2WSCJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determination and Improved Model of Plant Photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wscJ00
2D2CB 2WPVB 4RKUJ 2ZT9B 1JB0J 1VF5B 4OGQB 1Q90D 2E75B 3C8VA 4IL6X 2QJPC 2E76B 2FYNC 2YIUC 2QIWA 2WSFJ 4PV1B 3LW5J 4H44B 5L8RJ 2K9YA 4Y28J 4H0LB 2E74B 4I7ZB 5KLIC 2QJKC 1ZRTE 4H13B 2WSCJ 5KKZC 2O01J 2WSEJ 2QJYC 4KT0J 2QSIA 1S5LX
chains in the Genus database with same CATH superfamily
1GW3A 1JY3P 4PD4H 2FYZA 1DEBA 5CJ0A 1NKZB 1KV4A 1SQQE 3GMAA 4HH2A 3VMAA 5B66H 3I55P 1FZFA 1N8RQ 1NAFA 2B9BA 2GUVA 2KLUA 2KSEA 1LTTC 3H1HD 3SSUA 4B86A 3BCCD 3H25A 2Z4EA 1KTMA 1KILC 1ZXGA 3E1RA 1J1EB 3A2AA 2K1AA 1KB9H 3AE4C 3CL3D 3HTKA 3CCMP 2OYIB 1N7SB 1SQBJ 5APYA 3B5NB 4I2LC 5KAIE 5AVUB 2KIKA 1LTAC 1T2KC 3EWKA 3H1HG 2ITAA 2KK7A 4BWNA 2QE7H 2WSFJ 4GDOA 2ZYDA 2HFED 1HUCA 1HWTC 3EQ2A 2IFMA 4ZKPA 3B5NA 4I7ZB 1L4AA 3L75E 3O6QA 1JNMA 5KKZC 3A5TA 2HPCA 3IR9A 4JBZA 3IFMA 2WSCH 2ZAEB 2C9LY 3CD6P 1FDMA 1CSBA 2Q1KA 5AVSB 3CC7P 1DIPA 1LJ2A 3AE2C 3MP7B 2E76C 3AECC 1SQVK 3CCVP 1KFMA 3H1IE 1LP1B 3AE7C 5CCGC 1N86A 1E79H 5B5EH 1T6AA 4C7NB 4Y99C 2A06E 2QJPC 2IZ1A 3MHVA 3S4RA 2OTJP 3Q1MA 1SFCC 4IL6E 3TNUB 4BRYA 3G9RA 2KNCB 3GF3A 1W2BO 3PH0A 1JMMA 2LXCB 2PRRA 2W8ZA 1W2EA 2WTYA 1VQ4P 1BCCD 2N1TB 3MGNA 3HD7B 1NTKJ 4H0LB 1LTJB 1LWUC 1NTKD 4H13B 3M9BA 2FKWB 2R3SA 3BRTB 1K8AQ 2OYOA 1L0LK 1G2CB 1LTGC 1T3UA 1X22A 1ZN5A 2E5TA 2IBZG 2JWAA 3HE4B 4NPFX 5CJ4A 3A7OA 2IDBA 1M8OB 1SQVE 3W67A 1CW5A 3AE5C 3QH9A 1R5SA 2JEEA 1LT1A 4PD4D 2AXCA 2QJPB 2CPBA 1VQ5P 4Y99B 3V2RA 4DCKA 2B88A 5CBOA 3V6IA 3N4XA 2IFNA 1LT9C 1NHLA 3L73E 5B5EE 3Q5PA 1AVOA 1ZR4A 2HPCB 4A7PA 1FZBA 4ASVA 1S4XA 1BE3G 2JKVA 3M06A 4U7JA 5KAFE 1U7MA 1P84I 5AW2B 2AEFA 2FYNC 3VMYA 2XNXA 1PGQA 4UB8H 1L0ND 1L0LE 2OTKE 1SQXK 2NRGA 2R32A 4U3FE 3L70E 1AFOA 1VQ8P 1IFNA 1PZQA 1BGYD 3L72D 3LIDA 1JCCA 1IFIA 2LR2A 3A0BE 1KYOE 2FYUJ 3WUUA 4UB6E 1DEEG 3A0BH 1KQSO 1KILA 1SQBD 5BVZA 2P7JA 3AEEC 1FS0E 2KS1B 2VRSA 2LXBA 2P58A 3SFDC 2W6AA 4H44C 1A02F 5DJUB 2A45G 2Y0CA 3W68A 1MV8A 3CPWO 1IJDB 2FXOA 1KB9D 1SQVJ 1NWQA 2O1KA 1SQVG 1HH0A 3MZWB 1SFCD 5APWA 1M7LA 3B71A 3FXDA 3LW5H 3RL0C 3T97A 4DT0A 2BASA 1DH3A 1G1JA 3L4FA 4R4LA 1GU4A 1KZUB 3ZDMA 3UIAA 3KQGA 2GM4A 1NU1J 3U59A 4AYCA 3AEGC 5B66E 2WPQA 5GTHE 4GIFA 3PTZA 1WT6A 1ZV8A 3H1LG 1BSNA 2C9NY 1JY2P 1ZW0A 1PPJE 1Y8AA 4JYCA 3MTUE 4AUWA 3KYQA 3R2PA 3M9QA 5L8RJ 2K9YA 1M1JA 4H44D 3L74E 3CI9A 4RO0A 3H1LE 1HVVA 1BE3J 5AVZB 2B87A 2MJZA 2YO2A 4NPDA 1YQ4C 1SQPD 1Y47A 1OX3A 1QL2A 5C39A 1M90Q 2OYHA 1FZEA 1JTHA 1OZHA 2WSSH 1IFDA 5K5GB 1FU1A 1EXJA 4NPEA 2XNDH 1N7LA 2FYNB 3L71J 1FZAA 1GDTA 3HD7D 3P8CD 4H0LD 3T97B 1OW7A 4ASWA 2ZYGA 1KC8Q 5KLVD 1EDIA 1FAVA 1IFJA 3VYIA 2QM7A 1JTHB 1W5CE 1EZVE 2V7QJ 2Y9YA 3AE8C 1GMJA 3L37A 4JF7A 5AVWB 4GOFA 3V5BA 5CCGD 1QL1A 1PV3A 4QMAA 1R8EA 1NTKK 1LTJA 1HGZA 3USSA 3F5HA 4U3FG 1LT9A 1Q2NA 2HODA 3AE6C 2E74D 2KP8A 3CWBJ 4JPZB 4BXLA 1X0TA 1X9VA 1URQB 2QJYC 1KQGB 2KZJA 3IAOA 2XV5A 3HD7C 4H0LC 1NTME 3PLNA 4KT0J 1HTLC 3CWBE 4WBAA 1BE3E 5AVVB 2Q7CA 3RK3B 2FBWC 4HB1A 2PFXA 1QX8A 1SLQA 1FDIA 2Q6QA 3L73G 5DJTB 1YJNP 1GK4A 1JB0J 2FYUG 1P84D 3FWLA 1SFCB 2ZYAA 3WUVA 1S9KD 3KPEA 3CCRP 1SQQD 4GT1A 2HG5D 3GW6A 1AVYA 3PJSK 3KZIE 1LTSC 2B89A 5KAFH 2E76B 1PIXA 4GOEA 1FE6A 1RE4C 3AEBC 2AEMA 3A0HE 1J1EC 3B4SA 1K73Q 3TNUA 3H1KD 1L2PA 4N78D 1Q86Q 3CX5E 1SQXE 1IZNB 2FXMA 2QJYB 2YKQA 3H1JE 4K3AA 2ZVOB 4TT3H 4ZKUA 1R5LA 5KLIC 2QJKC 1CI6B 3GHGA 1DD4A 1LNQA 1NU1G 2GUSA 2R5DA 3L35A 1S5LX 5APUA 1OWAA 3H1LJ 4Z1MH 3SWYA 1NTZD 1USDA 1LWUA 5GTIE 3Q3DA 2RMZA 3RK2D 1GL2D 2JJLA 4JQ0D 4WY4C 4EIJA 3AEFC 5GTIH 3IF4A 1JY2O 3R4YA 2N1TD 2KI7B 2ZFCA 3B5NC 3BRVB 1KILE 1LTIC 5H2FE 3CCQP 3TSIA 2WPSA 4IL6X 4WY4B 1RE4A 1J1DB 1Z56A 4D6TE 4RESB 2BCCE 2IPPA 2K88A 1LTBC 2YIUB 3CWBG 5APQA 5AVYB 3MIWA 2I8DA 2IBZD 3WUTA 2WWWA 4WVZA 5CCHC 2JDIH 2YIUC 2YKPA 3L75G 3P32A 1URQC 2PP6A 1RQVA 2WVRA 3L75J 1S1CX 5AW7B 4L75A 5KLIB 3P7KA 1NO4A 3V2PA 3TYYA 5EFWB 3RK3E 1JOCA 2Q5UA 3CCLP 1EC5A 1MFTA 5TISH 2JR8A 2NZ2A 2W27A 3AEDC 4LGDE 2YXRB 4KHXA 3AEAC 1PP9E 2KXPB 1NU1D 3V2NA 1L4AC 1XTGB 2K37A 1AA0A 1LTJC 1LWUB 1ZRTD 2FYUK 1N7SC 3F89A 4H13C 5BU8B 1YIJP 2R44A 1P84H 1BCCG 2N9YB 1BCCJ 2CK3H 1AV1A 1MZ9A 3EFFK 1S5LH 2JWDA 1SQQG 2LKMA 4PD4E 1VQPP 2E42A 3D70A 1VQNP 1ZOYC 2BEZF 1GL2A 1L0LG 2E76D 3PRJA 5AW1B 2M0BA 2L5GB 5AVTB 3L73D 2OYHB 5AW3B 2BCCJ 4I7ZC 2BCCG 3I56P 2ZXEB 3JC22 4H44B 5CCHA 3L71D 1FC2C 1BGYJ 1JY2N 1KB9I 1L0LD 1M57D 1PPJG 2FY8A 1DD3A 1OIPA 2WPRA 3L70D 5APVA 1FBMA 2KYVA 2P2UA 1X79B 3L72E 4IFDK 2XDJA 1GU5A 2PGDA 3CXHD 1RF0C 2OYIC 4W7YA 1NTMK 2YMKA 2J59M 3C9IA 2E74C 4IOIH 1H0TB 3L71G 3L72G 1SQQK 3L72J 5APTA 1KORA 1VL2A 3FX0A 1Q90D 2K3RA 3GG2A 3JCUE 2OYIA 1JUNA 3CCJP 3AE9C 3PHLA 1JY3N 3E7KA 1KFNA 1WMKA 3GHGC 1SQPJ 1SQPG 4I6MC 3BCCE 2ZT9C 4PV1D 3CCUP 2POHA 3GF7A 3D71A 1VQOP 4KJMA 3L75D 2A06G 3M0DA 1YJWP 2D2CD 1BDCA 3A0HH 3BATA 3L74J 1AQTA 3HE5A 3D6ZA 2NPSD 1FOSE 2BEQD 4M3LA 5KJ7C 3KZIH 1J2JB 1OVUA 4U3FJ 2C0WA 2W6BA 3RK3C 2HR3A 2WSEJ 3HE4A 2WT7A 4LC1A 4W7ZA 1HJ0A 3TGUE 3HUSB 2L91A 2D2CB 2CPSA 3L74D 5CHXA 3VMZA 3L73J 3H1LD 2ZVNB 3CCEP 1MFZA 2ZT9B 2C0XA 1VDFA 1XTCC 1AQ5A 4XFJA 1HF9A 1PFIA 3AE3C 1NVOA 4C7RA 1EDLA 2J58A 3VMXA 3HD7A 5BU5A 1YTZT 1YQ3C 2NPSC 1U7JA 1KILB 1TU3F 3WU2E 4RJTA 3P8CE 4C46A 5KJ7A 1ZMEC 1NTKE 1U57A 3CMEP 5AVXB 3NXSA 2A06D 2H8PD 4UB8E 2IX7C 3LW5J 2W83C 4L76A 1VQ9P 3I5CA 3TDKA 4TLFA 3L70J 1M1KQ 2QM8A 1RF1B 2N9BA 4N3YB 5KTBA 4BRYB 2HODB 1BCCE 1YHQP 1SQPK 1EDKA 1G1IA 3HUSA 4ZNCA 1J1DC 3MUDC 2YNYA 1L0NG 2V7QH 3KHUA 1IK9A 1GW4A 1IFMA 2O01H 3L74G 1PP9G 1ZLLA 1OVRA 1PP9J 3SWKA 3BCCJ 1LP1A 5KLVK 1BGYG 2HLOA 3C8VA 1SQVD 3CCSP 3H1IJ 1RF1A 2QG4A 3U1CA 1KD1Q 2RH0A 2KLVA 4YXWH 2OTLP 3SWFA 1KN7A 1KYOD 1GZLA 4MN4C 1SQBK 5KJ7D 1H8AA 1P84E 2B87B 1YJ9P 2DW3A 2R5BA 5AW8B 3IN6A 4LLHA 3GLMA 3S1KA 3HUSC 1T3JA 2Y0DA 1M1JB 4PJ0H 1FJKA 2FYUD 1N73C 3TGUJ 4Y28J 1NKNA 1IFPA 5KLVJ 2OQQA 5TISE 1NJIQ 1E5WA 1IC2A 4U3FD 3H1HE 3RGUA 5AVRB 3H1KE 3O8ZA 2KNCA 1RQUA 1BGYE 5AVQB 4XE5B 1SQXD 1G2CA 3FWNA 1K04A 1SS1A 1M56D 2IYPA 3C1LA 1Y9BA 3CX5I 2QJKB 1SQBE 2IBZI 4L73A 2N1TA 1A02J 3V2QA 5AW6B 2E75D 2WSEH 2HYNA 2RKLA 3II6A 4OGQB 1SP4A 1H88A 1VQ6P 1PPJD 1SQQJ 3G3ZA 3H6PA 4HKZH 1MKMA 1T2KD 3ABVC 3L70G 3VP8A 1CZQA 1JY3O 1L0LJ 1Q7YQ 1NU1K 1LT9B 3H1JG 2GA1A 1QEXA 2R3CA 1KILD 3H1JJ 3RL0B 3HE5B 3TK1A 2H43A 1FOSF 2Y0EA 5H2FH 2BCCD 1JM0A 3G6EP 4L74A 1ZR2A 1EQ7A 1RE3A 1GK6A 1EZVG 1SQPE 1L4AB 2M3EA 4K35A 4W80A 1BSHA 4AQRD 1NGMB 4YPCA 1LGHB 1GL2C 1D7MA 1SFCA 2D2CC 2IYOA 3H1ID 1K9MQ 2N1TC 3B5ND 2KZIA 3ITKA 4EDFA 2QVAA 1FDOA 2UWJE 1HGVA 1YBKA 5APXA 1QVGO 3PP5A 2Q3IA 1YYCA 4YXDC 1YTZI 1VQLP 3AE1C 4C7NA 1OXZA 1NTMG 1S2EA 4WY4A 2A45I 3BASA 2NPSB 3TGUG 3A3YB 2SPZA 3VTPC 2H7HA 3U1AA 2WMMA 1EZVI 1WRGA 2KS1A 4HJGH 3OW2O 3CXHH 1KYOH 2AXTH 5CMZA 2Q9IA 2OGUA 2FFDC 1JO5A 2YMYA 3H1KG 1UIIA 3CC4P 4JYBA 1RY3A 3FXEA 3JSVC 1H89A 1VQMP 5KLVE 3HRNA 4I1LA 1Q82Q 4WB4A 3BCCG 3M91A 1RF1C 1BE3D 3WU2H 1KMIZ 3H1IG 2E74B 3M0AA 1BDDA 3N7NA 3SFEC 1URQD 2O1JA 4HYTB 1NTZK 2V4HA 1RE3C 1MUUA 2Z5HA 3NMDA 1SQXJ 3MD0A 1YI2P 1GTWA 2P10A 3M0DC 1M1JC 1RHZB 1KQFB 3V4QA 1S9KE 2P1JA 1GD2E 2E43A 3EFGA 3L71E 3LIEA 2FFDA 4CPGA 4DZOA 5KAIH 4PJ0E 1FZGA 4EYYQ 2YKOA 4PD4I 1L0NE 4EI2A 2RN0A 3CWBD 4OGQD 1OW6A 2MKVA 4YTPC 3S9OA 3CXHE 2XU6A 2OARA 2Q3EA 3RK2C 1FZCB 1L0NK 4H13D 2OYHC 3E1IA 4D6TJ 4IFMA 3H1JD 1RF0A 2WITA 5APSA 1T8ZA 1X8YA 2M5AA 2Z5IA 5M1BA 5AW0B 3Q5RA 1QLED 4GODA 1UIXA 3L36A 3CLQA 1NTZJ 3TF5A 5AW9B 1NTZG 2NPSA 1VF5D 1HJBA 5GTHH 4ZMDA 2K9JA 2XKMA 3JCUH 1NTMJ 1NTZE 1JMBA 1KQLA 1FZCA 1KYOI 1NTKG 2YXQB 1DX7A 2O01J 1N73A 1KB9E 2E5YA 3MUDA 1OVVA 2M5AB 2JO1A 2XZRA 3CX5D 4N78E 3WMM0 3G71P 1URQA 2WT7B 2FXPA 1GL2B 2QRXA 3H1KJ 1SVFA 4N6JA 4OWFA 5TJHA 1Q81Q 3VN0A 3P8MC 4O9BA 1L0NJ 1NYHA 1NH4A 2FFDB 3RK2B 3QWOC 4XA4A 2IBZE 2YO3A 4OH8B 5AW5B 3TGUD 2WSFH 3NFQA 2W90A 5E79H 1N7SD 2QEXP 3CMAP 1NOHA 1SQXG 1PL5A 2E75C 2H89C 3FGAD 2KOGA 3CX5H 3VOPA 3BVHA 3M9HA 3VP9A 4D6TD 4IFFA 1JEKA 1IK7A 1OW8A 2O01N 5KKZB 3K5BA 3H32A 3OA7A 3CXHI 1K05A 1PP9D 1HBWA 2K9JB 2ZT9D 4PV1C 1QGKB 4DOJA 1OFCX 1PGPA 1N2DC 3KDPB 2PAJA 1SQBG 1ZRTE 2M3BA 1VPCA 2WSCJ 4UB6H 4WWIA 1ZP0C 3RBXA 3RL0g 2G8YA 3B8EB 4PV1B 2QSIA 4D6TG 2WZ7A 1EXIA 1EDJA 3H1HJ 2QA4P 1YITP 1S72P 1H0TA 1USEA 1S3JA 2J5UA 4DJGA 2KB7P 2WPVB 3RK3D 1IO4A 3H32B 2H88C 4RKUJ 2JP3A 1EZVD 1VQKP 1VF5B 1CI6A 2I1KA 2E75B 3GHGB 5CCHD 1OMIA 3OAKA 2G3AA 1NU1E 2I1JA 3NTNA 1QVFO 3KXDA 5CBNA 4EOTA 2AEJA 1JCDA 1VF5C 2P67A 2ZXXA 3G4SP 3D6YA 1FJPA 3O6QB 1AJYA 5CCGA 1PGOA 2A45H 3OJAB 4OVNF 2O3JA 5AW4B 2W6JH 4OGQC 2QIWA 1FZCC 3Q5SA 1RH5B 2IZ0A 2M8RA 4GKGA 4IL6H 3RBZA 1NTMD 1NAYA 3Q2YA 2AXTE 2ZJSE 1L4AD 4R4MA 5KLVG 3V4WA 5E79E 1PGJA 2KUBA 2Y9ZA 1VQ7P 4WY4D 2KSJA 3HTKB 2WQYC 1S5LE 1N7SA 1N73B 3RL0D 3CC2P 2FYUE
chains in the Genus database with same CATH topology
1EXJA 1FDOA 3GMAA 4YXDC 2YMKA 2E74C 3AE1C 3H25A 1KORA 1VL2A 4H0LD 1Q90D 1KTMA 3AE4C 3T97B 1OW7A 3AE9C 1WMKA 3AE8C 2V7QJ 1GMJA 2ZT9C 3EWKA 4PV1D 3GF7A 3D71A 2WSFJ 4GDOA 1PV3A 2D2CD 1R8EA 3D6ZA 2BEQD 1KMIZ 3SFEC 2E74B 4I7ZB 3O6QA 3AE6C 5KKZC 2WSEJ 2E74D 2QJYC 4KT0J 1KQGB 1HJ0A 3IAOA 2P10A 4H0LC 1KQFB 1DIPA 2D2CB 2FBWC 3AE2C 2E76C 3AECC 1FDIA 3AE7C 2ZT9B 1JB0J 1HF9A 4XFJA 4OGQD 3S9OA 1OW6A 2MKVA 3AE3C 4YTPC 4H13D 2QJPC 1YQ3C 1TU3F 3Q1MA 2E76B 1PIXA 3Q5RA 3G9RA 3AEBC 3GF3A 5M1BA 1ZMEC 1U57A 1UIXA 1VF5D 3LW5J 4TT3H 4H0LB 5KLIC 2QJKC 4H13B 1DD4A 2O01J 2JO1A 1S5LX 4Z1MH 2IDBA 2FXPA 3Q3DA 3AE5C 1NYHA 3AEFC 3R4YA 1KILE 3Q5PA 3C8VA 4IL6X 4U7JA 2E75C 1PL5A 2FYNC 2H89C 3FGAD 2YIUC 1IK7A 1RQVA 1OW8A 3IN6A 1S1CX 3GLMA 1K05A 4Y28J 2ZT9D 4PV1C 2OQQA 3RK3E 1ZRTE 3RL0g 2WSCJ 1ZP0C 3AEEC 2G8YA 2NZ2A 2QSIA 1RQUA 3AEDC 4PV1B 3SFDC 1EXIA 3AEAC 1K04A 4H44C 2J5UA 2WPVB 1Y9BA 4H13C 2H88C 4RKUJ 2JP3A 2E75D 4OGQB 1VF5B 3B71A 2E75B 1OMIA 2G3AA 1MKMA 4R4LA 3ABVC 3D70A 1VF5C 1ZOYC 2BEZF 2E76D 3D6YA 1AJYA 3AEGC 4OGQC 2QIWA 4I7ZC 3Q5SA 4H44B 3Q2YA 5L8RJ 2K9YA 4H44D 4R4MA 1NGMB 1DD3A 2D2CC 2WQYC 1YQ4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2C B;  2WPV B;  4RKU J;  2ZT9 B;  1JB0 J;  1VF5 B;  4OGQ B;  1Q90 D;  2E75 B;  3C8V A;  4IL6 X;  2QJP C;  2E76 B;  2FYN C;  2YIU C;  2QIW A;  2WSF J;  4PV1 B;  3LW5 J;  4H44 B;  5L8R J;  2K9Y A;  4Y28 J;  4H0L B;  2E74 B;  4I7Z B;  5KLI C;  2QJK C;  1ZRT E;  4H13 B;  2WSC J;  5KKZ C;  2O01 J;  2WSE J;  2QJY C;  4KT0 J;  2QSI A;  1S5L X; 
#chains in the Genus database with same CATH topology
 1GW3 A;  1JY3 P;  4PD4 H;  2FYZ A;  1DEB A;  5CJ0 A;  1NKZ B;  1KV4 A;  1SQQ E;  3GMA A;  4HH2 A;  3VMA A;  5B66 H;  3I55 P;  1FZF A;  1N8R Q;  1NAF A;  2B9B A;  2GUV A;  2KLU A;  2KSE A;  1LTT C;  3H1H D;  3SSU A;  4B86 A;  3BCC D;  3H25 A;  2Z4E A;  1KTM A;  1KIL C;  1ZXG A;  3E1R A;  1J1E B;  3A2A A;  2K1A A;  1KB9 H;  3AE4 C;  3CL3 D;  3HTK A;  3CCM P;  2OYI B;  1N7S B;  1SQB J;  5APY A;  3B5N B;  4I2L C;  5KAI E;  5AVU B;  2KIK A;  1LTA C;  1T2K C;  3EWK A;  3H1H G;  2ITA A;  2KK7 A;  4BWN A;  2QE7 H;  2WSF J;  4GDO A;  2ZYD A;  2HFE D;  1HUC A;  1HWT C;  3EQ2 A;  2IFM A;  4ZKP A;  3B5N A;  4I7Z B;  1L4A A;  3L75 E;  3O6Q A;  1JNM A;  5KKZ C;  3A5T A;  2HPC A;  3IR9 A;  4JBZ A;  3IFM A;  2WSC H;  2ZAE B;  2C9L Y;  3CD6 P;  1FDM A;  1CSB A;  2Q1K A;  5AVS B;  3CC7 P;  1DIP A;  1LJ2 A;  3AE2 C;  3MP7 B;  2E76 C;  3AEC C;  1SQV K;  3CCV P;  1KFM A;  3H1I E;  1LP1 B;  3AE7 C;  5CCG C;  1N86 A;  1E79 H;  5B5E H;  1T6A A;  4C7N B;  4Y99 C;  2A06 E;  2QJP C;  2IZ1 A;  3MHV A;  3S4R A;  2OTJ P;  3Q1M A;  1SFC C;  4IL6 E;  3TNU B;  4BRY A;  3G9R A;  2KNC B;  3GF3 A;  1W2B O;  3PH0 A;  1JMM A;  2LXC B;  2PRR A;  2W8Z A;  1W2E A;  2WTY A;  1VQ4 P;  1BCC D;  2N1T B;  3MGN A;  3HD7 B;  1NTK J;  4H0L B;  1LTJ B;  1LWU C;  1NTK D;  4H13 B;  3M9B A;  2FKW B;  2R3S A;  3BRT B;  1K8A Q;  2OYO A;  1L0L K;  1G2C B;  1LTG C;  1T3U A;  1X22 A;  1ZN5 A;  2E5T A;  2IBZ G;  2JWA A;  3HE4 B;  4NPF X;  5CJ4 A;  3A7O A;  2IDB A;  1M8O B;  1SQV E;  3W67 A;  1CW5 A;  3AE5 C;  3QH9 A;  1R5S A;  2JEE A;  1LT1 A;  4PD4 D;  2AXC A;  2QJP B;  2CPB A;  1VQ5 P;  4Y99 B;  3V2R A;  4DCK A;  2B88 A;  5CBO A;  3V6I A;  3N4X A;  2IFN A;  1LT9 C;  1NHL A;  3L73 E;  5B5E E;  3Q5P A;  1AVO A;  1ZR4 A;  2HPC B;  4A7P A;  1FZB A;  4ASV A;  1S4X A;  1BE3 G;  2JKV A;  3M06 A;  4U7J A;  5KAF E;  1U7M A;  1P84 I;  5AW2 B;  2AEF A;  2FYN C;  3VMY A;  2XNX A;  1PGQ A;  4UB8 H;  1L0N D;  1L0L E;  2OTK E;  1SQX K;  2NRG A;  2R32 A;  4U3F E;  3L70 E;  1AFO A;  1VQ8 P;  1IFN A;  1PZQ A;  1BGY D;  3L72 D;  3LID A;  1JCC A;  1IFI A;  2LR2 A;  3A0B E;  1KYO E;  2FYU J;  3WUU A;  4UB6 E;  1DEE G;  3A0B H;  1KQS O;  1KIL A;  1SQB D;  5BVZ A;  2P7J A;  3AEE C;  1FS0 E;  2KS1 B;  2VRS A;  2LXB A;  2P58 A;  3SFD C;  2W6A A;  4H44 C;  1A02 F;  5DJU B;  2A45 G;  2Y0C A;  3W68 A;  1MV8 A;  3CPW O;  1IJD B;  2FXO A;  1KB9 D;  1SQV J;  1NWQ A;  2O1K A;  1SQV G;  1HH0 A;  3MZW B;  1SFC D;  5APW A;  1M7L A;  3B71 A;  3FXD A;  3LW5 H;  3RL0 C;  3T97 A;  4DT0 A;  2BAS A;  1DH3 A;  1G1J A;  3L4F A;  4R4L A;  1GU4 A;  1KZU B;  3ZDM A;  3UIA A;  3KQG A;  2GM4 A;  1NU1 J;  3U59 A;  4AYC A;  3AEG C;  5B66 E;  2WPQ A;  5GTH E;  4GIF A;  3PTZ A;  1WT6 A;  1ZV8 A;  3H1L G;  1BSN A;  2C9N Y;  1JY2 P;  1ZW0 A;  1PPJ E;  1Y8A A;  4JYC A;  3MTU E;  4AUW A;  3KYQ A;  3R2P A;  3M9Q A;  5L8R J;  2K9Y A;  1M1J A;  4H44 D;  3L74 E;  3CI9 A;  4RO0 A;  3H1L E;  1HVV A;  1BE3 J;  5AVZ B;  2B87 A;  2MJZ A;  2YO2 A;  4NPD A;  1YQ4 C;  1SQP D;  1Y47 A;  1OX3 A;  1QL2 A;  5C39 A;  1M90 Q;  2OYH A;  1FZE A;  1JTH A;  1OZH A;  2WSS H;  1IFD A;  5K5G B;  1FU1 A;  1EXJ A;  4NPE A;  2XND H;  1N7L A;  2FYN B;  3L71 J;  1FZA A;  1GDT A;  3HD7 D;  3P8C D;  4H0L D;  3T97 B;  1OW7 A;  4ASW A;  2ZYG A;  1KC8 Q;  5KLV D;  1EDI A;  1FAV A;  1IFJ A;  3VYI A;  2QM7 A;  1JTH B;  1W5C E;  1EZV E;  2V7Q J;  2Y9Y A;  3AE8 C;  1GMJ A;  3L37 A;  4JF7 A;  5AVW B;  4GOF A;  3V5B A;  5CCG D;  1QL1 A;  1PV3 A;  4QMA A;  1R8E A;  1NTK K;  1LTJ A;  1HGZ A;  3USS A;  3F5H A;  4U3F G;  1LT9 A;  1Q2N A;  2HOD A;  3AE6 C;  2E74 D;  2KP8 A;  3CWB J;  4JPZ B;  4BXL A;  1X0T A;  1X9V A;  1URQ B;  2QJY C;  1KQG B;  2KZJ A;  3IAO A;  2XV5 A;  3HD7 C;  4H0L C;  1NTM E;  3PLN A;  4KT0 J;  1HTL C;  3CWB E;  4WBA A;  1BE3 E;  5AVV B;  2Q7C A;  3RK3 B;  2FBW C;  4HB1 A;  2PFX A;  1QX8 A;  1SLQ A;  1FDI A;  2Q6Q A;  3L73 G;  5DJT B;  1YJN P;  1GK4 A;  1JB0 J;  2FYU G;  1P84 D;  3FWL A;  1SFC B;  2ZYA A;  3WUV A;  1S9K D;  3KPE A;  3CCR P;  1SQQ D;  4GT1 A;  2HG5 D;  3GW6 A;  1AVY A;  3PJS K;  3KZI E;  1LTS C;  2B89 A;  5KAF H;  2E76 B;  1PIX A;  4GOE A;  1FE6 A;  1RE4 C;  3AEB C;  2AEM A;  3A0H E;  1J1E C;  3B4S A;  1K73 Q;  3TNU A;  3H1K D;  1L2P A;  4N78 D;  1Q86 Q;  3CX5 E;  1SQX E;  1IZN B;  2FXM A;  2QJY B;  2YKQ A;  3H1J E;  4K3A A;  2ZVO B;  4TT3 H;  4ZKU A;  1R5L A;  5KLI C;  2QJK C;  1CI6 B;  3GHG A;  1DD4 A;  1LNQ A;  1NU1 G;  2GUS A;  2R5D A;  3L35 A;  1S5L X;  5APU A;  1OWA A;  3H1L J;  4Z1M H;  3SWY A;  1NTZ D;  1USD A;  1LWU A;  5GTI E;  3Q3D A;  2RMZ A;  3RK2 D;  1GL2 D;  2JJL A;  4JQ0 D;  4WY4 C;  4EIJ A;  3AEF C;  5GTI H;  3IF4 A;  1JY2 O;  3R4Y A;  2N1T D;  2KI7 B;  2ZFC A;  3B5N C;  3BRV B;  1KIL E;  1LTI C;  5H2F E;  3CCQ P;  3TSI A;  2WPS A;  4IL6 X;  4WY4 B;  1RE4 A;  1J1D B;  1Z56 A;  4D6T E;  4RES B;  2BCC E;  2IPP A;  2K88 A;  1LTB C;  2YIU B;  3CWB G;  5APQ A;  5AVY B;  3MIW A;  2I8D A;  2IBZ D;  3WUT A;  2WWW A;  4WVZ A;  5CCH C;  2JDI H;  2YIU C;  2YKP A;  3L75 G;  3P32 A;  1URQ C;  2PP6 A;  1RQV A;  2WVR A;  3L75 J;  1S1C X;  5AW7 B;  4L75 A;  5KLI B;  3P7K A;  1NO4 A;  3V2P A;  3TYY A;  5EFW B;  3RK3 E;  1JOC A;  2Q5U A;  3CCL P;  1EC5 A;  1MFT A;  5TIS H;  2JR8 A;  2NZ2 A;  2W27 A;  3AED C;  4LGD E;  2YXR B;  4KHX A;  3AEA C;  1PP9 E;  2KXP B;  1NU1 D;  3V2N A;  1L4A C;  1XTG B;  2K37 A;  1AA0 A;  1LTJ C;  1LWU B;  1ZRT D;  2FYU K;  1N7S C;  3F89 A;  4H13 C;  5BU8 B;  1YIJ P;  2R44 A;  1P84 H;  1BCC G;  2N9Y B;  1BCC J;  2CK3 H;  1AV1 A;  1MZ9 A;  3EFF K;  1S5L H;  2JWD A;  1SQQ G;  2LKM A;  4PD4 E;  1VQP P;  2E42 A;  3D70 A;  1VQN P;  1ZOY C;  2BEZ F;  1GL2 A;  1L0L G;  2E76 D;  3PRJ A;  5AW1 B;  2M0B A;  2L5G B;  5AVT B;  3L73 D;  2OYH B;  5AW3 B;  2BCC J;  4I7Z C;  2BCC G;  3I56 P;  2ZXE B;  3JC2 2;  4H44 B;  5CCH A;  3L71 D;  1FC2 C;  1BGY J;  1JY2 N;  1KB9 I;  1L0L D;  1M57 D;  1PPJ G;  2FY8 A;  1DD3 A;  1OIP A;  2WPR A;  3L70 D;  5APV A;  1FBM A;  2KYV A;  2P2U A;  1X79 B;  3L72 E;  4IFD K;  2XDJ A;  1GU5 A;  2PGD A;  3CXH D;  1RF0 C;  2OYI C;  4W7Y A;  1NTM K;  2YMK A;  2J59 M;  3C9I A;  2E74 C;  4IOI H;  1H0T B;  3L71 G;  3L72 G;  1SQQ K;  3L72 J;  5APT A;  1KOR A;  1VL2 A;  3FX0 A;  1Q90 D;  2K3R A;  3GG2 A;  3JCU E;  2OYI A;  1JUN A;  3CCJ P;  3AE9 C;  3PHL A;  1JY3 N;  3E7K A;  1KFN A;  1WMK A;  3GHG C;  1SQP J;  1SQP G;  4I6M C;  3BCC E;  2ZT9 C;  4PV1 D;  3CCU P;  2POH A;  3GF7 A;  3D71 A;  1VQO P;  4KJM A;  3L75 D;  2A06 G;  3M0D A;  1YJW P;  2D2C D;  1BDC A;  3A0H H;  3BAT A;  3L74 J;  1AQT A;  3HE5 A;  3D6Z A;  2NPS D;  1FOS E;  2BEQ D;  4M3L A;  5KJ7 C;  3KZI H;  1J2J B;  1OVU A;  4U3F J;  2C0W A;  2W6B A;  3RK3 C;  2HR3 A;  2WSE J;  3HE4 A;  2WT7 A;  4LC1 A;  4W7Z A;  1HJ0 A;  3TGU E;  3HUS B;  2L91 A;  2D2C B;  2CPS A;  3L74 D;  5CHX A;  3VMZ A;  3L73 J;  3H1L D;  2ZVN B;  3CCE P;  1MFZ A;  2ZT9 B;  2C0X A;  1VDF A;  1XTC C;  1AQ5 A;  4XFJ A;  1HF9 A;  1PFI A;  3AE3 C;  1NVO A;  4C7R A;  1EDL A;  2J58 A;  3VMX A;  3HD7 A;  5BU5 A;  1YTZ T;  1YQ3 C;  2NPS C;  1U7J A;  1KIL B;  1TU3 F;  3WU2 E;  4RJT A;  3P8C E;  4C46 A;  5KJ7 A;  1ZME C;  1NTK E;  1U57 A;  3CME P;  5AVX B;  3NXS A;  2A06 D;  2H8P D;  4UB8 E;  2IX7 C;  3LW5 J;  2W83 C;  4L76 A;  1VQ9 P;  3I5C A;  3TDK A;  4TLF A;  3L70 J;  1M1K Q;  2QM8 A;  1RF1 B;  2N9B A;  4N3Y B;  5KTB A;  4BRY B;  2HOD B;  1BCC E;  1YHQ P;  1SQP K;  1EDK A;  1G1I A;  3HUS A;  4ZNC A;  1J1D C;  3MUD C;  2YNY A;  1L0N G;  2V7Q H;  3KHU A;  1IK9 A;  1GW4 A;  1IFM A;  2O01 H;  3L74 G;  1PP9 G;  1ZLL A;  1OVR A;  1PP9 J;  3SWK A;  3BCC J;  1LP1 A;  5KLV K;  1BGY G;  2HLO A;  3C8V A;  1SQV D;  3CCS P;  3H1I J;  1RF1 A;  2QG4 A;  3U1C A;  1KD1 Q;  2RH0 A;  2KLV A;  4YXW H;  2OTL P;  3SWF A;  1KN7 A;  1KYO D;  1GZL A;  4MN4 C;  1SQB K;  5KJ7 D;  1H8A A;  1P84 E;  2B87 B;  1YJ9 P;  2DW3 A;  2R5B A;  5AW8 B;  3IN6 A;  4LLH A;  3GLM A;  3S1K A;  3HUS C;  1T3J A;  2Y0D A;  1M1J B;  4PJ0 H;  1FJK A;  2FYU D;  1N73 C;  3TGU J;  4Y28 J;  1NKN A;  1IFP A;  5KLV J;  2OQQ A;  5TIS E;  1NJI Q;  1E5W A;  1IC2 A;  4U3F D;  3H1H E;  3RGU A;  5AVR B;  3H1K E;  3O8Z A;  2KNC A;  1RQU A;  1BGY E;  5AVQ B;  4XE5 B;  1SQX D;  1G2C A;  3FWN A;  1K04 A;  1SS1 A;  1M56 D;  2IYP A;  3C1L A;  1Y9B A;  3CX5 I;  2QJK B;  1SQB E;  2IBZ I;  4L73 A;  2N1T A;  1A02 J;  3V2Q A;  5AW6 B;  2E75 D;  2WSE H;  2HYN A;  2RKL A;  3II6 A;  4OGQ B;  1SP4 A;  1H88 A;  1VQ6 P;  1PPJ D;  1SQQ J;  3G3Z A;  3H6P A;  4HKZ H;  1MKM A;  1T2K D;  3ABV C;  3L70 G;  3VP8 A;  1CZQ A;  1JY3 O;  1L0L J;  1Q7Y Q;  1NU1 K;  1LT9 B;  3H1J G;  2GA1 A;  1QEX A;  2R3C A;  1KIL D;  3H1J J;  3RL0 B;  3HE5 B;  3TK1 A;  2H43 A;  1FOS F;  2Y0E A;  5H2F H;  2BCC D;  1JM0 A;  3G6E P;  4L74 A;  1ZR2 A;  1EQ7 A;  1RE3 A;  1GK6 A;  1EZV G;  1SQP E;  1L4A B;  2M3E A;  4K35 A;  4W80 A;  1BSH A;  4AQR D;  1NGM B;  4YPC A;  1LGH B;  1GL2 C;  1D7M A;  1SFC A;  2D2C C;  2IYO A;  3H1I D;  1K9M Q;  2N1T C;  3B5N D;  2KZI A;  3ITK A;  4EDF A;  2QVA A;  1FDO A;  2UWJ E;  1HGV A;  1YBK A;  5APX A;  1QVG O;  3PP5 A;  2Q3I A;  1YYC A;  4YXD C;  1YTZ I;  1VQL P;  3AE1 C;  4C7N A;  1OXZ A;  1NTM G;  1S2E A;  4WY4 A;  2A45 I;  3BAS A;  2NPS B;  3TGU G;  3A3Y B;  2SPZ A;  3VTP C;  2H7H A;  3U1A A;  2WMM A;  1EZV I;  1WRG A;  2KS1 A;  4HJG H;  3OW2 O;  3CXH H;  1KYO H;  2AXT H;  5CMZ A;  2Q9I A;  2OGU A;  2FFD C;  1JO5 A;  2YMY A;  3H1K G;  1UII A;  3CC4 P;  4JYB A;  1RY3 A;  3FXE A;  3JSV C;  1H89 A;  1VQM P;  5KLV E;  3HRN A;  4I1L A;  1Q82 Q;  4WB4 A;  3BCC G;  3M91 A;  1RF1 C;  1BE3 D;  3WU2 H;  1KMI Z;  3H1I G;  2E74 B;  3M0A A;  1BDD A;  3N7N A;  3SFE C;  1URQ D;  2O1J A;  4HYT B;  1NTZ K;  2V4H A;  1RE3 C;  1MUU A;  2Z5H A;  3NMD A;  1SQX J;  3MD0 A;  1YI2 P;  1GTW A;  2P10 A;  3M0D C;  1M1J C;  1RHZ B;  1KQF B;  3V4Q A;  1S9K E;  2P1J A;  1GD2 E;  2E43 A;  3EFG A;  3L71 E;  3LIE A;  2FFD A;  4CPG A;  4DZO A;  5KAI H;  4PJ0 E;  1FZG A;  4EYY Q;  2YKO A;  4PD4 I;  1L0N E;  4EI2 A;  2RN0 A;  3CWB D;  4OGQ D;  1OW6 A;  2MKV A;  4YTP C;  3S9O A;  3CXH E;  2XU6 A;  2OAR A;  2Q3E A;  3RK2 C;  1FZC B;  1L0N K;  4H13 D;  2OYH C;  3E1I A;  4D6T J;  4IFM A;  3H1J D;  1RF0 A;  2WIT A;  5APS A;  1T8Z A;  1X8Y A;  2M5A A;  2Z5I A;  5M1B A;  5AW0 B;  3Q5R A;  1QLE D;  4GOD A;  1UIX A;  3L36 A;  3CLQ A;  1NTZ J;  3TF5 A;  5AW9 B;  1NTZ G;  2NPS A;  1VF5 D;  1HJB A;  5GTH H;  4ZMD A;  2K9J A;  2XKM A;  3JCU H;  1NTM J;  1NTZ E;  1JMB A;  1KQL A;  1FZC A;  1KYO I;  1NTK G;  2YXQ B;  1DX7 A;  2O01 J;  1N73 A;  1KB9 E;  2E5Y A;  3MUD A;  1OVV A;  2M5A B;  2JO1 A;  2XZR A;  3CX5 D;  4N78 E;  3WMM 0;  3G71 P;  1URQ A;  2WT7 B;  2FXP A;  1GL2 B;  2QRX A;  3H1K J;  1SVF A;  4N6J A;  4OWF A;  5TJH A;  1Q81 Q;  3VN0 A;  3P8M C;  4O9B A;  1L0N J;  1NYH A;  1NH4 A;  2FFD B;  3RK2 B;  3QWO C;  4XA4 A;  2IBZ E;  2YO3 A;  4OH8 B;  5AW5 B;  3TGU D;  2WSF H;  3NFQ A;  2W90 A;  5E79 H;  1N7S D;  2QEX P;  3CMA P;  1NOH A;  1SQX G;  1PL5 A;  2E75 C;  2H89 C;  3FGA D;  2KOG A;  3CX5 H;  3VOP A;  3BVH A;  3M9H A;  3VP9 A;  4D6T D;  4IFF A;  1JEK A;  1IK7 A;  1OW8 A;  2O01 N;  5KKZ B;  3K5B A;  3H32 A;  3OA7 A;  3CXH I;  1K05 A;  1PP9 D;  1HBW A;  2K9J B;  2ZT9 D;  4PV1 C;  1QGK B;  4DOJ A;  1OFC X;  1PGP A;  1N2D C;  3KDP B;  2PAJ A;  1SQB G;  1ZRT E;  2M3B A;  1VPC A;  2WSC J;  4UB6 H;  4WWI A;  1ZP0 C;  3RBX A;  3RL0 g;  2G8Y A;  3B8E B;  4PV1 B;  2QSI A;  4D6T G;  2WZ7 A;  1EXI A;  1EDJ A;  3H1H J;  2QA4 P;  1YIT P;  1S72 P;  1H0T A;  1USE A;  1S3J A;  2J5U A;  4DJG A;  2KB7 P;  2WPV B;  3RK3 D;  1IO4 A;  3H32 B;  2H88 C;  4RKU J;  2JP3 A;  1EZV D;  1VQK P;  1VF5 B;  1CI6 A;  2I1K A;  2E75 B;  3GHG B;  5CCH D;  1OMI A;  3OAK A;  2G3A A;  1NU1 E;  2I1J A;  3NTN A;  1QVF O;  3KXD A;  5CBN A;  4EOT A;  2AEJ A;  1JCD A;  1VF5 C;  2P67 A;  2ZXX A;  3G4S P;  3D6Y A;  1FJP A;  3O6Q B;  1AJY A;  5CCG A;  1PGO A;  2A45 H;  3OJA B;  4OVN F;  2O3J A;  5AW4 B;  2W6J H;  4OGQ C;  2QIW A;  1FZC C;  3Q5S A;  1RH5 B;  2IZ0 A;  2M8R A;  4GKG A;  4IL6 H;  3RBZ A;  1NTM D;  1NAY A;  3Q2Y A;  2AXT E;  2ZJS E;  1L4A D;  4R4M A;  5KLV G;  3V4W A;  5E79 E;  1PGJ A;  2KUB A;  2Y9Z A;  1VQ7 P;  4WY4 D;  2KSJ A;  3HTK B;  2WQY C;  1S5L E;  1N7S A;  1N73 B;  3RL0 D;  3CC2 P;  2FYU E; 
#chains in the Genus database with same CATH homology
 1EXJ A;  1FDO A;  3GMA A;  4YXD C;  2YMK A;  2E74 C;  3AE1 C;  3H25 A;  1KOR A;  1VL2 A;  4H0L D;  1Q90 D;  1KTM A;  3AE4 C;  3T97 B;  1OW7 A;  3AE9 C;  1WMK A;  3AE8 C;  2V7Q J;  1GMJ A;  2ZT9 C;  3EWK A;  4PV1 D;  3GF7 A;  3D71 A;  2WSF J;  4GDO A;  1PV3 A;  2D2C D;  1R8E A;  3D6Z A;  2BEQ D;  1KMI Z;  3SFE C;  2E74 B;  4I7Z B;  3O6Q A;  3AE6 C;  5KKZ C;  2WSE J;  2E74 D;  2QJY C;  4KT0 J;  1KQG B;  1HJ0 A;  3IAO A;  2P10 A;  4H0L C;  1KQF B;  1DIP A;  2D2C B;  2FBW C;  3AE2 C;  2E76 C;  3AEC C;  1FDI A;  3AE7 C;  2ZT9 B;  1JB0 J;  1HF9 A;  4XFJ A;  4OGQ D;  3S9O A;  1OW6 A;  2MKV A;  3AE3 C;  4YTP C;  4H13 D;  2QJP C;  1YQ3 C;  1TU3 F;  3Q1M A;  2E76 B;  1PIX A;  3Q5R A;  3G9R A;  3AEB C;  3GF3 A;  5M1B A;  1ZME C;  1U57 A;  1UIX A;  1VF5 D;  3LW5 J;  4TT3 H;  4H0L B;  5KLI C;  2QJK C;  4H13 B;  1DD4 A;  2O01 J;  2JO1 A;  1S5L X;  4Z1M H;  2IDB A;  2FXP A;  3Q3D A;  3AE5 C;  1NYH A;  3AEF C;  3R4Y A;  1KIL E;  3Q5P A;  3C8V A;  4IL6 X;  4U7J A;  2E75 C;  1PL5 A;  2FYN C;  2H89 C;  3FGA D;  2YIU C;  1IK7 A;  1RQV A;  1OW8 A;  3IN6 A;  1S1C X;  3GLM A;  1K05 A;  4Y28 J;  2ZT9 D;  4PV1 C;  2OQQ A;  3RK3 E;  1ZRT E;  3RL0 g;  2WSC J;  1ZP0 C;  3AEE C;  2G8Y A;  2NZ2 A;  2QSI A;  1RQU A;  3AED C;  4PV1 B;  3SFD C;  1EXI A;  3AEA C;  1K04 A;  4H44 C;  2J5U A;  2WPV B;  1Y9B A;  4H13 C;  2H88 C;  4RKU J;  2JP3 A;  2E75 D;  4OGQ B;  1VF5 B;  3B71 A;  2E75 B;  1OMI A;  2G3A A;  1MKM A;  4R4L A;  3ABV C;  3D70 A;  1VF5 C;  1ZOY C;  2BEZ F;  2E76 D;  3D6Y A;  1AJY A;  3AEG C;  4OGQ C;  2QIW A;  4I7Z C;  3Q5S A;  4H44 B;  3Q2Y A;  5L8R J;  2K9Y A;  4H44 D;  4R4M A;  1NGM B;  1DD3 A;  2D2C C;  2WQY C;  1YQ4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...