2WSFC

Improved model of plant photosystem i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
81
structure length
81
Chain Sequence
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 3
structure length 81
sequence length 81
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2wsfC00
1C4AA 1GTHA 2FJEB 2FDNA 2XSJA 1FRHA 1C4CA 5L8RC 1Y5NB 2VPYB 1Y4ZB 4OV1A 3MM5A 2GMJA 2PA8D 1BQXA 3MM6A 2WSFC 2FJBB 4RKUC 2C3PA 1DAXA 3IR7B 1PC4A 1BWEA 1Q16B 7FD1A 1JNZB 3EUNA 3HKZD 3MM7B 3OR2B 2O01C 2VPWB 3OR1B 1B0TA 1FRKA 1AXQA 3MMCB 2VKRA 3IR5B 1Y5LB 1Y5IB 3MM5B 3MM9B 2PDAA 1H0HB 1H7XA 3MM6B 4CI0B 2WSCC 1A6LA 4XDCA 3MMAB 2C3MA 1FRMA 1DFDA 2Z8QA 2C3YA 5E7OB 6FDRA 4ID8A 2FD2A 2C3UA 1KQGB 3PNIA 7FDRA 1FRJA 1GTEA 1KQFB 2ZVSA 1FDAA 4Y28C 1IR0A 1H7WA 3OR2A 4YDDB 5BYRA 1JNRB 1WTFA 1CLFA 3MMCA 2IVFB 2WB1D 1JB0C 1FTCA 1F5CA 2V4JB 1B0VA 1FCAA 1FDNA 1FRLA 1FD2A 5FD1A 3LW5C 1HFEL 2UZAA 1KEKA 1RGVA 1SIZA 2FJAB 1FF2A 1F2GA 1ROFA 1PC5A 6FD1A 5BYSA 1D3WA 3MMBA 1FEHA 4AYBD 1G3OA 1F5BA 1FERA 1R27B 1GT8A 2VPZB 2WAQD 5CH7B 5BYQA 1FXRA 2WSEC 2V4JA 2GMHA 4L6V3 1K0TA 1IQZA 2PMZD 2Y0SD 3MM8A 3MMAA 1FDDA 1SIWB 4XDDA 3EGWB 1BLUA 1B0PA 3MM7A 1DURA 3IR6B 3OR1A 1FRIA 3MMBB 1FDBA 1FRXA 2XSJB 3MM9A 1FXDA 5CHCB 4DHVA 4KT0C 2V2KA 1BC6A 1GAOA 1G6BA 3MM8B 2C42A 1BD6A 2FJDB 2VPXB 4OMFG 1VJWA 3GYXB 2FGOA 3EXYA 2C3OA 4XK8C 1H98A 1SJ1A 3C8YA 1XERA
chains in the Genus database with same CATH superfamily
5D6GA 1GX6A 3D68A 3O2IA 4RBVA 2V9KA 3N0VA 1HMVA 4X65F 2AJ1A 2R2RA 2IY5B 4P74A 4OZ0A 1VIXA 4WXOA 2MKIA 3UCUP 1CEZA 2FHOB 4P7VA 3O3LA 3UWTA 4EBEA 2DGVA 1OPZA 4M1KA 4OZLA 2EPIA 2LQBA 2VG6B 2MKJA 1RT5A 3OXFA 4P2XA 2DRBA 1S9GA 2GV1A 3VVUA 3RAXA 4K2JA 2XCPA 3MR3A 2KHCA 3PJWA 3KHLA 2ASLA 4DSFA 1SH2A 3KG1A 3IRXB 2XWXA 3KMSA 1DHMA 4CZCA 3MEEA 4AQYJ 2G13A 4DZ6A 4DX7A 4CLKA 1D1UA 2XMKA 3KLGB 3GPAA 1UPPA 4DV4F 1M1HA 4IFYA 3ZNUA 3OR1B 5HQLA 2JLGA 5D4PA 4DUYF 4B3OA 1HNZF 2KB2A 3KYLA 1RTDA 5K8NA 4NPOA 3ZTRA 4DN0A 3DU6A 2HRYA 1FKOB 1Y5IB 3FEXB 4NI2A 3A1YG 2DNRA 3A8JA 1BWVA 2GGPB 3AJ2A 1ACMB 4IDKA 4Y0FA 2BRKA 1LNQA 2MGZA 2X3GA 3N9UC 1YJ9S 1SQFA 3D6HB 2FZGB 4KGXB 2DY9A 2M5YA 4FYWB 1EKSA 1FFGB 5KFJA 4QWCA 1HBMA 1LWCB 2AEJA 2FD2A 3WBZA 1N32F 2QLXA 2R2UA 2CJYB 1RB0A 2P9CA 3HD2A 5C24B 2LQ5A 1VQ6S 1AZSB 3NS5A 4KKOA 4AFFA 2QYCA 1ITPA 4CNYA 2V67A 5KG0A 2DTJA 2OI2A 3BR9A 1CLFA 2YQ3A 1UVLA 1K0VA 2NSBA 3M8WA 2IC3A 3WX8A 3MWBA 4WYLA 4Y34A 4O3QA 1NKEA 1OYDA 1FTCA 2OEMA 4C8NA 3T6JA 5AJ3J 3M30B 3PW0A 2ZDPA 2V2QA 4J9OA 2HLTA 2VC0A 4UF4A 4K50A 1F1BB 2CPHA 1RTZA 3LGNA 4RNNA 1NJIT 1FD2A 3AHPA 3C14A 3JQJA 3DLGA 2UZAA 4ZN1A 2N4DA 2ZKTA 1IXKA 1PC5A 2FIUA 4O3PA 2EC0A 2VKZG 1MG7A 1LWEA 1NPKA 2KT3A 2ASDA 3THTA 1VC5A 1LXJA 1N8RT 1U8WA 1PO6A 3R6GB 2Q3PA 2V8GA 3FMWA 2VPZB 3QMQA 4BC9A 3BJYA 4NXNF 5H9FJ 3V4MA 4Z2XA 8AT1B 5L9NA 1PYSB 4TYBA 1OSDA 4ZVTB 1VQ4S 2G1DA 4DQRA 4ATNA 3WIUA 3MMAA 1RHQB 3RW7A 1JWWA 1VQPS 1WC5A 1IBKJ 1QSYA 3Q83A 4DOZA 5BXIA 4RUCA 5JVHQ 3BPSP 2N82B 2F8MA 3LALA 1B0PA 2A6MA 5F3TA 3G8SA 1NPRA 3AXMA 3OR1A 5AE1A 2XMMA 3PG9A 3KG0A 3ZZZA 2JNJA 1APSA 2RMLA 2EFVA 1JLFB 1T0TV 4KFBB 1FXDA 4USWA 3R3TA 2GGPA 2LQ9A 2VV5A 4RW8A 4RNOA 2NYIA 2WCXA 2V2KA 4EFAC 2VF3A 1ZTTA 4WKRA 2IBOA 5E2QA 1WEXA 1GK8A 1VMBA 4OMFG 1TKXA 4I6WA 2HHSA 4F3OA 4TU7A 1GMUA 1Q8LA 4B9VA 3BV8A 1LK7A 1N0UA 4NLPA 1TP7A 4X4QA 2ZM6F 3M4XA 1WKKA 4ZCKA 2HFZA 3TEGA 1ZAXA 1Z4UA 4DV7F 3TAMB 3CCMS 2BKOA 3D6FB 1IM6A 3W3SA 3DRSB 2FJEB 5KG4A 3CDBA 1YHQS 1NRKA 1UEUA 1U09A 4NA2A 1Q81T 4DEZA 4X4PA 2XWYA 4FVCA 1X5SA 4K7QA 3FSYA 3DYAA 3TVKA 1H2UX 1BQXA 4BHQA 2R7RA 3MM6A 3BN4A 1GXLA 3LO3A 2CJQA 3LP2A 4NZ0A 1TKTA 2KL8A 3DGVA 3F41A 2LLZA 3RGIA 3VR1A 3U1NA 4EK2A 1SPBP 1GMVA 3HHDA 3MAHA 1VYAA 4HI2A 1MW7A 5I4MA 2AJ0A 2JJ4D 2XMAA 4WBFA 1S6QB 1NUEA 1ZZNA 4FVMA 3CDAA 2BE7D 3S7RA 2AYMA 2F40A 2DB1A 1IJFB 2BYCA 4E8UA 3M8SA 2QA4G 1FESA 1N56A 1D9FA 1R43A 5JJBA 3KK3A 4LREA 4DR1F 3TX8A 4ZP8A 1FJGJ 2ZZMA 2EFOA 2VKRA 1XNQJ 1EETA 3EE3A 1RSCA 4JI5F 4W90B 2PDAA 1WF0A 2CPYA 4CO2A 4PXDA 4RUBA 3GZ7A 4F2RA 4L3KA 1R8PA 4KQZA 4DV6F 4DFKA 4NOHA 3BN7A 2QMXA 3NBPA 2V6AA 5GAHU 1IBCB 2YWHA 3ZTOA 3GLJA 3HVRA 2VJVA 3HP6A 4ILLA 2KO1A 2BJ7A 3VTIA 2BOPA 2IBKA 2C3UA 2AEMA 7FDRA 2K2PA 1RYSA 2VG7A 3P49B 4HEA9 3TYTA 1H74A 1M5VC 3JTOA 4ZOSA 1V3SA 3HZEA 2J9EA 4WE1B 2J9DA 3U1LA 4JI1F 1CJTB 1TL7B 2Y1JA 2EEYA 1S77D 1QVFR 2XMUA 4CLWA 4M5MA 1N34F 4GVLA 3WZ0A 3ILLA 3PJXA 4IO9Q 2M8DB 3GONA 3DRYA 2CQCA 1F9FA 2DR6A 2HNZB 3FQLA 4B9MA 3GU0A 2WB4A 3FUYA 3H4DA 3DOKB 5FLXY 2R7TA 1M1GA 4ES1A 4DFMA 2MQQA 1CC8A 2Z58B 4HL9A 4CTAB 1VQMS 2A0FB 2RF2A 1LW2A 2D74B 3NOGA 4U8YA 3ZO7A 4A8FA 3MPVA 2BABA 4AYBD 2KXNB 3TJAA 5KFAA 3EZ5A 4U6PA 5I42B 1KVIA 4MIAA 4P6QA 5CH7B 2GIRA 4OX8A 5DDRC 4G3IA 4GKKF 2MHNA 4NZ6A 2UVVA 2Y3YA 2GMHA 5AT1B 3I0SB 3IRWP 2OPSA 2NZ4A 5FJ4A 4DWIA 4RZRA 3HD1A 2V2VA 5E0OA 3ILIA 3KDOA 5LMUF 1YI2S 2HHHF 4ZPCA 1SIWB 5K20B 3IBFB 3DOKA 1UWBA 4K59A 4K4WA 3ENWA 3K5OA 4CLTA 4ERDA 3ETMA 2EFQA 1YK9A 5G0RB 4JI6J 1X4BA 3HVTB 2HQ3A 1C2PA 1WHWA 3E8OA 3GR0A 1IKVB 1RP5A 4KGKA 3CJQA 4TLRA 1EETB 4A48A 3R1LA 1PGZA 1NCLA 1VFJA 2L9WA 1Q86T 4F4KA 2ZBQA 3UNGC 3OTOJ 1WG4A 3CCLS 3DLEA 1GFWB 4DCJB 2B7CB 3I0SA 3VF0B 4F02A 1GAOA 3ISNC 5EGYA 3AJDA 2C42A 2FJDB 3DC2A 3J81U 2BE2B 3VAFA 2YWKA 1NXIA 1X4EA 2LDIA 2HS0A 2LDYA 1L3KA 1QSSA 2QJ3A 2BQRA 2XNRA 3CTRA 4M5HA 3JB9k 3N01A 2PN6A 3D5MA 3IO1A 3QAUA 5DG7A 2NZCA 3BBCA 1R8BA 2MLXA 4WPAA 3U7JA 3V6KA 1S48A 2V8PA 5J2NA 4F04B 5HP1A 1L3UA 1Q78A 2POKA 3R97A 3POTA 1HNWJ 4LSNB 1TUGB 1YBAA 4RL1A 2WZ1A 3QLHB 2OEJA 1WI6A 4DR5J 2UU9J 5A76A 1K44A 3W8GA 4Y2CA 1MMLA 2HFNA 2IVYA 2Z2ZA 3N5FA 4EMDA 5E41A 1RT6B 2IJRA 3EPIA 5L1LA 2ZJRQ 1K47A 1M0SA 4PG4A 4IOCQ 5ETPA 1KFSA 3TZXA 2RAQA 7FD1A 1OWXA 3H2UB 1MWQA 3L7OA 3QGIA 4LIRA 1QSLA 4W92B 2XM3A 3W9HA 3HKZD 4DI6A 2W2OP 3CJKA 4L76A 2I9SA 3B4MA 3L4BC 4IH5A 3VHQA 3DRXA 2A18A 4PYDA 3OD2A 1SL1A 4I2QA 3LP1A 1UFLA 2B9YA 2CQBA 3JSYA 3TZWA 2ZJQQ 3F44A 2FGCA 4LR9A 4HH0A 4XO0A 4Q0BA 4OI2A 2C28A 2YKNA 4YB6A 4B3TJ 3QO9A 1G4CA 5A8KA 3K7RA 3SQGA 3OW2R 1T03B 2VFUA 2B4PA 2QSWA 4QWAA 1KQFB 4PEOA 4Y28C 4QYZJ 3OFEA 4FS1A 3CJ4A 4DR5F 1XBWA 1U6BA 3FCWA 4DR4J 1XIQA 2X51A 3V6HA 1CC7A 4I7FA 2B0GA 3DRSA 4OHYA 5CYMB 1AB8A 2VFSA 4QIFA 4QIEA 4DUZF 4LF5F 1RA6A 2AF6A 2M2BA 1G7CB 3OUYB 2XGPA 2VICA 4P7TA 3DYAB 3UPFA 1S0OA 3M8YA 4NLUA 3VGSA 2MDAA 2M52A 3FQKA 5A8KB 2JFKA 4CIOA 2QG9B 1QUVA 4WFZA 1WEZA 2BJ1A 2PIIA 1LK5A 1T3OA 1Y3KA 3GTYX 2VHGA 1TL5A 2HBYB 1FF2A 3GSDA 2MQOA 1ROFA 4ED6A 3Q2TC 2JEIA 1XR7A 4LF7J 3N4WA 3FSIA 2MZSA 3M05A 2KI2A 1FK9B 2PD1A 4C8OA 2ZH7A 4B9LA 2F4VF 5BYQA 4J91A 4NMLA 1EP4A 3N6MA 4O4GB 3IN5A 1B4SA 2OELA 4JI2F 3EJMA 3MUMP 4CO1A 4EYHB 3DNCA 4CH0S 3K5LA 1EAYC 3Q23A 2EFPA 4R8UA 3BQ2A 2ASJA 2OIHA 4JI0J 4LF4F 4HLBA 4A4JA 2DNHA 2N3OA 1RKJA 2H5IB 7AT1B 4C0OC 3V6DB 4GKJJ 1RA7A 1J2VA 3PKYA 2LP4A 2YH0A 3R27A 3TX0A 2XY7A 2Y1IA 1KONA 1U45A 3GIKA 1NU4A 3K8VA 2V0NA 5D15A 3PFEA 3E01B 4NCGB 3J7YU 3H8YA 3TO8A 4K2XA 1T9TA 2HBZB 2WBRA 1AT1B 2HKEA 3BEGB 3CDEA 4Q7AA 2Z2MA 1PAUB 2HVZA 1U24A 3MM8B 4A8QA 1BD6A 2BANB 2CNOB 2DPJA 1NO8A 3GCWP 5E33A 4DQIA 1KC8T 3SV4A 4P2SA 1N36J 2ZH6A 1HYSA 1CULA 1HNVB 2HLUA 2HEKA 3GIMA 4NLWA 2DO0A 1RCOB 3PW4A 3C3LA 3KLHB 3C8YA 1E6VB 3D7SB 4I1TA 1DTQA 3QT6A 3Q0AA 3TUIC 2ZC3A 1GTHA 2ZBRA 3N79A 4M5DB 1VOMA 4X4NA 3HMJG 3OJSA 2LMIA 2C2DA 3QRPA 1AFIA 3G82A 3JQKA 1OIAA 3MDFA 3O5TB 3I5CA 3RZAA 5MLCV 3PFOA 4NEYA 3O8WA 4A8XA 1QTNB 1KQSR 3TJ8A 3GJRB 2IJNA 2MGZB 4J5OA 4YP3A 3R5BA 1QE1B 5IQ6A 4ED4A 1Y00A 3J81j 1YRTA 1I1GA 4QCLA 1IKWB 1S1VB 2BUNA 3LAMA 3T5KA 1QDUB 3PDNA 2CWKA 2KVQE 3GG1A 3P3DA 2EFNA 2KRBA 1RAGB 3DOMA 1NK9A 1N6QB 1NH7A 5D4LA 2ZM6J 4DL5A 2HWHA 3CMES 3CDWA 1Q7YT 2E9ZA 4A46A 4FYXB 2IRYA 1X31C 5K8OA 2HRTA 1YRXA 3CWJA 4U7UK 3S01A 4DFPA 1T05B 3ZTPA 4MIBA 4ZHRB 3NNHA 4ECZA 3J80U 2E7XA 2C3MA 3GG0A 3KHHA 1S9GB 1YJRA 4OIXA 5KFYA 2FLLA 4UZCA 4KV8B 3T5HA 2YNFB 3D66A 4WIIA 3THVA 4UOCA 1SJ4P 2B6AB 2DYAA 5KT3A 1TELA 4C11A 3KJVB 4MKBA 2UVRA 1B7FA 2I38A 2K7KA 2OSQA 5EHHA 4RO0A 2DVIA 1FNMA 4N76A 3GIRA 3HI9A 4ZPTR 4RU2A 2R7XA 1YJUA 3A8EA 1V5VA 1U7LA 3LQVA 4KBIA 2IVFB 2RKIA 4JUZA 3C2PA 1HI8A 2AGQA 4DR6J 4NEZA 4U96A 4DSLA 2E1CA 3UDCA 1Q8BA 5B0FA 4DXLA 3LP0B 2WW4A 2QLWA 4K4XA 2E66A 2HAFA 1FDNA 5HVHA 4WTOB 5DGBA 5DG8A 4ECVA 2FVQA 4X65J 3KHRA 2M8HA 2VBYA 3CJRA 5AXKA 5EWEA 3DMJB 4ZP6A 2JOQA 4USHA 5EWFA 3DN9A 4C11B 3KJVA 2DXDA 4WFYA 4DV3J 4IYQA 1KOHA 1YJTA 5IT0A 3PR4A 1LKZA 3IWXA 1KNZA 2CZVC 5E3QA 2HGLA 3HPOA 4IOAQ 3POTB 4ETZA 3HK2A 3KLFB 2XI3A 2APOA 1GEHA 2WAQD 4BS2A 3TWZA 3CCUS 2HQIA 2DNNA 1REGX 3VVTA 2CPDA 3HLUA 4F0KA 1WNEA 2HIQA 3M6WA 4ZPVR 3PIPQ 1VQOS 1RT6A 1V3ZA 2GZOA 2EW9A 2HNDB 1ZM2A 2RS2A 4MYUA 3BO3A 4A8KA 4F50A 5KFWA 3B4DA 1M1KT 4CO4A 2MY7A 2AMCB 3LPEA 2N7CA 4DDFA 3H40A 2JL9A 4MMOA 3DRRA 1IBLF 2J0XA 2J9DE 4ZP9A 4F36A 2HHXA 4HHHA 3VGUA 4YUDA 2RIJA 2V63A 3ETOA 3OTBA 4LMZA 5I3QA 2BOAA 2R7OA 4KR0B 1U49A 1OJ4A 1I3OB 1NSKL 2I8EA 4OJ3A 4QJVA 1DJ0A 3DLKB 3KFWX 1RT3B 2FLOA 4PXBA 3VCDA 1LFPA 4LSNA 3WX4A 2ZOMA 4A47A 1EKRA 2OLWA 2PA3A 2KYXA 1LWFB 3A3NB 3FFIB 1PYOB 2QSFA 1X7VA 3GYXB 3PCOB 1K73T 2E7WA 4ILMA 4HI1A 4LSZB 5F8JA 1QAYA 3FCVA 4DR3J 3LANA 4G1PA 4B3RF 1U0HA 1C1CA 3W5XA 5IV3A 4X66J 2J7WA 3AD7C 4FYYB 1UEVA 4KIAA 4C98A 5HMXA 1DTTB 5L8RC 3L3CA 2DHGA 1WOSA 2W24A 3FJ2A 4ZPBA 1KR4A 1X9MA 2UUAJ 1N5YB 3DXBA 3I0RB 3BQ0A 2ZZTA 2QL7B 3Q8UA 2XB2D 2ROGA 3T9ZA 3NBPB 4IFVB 1H2VZ 2ZE2B 4LRFA 4CLZA 4TY8B 4J9KA 2QL9B 3OL8A 4ECQA 4ED8A 2VA2A 3V4IA 4PWDB 8ATCB 1VQKS 1LWXA 1PJ5A 2WW8A 3M32B 2OD6A 3UW1A 4YQWA 4FBTA 2BE9B 2ZHAA 2DR7A 1IKXA 1VK8A 1IN0A 5FDLA 2CPJA 2I6WA 2NXJA 4QW8A 2G0CA 2O01C 4AD6A 1A9NB 2VA3A 1PG5B 5LJ3Y 1QJHA 3MPUB 5CXTA 1AROP 3QJLA 5GADU 5GAEU 4C3LA 1VQLS 5CYMA 5ADZA 3NCPA 2BBEA 4JV1A 4YDXA 1RWVB 4LQ3A 1WOOA 4RW9A 3T41A 3G96A 1NJZA 5B09A 1DFDA 4DR3F 3LWLA 1O5JA 4X66F 1KVKA 3R8YA 3M8ZA 3BGLA 3VAKA 2DNOA 3V81B 1N52B 2ACMA 2F9JA 3VAGA 1HNVA 2H65B 1GTEA 1U1OA 4B9NA 2SXLA 2CVEA 2YX4A 4KO0A 4DJBA 4RW6B 3KDNA 5BYRA 1NSPA 4ZMMA 2OMOA 3BB5A 3M9OB 3CCRS 4WCEQ 2YKQA 3HDSA 3VAMA 2AJQA 2HK2A 3R2DJ 5HROB 1JJCB 2WB1D 3OT9A 2EWHA 2KN4A 5HBMA 4FZVA 3H5YA 1LWFA 1NSAA 2X1BA 4CLUA 1V9OA 3W9JA 5B0EA 2BA9A 5AXMA 5KG6A 3DM2B 1DBDA 1TVRB 4B9UA 9RUBA 3O44A 4N5SA 2JLEA 3JTNA 2HQGA 1SL2A 2YVSA 4O44B 2BQUA 2LQ8A 2PGCA 4TN2A 3IRXA 2K7JA 3I82A 1TL1B 3W60A 1LQ9A 4QPTA 4DX8H 4ZJLA 5C7PA 1MROB 4OI3A 4KB7A 1FJCA 2DGOA 3EMTA 4FNHA 1EZZB 2AV5A 2MZJA 2ALZA 4B3OB 3W2WB 1CPZA 2L08A 1YGYA 2QTWA 4M5LA 1OQ6A 2XYPB 4IG0A 1W2BR 1GQEA 2ADBA 4EU0A 1JLCA 2OPQB 1KD1T 1IUJA 4K4VA 4E2FB 4NCAA 3R5AA 2CQ1A 2B43A 4ICLB 1EQ0A 4Y6IA 1S7IA 1B99A 2YKOA 3EGWB 2CNKB 3EGVA 1LW0A 1J5OA 2C2ZB 3MEGB 4OYAA 3MHYA 2F7VA 2UXBJ 3MZIA 3FGVA 2FLNA 4N7TA 1BHNA 2OD4A 3VWSA 3KK3B 3DRPB 3MMBB 1CS4A 1HMVB 3RRKA 1IBMJ 5CHCB 4DSEA 3WDOA 3OL7A 3DXSX 3WHIA 3LGMA 1KHVA 2HPUA 5CQGA 4KYZA 5KFCA 3L7UA 1B64A 3OV7A 4N56A 1P27B 4KV8A 4R0EA 1YBUA 5SZTA 2KH9A 4X4UA 4RUAA 2B6AA 3WC0A 4C0HA 2RU3A 1N0VC 2HNYA 4LF9J 5DQIA 5ETOA 2HWIA 1IKWA 2FGOA 3I31A 1IWGA 4OHXA 3RB6A 2E29A 2HZAA 3E3XA 3NP5A 2LXIA 3SIPB 4Q2MA 2E5HA 4UY85 4OX9F 4CO3A 4TLQA 2HFOA 4NLDA 3RB0A 2J8AA 2FHKA 3HJFA 2AT1B 3PX6A 2OGUA 2IFXA 2WBMA 4QIVA 1ZA1B 3W7BA 2VG5B 3EZOA 4WKYA 1CSJA 4KHMA 1U48A 2GQ2A 1NLKL 1JLEB 1JLAB 3BF4A 3IR7B 2Z57B 4IH7A 1Z1ZA 2QFJA 1FD8A 4LF5J 1RBOB 1XNRJ 4PQUB 3KWMA 3TUZC 5KT5A 3FBFA 2C2EA 2FVPA 1XWLA 2DHSA 5THWA 1VQ9S 2UXDJ 1CJUA 1PAEX 4EEYA 1HI0P 1VQ8S 4UY8T 4KHPF 4C9DA 2AQ4A 4M5GA 4PWUA 3SV3A 3JAMU 3DCAA 3DI6A 4OHVA 3DU5A 4DPOA 4ELUA 4RBTA 3AB4B 2D3ZA 1WC6A 2QZ8A 2E44A 2HBQB 3OQ2A 1NK6A 1D8YA 4ELVA 4LF9F 3KOAA 4XIUA 2UUCF 3W9IA 1FRMA 2OSRA 2KYZA 2ZITA 1ZM4A 3GCXP 3M7VA 2N7YA 3MF5A 4DN9A 3OLBA 1XMQF 1HARA 4LFBF 1GXUA 3AAWB 3B78A 3MTKA 4FYDA 1HQUA 1S99A 1TUWA 3C6TB 3PHEA 3SSRA 2BZ2A 3P45B 1RHUB 1YIJS 1X8DA 2ILYA 2YNGB 4JI8F 5ITHA 1P8GA 4ZLNA 3HF5A 3HULA 1UEKA 1WTFA 3C16A 2QLBB 2RQMA 2DIVA 3DI6B 4OL8A 3QSYB 3GFZA 4GKJF 3KK2A 4NI2B 4RW4B 3R9LA 2DKOB 4U67Q 1G1XA 4R5PB 1SKUB 1RJJA 2E5GA 2H5EA 1M5KC 4DPTA 4LF8J 3FFIA 1N33J 1MN9A 2H9ZA 2CZ4A 2R7QA 2YNHB 2YXLA 3EM1A 1VRTB 2EBEA 4I6AA 4ZVOB 1PIEA 2IRUA 2X7IA 4DU8A 2NXEA 1QAIA 4LFCF 1JMTA 2XCAA 2HBRB 4KHPJ 2B8QA 3QWUA 4R8UB 2GNKA 4F25A 5KFTA 1WDTA 1O51A 1FO1A 3IS9B 2FJAB 3HT0A 5KFVA 3UVJB 1NK5A 4ZDNA 1VCTA 2ZH1A 5JMNA 4AL6A 2ILZA 2A2DA 1RAHB 3CB4A 3CJ5A 3NLCA 5L1IA 1JJ4A 1FEHA 8RUCA 5T41A 4AT1B 1XMQJ 2J76E 4Z37A 4EWTA 3CD0A 4UUWA 1F0XA 3UDVA 2AW0A 3I0RA 3LPYA 2KT5A 2WSEC 3W62A 2ZH3A 4D3HA 2HAIA 1S10A 1UVKA 1CJKB 1N34J 1ZH5A 1UMJA 3DLJA 3P5TL 2Y0SD 3FDSA 3CIZA 2PMZD 1HQ2A 4DL2A 1YBTA 2PMHA 2IIHA 2O5DA 3IGNA 1S72S 2VD3A 2ZH4A 3M1VA 3TVYA 1RT7B 2IM0A 2RT3A 1X5OA 3THPA 1RYRA 2LXFA 1HHSA 3QZ7A 3BKUA 1FEEA 3NKYA 2EKNA 4USIA 3NMAA 1VRUB 3GJQB 2MQPA 2VC1A 4Q43A 2W25A 3TAMA 4NLVA 3U27A 3P4UB 1ZA2B 2UUBF 4ZA1A 1S9FA 1F9HA 2ZWPA 2JRSA 4LF1A 5EX3A 3KMQA 3W64A 3HSZA 2AYBA 1VI7A 4OX7A 1SI9A 1Y7PA 2VPXB 3CJ3A 1DLOB 2OPRA 3IAS9 2RE1A 1S0NA 2GO9A 4YB1P 4KY3A 3FNNA 4P2FA 1HHTP 5HVGA 1T95A 4JOUA 2E5IA 5KFXA 4E98A 5DQHA 1WOPA 2G2OA 1N6QA 1S6PA 2C2RA 1XERA 3ENQA 4R0JA 4HTIA 2W9CB 4CH7A 3H5UA 4DU7A 4RNMA 3SEOA 1TL1A 2W1BA 3OTCA 4ZPAA 4KTQA 2DR5A 1XR6A 2F3JA 2ASYA 1HIYA 3A3OB 3VGVA 1SC6A 3IM8A 2GJFA 4R5PA 3MUTP 3JSMA 5HQ8A 2NREA 2KFNA 2KKHA 5J2PB 3Q22A 3MM5A 3W2WA 1DRZA 1R8CA 2GMJA 1S6OA 1TAQA 2OPPA 3TNVA 2RDIA 4DX6A 3RAQA 2ROEA 2WK4A 5BR8F 1PYTA 3T1YJ 5ETQA 1H2TZ 3AXKA 2OPQA 4W4MA 2Y9HA 4K0KJ 4WFNQ 1RBLA 1YJVA 4WP8A 4DR6F 1AFJA 5KG1A 1FKPA 3K89A 1VLYA 2W2NP 1A0OB 4L73A 3ZZUA 4X4VA 4OV6A 1WF1A 2J6SA 1ZPVA 1DTQB 2DXFA 2KFZA 4I68A 4O3OA 1SKWA 3H59A 4KO0B 4JI2J 4NLQA 2VQFF 1RHJB 2CJKA 4J9UE 2MLZA 2GW8A 4LBIA 4NL5A 4PABA 4OZ5A 2XS5A 3BDPA 1P6TA 4LF4J 4KJIA 4O23A 3MM5B 2ZHBA 5HROA 2Y1LB 3C15A 3RR8A 4NLSA 3JSRA 2CG8A 1JKHB 1M5OC 1SKRA 1A6LA 2CZ9A 4NYPA 4F67A 1U1PA 4ALZA 4HT7A 3RRHA 1X4AA 1ZBTA 1BQNA 1KP6A 4L74A 3PZPA 1FNOA 2BE2A 1S1VA 2A6OA 4YY3F 2HS4A 4UUXA 1RWMB 2Y1RI 1ZAVA 4ZIVA 2UUWA 3BGRA 4NYOA 2QT7A 1FVSA 3D3BJ 1HL6A 1HPZA 3CCWA 5D8HB 2FYXA 2V8DA 3D0IE 3IMQJ 5K5MA 5J2QB 3Q2SC 1P1LA 1KS2A 2A10A 2Z2YB 1URNA 5LJ5Y 1VRQC 1X4FA 3GWCA 1JB0C 3PRBA 4JI4J 3GE9A 5KFNA 3LTOA 2F63A 3PTWA 2W01A 3SFUA 3PYGA 4CM0A 4M8LA 2GVZB 2F4FA 2KVIA 3R1HA 3M6VA 2HMIB 1T9YA 2MKSA 5D0GA 5KFBA 2O67A 1V6HA 4JP8A 5FD1A 5A0YA 2KG1A 3LW5C 2G2YA 4CYUA 2IJFA 2ZNZA 1E6VA 4I2PA 2GCFA 3KLVA 4LIWA 1KEKA 3RW6A 2ZH5A 2V34A 4IH6A 1ZOTA 2HHTA 3D9BA 2UV8A 2AGPA 4F0HA 4F3QA 4I64A 1RTJB 4I0WA 4MKYA 3H0PA 5J2QA 2QFIA 1J5EF 1NHKL 2AZ1A 4ED3A 2HFSA 2VB6A 3QWPA 2YWGA 2ROPA 4DCOB 3PR5B 3GV8B 2R8JA 2OTJS 1JXLA 3VV2B 4D3GA 5B0AA 3M2UA 3W8PA 4WP9A 4KH0B 5K14B 1TK8A 1QAJA 2RRBA 4EZ9A 2QYGA 3LAKA 2W7PA 3DHXA 3H4BA 4ED2A 3RB4A 1SUQB 2F8EX 3NEKA 5U47A 3KJQB 5KAKA 5DLFA 1WDDA 2CJXB 4XPCA 4LRAA 3DLGB 1XQIA 3H2VE 3MEEB 3H42A 2W7AA 4XDDA 1CJUB 3MOZA 2ZUGA 1YSJA 3CDUA 4OZ3A 2G9OA 5M2UA 3KLGA 2X1AA 1M5PC 2FJVA 1KFDA 3TOQA 3BBBA 2D3O1 4ANCA 1LWEB 4WZQA 1RTDB 1HHQA 1S1WB 1U2RA 4ZITA 1QTMA 2LQJA 4JYAF 3K2YA 1SJRA 1FKOA 1S57A 1Q1KA 3UD3P 2PC6A 1VBZA 1XJWB 1UPMB 3FSXA 3W5YA 3PW2A 3NMRA 4MFBB 1X9WA 1RWUA 4RW4A 1AA1B 3W1YC 2IM3A 2OPSB 4MJKA 4MT1A 5AXLA 2VG5A 4PUOB 1BQNB 4Y00A 4USKA 5DO2A 1P1TA 4GC7A 4OQJA 5T7LA 2XYGB 4AXJA 2RILA 1X0PA 2CQ2A 2WONB 3Q8RB 2R8IA 2AKWB 2B4OA 1ZS6A 3G6YA 3NXZA 2WVCA 3D1QA 3D28A 1D0EA 1CQMA 4PXEA 3G9CA 2D69A 1HD1A 1C0UA 1H98A 1KLNA 1KTQA 4PG6A 5H9EK 1S97A 3QRRA 3T1HJ 2LKZA 3TUJC 1FVQA 2JZ5A 2RUGA 1XR5A 2WVEA 2O1PA 4USVA 5E3AA 1T11A 3PIOQ 5F8IA 1TL4A 3SQOP 3OL9A 3CJ2A 2DHXA 2DEIA 2OJ3A 2VOOA 5KG7A 4V19X 1UZDA 4USTA 3LGHA 4H4MB 4TVAB 2GQCA 4NA3A 5HATA 1N5VA 4I56A 1BWEA 2ZVIA 2XC9A 1HWLA 2YWFA 2KU7A 2VJUA 1N4LA 5A8WA 3VQTA 4C4WA 2FJWA 3EUNA 2HWTA 3MM7B 3MUVP 4H54A 3VZHA 2VQEJ 1NB2A 2BQ3A 3IXQA 3PVXA 4R25A 3OVSA 2WVBA 1FRKA 3JTPA 2PFDA 2J6UA 3RB3A 3PEHA 4B3MF 4IRCA 1S1XA 4ECUA 4EBDA 4UQTA 1R8HA 3UCZP 3MR7A 4OYOA 2U2FA 3JS9A 4PXCA 4NLYA 5HBMB 3MM6B 1U47A 2BDPA 4WF9Q 3CIMA 4DG1A 4JI3J 2LU1A 1TFYA 4JI0F 1NJYA 2YH1A 1OY6A 2AYEA 3TRGA 4K4YA 4F4WA 1UVJA 1F2HA 2M7SA 3J7AN 1TKXB 4WFAQ 3JAMY 4ZLLA 4C6AA 3I5AA 3TW0A 2E7VA 2AYGA 2W4PA 4KAIA 1N88A 4OI4A 2BMBA 1IR0A 3OR2A 1S6PB 2Q6CA 2E5LJ 1RCXB 2A3JA 4KFBA 2WHOA 4P71A 5JXSA 2CUYA 3BBFA 4J90A 4ECTA 2ZWOA 5KFDA 3DLLQ 2X1FA 2E1PA 4X62J 4NE9C 1KLMB 5L38A 1NJXA 2JHEA 1F5CA 3CT9A 2OKQA 1SC4B 2HSEB 3MCMA 1NAQA 5EWGA 3KLIB 3AOCA 4OHWA 4IUFA 4O4RA 4RPFA 3H20A 2Z0GA 5GMEA 5LM7E 4DUTA 3K59A 4MH8A 3LH2S 2UUCJ 2E5JA 2PT0A 1QE1A 1RWNB 1TMMA 1Z2LA 1SH0A 2JC0A 3R6LB 4NXMF 2KT2A 1SIZA 4ED7A 4C3MA 3CXCR 2CVIA 1WC3A 1U25A 3CO9A 3H98A 4URQU 5GAGI 2I5JB 4H4OA 4TU9A 3DLBA 3MEKA 4KGMA 2OEKA 3UFCX 2UVWA 3J81Y 1K8AT 2HYIB 1T8EA 2IM1A 2B9XA 4OX6A 3PYEA 5BJRA 2FZKB 4B3SF 3A13A 3MM8A 2ZE2A 4J7CA 5E3PA 1IR1A 5DDPC 4ZVPB 5D0HA 4IG3A 2YTCA 5ETSA 3V4IB 2R7UA 2CQGA 2RVJA 3PRDA 3SBMA 4LFCJ 4QU6A 2BJEA 5CA5A 2W8LA 4ZLJA 5ETVA 3IR6B 1HWJA 3FRYA 3QBCA 4G1QB 4KC5A 5HI7A 4YR2A 4DV6J 1KVJA 1FK9A 2XSJB 1UAWA 3RG6A 5GAHI 3Q8YA 3JXOA 1R8AA 3UI3A 4Y2IA 3FMBA 1UVIA 1D09B 1WG1A 2MZQA 3CD5A 3DDIA 1OY9A 3FRZA 2D41A 4ZCMA 2YWWA 2R8KA 1G6BA 2PEHA 1M90T 2VG6A 3BH6B 4DL0C 3DDNA 5B0BA 1NKCA 1WUUA 4CWBA 3TZZA 1JLAA 2DO4A 2EK1A 2HMIA 1N32J 3IBWA 1EQMA 5KFRA 3R7BB 3E51A 2QE5A 3V6JA 2XO7A 3EICA 2ZH9A 5G4DA 1JQGA 2AZ3A 3HHKA 5KFHA 3RTVA 1CJTA 2MKHA 2JVOA 4B02A 4OYZA 1Q8KA 2MMYA 4LRBA 4NWBA 2GAHC 3DGPB 4QYRA 4Y2MA 2QLJB 5DS7A 2FY8A 1KLMA 3MPDA 1S6UA 1D9AA 2PO4A 4AL7A 2R2TA 2C2OB 1S0MA 3C15B 4RW7B 4IDKB 1RAEB 3M2UB 2HURA 2O3DA 2GS8A 3PACA 4RR5A 4DCPB 2HNZA 1DAXA 2K8GA 3NY0A 5A0YB 4LFAF 1NZAA 1RXOB 1Q7LB 2XO6A 4WFBQ 4ZKAA 1N36F 3MAAB 4C8YA 5L39A 2XLIA 3DRRB 1MROA 2B56A 3RAMA 5EDWA 1YDLA 3D0HE 5C24A 1U1KA 1UW9A 1RI7A 2B5JB 2CADA 4MIWA 4ZVHA 2HVDA 2RH3A 4ANEA 2CRLA 2YY3A 3GIJA 3T5JA 5I42A 1H6KX 4B9SA 4OJHA 1YRUA 1U1NA 3QT8A 1H38A 1RTHB 2Z4PA 1WKLA 3BZQA 5C42B 1P9QC 1U26A 2MQNA 2CPFA 1NDLA 3BKTA 3QLHA 3KUHA 3NGRA 5KFUA 4DV2F 1TUVA 4WWSA 2J5AA 2DT9A 3MURP 1BXNA 1RWPB 2L48A 4EI2A 4DL3A 3EYZA 2Z30B 1HBUA 4ZCIA 2FY1A 1TAUA 4HR2A 4ID8A 4LUBA 4A8MP 1RAOA 1LW0B 1J5OB 1RHRB 1RAIB 3FBCA 3MCOA 1WSRA 3AOBA 3S6EA 5CAAA 1L3VA 4LBPA 1UJ6A 4K4UA 4WJBA 1CS4B 9ATCB 4YR3A 1H3DA 2AJFE 2HG4A 5EUHA 2UV8G 4V19J 5HP1B 3MMCA 3ZZRA 2ZH2A 1NK8A 4QBUA 2DD8S 2E1AA 3BREA 1WHYA 4YB5A 1T05A 4LF6J 4BWJA 2FZCB 2RQ4A 4G6VB 4GVBB 4P10A 5KFGA 2M70A 2KJWA 3QGHA 5CABA 3OTEA 5D77A 1REVA 1V5IB 3TA1A 1YX2A 2CIMA 2HNDA 2JDJA 3H7HB 1VQ5S 5HJXA 1KRPA 1SUQA 1CVJA 1RT2B 1RTIB 2M3DA 3V5RA 5EN1A 4DPUA 3ZXWA 3P6YC 2X1GA 4DR2J 2MJUA 3DFEA 2W4CA 2V94A 1UETA 5F9NA 4GRSA 2FB0A 5F3ZA 5K8PA 1HKAA 2UU9F 3ISND 4FXWA 5J2NB 6FD1A 5L9XA 4LT6A 3S8SA 1IKXB 2XG8A 4CH1A 4O0IA 5LXRA 1VBXA 1B7YB 2IYGA 1MLAA 3HSDA 2CNNB 1RLCL 3M6XA 1UVNA 2RKIB 1RLDA 2VOPA 3IAM9 2FHMA 2VDIA 4OZ1A 4FP9A 1X4DA 2AHOB 3Q86A 1HLWA 4TNOA 2DR8A 3GV7B 3TZYA 4JI4F 4Z7YA 1U1QA 4DR7F 4OJGA 3IG1B 2NS1B 3UN3A 2YKNB 1TL3A 5LSLA 2HHQA 2ACYA 3D67A 4MKVA 2NCKL 3FBBA 4Y2KA 5D3GA 1HBOA 3CJ8A 1Q79A 3G71S 2DISA 4NA1A 2R8HA 4J9QA 2B9EA 3V81A 2D3OR 1ZAWA 3CCTA 3IWLA 2J9CA 4X4TA 5DZ6A 1RAAB 4QWEA 4RW6A 4GMKA 5KFSA 1EP4B 3RR7A 1C1BB 4USJC 4YS2A 3MCSA 3V2UC 4DHVA 4KT0C 3A4TA 4MKAA 4OFZA 2E1MC 2GJIA 4Q8EA 2R42A 4ZPDA 1HBUB 3Q8PB 3EWGA 1KBRA 4JI8J 3M1VB 5CYQB 4TQRA 1LEOA 1VQSA 3TAQA 5D0RA 4PWDA 4X4OA 4OZJA 3JYTA 1AZSA 2RRAA 5KFOA 2B4UA 1Q95G 2RQCA 2GAGC 1N33F 4NX9A 3M8PB 4I67A 4CTAA 1Y11A 5M2PA 2HGNA 1R0CB 4CLFA 1T94A 1JLFA 1X5TA 2F5GA 2X3DA 3I9V9 1URRA 1RT3A 2VPYB 3ZZ0A 5IM0A 4KPCA 4QR0A 2BW7A 2M9KA 4F4ZA 1F3VA 1PBAA 2DNKA 3GILA 4W98A 3BKFA 1EX8A 3QNWB 2AGOA 1SQGA 2C3PA 1OPIA 3PKMA 1TK5A 1PC4A 3PW5A 3OSPA 1T7PA 1WORA 5HK4A 2RHSB 1TZ0A 3QGGA 1JJHA 5H9EJ 2H54B 1SQEA 1U0HB 2DRDA 3CJSA 2QO3A 3WC2A 2R7VA 4DFJA 4DPYA 4X4SA 1RU2A 2DNPA 3D0GE 5CCMA 1BQMA 4CO0A 1TL7A 5DZ7A 4GKKJ 5IQQA 1ZPWX 3H25A 3NS6A 1HW9A 2V5HG 2RHQB 4URSA 3Q8SB 1Q5VA 4TU8A 2JWNA 4CI0B 2WSCC 2DPIA 2XBPA 4F4AA 3CVKA 2HHWA 3IG1A 3T1YF 3KHGA 4CLYA 3CEDA 4CO5A 1JIHA 2MSSA 5AE3A 3I4PA 1RAFB 3AOAA 4ZVSB 1D8ZA 3BGOP 3TVZA 2IHR1 4DX5A 1FRJA 1FX4A 4RU9A 1OY8A 2R2SA 5GVQA 3CW2C 3HT3A 1M5SA 3MFIA 3SZ2A 5E3CA 1GMWA 1IKYB 2M4MA 4UZBA 3TARA 2ADCA 4BCAA 1CJVA 3KLEA 4C8KA 1RISA 1HNIB 1SCJB 1C1BA 3OXLA 4HHUA 4JB8B 4ZJQA 2R7SA 4DF8A 1WSVA 1E6YA 2MZTA 2MLYA 2ZD1B 3QFHA 1B0VA 3EPGA 2L9NA 1YJ7A 1JXVA 2LXUA 2DGQA 4YHHJ 4JV2A 1KOOA 2ZDOA 2W9BB 3M8QA 4HDGA 1JLEA 2YPYA 3GFXA 1RT1B 3IFEA 4QR1A 2CA9A 4ZJOA 5A6PA 2W9CA 2OP5A 2B7BB 3K17A 3QT7A 2DGUA 4S0MA 3CC2S 1R0AA 1SJ3P 3QJPA 1WELA 2F1FA 1Q4RA 3US5A 4MK7A 4O3SA 3W65A 1YLXA 3BR8A 3BYRA 1G3OA 5B0GA 5KFLA 1FXRA 4MAKA 1S12A 3PM9A 3QSIA 3PRVA 3T1HF 2EC2A 4JI5J 4WK1A 2FUG9 3S1TA 1K0TA 2NUUG 2NSCA 3UCGA 3I5BA 3GFHA 4CLPA 2OAUA 2VQFJ 1FT8A 4NLTA 1Z2ZA 2J0QD 1WC4A 3MAAA 1Q82T 4TKTA 2UXDF 3M6UA 2DRAA 5HSPA 4ECXA 1S76D 3LUYA 1R0AB 3QIPB 1DURA 5DDQC 1SJQA 2W2MP 4F26A 1FRIA 1UVMA 4B3RJ 2HIYA 2WOMB 2GHWA 3CE8A 3ULHA 3G86A 4WIQA 1YQHA 1R6YA 3OTDA 4G65A 4KSEB 3KG4A 2XS2A 4ZHRA 3G8TA 2Z56B 2DH9A 2YKAA 2KG0A 1T9VA 4IG0B 1HNXJ 1BC6A 2CQ4A 3GR1A 2XHCA 3MECA 4RW7A 2VODA 3GP9A 3I87A 1PILA 4V1Ak 5K9FA 4EGLA 3TI0A 3ZC4A 1YJWS 3FEYB 1XMOJ 3SFGA 1NEEA 2D9PA 3D3CJ 4ICLA 4N47A 5J2MA 1EJ7L 3DKDA 3AA8A 1GH8A 4L72B 3RU0A 5DG9A 1FWPA 5KT2A 3G6VA 2DK2A 1WJ9A 4PPZA 2GMLA 3UR0A 1ZETA 3HHLA 2LFVA 3T9NA 1FNXH 2XZWA 3TQ1A 3B54A 1T02A 2KDOA 1YJNS 1L5UA 1FRHA 3ITHB 2DHHA 1OMSA 3N6NA 3HHLD 3MAQA 4OV1A 3GYGA 3ZZPA 2H4WB 4ENOA 5D4OA 3HKWA 2PA8D 4MTPA 1VHFA 2FVCA 2G2ZA 4CLLA 3VALA 3PEJA 2MTLA 4NXNJ 3QQCD 4XPEA 1HQEB 2RD5C 3FZBA 2IA6A 2H5JB 1TU0B 3C6UB 1HQUB 3C6TA 2DY1A 1TV6A 4X4RA 1D9DA 2VH7A 1RTJA 4RUHA 1F60B 4HHJA 2WVFA 3TANA 3IM9A 4A8YA 4LR8A 1FJEB 1RT4A 1B0TA 2LECA 4NXMJ 4O0NA 5I3PA 1XMOF 1NH8A 5DQGA 5DLGA 3IR5B 4CQ1A 5LMNF 4XTTA 3E01A 3HM9A 3CUNA 3BH7B 2OH2A 1IBLJ 3CCES 5B0CA 3M30A 2XGQA 2EFGA 4WXWA 3QZ8A 1VJQA 1WHXA 1FA0A 4K5SA 2P9GA 2YQ1A 2WVDA 4PR6A 4AUKA 4JYAJ 4DQQA 3KJFB 2AJ2A 2F65A 1KQGB 4I69A 1KKHA 4KGVB 4LFAJ 2HZVA 3TR5A 2ZVSA 2J7UA 3IS9A 2B4VA 2Q79A 3HVAA 4C0BA 2FC8A 2Y8WA 4LRCA 1C1CB 4PCQA 4GO5X 1OQ3A 4L75A 4QIWD 1KDNA 5F8GA 2V2ZA 1I6JA 4Q8FA 4M63A 2DEJA 4P9SA 1WTBA 2VZ9A 2FHJD 3N28A 1UA1A 3R5JB 1JX4A 4N77A 4ITSA 1Y10A 3UO0A 3PHTA 4UT4A 1UFWA 2CJAA 4PPDA 1SH3A 4QZVB 4DV2J 4J9RA 5CYQA 1HW8A 3GV5B 4IQXA 2HVEA 4IFVA 1T03A 2VASA 3CCJS 4E0DA 2YQ0A 3EX7B 2KHDA 4ECSA 2GFFA 2V9WA 5L1KA 3MXHP 3NGTA 4FXVA 3JSBA 3UDLA 3Q89A 5D0EA 3TEHB 4G1QA 3OVAA 3F73A 1D3WA 2R9LA 5A8RA 4M5KA 4F2SA 2EI5A 4M5JA 5B7WA 2Y8YA 1XK8A 2GIFA 1Q0NA 1N5TA 4PWWA 5CZXA 2AX1A 2YKMB 2C2NA 3Q8VA 4DL4A 2DGSA 3AA9A 2XS7A 2YPZA 3EVOA 4K0KF 3UD5A 3IP0A 1VIOA 1VK3A 1HQEA 1G2EA 2BVZA 2VFTA 3NGUA 1ICEB 4DQPA 3AH6A 2IRXA 4B3TF 1DZ5A 4FKYA 2AP6A 1U8SA 3MM7A 2MJNA 2IDEA 4DR2F 1RABB 1VS3A 4LSLA 4IR9A 3K0JA 2DGXA 3AD8C 4F7VA 4QIGA 3J7A1 2RDJA 3CULA 1U1LA 4P72A 1S1XB 4DV5F 1ELOA 4O3NA 5DM7Q 5H1SV 1XMBA 2G0IA 1SC1B 2IA0A 2R4FA 1NPPA 1S9EA 3NRBA 4Y65A 2YKMA 5GMKa 1F3FA 3J7YI 2MQMA 2FTRA 2HHUA 2VBXA 3D4JA 5E3RA 4MK9A 2EK6A 4J37A 1JLGB 2RNEA 3BSCA 2OFGX 3LP0A 1I94J 4YY3J 3HCXA 2A2CA 5D78A 5AXNA 5IT9Y 2MZRA 3DM2A 4NMXA 3EXYA 2PSZA 2QC3A 5A6WA 3SCKE 4NRUA 5J1PA 1IVZA 1RT1A 4J9PA 1W7WA 1HNZJ 4JI7F 2ZOFA 4WFXA 4BLGA 1WACA 3CMAS 1C4AA 3VAIA 2AD9A 1ZYQA 1HR0F 3RBDA 1ULRA 3KLFA 2HRUA 1AUSL 3Q24A 3PYDA 1S9EB 1Y4ZB 2MB0B 1S49A 3HSGA 3ZZYA 3FK4A 4PAAA 2F4VJ 4J9VA 2P9EA 3G6ES 2CFXA 4Z7CA 2QRRA 3BSOA 1U02A 1RAJA 3CD7A 2YNFA 4C7QA 4U8VA 1CULB 3BS9A 4LF6F 1PJ7A 2V4QA 3M9MB 1HBMB 1LWCA 2LEPA 2ZUAA 1J27A 2V68A 3C66A 3NG8A 4WK3A 3RJMB 4C3KA 4YEAA 4GO7X 2GC8A 3A8IA 4ELTA 5IZHA 4U95A 1FHTA 2RSQA 4KKOB 2QX0A 2PEBA 3NNCA 1QUPA 2IM2A 1DQ8A 2IAJA 2QLFB 2IDLA 4H4KC 1I5OB 1W2IA 1WF2A 3MMCB 3M9NB 2I2YA 1S1UB 4ZVEA 4ECRA 4ED0A 3PX0A 4HKQA 1M5HA 1HWUA 4QYZK 2GVZA 2GHPA 2C3YA 2LCWA 2KXHA 2LVWA 4YB7A 2ZBIA 1YKWA 4WU3A 2XEXA 1R0BG 1Q5YA 1T9UA 2EG2A 2RU9A 2WONA 4NASA 4PKDB 4CYUB 3OTOF 3BPDA 3CCSS 4YOEA 1F9EB 1ZZFA 3HVTA 3BYPA 4IO1A 2P8IA 3GQCA 2Q6BA 2YNIA 1H7WA 1PSDA 2LA6A 5IWAJ 1IKVA 2B8PA 2RF2B 4H4KA 1YG0A 4NCBA 1S79A 4OHZA 2BM0A 4J9LA 3NAIA 5LSRA 3BDEA 2D1CA 4PYAA 4OLOA 3GB0A 4ZLPA 1YITS 2QL5B 3FEZA 1UWAA 1YWXA 1TKZA 2UXBF 4ZVRB 5K14A 1Y0HA 1HWIA 1MMNA 2MSTA 4ZVUB 3MOJB 3NAHA 5KFZA 3HHLB 1I51B 2Z2LA 1UJ5A 1RGVA 3X1LB 1F2GA 2KZMA 2CKWA 4DS4A 3LWMA 2YNIB 1TV6B 4TXSA 2JEFA 1HI1A 5IV4A 1FE4A 1JLQA 1HWKA 3ITHA 3SCJE 4ZK7M 2OHDA 3G82B 3MR5A 4DV4J 2MEWA 2FVRA 2YX1A 4ZS6A 3KUEA 1RT4B 3OSNA 2IC3B 4BDPA 4JV5J 2P2CB 3TA0A 1U2FA 2KM8C 2XMWA 2XI2A 4DV0F 1H72C 1RACB 1NZ8A 3TUPA 2P6SA 3SYZA 4ED5A 4K4TA 1FDDA 4HDHA 2CAJA 1F5AA 1WD6A 3DDKA 4FBUA 2HK3A 3MGJA 3ILJA 4YHHF 3HFVA 1UJ4A 2ZKUA 2PFFB 1H73A 4EYIB 2VQEF 1TQLA 1VGYA 3HFZB 1FX2A 1TFWA 2HQFA 2Q43A 1JLQB 1WI8A 4X64J 2IAJB 1SV5B 2VIHA 2KJVA 5JVGQ 1B70B 3CJTA 1S1UA 3RBXA 1SBRA 4IKAA 2ZZNA 4LFBJ 2JLFA 4DL6A 1J5EJ 3MPYA 3PJ9A 2M0GB 4B17A 3HX9A 1NK7A 3ZTQA 4K4ZA 1VDHA 2FHJA 1O8BA 3HJVA 1TKTB 5F8NA 5C2CA 3HO1A 4N8NA 3AJ1A 5KOWA 5ETMA 2H4YB 1RHKB 2BJ3A 4DUZJ 3B82A 4DSJA 4NZ7A 4PG5A 3BSAA 3QGPA 5GADI 2QA4S 4FF3A 1SJ1A 3N6LA 2YKPA 4C8ZA 2HW3A 2NXUA 2GVDB 5A2QU 3H90A 3AD9C 2U1AA 1R31A 1UTAA 5KOXA 5LOQA 1ZTWA 3RRGA 4DSIA 3PV8A 1UCNA 4OYBA 3SDEA 4PRFA 2VBWA 2E1RA 4I2QB 3AODA 4GVBA 2XZDB 3FZ2A 1RWOB 1R3NA 2CWXA 2DCUB 3OHBA 4WZMA 1N48A 1W26A 1UA0A 4ECYA 2WSFC 2FJBB 4RKUC 1UW4A 3TAPA 4U9RA 4UOHA 4FS2A 1RKIA 2LEAA 4WYWA 2YX7A 4PQAA 2JEJA 3QO9B 2LA4A 3ISZA 4X64F 2DNMA 3W2VB 3AT1B 1UP1A 2AU0A 1IBKF 1RWXB 4TQSA 2B9WA 2BJ9A 3T3FA 3SSQA 2EG1A 3QIDA 4LVOP 5A8RB 1OO0B 2GVDA 2VPWB 1VC0A 3ZZOA 1CJVB 3KLEB 5HN0A 1AXQA 2HVIA 2UXCJ 3OVBA 3MD1A 2D3UA 2DNGA 1QVGR 1VQYA 1SVDA 1CJKA 5HANA 1O0PA 4JBCA 1FKAF 3LP2B 4XDCA 2VFRA 1NDCA 1TTHB 2MHEA 3MMAB 3OUYA 4DV1F 1FE0A 4OLPA 2Z8QA 2XSFA 1KHWA 2ZBPA 1RT7A 5E7OB 1TVRA 1JK9B 1X4CA 3I6PA 3KUGA 3OPKA 3W2VA 2RJZA 2W9BA 3G4SS 1WEYA 3QJJA 4P75A 2HZCA 4ES3A 2DNYA 3VQSA 1VRUA 1IQTA 1DY3A 3I32A 3RBEA 4FKXA 3AB2B 3NNAA 3NCQA 3LOUA 4RW8B 5HMWA 3K5PA 1S5ZA 4DLGA 3M2VB 2J6TA 2NLWA 1NDPA 1WC1A 4OYMA 2V4JB 2DJWA 2DNLA 5K8MA 5KFKA 3OL6A 3MEDA 4M5NA 2XHWA 3H2LA 4JI3F 3K8WA 2H3EB 3DHWC 2YBVA 3JYTB 1HFEL 1U1RA 3I56S 5H9FK 2FLPA 4LF2A 3WIVA 5HMZA 3ZZTA 4OX9J 1BUXA 1MSWD 2K1RA 3KK1A 3I9ZA 1R7IA 3RBZA 3OLAA 3KKFA 2J8SA 1DTTA 3CMQA 1NNDA 3L7PA 4KGZB 4Y3CA 1JXEA 4JV0A 5KFFA 3CC4S 5IM0B 5LSOA 3OXGA 2IPOB 4J9SA 2LEBA 2HHVA 2N3LA 3D6TB 4RNHA 2XLKA 2HVHA 1O6XA 2V4JA 3DLEB 3HSJA 2BJDA 3RUBL 4ZVFA 1XNRF 4QU7A 2BANA 4TY8A 2RUSA 5F41A 2EVZA 1DQAA 1OSCA 2DH8A 3R5CA 3M8RA 1RZMA 1NB7A 1HYSB 2VONA 2XLJA 1HBNB 2EXUA 5CCLA 3FC9A 2UP1A 2XY5A 2BV3A 5KFIA 1LW2B 1BQMB 4N8OA 4RWXA 3EVMA 3DGPA 1HPZB 1PCAA 4EO6A 5KT7A 1VLOA 1EIYB 2XMTA 3IA0A 2ZJPQ 3TJ9A 3H5XA 3N5BA 2DNZA 4LRDA 3MFHA 3K5NA 1XEZA 3CCVS 2JVRA 1X4GA 3R2CJ 1X9SA 4U7UD 3AFGA 5F8LA 2BRLA 2DHAA 4DPWA 5LMNJ 2GQQA 4DQSA 3ZFVA 1K1SA 2NPFA 3P8BB 1V3RA 4USMA 2UVUA 2VG7B 5AJ3F 1XC9A 3BGRB 3Q8QB 1QAXA 3DMJA 4C8LA 2NXNA 4YFUA 3MD3A 3U1MA 2WOMA 1NHVA 1Q8IA 2V4RA 3G87A 2A1BA 3AQPA 3GYNA 3M2VA 2ATCB 1K9MT 4DV3F 1Y5NB 4FF2A 1U6FA 1K1QA 2BW2A 3GFYA 2NYHA 4EUVA 4RWWA 2G0JA 4QQBA 3X3UA 2FJXA 2RQKA 1S7HA 5J2MB 5J1EA 1FWLA 2HNYB 5AE2A 4O44A 4MK8A 4P52A 2ZBCA 1MWZA 4LBHA 1NJWA 3EGZA 5D3GB 1SB6A 2J0SD 3T5LA 2MY8A 5MAOA 3IC1A 2O66A 4I6YA 2DXEA 4JI6F 4IRKA 4B08A 2CQIA 3A3PB 3HZGA 5EX0A 5GMDA 3CD6S 3R7NB 1FFSB 2XMVA 1SV5A 5DJBA 2DGTA 3MTJA 4HT5A 2ALYB 4I7FB 4IR1A 1XN9A 3MM9B 3DLKA 1S59A 4CDIA 2MXYA 4HACA 2RS8A 2ZNYA 1DARA 4HVZA 2AWZA 5F0WA 1REVB 4ZP7A 2PE8A 2QIFA 4ER8A 2V8HA 1DLOA 2OPRB 4LF8F 4K8RA 4GC6A 1FXLA 2JH3A 4QOTA 4IRDA 2MYFA 3BQ1A 4DL7A 1VC6A 3GMGA 4N41A 2HQDA 5M2RA 3W61A 1KWMA 5F9LA 2QGFB 2W4DA 1C0UB 2HGMA 2LU2A 2XZTB 4HYKA 1R89A 5ETLA 1NKBA 3CF5Q 4IQMA 3PXGa 3LP1B 1N54B 1S1TB 4AE5A 2QA1A 3SDEB 1GX5A 4ED1A 4KE5A 2HS3A 1LXNA 2G1HA 4PZVA 3QFWA 4PUOA 1VR6A 4DV7J 1RUSA 3NGSA 3BM7A 1JLBA 5KFMA 2OPPB 4DV5J 4AQYF 3SI8A 2KTQA 1FCAA 1S4FA 2L41A 4H4MA 1OYEA 1PKUA 3I96A 3J80Y 1U2CA 3VAHA 4ZIWA 1QY7A 3NWRA 2UUTA 3EGNA 1RWWB 3CO0P 3UDEA 3HFKA 5B0DA 1GXTA 2EBGA 2CQ3A 2QN6B 4I4BA 3G2XA 3A12A 5IFMA 5HVFA 4DG1B 2KFYA 2GO8A 1MWYA 1VBKA 1WC0A 1WHVA 1WKJA 1F5BA 1FERA 2YWEA 4P73A 5C2GA 3CC7S 4K4SA 2BEFA 4OZ2A 2W2QP 4JI7J 1VQNS 1IWAA 1RDRA 2CJ9A 5IXUA 5BR8J 4OYIA 4UW2A 2XTJP 1YZ6A 1VRTA 2H51B 1IQZA 1MNEA 2I0XA 1FFWB 2CYYA 2WRMA 2XULA 3BGUA 5J1EB 1SKSA 2J7KA 1FJGF 2C1EB 3GSIA 4ILRA 5CZVA 3ZNJ1 4F3MA 1XNQF 3SCIE 3M32A 3HHLC 2J0WA 2OFHX 5CD4A 3UVJA 3KLHA 5F8HA 2PI5A 4QR2A 3MPWA 1L3SA 2JEGA 2JC1A 2MKCA 2DGWA 4RBUA 1TK0A 1B3TA 3QRQA 4BWMA 3M8PA 3T1AA 2V8VA 5HAOA 4CT8A 5LT5A 3PO5A 2DNQA 3DOLA 2VU5A 3NL0A 1BMQB 2FVSA 2CJBA 2QMUB 5I3UB 3E2EA 3SMZA 3PW7A 3JQMA 3GJTB 4JV5F 2AEFA 2VL1A 3W66A 4JI1J 2BKPA 4LVNP 4DV0J 2XQCA 1IM4A 4IG3B 3KLIA 3K57A 4M94A 2IMOA 3CNQP 1KQKA 1X5PA 2CDQA 4ETXA 4HTJA 2ZHOA 2MKKA 3GIIA 2CQHA 1RQ0A 5L1JA 1NBEB 1MMDA 5E5NA 4F0MA 4X62F 3SSSA 1VBYA 4OYWA 4DLEA 3LF0A 1UZHA 2HFUA 5ETRA 1MU2A 2K1RB 1EHWA 2OUGA 3KK2B 3KJNB 2XSJA 3AY0A 3M2RB 1T9XA 4Y2AA 2IMWP 4AXIA 2V50A 2C22A 4CCHA 3QPIA 4RLEA 2OMLA 2KRRA 4LQ9A 5F8MA 1SXLA 5I3UA 2YNHA 2Q66A 5F0UA 5T14A 5C5JA 1Q53A 2XNQA 3BO4A 3ELHA 5IC6B 2KZZA 2KM8B 2DH7A 4NLRA 4QWBA 3B8HA 1Q16B 2NR0A 4CLSA 5DM6Q 1U6ZA 4NLXA 3EDRB 1JNZB 1OS5A 1LFWA 5C25B 2I5JA 4H4OB 1MU2B 2DITA 2QV6A 3R5GA 4M5DA 2RB7A 3AQOA 4OYPA 1DQ9A 5J1NA 4EZ6A 4FF4A 5IT9U 2JFDA 2K3IA 4O4GA 4RNFA 5HJYA 1X4HA 2LYVA 4ZVGA 1Y5LB 2UUBJ 1H0HB 2NUHA 3MCNA 3O6QA 4TYAA 5FLXU 1JLCB 2W9AA 4BBYA 2MQLA 2PMWA 3EXCX 4WTYA 1U1MA 2B3TB 4UTGA 2NPIA 2AJ4A 1FTRA 1Y3JA 4ANDA 1RBAA 6FDRA 3PYFA 1FKPB 3B6BA 3NWGA 5KFPA 2K06A 1S6QA 2GIQA 5HLFB 3MI7X 5KFEA 1YTYA 1AYEA 5SUHA 4UOFA 2B5JA 5DETA 3OJUA 1PJ6A 2NQPA 5GAEI 1JNRB 4J9NA 1I94F 1UFKA 3CCZA 4OI0A 5D4NA 4WU2A 1KSPA 4XAKA 1C0TA 2BM1A 1EARA 2VFVA 4ID5B 1TR0A 2HHPA 2DCLA 2FQQB 3L9ZA 1JLGA 5DDOC 3T6BA 2UXCF 3I55S 1S4EA 3BGFA 3SXLA 2BJ8A 5KG3A 4DBQA 5KFQA 3MR6A 4M95A 1HNWF 1FRLA 1HR0J 4J9MA 2FPHX 4G1IA 3HHNB 1FI4A 2D9OA 3KXDA 1IJEB 2P6TA 4NLGA 4DR1J 1TMJA 4PQUA 4ZCLA 3L09A 1LV5A 2COLA 4KRWA 3QIPA 2B51A 1IKYA 3HXMA 2CPZA 5KTQA 3NOCA 1GNKA 2VUGA 4P2MA 4PG7A 3DRPA 1T9WA 3MMBA 3UR3C 1S1WA 2MZ1A 4UQGA 2ZH8A 2EKYA 1Y9OA 4F4YA 1BGXT 1E6YB 4LJMA 5B08A 4O3RA 3NGKA 3QYYA 1RK8A 4ID5A 3WQPA 2R3VA 3ENVA 2XMJA 2ZD1A 4MFBA 4BC7A 1RT5B 1HD0A 4YMEA 5C42A 3EDQB 4L6V3 3OHAA 3I4HX 3CCQS 3MECB 4WP3A 2BR0A 2AIRB 3OBIA 4HACB 4NRTA 2IVMA 1WWHA 2P5VA 4OYXA 4FPRA 5ETNA 4ZVQB 5T7LB 1VISA 2CXEA 1L3TA 4OI6A 2D7SA 5RUBA 1SJFA 2GJ2A 2Y0BB 2MKYA 3UNYA 3W5ZA 3BO2A 5A2QY 1BLUA 3DOMB 3SQGB 2W2PP 5IOLA 1NMEB 3ILOA 3K5MA 3VAJA 1FWKA 3H5SA 3D1HA 2XY6A 4B3MJ 4ECWA 4OI1A 5CYJA 4X2BA 4AL5A 2CDRB 2Q1LA 1RTHA 2M88A 3C16B 2V69A 3MM9A 3UN2A 2GA7A 3OFFA 2UUAF 4ZPWR 2CG4A 1MN7A 1S1TA 4NYZA 3VZIA 3U02A 3PX4A 1JJ2R 4Q0BB 1N5YA 4DPXA 2G4BA 3C46A 3EZUA 3R7SB 4EO8A 2R7WA 3FBEA 5IWAF 4EBCA 2DR9A 5JUMA 2ZC4A 1AW0A 2HFVA 4DS5A 5LL6d 4CM2A 5G0RA 4K5RA 2I1RA 2YNGA 3FCHA 5HQMA 2E5LF 3NS7B 1TKDA 4Q45A 3HVWA 1KTVA 4A8SA 4M5IA 4ES2A 4A8OA 3IWNC 2CPEA 3CJKB 4C2MA 3HHEA 2FDNA 5IC4B 1C4CA 4RJVA 2CQPA 5LMUJ 3ENAA 3KNAA 4C8MA 1U0SA 1TKZB 3RYLA 2CQDA 1NK4A 4LF7F 1HA1A 1NHUA 3LA0A 1NSQA 3FVYA 1ZM3A 2N4CA 4URGA 3K58A 2ZEJA 1HNXF 5GAGU 2E9RX 1NK0A 1SC3B 3C14B 4I2PB 1FJ7A 4FN5A 5KG2A 1TL3B 1UKUA 3IGVA 2DIUA 1RADB 3W63A 1A7GE 1CQNA 4CT9A 1X0FA 3NGDA 3G6XA 3QATA 3ET6A 3SCLE 4IOBA 4Q2LA 4PG8A 3V6DA 1T3NA 3CPWR 1S0VA 5IT4A 3OR2B 5KT4A 2MQ8A 1QM9A 4DF4A 5CD4H 2VDHA 2QEXS 2E9TA 4DR7J 2XYHB 3ICLA 3KTQA 5DRKA 3TA2A 3MMJA 1H7XA 3DOLB 4NCGA 2JSXA 4B9TA 3TQEA 2JX2A 4B3SJ 3D1OA 4QPXA 1JLBB 2CPXA 3C19A 3CGIA 2HQCA 2IYIA 3F56A 3PY8A 2BACA 1KN6A 2DBBA 1UL3A 4OZNA 5HO4A 1EB0A 1HBOB 2BKNA 3C6UA 3UE2A 3FKBA 2ERRA 2R8GA 3PNIA 2BX6A 4U7CA 1RWKB 3ET6B 1R6VA 4DZDA 2CPIA 1FDAA 5FDLB 3DLHA 4FF1A 2QA2A 2ZOGA 3KK1B 4YDDB 4L3NA 3PO4A 4NLOA 3ZTSA 2W7OA 3UD4P 2CQ0A 3QT5A 1RHMB 1P9YA 3M2RA 3VGTA 1RU1A 2H48B 2MPUA 5ETTA 4FXDA 2W8KA 5J2PA 1WG5A 2C2MB 2RDDA 2HHHJ 2F9DA 1RE1B 1QD1A 2KXFA 2GHVC 1X60A 1VQ7S 1CBKA 2H1YA 3BSNA 4OJ1A 3UN5A 3KNGA 5HL7Q 4Q5VA 4RX6A 2WTFA 1LOUA 4HH1A 2AX0A 4QWDA 3MR2A 1BY9A 4A8WA 2OTLS 1BE4A 1HBNA 3J7Z5 2NXCA 6AT1B 4MYTA 2L3MA 2GX8A 4F4XA 3TP2A 4DMZA 5L46A 1YZ7A 3D54A 4KHRA 4WE1A 1XTZA 5BYSA 1IBMF 4FDFA 5LXYA 3JSMB 3D2WA 4KPYA 1HNIA 4IFYB 1R27B 3F0NA 1GT8A 1GMWD 3T19A 3G8QA 4CRJA 1N5QA 4LR7A 3UQSA 3ONQA 4YR0A 3MEDB 1U4BA 4UOGA 5IS2A 3OFHA 2F8HA 2OO4A 2VBZA 2C2KB 3R5DA 1CG2A 5HMYA 4DR4F 4USUA 3J7ZT 2ZFHA 5A8WB 1AUDA 1W25A 2ABYA 4KH1B 3QAEA 3O1LA 4ZN3A 3ADAC 4QW9A 4FYVB 4C48A 4CNZA 4DV1J 1FDBA 1FRXA 5FIIA 5KT6A 4C97A 3P96A 4F8RA 1NM2A 1VHIA 2CNLB 1JKHA 3D6MB 4RW9B 1PBUA 3IBCB 1C0TB 1NDKA 2QMWA 1YVFA 1F6TA 3CSKA 4FNIA 1ZM9A 4YN3B 4DUYJ 3OFGA 1QLNA 3NCRA 4TY9A 1N5SA 3L95X 4Q44A 3A8KA 2PI4A 1IR2A 1VJWA 2L9DA 5ETKA 2K3KA 2BXJA 5DGAA 5HLFA 4DSKA 3P5BP 1UWBB 2ATLA 1RT2A 1RTIA 2FC9A 2RRNA 3M8QB 3EVWA 4CP5A 2C3OA 3MEGA 4XK8C 3CJ0A 4FPIA 5KG5A 4LSLB 3GJSB 5C25A 4X84A 1SL0A
chains in the Genus database with same CATH topology
5D6GA 1GX6A 4RBVA 3O2IA 4X65F 2V9KA 3N0VA 1HMVA 2AJ1A 2R2RA 4OZ0A 1VIXA 4WXOA 2MKIA 3UCUP 1CEZA 2FHOB 4P7VA 3O3LA 3UWTA 4EBEA 2DGVA 1OPZA 4M1KA 4OZLA 2EPIA 2LQBA 2VG6B 2MKJA 1RT5A 3OXFA 2DRBA 1S9GA 2GV1A 3RAXA 2XCPA 3MR3A 2KHCA 3PJWA 3KHLA 2ASLA 4DSFA 1SH2A 3KG1A 3IRXB 2XWXA 3KMSA 1DHMA 4CZCA 3MEEA 2G13A 1D1UA 2XMKA 3KLGB 2RRAA 4DV4F 2UXBF 4IFYA 3OR1B 2JLGA 4DUYF 5D4PA 4B3OA 1HNZF 2KB2A 3KYLA 1RTDA 5K8NA 4NPOA 4DN0A 3DU6A 2HRYA 1FKOB 1Y5IB 3FEXB 3A1YG 2DNRA 3AJ2A 2GGPB 4IDKA 4Y0FA 2BRKA 2MGZA 2X3GA 3N9UC 1YJ9S 2M5YA 5KFJA 4QWCA 1HBMA 1LWCB 1N32F 2FD2A 3WBZA 2QLXA 2R2UA 2P9CA 5C24B 2LQ5A 1VQ6S 3NS5A 4KKOA 4AFFA 2QYCA 4CNYA 5KG0A 2DTJA 3BR9A 1CLFA 2YQ3A 1UVLA 1K0VA 2NSBA 2IC3A 3MWBA 4WYLA 4Y34A 4O3QA 1NKEA 1FTCA 3T6JA 4C8NA 3M30B 3PW0A 2ZDPA 4J9OA 2HLTA 2VC0A 4K50A 2CPHA 3LGNA 4RNNA 1NJIT 1FD2A 3AHPA 3DLGA 2UZAA 2N4DA 2ZKTA 1IXKA 1PC5A 2FIUA 4O3PA 2EC0A 2VKZG 1LWEA 2KT3A 2ASDA 1N8RT 3THTA 1VC5A 1LXJA 1PO6A 2Q3PA 2V8GA 3FMWA 2VPZB 3QMQA 4BC9A 3BJYA 4NXNF 5H9FJ 3V4MA 4Z2XA 5L9NA 4TYBA 1OSDA 1VQ4S 2G1DA 4DQRA 4ATNA 3MMAA 3RW7A 1JWWA 1VQPS 1QSYA 4DOZA 4RUCA 5JVHQ 2N82B 2F8MA 3LALA 1B0PA 5F3TA 3G8SA 3OR1A 5AE1A 2XMMA 3KG0A 3ZZZA 1APSA 2RMLA 2EFVA 1JLFB 4KFBB 4RNOA 1FXDA 3R3TA 2GGPA 2LQ9A 2VV5A 4RW8A 2NYIA 2WCXA 2V2KA 4EFAC 1ZTTA 4WKRA 2IBOA 5E2QA 1WEXA 1VMBA 4OMFG 1TKXA 4I6WA 2HHSA 4F3OA 4TU7A 1Q8LA 4B9VA 1LK7A 1N0UA 4NLPA 1TP7A 4X4QA 2ZM6F 3M4XA 4ZCKA 2HFZA 1ZAXA 1Z4UA 4DV7F 3TAMB 3CCMS 3W3SA 3DRSB 2FJEB 5KG4A 3CDBA 1YHQS 1NRKA 1UEUA 1U09A 4NA2A 1Q81T 4DEZA 4X4PA 2XWYA 4FVCA 1X5SA 3TVKA 3FSYA 3DYAA 4BHQA 1H2UX 1BQXA 2R7RA 1UVIA 3MM6A 3BN4A 1GXLA 3LO3A 2CJQA 3LP2A 4NZ0A 1TKTA 3VR1A 3F41A 1ZYQA 2LLZA 1N34F 3U1NA 3HHDA 3MAHA 4HI2A 1MW7A 5I4MA 2AJ0A 2JJ4D 1S6QB 1ZZNA 4FVMA 3CDAA 3S7RA 2AYMA 2F40A 2DB1A 1IJFB 2BYCA 4E8UA 3M8SA 2QA4G 1FESA 1N56A 1D9FA 1R43A 5JJBA 3KK3A 4DR1F 3TX8A 4ZP8A 2ZZMA 2EFOA 2VKRA 1EETA 4JI5F 4W90B 2PDAA 1WF0A 2CPYA 4CO2A 4PXDA 3GZ7A 4F2RA 4DFKA 1R8PA 4KQZA 4DV6F 4NOHA 3BN7A 2QMXA 3NBPA 5GAHU 2YWHA 4ILLA 3HVRA 3HP6A 2KO1A 3VTIA 2BOPA 2IBKA 2C3UA 7FDRA 1RYSA 2K2PA 2VG7A 3P49B 4HEA9 3TYTA 1M5VC 3JTOA 4ZOSA 1V3SA 3HZEA 2J9EA 4WE1B 2J9DA 3U1LA 4JI1F 2Y1JA 1S77D 1QVFR 2XMUA 3WZ0A 3PJXA 4IO9Q 2M8DB 3DRYA 2CQCA 1F9FA 2HNZB 3FQLA 4B9MA 2WB4A 3H4DA 3DOKB 5FLXY 2R7TA 4ES1A 4DFMA 2MQQA 1CC8A 4HL9A 4CTAB 1VQMS 4A8FA 2RF2A 1LW2A 2D74B 3MPVA 2BABA 4AYBD 2KXNB 1KVIA 5KFAA 3EZ5A 4U6PA 5I42B 4MIAA 4P6QA 5CH7B 2GIRA 4OX8A 5DDRC 4G3IA 4GKKF 2MHNA 4NZ6A 2UVVA 2GMHA 3I0SB 3IRWP 2OPSA 2NZ4A 5FJ4A 4DWIA 4RZRA 5E0OA 5LMUF 1YI2S 2HHHF 4ZPCA 1SIWB 3DOKA 1UWBA 4K59A 4K4WA 3ENWA 3K5OA 4ERDA 5G0RB 2EFQA 1X4BA 3HVTB 2HQ3A 1C2PA 1WHWA 3E8OA 3GR0A 1IKVB 1RP5A 4KGKA 4TLRA 4A48A 1EETB 3R1LA 1VFJA 2L9WA 1Q86T 4F4KA 3UNGC 3CCLS 1WG4A 3DLEA 4F02A 2B7CB 3I0SA 3VF0B 1GAOA 3ISNC 5EGYA 2C42A 2FJDB 3DC2A 2BE2B 3VAFA 2YWKA 1X4EA 2LDYA 2LDIA 2HS0A 1L3KA 1QSSA 2BQRA 2XNRA 3CTRA 3JB9k 3N01A 2PN6A 3D5MA 3IO1A 3QAUA 5DG7A 1R8BA 3U7JA 3V6KA 1S48A 5J2NA 5HP1A 1L3UA 1Q78A 2POKA 3POTA 4LSNB 1YBAA 3QLHB 1WI6A 4Y2CA 1MMLA 2HFNA 2IVYA 3EPIA 3N5FA 5E41A 5L1LA 1RT6B 2ZJRQ 1M0SA 4PG4A 4IOCQ 1KFSA 1QSLA 7FD1A 1OWXA 3H2UB 3L7OA 3QGIA 4LIRA 4W92B 3HKZD 3CJKA 2I9SA 3B4MA 4IH5A 3DRXA 2A18A 1SL1A 4I2QA 3LP1A 1UFLA 2B9YA 2CQBA 3JSYA 2ZJQQ 3F44A 2FGCA 4HH0A 4XO0A 4OI2A 2C28A 2YKNA 4YB6A 3QO9A 5A8KA 3K7RA 3SQGA 3OW2R 1T03B 2VFUA 2B4PA 2QSWA 4QWAA 1KQFB 4Y28C 4QYZJ 3OFEA 4FS1A 3CJ4A 4DR5F 1XBWA 1U6BA 2X51A 3V6HA 1CC7A 4I7FA 2B0GA 3DRSA 4OHYA 5CYMB 4QIFA 2VFSA 4DUZF 4QIEA 4LF5F 1RA6A 2AF6A 2M2BA 1G7CB 3OUYB 2XGPA 4P7TA 3DYAB 3UPFA 1S0OA 4NLUA 5A8KB 2MDAA 2M52A 3FQKA 2JFKA 4CIOA 4WFZA 1QUVA 1WEZA 2PIIA 1LK5A 1T3OA 1Y3KA 1TL5A 3GSDA 1FF2A 2MQOA 4ED6A 1ROFA 2JEIA 3Q2TC 1XR7A 3N4WA 3FSIA 2MZSA 3M05A 2KI2A 1FK9B 2PD1A 4C8OA 2ZH7A 4B9LA 2F4VF 5BYQA 4NMLA 1EP4A 3N6MA 4O4GB 3IN5A 4JI2F 3MUMP 4CO1A 4EYHB 3DNCA 4CH0S 3K5LA 3Q23A 2ASJA 2EFPA 4R8UA 3BQ2A 2OIHA 4LF4F 4HLBA 4A4JA 2DNHA 2N3OA 1RKJA 3V6DB 4C0OC 1RA7A 1J2VA 3PKYA 2Y1IA 2YH0A 3R27A 2XY7A 1KONA 1U45A 3GIKA 1NU4A 3K8VA 2V0NA 3PFEA 3E01B 4NCGB 3J7YU 3H8YA 3TO8A 4K2XA 2WBRA 3CDEA 3BEGB 4Q7AA 2Z2MA 2HVZA 3MM8B 1U24A 4A8QA 2DPJA 1BD6A 2BANB 1NO8A 5E33A 4DQIA 1KC8T 3SV4A 4P2SA 2ZH6A 1HYSA 1HNVB 2HLUA 3GIMA 4NLWA 2DO0A 3PW4A 3C3LA 3KLHB 3C8YA 1E6VB 4I1TA 1DTQA 3Q0AA 3TUIC 2ZC3A 1GTHA 3N79A 4M5DB 1VOMA 4X4NA 3HMJG 3OJSA 2LMIA 2C2DA 1AFIA 3MDFA 5MLCV 1OIAA 3O5TB 3I5CA 3RZAA 3PFOA 3O8WA 4A8XA 1KQSR 2IJNA 2MGZB 4J5OA 4YP3A 3R5BA 1QE1B 5IQ6A 1Y00A 1YRTA 1I1GA 4QCLA 1IKWB 1S1VB 2BUNA 3LAMA 3T5KA 3PDNA 3GG1A 3P3DA 2EFNA 2KRBA 1NK9A 3DOMA 1N6QB 1NH7A 5D4LA 4DL5A 2HWHA 3CMES 3CDWA 1Q7YT 2E9ZA 4A46A 2IRYA 5K8OA 1YRXA 3CWJA 4U7UK 3S01A 4DFPA 1T05B 4ZHRB 4MIBA 3NNHA 4ECZA 2E7XA 2C3MA 3GG0A 3KHHA 1S9GB 1YJRA 4OIXA 5KFYA 2FLLA 4KV8B 3T5HA 2YNFB 4WIIA 3THVA 4UOCA 1SJ4P 2B6AB 5KT3A 4C11A 3KJVB 4MKBA 2UVRA 1B7FA 2I38A 2K7KA 2OSQA 5EHHA 2DVIA 1FNMA 4N76A 3HI9A 4ZPTR 4RU2A 2R7XA 1YJUA 3A8EA 1U7LA 3LQVA 4KBIA 2IVFB 2RKIA 4JUZA 3C2PA 1HI8A 2AGQA 4DSLA 2E1CA 3UDCA 1Q8BA 5B0FA 3LP0B 2QLWA 4K4XA 2E66A 1FDNA 5DGBA 5DG8A 4ECVA 2FVQA 3KHRA 2M8HA 2VBYA 5AXKA 5EWEA 3DMJB 4ZP6A 2JOQA 4USHA 5EWFA 3DN9A 4C11B 3KJVA 4WFYA 4IYQA 1KOHA 1YJTA 5IT0A 3PR4A 1LKZA 3IWXA 1KNZA 2CZVC 5E3QA 2HGLA 3HPOA 4IOAQ 3POTB 4ETZA 3HK2A 3KLFB 2XI3A 2APOA 2WAQD 4BS2A 3CCUS 2HQIA 2DNNA 2CPDA 3HLUA 1WNEA 2HIQA 3M6WA 4ZPVR 3PIPQ 1VQOS 1RT6A 1V3ZA 2EW9A 2HNDB 1ZM2A 2RS2A 4MYUA 3BO3A 4A8KA 4F50A 5KFWA 3B4DA 1M1KT 4CO4A 2MY7A 2N7CA 4DDFA 3H40A 2JL9A 4MMOA 3DRRA 1IBLF 2J0XA 2J9DE 4ZP9A 2HHXA 4YUDA 2RIJA 3ETOA 3OTBA 4LMZA 5I3QA 4KR0B 2R7OA 1U49A 2I8EA 4OJ3A 5B09A 4QJVA 1DJ0A 3DLKB 3KFWX 1RT3B 2FLOA 4PXBA 3VCDA 1LFPA 4LSNA 3WX4A 2ZOMA 4A47A 2OLWA 2PA3A 2KYXA 1LWFB 3FFIB 2QSFA 1X7VA 3GYXB 1K73T 2E7WA 4ILMA 4HI1A 5F8JA 1QAYA 3LANA 4G1PA 4B3RF 1C1CA 2J7WA 1UEVA 4KIAA 4C98A 5HMXA 1DTTB 5L8RC 3L3CA 2DHGA 2W24A 3FJ2A 4ZPBA 1KR4A 1X9MA 1N5YB 3DXBA 3I0RB 3BQ0A 2XB2D 2ROGA 3T9ZA 3NBPB 4IFVB 1H2VZ 2ZE2B 4J9KA 4TY8B 3OL8A 4ECQA 4ED8A 2VA2A 3V4IA 4PWDB 1VQKS 2WW8A 3M32B 2OD6A 3UW1A 4YQWA 4FBTA 2ZHAA 2DR7A 1IKXA 1VK8A 1IN0A 5FDLA 2CPJA 4QW8A 2G0CA 2O01C 1A9NB 2VA3A 5LJ3Y 1QJHA 5CXTA 3QJLA 1AROP 5GADU 5GAEU 4C3LA 1VQLS 5CYMA 5ADZA 3NCPA 2BBEA 4JV1A 4YDXA 4LQ3A 4RW9A 3G96A 1NJZA 1DFDA 4DR3F 3LWLA 1O5JA 4X66F 3BGLA 3VAKA 2DNOA 3V81B 1N52B 2F9JA 3VAGA 1HNVA 1GTEA 1U1OA 4B9NA 2SXLA 2CVEA 2YX4A 4KO0A 4DJBA 4RW6B 5BYRA 4ZMMA 2OMOA 3BB5A 3M9OB 3CCRS 4WCEQ 2YKQA 3HDSA 3VAMA 2AJQA 5HROB 2WB1D 5HBMA 2EWHA 2KN4A 3H5YA 4FZVA 1LWFA 2X1BA 1V9OA 5B0EA 2BA9A 5AXMA 5KG6A 3DM2B 1DBDA 1TVRB 4B9UA 3O44A 4N5SA 2JLEA 3JTNA 1SL2A 2YVSA 4O44B 2BQUA 4TN2A 2PGCA 3IRXA 2K7JA 3I82A 1TL1B 1LQ9A 4QPTA 4DX8H 1MROB 4OI3A 4KB7A 1FJCA 2DGOA 4FNHA 4B3OB 2AV5A 2MZJA 2ALZA 1CPZA 3W2WB 2L08A 1YGYA 1OQ6A 4IG0A 1W2BR 1GQEA 2ADBA 4EU0A 1JLCA 2OPQB 1KD1T 1IUJA 4K4VA 4NCAA 3R5AA 2CQ1A 2B43A 4ICLB 4Y6IA 2YKOA 3EGWB 1LW0A 1J5OA 3MEGB 3MHYA 2F7VA 3MZIA 3FGVA 2FLNA 3VWSA 2OD4A 3KK3B 3DRPB 3MMBB 1HMVB 3RRKA 5CHCB 4DSEA 3WDOA 3OL7A 3DXSX 1KN6A 3LGMA 1KHVA 2HPUA 5CQGA 5KFCA 1B64A 3OV7A 4N56A 1P27B 4KV8A 4R0EA 5SZTA 2KH9A 4X4UA 4RUAA 2B6AA 3WC0A 2RU3A 1N0VC 2HNYA 5DQIA 2HWIA 1IKWA 2FGOA 3I31A 4OHXA 3RB6A 2E29A 3E3XA 3NP5A 2LXIA 4Q2MA 2E5HA 4UY85 4OX9F 4CO3A 4TLQA 2HFOA 4NLDA 3RB0A 2J8AA 2FHKA 3HJFA 3PX6A 2IFXA 2WBMA 4QIVA 3W7BA 2VG5B 4WKYA 1CSJA 4KHMA 1U48A 2GQ2A 4IH7A 1JLEB 1JLAB 3BF4A 3IR7B 4PQUB 2QFJA 1Z1ZA 1FD8A 3KWMA 3TUZC 5KT5A 2C2EA 2FVPA 1XWLA 2DHSA 5THWA 1VQ9S 4EEYA 1VQ8S 1HI0P 4UY8T 4KHPF 4C9DA 2AQ4A 4PWUA 3SV3A 3DCAA 3DI6A 4OHVA 3DU5A