH 1BSNA 1VQLP 3D70A 1AQ5A 3I55P 2Z5HA 2GUSA 4W7YA 3VOPA 2Z5IA 2WPVB 3V2QA 2E76C 2QJPB 5H2FH 3QWOC 2WSFJ 2O3JA 1ZLLA 3TGUE 2QJKB 1URQD 1SQVJ 4D6TE 1H88A 1X9VA 1L4AC 1RHZB 2L91A 2OTJP 3V2PA 3L71E 2P2UA 1U7JA 1SQPK 3O6QB 2ZYDA 5KAFE 1DEBA 1SFCA 2Q3IA 3BASA 3CX5E 1J2JB 1IC2A 4JYBA 2KZIA 3F89A 3GHGA 3KZIE 1BE3E 2O1KA 3H1LD 1G1IA 4OWFA 4I1LA 1H0TA 5E79E 1YQ3C 1UIIA 2E75D 2LXCB 2WWWA 1ZR2A 1WRGA 1HJ0A 3CWBD 1NTZG 1LP1B 2M3EA 1AV1A 1FZEA 2C0XA 4DT0A 1A02F 1LT1A 1EZVG 1LTIC 2FYUG 3L70E 1KD1Q 3Q2YA 1MZ9A 2A06D 3ZDMA 1SQQD 3AE5C 2FXOA 2B9BA 1JO5A 1KILC 2HYNA 1QEXA 1S3JA 2DW3A 3CXHE 1DD3A 3L75J 3FWLA 2M3BA 4H44D 2WSEJ 1DIPA 3B5NA 2PP6A 3EWKA 4HKZH 2V7QH 3C9IA 3Q5SA 3RK2B 3BVHA 4OGQB 4LLHA 1QVGO 5BU8B 2Y0EA 1FC2C 3MD0A 2JO1A 3F5HA 4IFFA 1GK4A 2KS1B 1KQSO 2KI7B 4WY4D 2YNYA 1GL2A 5AVSB 1M90Q 5KLVD 2N1TB 3I56P 3H1HD 2FKWB 1BGYD 3H1KG 3CCEP 1KILA 1FJKA 2YIUC 1J1EB 2P67A 2KNCB 2BEZF 1NOHA 3TNUA 1OVUA 1T6AA 4BWNA 4W80A 3L73G 1EZVE 4H0LD 3SFDC 2KP8A 4PD4D 4Y99C 3BCCG 1N7LA 1SQXE 1RE3A 2LR2A 1CI6A 1S9KD 3FWNA 2JR8A 2XDJA 3MZWB 2ZXEB 3A0HH 2ZYGA 2KUBA 1FZCC 1OZHA 2NZ2A 1ZOYC 3HRNA 3G3ZA 3MHVA 1QVFO 2R3SA 3AE7C 3CWBG 1H8AA 1X22A 1NTKJ 1SFCB 1T3UA 1NTME 1H89A 1DH3A 2A45H 1LJ2A 2KIKA 1K04A 1H0TB 1BCCE 1JCDA 1SQPD 2ZVOB 3CMAP 2W6JH 2W8ZA 1VF5B 1HUCA 1L4AD 1T3JA 1HTLC 3OA7A 1PIXA 3CC7P 3HUSA 1YJNP 1E79H 2H88C 4IL6H 5B66H 3M91A 3H1KE 3N7NA 1KMIZ 1RF0C 5APTA 5AW1B 4PV1D 1M8OB 3CC4P 3L74J 5KJ7A 4OH8B 2FFDA 2XV5A 3MGNA 2HPCA 1HJBA 2RMZA 1ZW0A 2NPSA 1N86A 4CPGA 3H1LE 1VQOP 3CXHI 1PP9J 2KOGA 1IFMA 2K3RA
chains in the Genus database with same CATH topology
3IAOA 1RQUA 1KTMA 2E76D 2QJKC 2G3AA 3H25A 1WMKA 1KORA 1PL5A 1VF5D 3AEEC 1ZMEC 4PV1C 4OGQD 5KLIC 3AE4C 1ZP0C 3D71A 1NGMB 1U57A 4H13C 1VF5C 2QSIA 3GMAA 1KILE 3S9OA 4XFJA 3Q1MA 1TU3F 3Q2YA 1EXIA 2E75C 4TT3H 2D2CC 1UIXA 1R8EA 2V7QJ 2NZ2A 1ZOYC 2ZT9D 3Q5RA 2QJPC 3AE1C 3AE5C 4PV1B 1KQFB 1JB0J 1AJYA 2ZT9C 1OMIA 1YQ4C 2E74D 4H13B 4R4LA 2H89C 1MKMA 1OW6A 2FXPA 4H0LC 3AE7C 1KQGB 3D70A 2IDBA 3Q5PA 3FGAD 1DD3A 2YMKA 2E75B 2WPVB 3O6QA 2D2CB 2E76C 2G8YA 4Y28J 3SFEC 2JP3A 1FDIA 1OW8A 2WQYC 5M1BA 3G9RA 4OGQC 1VL2A 2FYNC 4H44D 4I7ZB 2WSFJ 3IN6A 2P10A 2J5UA 3D6YA 1K04A 4H0LB 3AEBC 2WSEJ 1DIPA 3B71A 2BEQD 3EWKA 3GLMA 3RL0g 3AE6C 1PV3A 3LW5J 3AE9C 3Q5SA 3AEDC 1VF5B 4RKUJ 4OGQB 1EXJA 2E74C 1PIXA 4YXDC 1IK7A 2QIWA 3AECC 2FBWC 3AE3C 3R4YA 1HF9A 3AE8C 2JO1A 1Q90D 2H88C 5L8RJ 5KKZC 4GDOA 3AEGC 3AE2C 1KMIZ 3C8VA 2ZT9B 1ZRTE 4KT0J 3AEFC 2WSCJ 1DD4A 2MKVA 1GMJA 4H44C 1Y9BA 2O01J 2E74B 4U7JA 4PV1D 1FDOA 3GF3A 3T97B 2E76B 2QJYC 4H13D 4IL6X 1NYHA 3ABVC 1K05A 4YTPC 2YIUC 1YQ3C 1RQVA 2K9YA 2OQQA 2E75D 3GF7A 2BEZF 2D2CD 3AEAC 4H44B 1OW7A 4Z1MH 4R4MA 3RK3E 1S5LX 1S1CX 4H0LD 1HJ0A 3SFDC 4I7ZC 3Q3DA 3D6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 J;  4H13 B;  2E76 B;  1VF5 B;  2QJY C;  4RKU J;  4IL6 X;  2QJK C;  4OGQ B;  2YIU C;  5KLI C;  2E75 B;  2WPV B;  2D2C B;  2K9Y A;  2QIW A;  2QSI A;  4Y28 J;  4H44 B;  1Q90 D;  5L8R J;  5KKZ C;  2FYN C;  4I7Z B;  2WSF J;  3C8V A;  2ZT9 B;  1ZRT E;  4KT0 J;  4H0L B;  2WSC J;  2WSE J;  1S5L X;  2O01 J;  2QJP C;  4PV1 B;  2E74 B;  1JB0 J; 
#chains in the Genus database with same CATH topology
 1MFT A;  2SPZ A;  2K1A A;  3P7K A;  5AVV B;  1KTM A;  4I2L C;  2W6A A;  3E1I A;  1VQ8 P;  3CWB E;  3NTN A;  1W2E A;  3MUD A;  3N4X A;  3CCS P;  1FS0 E;  3WUU A;  2V7Q J;  2NRG A;  5AW8 B;  2Q7C A;  1JB0 J;  4K3A A;  1VDF A;  4C7R A;  2WTY A;  1GW3 A;  2IDB A;  1OWA A;  5CBO A;  4ZKU A;  2H8P D;  3FGA D;  2PFX A;  4L73 A;  3RL0 C;  1GL2 B;  1CSB A;  2A06 E;  3G9R A;  1SQQ E;  1KIL B;  3H1J G;  5KTB A;  3G71 P;  3TNU B;  2R32 A;  1Y8A A;  2BCC D;  1NTZ J;  1EZV I;  2K88 A;  3FXE A;  3K5B A;  1CI6 B;  1VPC A;  4JYC A;  1DD4 A;  2OYI A;  1YJW P;  2FYU J;  2IFM A;  1S72 P;  2QM8 A;  3GF3 A;  3T97 B;  1L0N G;  3JC2 2;  2B87 A;  2D2C D;  1PGO A;  1URQ C;  3E1R A;  1CZQ A;  1HBW A;  3HD7 D;  5KLV E;  2WSF H;  1VQ4 P;  4JQ0 D;  2WSC H;  1BGY E;  2IBZ G;  2YIU B;  3Q3D A;  1JCC A;  1NKN A;  3EQ2 A;  4I6M C;  3M9Q A;  4WBA A;  2E75 C;  1N8R Q;  4PD4 E;  2YMY A;  4HJG H;  2E74 D;  1S9K E;  1X8Y A;  5GTH H;  3I5C A;  3O6Q A;  3V5B A;  4Y28 J;  3USS A;  4W7Z A;  4C46 A;  3VP9 A;  3M0D C;  2FFD B;  3U1C A;  2HPC B;  4EIJ A;  2BEQ D;  2PAJ A;  3RL0 g;  1QGK B;  1OX3 A;  1PP9 D;  1SQB K;  2AEJ A;  3RGU A;  3O8Z A;  1NU1 G;  2YKQ A;  3IFM A;  3L73 J;  3SWK A;  4U3F D;  3B8E B;  1K8A Q;  3BCC J;  1SQP E;  2R5B A;  2ZT9 B;  2JDI H;  1RF1 C;  1L0N E;  1P84 D;  4H44 C;  1XTG B;  3G4S P;  1GW4 A;  4UB8 H;  2KSJ A;  4YTP C;  1GTW A;  5AW7 B;  1RQV A;  5TIS E;  3TGU G;  5AVW B;  1N7S D;  3AEA C;  1LWU A;  1M56 D;  1FOS F;  4IFD K;  4QMA A;  5AW5 B;  4D6T G;  2O01 H;  3CC2 P;  5APV A;  3L71 G;  1SVF A;  5AVR B;  1ZME C;  3AE4 C;  3H1I D;  2FXM A;  4L76 A;  1BE3 G;  3UIA A;  2POH A;  3HTK A;  1RF1 A;  1L0L K;  4R4L A;  2YXQ B;  2FXP A;  2ZJS E;  4H0L C;  4HYT B;  2Z4E A;  2OYI B;  2YMK A;  1VQ6 P;  5B5E H;  5M1B A;  3A3Y B;  5CCH D;  1EQ7 A;  3H32 A;  2I1K A;  3AED C;  2KNC A;  3L70 G;  5CCG D;  1E5W A;  4WY4 A;  2I8D A;  3V6I A;  2OYO A;  1SQV K;  1JY2 N;  1JMM A;  3C8V A;  1M7L A;  4YXW H;  1X0T A;  2WSC J;  2KSE A;  4JBZ A;  2Y9Y A;  5KAI E;  1HGZ A;  3NFQ A;  1A02 J;  2BCC E;  1Q86 Q;  4L74 A;  1WT6 A;  2R3C A;  4PD4 I;  3OW2 O;  3L36 A;  1R5S A;  5C39 A;  4HH2 A;  1Q81 Q;  3KDP B;  2ZXX A;  5KAF H;  1OVR A;  2AXT E;  1IO4 A;  3H1J J;  1BDC A;  3KZI H;  4PV1 C;  2JWA A;  1FJP A;  2CK3 H;  1TU3 F;  1KYO D;  2J59 M;  3FXD A;  2Y0C A;  4BRY B;  2B88 A;  1OVV A;  4RO0 A;  4HB1 A;  2FYZ A;  4WVZ A;  2O01 N;  1XTC C;  1KQF B;  2M0B A;  1Y47 A;  2OYH C;  4LGD E;  1KQG B;  1SQB D;  1QLE D;  5AW9 B;  2E75 B;  2IZ0 A;  4A7P A;  1GU5 A;  2WQY C;  3TF5 A;  2PGD A;  3L72 D;  2YKP A;  1SQX G;  3VMA A;  1L4A A;  1S4X A;  4RES B;  5GTI E;  1LWU B;  3NMD A;  1PV3 A;  2IBZ I;  1S2E A;  3AEC C;  3CXH H;  2N9B A;  3A2A A;  2VRS A;  3AE8 C;  1K9M Q;  5DJU B;  1PP9 E;  2O01 J;  1M57 D;  1NTM G;  2JJL A;  2OTL P;  2ZVN B;  1S5L E;  4H13 D;  3TSI A;  3U1A A;  4U3F E;  3BRV B;  3HTK B;  1BCC G;  1KZU B;  1RF1 B;  1LNQ A;  2KLV A;  2OQQ A;  1Q2N A;  4H44 B;  1P84 E;  1L2P A;  2YO2 A;  1HVV A;  2K9J A;  4OVN F;  1ZR4 A;  3CCL P;  1L0L D;  3H32 B;  3H25 A;  1KOR A;  3AEE C;  3A0B E;  1NGM B;  2WVR A;  3IR9 A;  1JY3 N;  1NU1 J;  4WY4 B;  2D2C C;  4O9B A;  1ZXG A;  3HD7 C;  3H1I E;  1EDK A;  2H89 C;  2JKV A;  1NTK K;  1PGQ A;  1G1J A;  4AQR D;  3H1L G;  2W90 A;  1SQV D;  1KFM A;  3IN6 A;  4KHX A;  3T97 A;  2KK7 A;  4H0L B;  5CHX A;  1KB9 D;  2H43 A;  3TGU J;  5AVY B;  1JEK A;  1Q82 Q;  2E74 C;  2KYV A;  4EOT A;  2FBW C;  1EC5 A;  5KKZ C;  3CX5 I;  3L71 J;  3TK1 A;  3CCJ P;  2P58 A;  1G2C B;  2AEF A;  4AYC A;  5CJ0 A;  2W83 C;  2E76 B;  3NXS A;  2A06 G;  1EDJ A;  1K73 Q;  1BE3 J;  3ABV C;  1SQQ G;  4DZO A;  3ITK A;  1IK9 A;  1J1D C;  4GOF A;  1NHL A;  5AW6 B;  4I7Z C;  4NPD A;  1FZC A;  3MIW A;  1L4A B;  1YTZ I;  2KZJ A;  2IYO A;  2LKM A;  3VMZ A;  2RKL A;  1FU1 A;  1LTB C;  1FDM A;  3L75 D;  3L70 J;  3OAK A;  1N7S C;  4KJM A;  1OXZ A;  1JMB A;  4PV1 B;  2AEM A;  1VQM P;  5CMZ A;  1AVO A;  2MJZ A;  5TJH A;  1OIP A;  1EDI A;  2QRX A;  3B5N D;  5KLV G;  1KYO E;  1L0L G;  3H1H G;  1BGY G;  1FDI A;  1OW8 A;  1VL2 A;  2FYN C;  2OYH B;  2P10 A;  3B71 A;  3MTU E;  3L35 A;  1SQB E;  1FZB A;  4L75 A;  2XKM A;  3SWF A;  2FY8 A;  2W6B A;  4RKU J;  1RF0 A;  1P84 I;  1EXJ A;  3WU2 H;  1LTS C;  3M0A A;  2K9J B;  1JUN A;  3L72 E;  1FBM A;  2JEE A;  2XZR A;  1HF9 A;  1NTZ K;  3WUV A;  4K35 A;  2QEX P;  1N73 C;  2R44 A;  1GMJ A;  1JY2 O;  5AVT B;  3RK3 D;  5CCH C;  2FYU K;  4WB4 A;  1DEE G;  4NPF X;  4XA4 A;  4JF7 A;  1M1J C;  5CCG C;  5EFW B;  1YIT P;  2GM4 A;  2Q3E A;  1FE6 A;  2E5Y A;  1NAF A;  1RH5 B;  1SQP G;  1SQX J;  2QJK C;  4BXL A;  4GOE A;  1NTK D;  3GW6 A;  3GMA A;  5AVX B;  1SP4 A;  2LXB A;  2E43 A;  3VN0 A;  1RE4 C;  1JTH A;  1NH4 A;  2W27 A;  4TT3 H;  1L0L E;  3H1H E;  3E7K A;  3JSV C;  4N6J A;  3JCU H;  4N78 D;  2HFE D;  2D2C B;  1NTM J;  2G8Y A;  4C7N A;  3HD7 B;  4Y99 B;  5CCG A;  1ZV8 A;  3AEB C;  3U59 A;  2C0W A;  1BCC J;  3R2P A;  4PD4 H;  1ZRT D;  4PJ0 E;  4DOJ A;  1U7M A;  5AW2 B;  1YIJ P;  1SQV E;  2HG5 D;  1D7M A;  3L74 D;  1FZC B;  1KB9 E;  3CI9 A;  3CME P;  5KJ7 D;  4ZNC A;  3H1K J;  3AEF C;  3IF4 A;  1URQ A;  3TDK A;  3P8C D;  1FAV A;  2P1J A;  2E74 B;  5APQ A;  4XE5 B;  2NPS D;  2WIT A;  3V2N A;  5KKZ B;  4BRY A;  3WUT A;  3CXH D;  1YJ9 P;  3M06 A;  4R4M A;  1VQ5 P;  1GDT A;  3H1L J;  1J1D B;  3D6Z A;  1KYO I;  1T8Z A;  1USE A;  1RY3 A;  1N2D C;  3D71 A;  1T2K D;  2HR3 A;  5AVQ B;  4H13 C;  5CJ4 A;  5DJT B;  4IOI H;  2J58 A;  5TIS H;  1EXI A;  3CWB J;  2V4H A;  2BCC G;  1UIX A;  1KQL A;  1GD2 E;  1JY2 P;  3OJA B;  3RBX A;  3M0D A;  1JY3 O;  3PLN A;  1W2B O;  2AXC A;  2O1J A;  4YPC A;  3L75 E;  1N7S B;  4UB6 E;  2C9L Y;  3PJS K;  1LTG C;  1NTZ D;  1SLQ A;  2YKO A;  2IYP A;  1SQQ J;  3P8M C;  1FZG A;  1IZN B;  3AE6 C;  5AW3 B;  1EZV D;  2FYU D;  4YXD C;  1IK7 A;  1DX7 A;  4ASV A;  5L8R J;  1LTT C;  2Y9Z A;  4KT0 J;  2GA1 A;  3L37 A;  3RL0 B;  4U7J A;  1FDO A;  1JTH B;  3LW5 H;  2K9Y A;  2KXP B;  1VQN P;  3RK3 E;  3PH0 A;  3GHG C;  1HWT C;  4C7N B;  3CL3 D;  1BGY J;  3LID A;  1M1J B;  1EDL A;  3CCM P;  3LIE A;  5APW A;  2QG4 A;  2KLU A;  4TLF A;  5KLI C;  1PP9 G;  3PP5 A;  5H2F E;  1U57 A;  1VF5 C;  3S9O A;  2RH0 A;  4GIF A;  4U3F G;  1LTJ C;  3H1K D;  3S4R A;  1KN7 A;  1YQ4 C;  4EDF A;  3WMM 0;  1KB9 I;  3CX5 H;  1NTK E;  3Q5P A;  2AXT H;  2JWD A;  1URQ B;  5BU5 A;  3CD6 P;  3L73 D;  1G2C A;  5E79 H;  4DCK A;  3BCC D;  1L0N K;  1MFZ A;  2WMM A;  4N78 E;  1PPJ D;  3A5T A;  1CW5 A;  4B86 A;  1FZF A;  2QIW A;  1Q90 D;  2Q9I A;  3B5N C;  4GDO A;  2E5T A;  3H1I G;  3VP8 A;  1SQP J;  2ZYA A;  3AE2 C;  1ZRT E;  1L0N J;  1JY3 P;  3L4F A;  2YO3 A;  1AVY A;  2WPQ A;  1LTJ A;  3L74 E;  2I1J A;  1LT9 C;  5GTI H;  4IL6 X;  1NYH A;  1HH0 A;  2N9Y B;  1LTA C;  1Q7Y Q;  1OW7 A;  3P8C E;  5APY A;  4Z1M H;  3S1K A;  1GL2 C;  1PGJ A;  3A7O A;  3HE4 B;  2WZ7 A;  4DJG A;  3PHL A;  3W67 A;  1NVO A;  2M8R A;  1RQU A;  3RK3 C;  3RK2 D;  1NWQ A;  4OGQ D;  1S5L H;  2OYH A;  3VMX A;  2P7J A;  4LC1 A;  1HGV A;  1P84 H;  1NU1 K;  1RE3 C;  1AJY A;  2A45 G;  3CCR P;  4H13 B;  2WPR A;  1IFN A;  1OW6 A;  2N1T D;  1LT9 A;  2HOD A;  3A0B H;  1NKZ B;  5BVZ A;  3FX0 A;  3CCQ P;  3GLM A;  3LW5 J;  2PRR A;  1NTZ E;  4GT1 A;  2FYU E;  1OFC X;  2MKV A;  3CCV P;  3SSU A;  3CCU P;  3HUS C;  5AVZ B;  1K05 A;  1KV4 A;  3II6 A;  2BCC J;  1PPJ G;  1GU4 A;  1LGH B;  3H1J D;  1SFC D;  2BAS A;  1KC8 Q;  1SQB G;  3GF7 A;  4D6T J;  3A0H E;  1AFO A;  3KXD A;  2IFN A;  1YHQ P;  3BRT B;  2XNX A;  5KJ7 C;  3L72 G;  2FFD C;  3SWY A;  3IAO A;  5AW4 B;  2QE7 H;  1MUU A;  2E76 D;  2IX7 C;  1VF5 D;  3HD7 A;  2NPS C;  1ZP0 C;  3GHG B;  3EFF K;  2QSI A;  1R5L A;  3HE5 A;  2WSS H;  5K5G B;  2WT7 A;  5KLI B;  1L0N D;  2ZT9 C;  5AW0 B;  1JOC A;  1QL1 A;  1FOS E;  5B66 E;  4IL6 E;  3MUD C;  1LTJ B;  3SFE C;  2ZAE B;  1T2K C;  2IBZ D;  1YI2 P;  3VMY A;  3M9B A;  1USD A;  3L73 E;  3PRJ A;  2GUV A;  3AE3 C;  3R4Y A;  1YBK A;  3BCC E;  2Q5U A;  1AQT A;  1KYO H;  2ITA A;  3AEG C;  1VQK P;  4M3L A;  1PGP A;  1PPJ E;  3H6P A;  5CBN A;  2R5D A;  3V4W A;  2H7H A;  1X79 B;  3GG2 A;  2QJY C;  3B5N B;  2RN0 A;  4U3F J;  1GL2 D;  2Q1K A;  2YXR B;  2OYI C;  3KQG A;  1LT9 B;  1KIL D;  5AVU B;  1SQV G;  1NU1 D;  2HOD B;  3WU2 E;  1N7S A;  1SS1 A;  2Q6Q A;  1PFI A;  1NAY A;  2G3A A;  1SQX K;  3KHU A;  1YTZ T;  5APX A;  4XFJ A;  3Q1M A;  2ZFC A;  1BDD A;  1KFN A;  3RK3 B;  3Q5R A;  2QJP C;  3AE1 C;  2E42 A;  3EFG A;  4ZKP A;  1OMI A;  2CPB A;  3TGU D;  3H1I J;  2L5G B;  1VQ9 P;  1NTM K;  4ASW A;  4D6T D;  4WWI A;  2J5U A;  3D6Y A;  3L71 D;  4ZMD A;  4GKG A;  1AA0 A;  1N73 A;  1IFP A;  3CX5 D;  2HLO A;  5CCH A;  1YYC A;  1BE3 D;  2OAR A;  4AUW A;  2M5A A;  2CPS A;  3RBZ A;  3KYQ A;  1M1J A;  3L75 G;  1QL2 A;  3JCU E;  1M1K Q;  1IFD A;  3HE5 B;  4GOD A;  2A45 I;  2WPS A;  3BAT A;  2XND H;  4PJ0 H;  2WT7 B;  3VYI A;  3QH9 A;  2XU6 A;  4IFM A;  1IJD B;  1KB9 H;  3HUS B;  3L70 D;  1FZA A;  1RE4 A;  1S1C X;  2Y0D A;  1VQ7 P;  3CPW O;  5GTH E;  3H1J E;  2IPP A;  1WMK A;  3V4Q A;  3P32 A;  3M9H A;  1LWU C;  2OTK E;  1GK6 A;  1BSH A;  2K37 A;  2KB7 P;  2ZT9 D;  2UWJ E;  2NPS B;  1NJI Q;  1MKM A;  2B89 A;  1IFJ A;  1VQP P;  1JNM A;  3RK2 C;  2JP3 A;  4OGQ C;  1LP1 A;  2QA4 P;  4NPE A;  4I7Z B;  4EI2 A;  3W68 A;  1SQQ K;  3G6E P;  4RJT A;  4UB8 E;  1SQB J;  3C1L A;  3AE9 C;  3V2R A;  4MN4 C;  2OGU A;  2IBZ E;  3HE4 A;  3L72 J;  2N1T C;  4UB6 H;  1MV8 A;  5APS A;  4N3Y B;  1J1E C;  5APU A;  1NTK G;  1Y9B A;  2WSE H;  1PZQ A;  4WY4 C;  3TYY A;  1JM0 A;  1QX8 A;  4EYY Q;  2FYN B;  3VTP C;  3PTZ A;  1SQX D;  1Z56 A;  4JPZ B;  3MP7 B;  2QM7 A;  1GZL A;  3KPE A;  2IZ1 A;  2QJY B;  1S5L X;  5KLV K;  3RL0 D;  1PL5 A;  3CLQ A;  2KS1 A;  5B5E E;  1ZN5 A;  1NO4 A;  1N73 B;  1IFI A;  1KIL E;  2QVA A;  3L74 G;  1NTM D;  1NU1 E;  1SFC C;  2N1T A;  2B87 B;  1R8E A;  1W5C E;  5KLV J;  1L0L J;  3H1H J;  2C9N Y;  2M5A B;  3B4S A;  1BCC D;  5KAI H;  1BSN A;  1VQL P;  3D70 A;  1AQ5 A;  3I55 P;  2Z5H A;  2GUS A;  4W7Y A;  3VOP A;  2Z5I A;  2WPV B;  3V2Q A;  2E76 C;  2QJP B;  5H2F H;  3QWO C;  2WSF J;  2O3J A;  1ZLL A;  3TGU E;  2QJK B;  1URQ D;  1SQV J;  4D6T E;  1H88 A;  1X9V A;  1L4A C;  1RHZ B;  2L91 A;  2OTJ P;  3V2P A;  3L71 E;  2P2U A;  1U7J A;  1SQP K;  3O6Q B;  2ZYD A;  5KAF E;  1DEB A;  1SFC A;  2Q3I A;  3BAS A;  3CX5 E;  1J2J B;  1IC2 A;  4JYB A;  2KZI A;  3F89 A;  3GHG A;  3KZI E;  1BE3 E;  2O1K A;  3H1L D;  1G1I A;  4OWF A;  4I1L A;  1H0T A;  5E79 E;  1YQ3 C;  1UII A;  2E75 D;  2LXC B;  2WWW A;  1ZR2 A;  1WRG A;  1HJ0 A;  3CWB D;  1NTZ G;  1LP1 B;  2M3E A;  1AV1 A;  1FZE A;  2C0X A;  4DT0 A;  1A02 F;  1LT1 A;  1EZV G;  1LTI C;  2FYU G;  3L70 E;  1KD1 Q;  3Q2Y A;  1MZ9 A;  2A06 D;  3ZDM A;  1SQQ D;  3AE5 C;  2FXO A;  2B9B A;  1JO5 A;  1KIL C;  2HYN A;  1QEX A;  1S3J A;  2DW3 A;  3CXH E;  1DD3 A;  3L75 J;  3FWL A;  2M3B A;  4H44 D;  2WSE J;  1DIP A;  3B5N A;  2PP6 A;  3EWK A;  4HKZ H;  2V7Q H;  3C9I A;  3Q5S A;  3RK2 B;  3BVH A;  4OGQ B;  4LLH A;  1QVG O;  5BU8 B;  2Y0E A;  1FC2 C;  3MD0 A;  2JO1 A;  3F5H A;  4IFF A;  1GK4 A;  2KS1 B;  1KQS O;  2KI7 B;  4WY4 D;  2YNY A;  1GL2 A;  5AVS B;  1M90 Q;  5KLV D;  2N1T B;  3I56 P;  3H1H D;  2FKW B;  1BGY D;  3H1K G;  3CCE P;  1KIL A;  1FJK A;  2YIU C;  1J1E B;  2P67 A;  2KNC B;  2BEZ F;  1NOH A;  3TNU A;  1OVU A;  1T6A A;  4BWN A;  4W80 A;  3L73 G;  1EZV E;  4H0L D;  3SFD C;  2KP8 A;  4PD4 D;  4Y99 C;  3BCC G;  1N7L A;  1SQX E;  1RE3 A;  2LR2 A;  1CI6 A;  1S9K D;  3FWN A;  2JR8 A;  2XDJ A;  3MZW B;  2ZXE B;  3A0H H;  2ZYG A;  2KUB A;  1FZC C;  1OZH A;  2NZ2 A;  1ZOY C;  3HRN A;  3G3Z A;  3MHV A;  1QVF O;  2R3S A;  3AE7 C;  3CWB G;  1H8A A;  1X22 A;  1NTK J;  1SFC B;  1T3U A;  1NTM E;  1H89 A;  1DH3 A;  2A45 H;  1LJ2 A;  2KIK A;  1K04 A;  1H0T B;  1BCC E;  1JCD A;  1SQP D;  2ZVO B;  3CMA P;  2W6J H;  2W8Z A;  1VF5 B;  1HUC A;  1L4A D;  1T3J A;  1HTL C;  3OA7 A;  1PIX A;  3CC7 P;  3HUS A;  1YJN P;  1E79 H;  2H88 C;  4IL6 H;  5B66 H;  3M91 A;  3H1K E;  3N7N A;  1KMI Z;  1RF0 C;  5APT A;  5AW1 B;  4PV1 D;  1M8O B;  3CC4 P;  3L74 J;  5KJ7 A;  4OH8 B;  2FFD A;  2XV5 A;  3MGN A;  2HPC A;  1HJB A;  2RMZ A;  1ZW0 A;  2NPS A;  1N86 A;  4CPG A;  3H1L E;  1VQO P;  3CXH I;  1PP9 J;  2KOG A;  1IFM A;  2K3R A; 
#chains in the Genus database with same CATH homology
 3IAO A;  1RQU A;  1KTM A;  2E76 D;  2QJK C;  2G3A A;  3H25 A;  1WMK A;  1KOR A;  1PL5 A;  1VF5 D;  3AEE C;  1ZME C;  4PV1 C;  4OGQ D;  5KLI C;  3AE4 C;  1ZP0 C;  3D71 A;  1NGM B;  1U57 A;  4H13 C;  1VF5 C;  2QSI A;  3GMA A;  1KIL E;  3S9O A;  4XFJ A;  3Q1M A;  1TU3 F;  3Q2Y A;  1EXI A;  2E75 C;  4TT3 H;  2D2C C;  1UIX A;  1R8E A;  2V7Q J;  2NZ2 A;  1ZOY C;  2ZT9 D;  3Q5R A;  2QJP C;  3AE1 C;  3AE5 C;  4PV1 B;  1KQF B;  1JB0 J;  1AJY A;  2ZT9 C;  1OMI A;  1YQ4 C;  2E74 D;  4H13 B;  4R4L A;  2H89 C;  1MKM A;  1OW6 A;  2FXP A;  4H0L C;  3AE7 C;  1KQG B;  3D70 A;  2IDB A;  3Q5P A;  3FGA D;  1DD3 A;  2YMK A;  2E75 B;  2WPV B;  3O6Q A;  2D2C B;  2E76 C;  2G8Y A;  4Y28 J;  3SFE C;  2JP3 A;  1FDI A;  1OW8 A;  2WQY C;  5M1B A;  3G9R A;  4OGQ C;  1VL2 A;  2FYN C;  4H44 D;  4I7Z B;  2WSF J;  3IN6 A;  2P10 A;  2J5U A;  3D6Y A;  1K04 A;  4H0L B;  3AEB C;  2WSE J;  1DIP A;  3B71 A;  2BEQ D;  3EWK A;  3GLM A;  3RL0 g;  3AE6 C;  1PV3 A;  3LW5 J;  3AE9 C;  3Q5S A;  3AED C;  1VF5 B;  4RKU J;  4OGQ B;  1EXJ A;  2E74 C;  1PIX A;  4YXD C;  1IK7 A;  2QIW A;  3AEC C;  2FBW C;  3AE3 C;  3R4Y A;  1HF9 A;  3AE8 C;  2JO1 A;  1Q90 D;  2H88 C;  5L8R J;  5KKZ C;  4GDO A;  3AEG C;  3AE2 C;  1KMI Z;  3C8V A;  2ZT9 B;  1ZRT E;  4KT0 J;  3AEF C;  2WSC J;  1DD4 A;  2MKV A;  1GMJ A;  4H44 C;  1Y9B A;  2O01 J;  2E74 B;  4U7J A;  4PV1 D;  1FDO A;  3GF3 A;  3T97 B;  2E76 B;  2QJY C;  4H13 D;  4IL6 X;  1NYH A;  3ABV C;  1K05 A;  4YTP C;  2YIU C;  1YQ3 C;  1RQV A;  2K9Y A;  2OQQ A;  2E75 D;  3GF7 A;  2BEZ F;  2D2C D;  3AEA C;  4H44 B;  1OW7 A;  4Z1M H;  4R4M A;  3RK3 E;  1S5L X;  1S1C X;  4H0L D;  1HJ0 A;  3SFD C;  4I7Z C;  3Q3D A;  3D6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...