2WSFF

Improved model of plant photosystem i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
154
structure length
154
Chain Sequence
DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 19
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2wsfF00
1JB0F 3LW5F 4L6V6 4Y28F 2O01F 4RKUF 4KT0F 5L8RF 4XK8F 2WSEF 2WSFF 2WSCF
chains in the Genus database with same CATH superfamily
2O5RA 3RGPA 2DNAA 1NV8A 3UJNA 2KZUA 3R8FA 2EO2A 4KODA 4IBGA 1GABA 1S3SA 1OTRA 2QSFX 1AIPC 3J27B 2CE7A 3B74A 2JP7A 2P5TA 2HKJA 4LF8M 7CATA 3QWLA 4KO8A 1VQ1A 2ZAOA 4KT0F 5EQTA 4DUYM 3FTCA 2L7IA 2KNZA 3TWKA 3M6AA 4MGZE 2C5RA 1N32M 2RGHA 2G5GX 2EA0A 2Z3XA 2OOBA 1NJFA 2JXNA 2YFQA 1E9RA 4JN6A 3HJ8A 2XZUA 2LWXA 2YNMD 3K92A 4F2LA 1YLAA 1G59A 2CV2A 2HCBA 3FUTA 2R0IA 4I81A 1XNRM 2MJ5B 4DR3M 1SXJE 5DNYA 2D7GA 3LQRA 2CEAA 1UFZA 4DR6M 3AOGA 1AUAA 1L8QA 2UXBM 4MB7A 1HT1E 2JNHA 1JR3A 4IBKA 2G8LA 3ILKA 4L15A 4IBBA 1K3WA 1XWIA 1NNJA 4LF4M 1YUBA 1Z6TA 4GEWA 2DKLA 5E6JA 3T1YM 2OPFA 2EKFA 3GRUA 3J80S 5GKNA 3HU3A 5EXTA 3BBZA 5ITXA 2DVWB 4G3OA 1HNXM 4LFCM 2F5PA 1VEGA 5F3WA 3SBJA 2XGNA 3B7NA 2DWMA 1G8PA 2XH9A 1NY5A 3UK6A 2DAMA 4DR4M 1QUTA 3LW5F 4QNMA 1DV0A 2K6BA 1N33M 1BVSA 4HLQA 3KW6A 3GPYA 1FJGM 3M0EA 1WXQA 4RF0A 4ITQA 3SASA 1N75A 4YHHM 2LXEA 1L1ZA 1L1TA 2R4JA 5C1BA 2L4EA 3KP1E 2VQEM 4KLNA 3LVWA 4WP2A 3TL4X 3L28A 3PFIA 3U61B 4AKHA 1YSYA 4NL4H 1IN7A 3GLHA 4JI2M 4JI7M 4DV6M 1IBKM 1XXHB 2CUZA 4XK8F 1N77A 4OU7A 1VDDA 4IBCA 4RF1A 2CHGA 3FYDA 4IJFA 2J7NA 1E9SA 3FTEA 2FS1A 2F5OA 2R18A 4JV5M 4EIWA 5ITRA 3IHPA 3MK6A 2FOIC 2W82A 2RRUA 1I4WA 3KSXA 1IFYA 2QNJA 3TPZA 2F5QA 2LVOC 2UXCM 2KZSA 1R2YA 2EUCA 2R44A 3FTDA 5FTNA 1JB0F 1PRBA 4PDGA 2I7NA 2KA6B 2D7EA 1NHWC 3JR4A 3KS8A 3KSJA 2L7HA 3T1HM 2FE8A 5EXPA 5IZ7D 3KS4A 3L26A 3A98B 4G4QA 1SXJB 2DAKA 2VQFM 3LQQA 4G4OA 3NBXX 3U5ZA 5EXSA 1I94M 3FTFA 3THGA 3GLGA 3SAUA 1XMQM 3HKPA 3TWMA 1NJGA 2X4AA 4LJ9A 2YQZA 1H6UA 1ZMVA 5KPRA 2QQ8A 3KOYE 3WHKA 1DO0A 1DGFA 1XXHE 3EIEA 1QZEA 2Z4RA 1WGLA 1NHGC 2NQ8C 1IQPA 3MJ5A 5JI2E 3FYCA 1HT2E 5BR8M 3CF6E 1JR3E 2Z7JA 1TH4A 1SXJD 1TR8A 1MN3A 1SXJC 5ITXE 3GQ5A 2L6OA 4JI1M 2CV1A 1GVNA 2KRUA 3T15A 3U6OA 3B7QA 2L09A 1DGGA 2R4EA 3KOZE 3WHLA 1OAOC 2F5SA 2AHMA 5ITUA 4PT5A 1DO2A 4LRSA 3CF0A 3FUUA 2HAKA 3GLHE 4II7A 4JI4M 1G4AE 5FTMA 4CIZA 3B9PA 4WURA 3HHZA 3VKHA 3D8BA 1YE9A 2J7OA 3ZH9B 2K9DA 4B3RM 4YY3M 2ZTDA 1D2NA 4M9SA 1OKSA 3DZDA 4M0DA 4QNRA 2CP8A 3U61A 3C3EA 5FTJA 3I4VA 3HHXA 4IBJA 1KSFX 2BWBA 3C9PA 4M0WA 4CJ6A 2E5LM 4M9ZA 3SAWA 1EIJA 2Y0TA 2B3TA 1DGBA 1P3QQ 2KHHA 3LVVA 2JY6B 4HEOA 4D81A 4QOZC 1F4IA 1VEKA 5KQDA 2KXEA 5FSWA 3L2AA 4GKKM 3U60B 4A3VB 1MJGM 2C9OA 3GPUA 2BJWA 4FCVA 4FWGA 4HL4A 4NSOB 1IY2A 3K1JA 4LJ8A 3MHVC 1L2CA 3L29A 4AKGA 3OTOM 2XFTA 2F5NA 3E4RA 3GP1A 1PJSA 3AOEA 1TGUA 3ZCBB 1PM5A 3PVSA 2ZANA 3U5ZB 1QYRA 3SHFA 3GO8A 2C99A 4OW0A 1ZV1A 2XSZD 3GLGB 2LVNC 4AQYM 1K3XA 4S12A 1R2ZA 3A42A 4NSRA 1D0MA 4LGMA 2MGWA 1XHBA 5EP4A 3M7GA 1FNNA 3T6PA 4BLCA 4BB9A 1CUKA 1PJTA 3GQ3A 4GHAA 4L16A 3GLIB 3KP0E 1G41A 4RNAA 3GLFA 3HGIA 5DYIA 3BOSA 1VEJA 2JY5A 1E32A 2KDLA 3NBIA 4MGIE 2DAEA 4JI3M 1GL7A 3U6DA 1GO5A 1Q3BA 2FH0A 3E46A 2R6FA 3RGSA 3J81S 3LMMA 4DV5M 3C3DA 2ZTCA 4NXNM 1OIPA 1N34M 4NRVA 1TTEA 4IJEA 3Q8XA 1XC8A 4IBFA 1MU5A 2I7PA 1QVRA 4I8OA 4P16A 1QAQA 2GQFA 5DFLA 1J5EM 1EFUB 3KOXE 1WJ7A 4FCWA 2GNOA 3AKZA 1QUSA 2V1CA 2KRKA 3I01M 1IXRC 2LVQD 2V6ZM 2XFSA 3L27A 4GIPA 1G71A 3AL0C 5FTKA 2WSEF 3NWLA 2Q2EB 4G4NA 3AV0A 5E26A 1GJSA 4QHSA 3SAVA 3ZC7B 2R45A 4GC5A 3CGWA 3SMPA 4LCBA 1MX0A 4DR7M 1T6OA 2JY8A 4LF6M 3KVWA 2ZM6M 2WZJA 4LGYA 3FE3A 2KW0A 2VIIA 3GLFE 4R71A 5FLXS 1NNUC 2K0BX 1IN8A 4GRIA 4XBOA 4Y28F 3T38A 3FKEA 4LJAA 1WHCA 4AZFA 2JY7A 2XEPA 3U6MA 4ZPXA 1VDLA 2DWNA 1OAIA 3U6QA 3E21A 4FW9A 2CV0A 2QP9X 2JZ1A 2DZNB 1IN5A 2QHOB 2WSFF 4GH9A 4LFAM 2A5YB 1R5LA 1WGNA 1X37A 5EP2A 3TWLA 2JZ0A 4GHLA 4LJ7A 1IXZA 2FFJA 4AKIA 4FWDA 2DENA 3F92A 3AJIB 2CHQA 1WIVA 1HR0M 1IN4A 3ZQJA 1IY0A 3U6LA 2OQ4A 2V1UA 3CF2A 4QHTA 4WW0A 3H4JA 2F4VM 3GLIA 1KFVA 3SC3A 1OQYA 2CRUA 3GLFB 2OOAA 5KPTA 4I5SA 3FD9A 4XGIA 5IREB 1Q39A 1L2DA 4K0KM 3HU2A 5EJCA 4DV7M 2R46A 3B89A 4DR2M 5LMUM 1A5TA 3QYEA 1LV7A 2O01F 3E9SA 2J5YA 2D7HA 2RGOA 3FRIA 4LJ5A 3VFDA 4D80A 3HJSA 3FUWA 2LHGA 3HY5A 4Q7JA 3CTWB 2JWSA 3K2LA 4REZA 2Y21A 1NY6A 2JA2A 4LZZA 1N36M 2UUCM 1Q3CA 4JI5M 2DI0A 2C9CA 3EIHA 5EP1A 2DWLA 4LF9M 3K9PA 4Z6YA 1QDTA 1TDHA 1TF0B 2QBYB 1PGYA 4NC6A 2KNVA 1KYIA 4NXMM 1IY1A 1C7YA 4LFBM 3GLHB 2DXIA 1XXHA 2BWEA 2G3QA 4X62M 4UN2B 3RE8A 2XZFA 2LHCA 4OVZB 2LBCA 3K8ZA 4OX9M 3QAUA 3GRRA 4L4UA 4B7GA 1T3TA 1R6BX 2BJVA 2LTUA 1QAMA 2LH0A 3VKGA 1IXSB 1ORYB 2Y20A 4DV3M 1IN6A 4M9XA 2H5XA 3C58A 2M60A 2O25A 1QZMA 2XF3A 4FD2A 2X8AA 3BXWA 4DR5M 1HQYE 4FCTA 2OO9A 2Z8YM 2DAIA 2VF8A 3D8LA 1JQJC 4I4LA 5KO3A 1ZQ9A 2UXDM 1R7RA 4LRTA 4RKUF 2QZ4A 4G4RA 3DFZA 1DGHA 4GC9A 3Q8GA 2QCUA 4R3DA 5IWAM 1QQWA 3W67A 3R9XB 3SHGB 1W5SA 2X49A 1D0LA 1VG5A 3LCUA 1Z5AA 4MM3B 3IG5A 4X65M 4DV4M 3J7AS 4X66M 4LF7M 2DHYA 2HL7A 5DYGA 4PD2A 4CGYB 8CATA 4IBEA 3FRHA 2H1RA 3QYBA 3UZUA 1D0KA 2N35A 3MMPA 2XLJA 3VK8A 2VDBB 3B7ZA 2CFOA 2DAGA 3SATA 4R7GA 1HJPA 2DHRA 2DZLA 4F1IA 3SARA 4LG2A 3KFUG 4JI6M 3J2PB 1J7KA 3AOEC 1J09A 1G3IA 1V34A 2K47A 1PJQA 3TE6A 3U6EA 1OFHA 2Z4SA 1OJLA 4DBGB 4NRWA 2UUAM 3L25A 5LMNM 3IG8A 4BBAA 1PJIA 1SXJA 1NV9A 1SG9A 2DZOB 1HNZM 3U6PA 1PJJA 2MROB 2QBYA 2ZBKB 4JI8M 1Q02A 3HHWA 3RFWA 1T43A 1ZMUA 2UUBM 1K82A 3U6CA 2M5ZA 4B7FA 2UU9M 4IBIA 3K9OA 2LVAA 3GPPA 2MR9A 2JUJA 2KNAA 4OVZA 4B7HA 4DR1M 3DOAA 3DA1A 3VDUA 3VLFB 2QPAA 3HHYA 4B08A 2MH8A 3UGJA 3IECA 1IXSA 1TH3A 4JI0M 1EE8A 4QOSA 3GRYA 4PDIA 4D82A 3W0LB 4L6V6 3GLGE 5FTLA 3U6SA 4LY6A 1ZMWA 3I04M 1HQCA 2ERCA 4MGKE 1WR1B 4G6ZA 2L2DA 2KEBA 4MGHA 2BNKA 1HNWM 3SYLA 1DGHB 2XSZA 3HU1A 4ANRA 4B3SM 4FWHA 1C1KA 2R62A 4AG5A 1Z5BA 5L8RF 1TDZA 2Y0QA 4AG6A 2LNHC 2VF7A 3HX3A 4GMQA 4B3TM 3UMMA 5EXXA 5BPVA 3J7BA 3W68A 1XB2B 1NO1A 3A45A 1R4GA 3KOWE 3W0FA 1Z59A 5IT9S 4X64M 3V76A 2RKOA 1UM8A 2R65A 5ITQA 3GQ4A 4L8RC 2LVPC 5H37D 4LZJA 4KHPM 1V92A 4MGYE 3A46A 3U60A 4TUWA 4LF5M 1NSFA 1Z5CA 4CHTB 3GLIE 2C98A 3PNYA 4IIWA 4AI6A 2FNAA 1GL6A 2EKKA 4DV0M 1V33A 4P17A 1QANA 5C18A 1IM2A 5ITTA 1ZAEA 3LCVB 2ZAMA 1OFIA 5KQ8A 3I4YA 4L78A 3H4MA 3VDPA 4DV1M 5A2QS 2C96A 1N78A 4GITA 1XMOM 3JAMS 1Y8GA 1L2BA 4DV2M 1GKIA 5KPZA 1IBLM 4IBDA 2WSCF 2HHHM 3GRVA 1JR3D 2CHVA 3KDSE 4Z8XA 1E94E 2EJSA 1LTMA 3JR5A 3PNVA 3FUXA 3SMSA 3VK7A 4JYAM 1QAOA 1QDRA 5EP3A 2HWJA 2DWZB 4B3MM 3HZJA 4AW4A 4CISA 3HJQA 3I51A 3KXEC 1XNQM 2APLA 1RU3A 1TH2A 5JI3E 4MH0E 4NOOB 4LJ4A 2YR0A 4W5WA 4GKJM 3PXGA 4LJ6A 3GPXA 1OIZA 1IBMM 1GLNA 3AFHA 3HWSA 5ITYA 2QENA 3SYKA 4FVMA 2L4FA 1NVMA 1W5TA 2CWBA 3FUVA 3TQSA 4PCZA 1GJTA 3SFZA 4JXJA 4DUZM
chains in the Genus database with same CATH topology
1JB0F 3LW5F 4L6V6 4Y28F 2O01F 4RKUF 4KT0F 5L8RF 4XK8F 2WSEF 2WSFF 2WSCF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB0 F;  3LW5 F;  4L6V 6;  4Y28 F;  2O01 F;  4RKU F;  4KT0 F;  5L8R F;  4XK8 F;  2WSE F;  2WSF F;  2WSC F; 
#chains in the Genus database with same CATH topology
 2O5R A;  3RGP A;  2DNA A;  1NV8 A;  3UJN A;  2KZU A;  3R8F A;  2EO2 A;  4KOD A;  4IBG A;  1GAB A;  1S3S A;  1OTR A;  2QSF X;  1AIP C;  3J27 B;  2CE7 A;  3B74 A;  2JP7 A;  2P5T A;  2HKJ A;  4LF8 M;  7CAT A;  3QWL A;  4KO8 A;  1VQ1 A;  2ZAO A;  4KT0 F;  5EQT A;  4DUY M;  3FTC A;  2L7I A;  2KNZ A;  3TWK A;  3M6A A;  4MGZ E;  2C5R A;  1N32 M;  2RGH A;  2G5G X;  2EA0 A;  2Z3X A;  2OOB A;  1NJF A;  2JXN A;  2YFQ A;  1E9R A;  4JN6 A;  3HJ8 A;  2XZU A;  2LWX A;  2YNM D;  3K92 A;  4F2L A;  1YLA A;  1G59 A;  2CV2 A;  2HCB A;  3FUT A;  2R0I A;  4I81 A;  1XNR M;  2MJ5 B;  4DR3 M;  1SXJ E;  5DNY A;  2D7G A;  3LQR A;  2CEA A;  1UFZ A;  4DR6 M;  3AOG A;  1AUA A;  1L8Q A;  2UXB M;  4MB7 A;  1HT1 E;  2JNH A;  1JR3 A;  4IBK A;  2G8L A;  3ILK A;  4L15 A;  4IBB A;  1K3W A;  1XWI A;  1NNJ A;  4LF4 M;  1YUB A;  1Z6T A;  4GEW A;  2DKL A;  5E6J A;  3T1Y M;  2OPF A;  2EKF A;  3GRU A;  3J80 S;  5GKN A;  3HU3 A;  5EXT A;  3BBZ A;  5ITX A;  2DVW B;  4G3O A;  1HNX M;  4LFC M;  2F5P A;  1VEG A;  5F3W A;  3SBJ A;  2XGN A;  3B7N A;  2DWM A;  1G8P A;  2XH9 A;  1NY5 A;  3UK6 A;  2DAM A;  4DR4 M;  1QUT A;  3LW5 F;  4QNM A;  1DV0 A;  2K6B A;  1N33 M;  1BVS A;  4HLQ A;  3KW6 A;  3GPY A;  1FJG M;  3M0E A;  1WXQ A;  4RF0 A;  4ITQ A;  3SAS A;  1N75 A;  4YHH M;  2LXE A;  1L1Z A;  1L1T A;  2R4J A;  5C1B A;  2L4E A;  3KP1 E;  2VQE M;  4KLN A;  3LVW A;  4WP2 A;  3TL4 X;  3L28 A;  3PFI A;  3U61 B;  4AKH A;  1YSY A;  4NL4 H;  1IN7 A;  3GLH A;  4JI2 M;  4JI7 M;  4DV6 M;  1IBK M;  1XXH B;  2CUZ A;  4XK8 F;  1N77 A;  4OU7 A;  1VDD A;  4IBC A;  4RF1 A;  2CHG A;  3FYD A;  4IJF A;  2J7N A;  1E9S A;  3FTE A;  2FS1 A;  2F5O A;  2R18 A;  4JV5 M;  4EIW A;  5ITR A;  3IHP A;  3MK6 A;  2FOI C;  2W82 A;  2RRU A;  1I4W A;  3KSX A;  1IFY A;  2QNJ A;  3TPZ A;  2F5Q A;  2LVO C;  2UXC M;  2KZS A;  1R2Y A;  2EUC A;  2R44 A;  3FTD A;  5FTN A;  1JB0 F;  1PRB A;  4PDG A;  2I7N A;  2KA6 B;  2D7E A;  1NHW C;  3JR4 A;  3KS8 A;  3KSJ A;  2L7H A;  3T1H M;  2FE8 A;  5EXP A;  5IZ7 D;  3KS4 A;  3L26 A;  3A98 B;  4G4Q A;  1SXJ B;  2DAK A;  2VQF M;  3LQQ A;  4G4O A;  3NBX X;  3U5Z A;  5EXS A;  1I94 M;  3FTF A;  3THG A;  3GLG A;  3SAU A;  1XMQ M;  3HKP A;  3TWM A;  1NJG A;  2X4A A;  4LJ9 A;  2YQZ A;  1H6U A;  1ZMV A;  5KPR A;  2QQ8 A;  3KOY E;  3WHK A;  1DO0 A;  1DGF A;  1XXH E;  3EIE A;  1QZE A;  2Z4R A;  1WGL A;  1NHG C;  2NQ8 C;  1IQP A;  3MJ5 A;  5JI2 E;  3FYC A;  1HT2 E;  5BR8 M;  3CF6 E;  1JR3 E;  2Z7J A;  1TH4 A;  1SXJ D;  1TR8 A;  1MN3 A;  1SXJ C;  5ITX E;  3GQ5 A;  2L6O A;  4JI1 M;  2CV1 A;  1GVN A;  2KRU A;  3T15 A;  3U6O A;  3B7Q A;  2L09 A;  1DGG A;  2R4E A;  3KOZ E;  3WHL A;  1OAO C;  2F5S A;  2AHM A;  5ITU A;  4PT5 A;  1DO2 A;  4LRS A;  3CF0 A;  3FUU A;  2HAK A;  3GLH E;  4II7 A;  4JI4 M;  1G4A E;  5FTM A;  4CIZ A;  3B9P A;  4WUR A;  3HHZ A;  3VKH A;  3D8B A;  1YE9 A;  2J7O A;  3ZH9 B;  2K9D A;  4B3R M;  4YY3 M;  2ZTD A;  1D2N A;  4M9S A;  1OKS A;  3DZD A;  4M0D A;  4QNR A;  2CP8 A;  3U61 A;  3C3E A;  5FTJ A;  3I4V A;  3HHX A;  4IBJ A;  1KSF X;  2BWB A;  3C9P A;  4M0W A;  4CJ6 A;  2E5L M;  4M9Z A;  3SAW A;  1EIJ A;  2Y0T A;  2B3T A;  1DGB A;  1P3Q Q;  2KHH A;  3LVV A;  2JY6 B;  4HEO A;  4D81 A;  4QOZ C;  1F4I A;  1VEK A;  5KQD A;  2KXE A;  5FSW A;  3L2A A;  4GKK M;  3U60 B;  4A3V B;  1MJG M;  2C9O A;  3GPU A;  2BJW A;  4FCV A;  4FWG A;  4HL4 A;  4NSO B;  1IY2 A;  3K1J A;  4LJ8 A;  3MHV C;  1L2C A;  3L29 A;  4AKG A;  3OTO M;  2XFT A;  2F5N A;  3E4R A;  3GP1 A;  1PJS A;  3AOE A;  1TGU A;  3ZCB B;  1PM5 A;  3PVS A;  2ZAN A;  3U5Z B;  1QYR A;  3SHF A;  3GO8 A;  2C99 A;  4OW0 A;  1ZV1 A;  2XSZ D;  3GLG B;  2LVN C;  4AQY M;  1K3X A;  4S12 A;  1R2Z A;  3A42 A;  4NSR A;  1D0M A;  4LGM A;  2MGW A;  1XHB A;  5EP4 A;  3M7G A;  1FNN A;  3T6P A;  4BLC A;  4BB9 A;  1CUK A;  1PJT A;  3GQ3 A;  4GHA A;  4L16 A;  3GLI B;  3KP0 E;  1G41 A;  4RNA A;  3GLF A;  3HGI A;  5DYI A;  3BOS A;  1VEJ A;  2JY5 A;  1E32 A;  2KDL A;  3NBI A;  4MGI E;  2DAE A;  4JI3 M;  1GL7 A;  3U6D A;  1GO5 A;  1Q3B A;  2FH0 A;  3E46 A;  2R6F A;  3RGS A;  3J81 S;  3LMM A;  4DV5 M;  3C3D A;  2ZTC A;  4NXN M;  1OIP A;  1N34 M;  4NRV A;  1TTE A;  4IJE A;  3Q8X A;  1XC8 A;  4IBF A;  1MU5 A;  2I7P A;  1QVR A;  4I8O A;  4P16 A;  1QAQ A;  2GQF A;  5DFL A;  1J5E M;  1EFU B;  3KOX E;  1WJ7 A;  4FCW A;  2GNO A;  3AKZ A;  1QUS A;  2V1C A;  2KRK A;  3I01 M;  1IXR C;  2LVQ D;  2V6Z M;  2XFS A;  3L27 A;  4GIP A;  1G71 A;  3AL0 C;  5FTK A;  2WSE F;  3NWL A;  2Q2E B;  4G4N A;  3AV0 A;  5E26 A;  1GJS A;  4QHS A;  3SAV A;  3ZC7 B;  2R45 A;  4GC5 A;  3CGW A;  3SMP A;  4LCB A;  1MX0 A;  4DR7 M;  1T6O A;  2JY8 A;  4LF6 M;  3KVW A;  2ZM6 M;  2WZJ A;  4LGY A;  3FE3 A;  2KW0 A;  2VII A;  3GLF E;  4R71 A;  5FLX S;  1NNU C;  2K0B X;  1IN8 A;  4GRI A;  4XBO A;  4Y28 F;  3T38 A;  3FKE A;  4LJA A;  1WHC A;  4AZF A;  2JY7 A;  2XEP A;  3U6M A;  4ZPX A;  1VDL A;  2DWN A;  1OAI A;  3U6Q A;  3E21 A;  4FW9 A;  2CV0 A;  2QP9 X;  2JZ1 A;  2DZN B;  1IN5 A;  2QHO B;  2WSF F;  4GH9 A;  4LFA M;  2A5Y B;  1R5L A;  1WGN A;  1X37 A;  5EP2 A;  3TWL A;  2JZ0 A;  4GHL A;  4LJ7 A;  1IXZ A;  2FFJ A;  4AKI A;  4FWD A;  2DEN A;  3F92 A;  3AJI B;  2CHQ A;  1WIV A;  1HR0 M;  1IN4 A;  3ZQJ A;  1IY0 A;  3U6L A;  2OQ4 A;  2V1U A;  3CF2 A;  4QHT A;  4WW0 A;  3H4J A;  2F4V M;  3GLI A;  1KFV A;  3SC3 A;  1OQY A;  2CRU A;  3GLF B;  2OOA A;  5KPT A;  4I5S A;  3FD9 A;  4XGI A;  5IRE B;  1Q39 A;  1L2D A;  4K0K M;  3HU2 A;  5EJC A;  4DV7 M;  2R46 A;  3B89 A;  4DR2 M;  5LMU M;  1A5T A;  3QYE A;  1LV7 A;  2O01 F;  3E9S A;  2J5Y A;  2D7H A;  2RGO A;  3FRI A;  4LJ5 A;  3VFD A;  4D80 A;  3HJS A;  3FUW A;  2LHG A;  3HY5 A;  4Q7J A;  3CTW B;  2JWS A;  3K2L A;  4REZ A;  2Y21 A;  1NY6 A;  2JA2 A;  4LZZ A;  1N36 M;  2UUC M;  1Q3C A;  4JI5 M;  2DI0 A;  2C9C A;  3EIH A;  5EP1 A;  2DWL A;  4LF9 M;  3K9P A;  4Z6Y A;  1QDT A;  1TDH A;  1TF0 B;  2QBY B;  1PGY A;  4NC6 A;  2KNV A;  1KYI A;  4NXM M;  1IY1 A;  1C7Y A;  4LFB M;  3GLH B;  2DXI A;  1XXH A;  2BWE A;  2G3Q A;  4X62 M;  4UN2 B;  3RE8 A;  2XZF A;  2LHC A;  4OVZ B;  2LBC A;  3K8Z A;  4OX9 M;  3QAU A;  3GRR A;  4L4U A;  4B7G A;  1T3T A;  1R6B X;  2BJV A;  2LTU A;  1QAM A;  2LH0 A;  3VKG A;  1IXS B;  1ORY B;  2Y20 A;  4DV3 M;  1IN6 A;  4M9X A;  2H5X A;  3C58 A;  2M60 A;  2O25 A;  1QZM A;  2XF3 A;  4FD2 A;  2X8A A;  3BXW A;  4DR5 M;  1HQY E;  4FCT A;  2OO9 A;  2Z8Y M;  2DAI A;  2VF8 A;  3D8L A;  1JQJ C;  4I4L A;  5KO3 A;  1ZQ9 A;  2UXD M;  1R7R A;  4LRT A;  4RKU F;  2QZ4 A;  4G4R A;  3DFZ A;  1DGH A;  4GC9 A;  3Q8G A;  2QCU A;  4R3D A;  5IWA M;  1QQW A;  3W67 A;  3R9X B;  3SHG B;  1W5S A;  2X49 A;  1D0L A;  1VG5 A;  3LCU A;  1Z5A A;  4MM3 B;  3IG5 A;  4X65 M;  4DV4 M;  3J7A S;  4X66 M;  4LF7 M;  2DHY A;  2HL7 A;  5DYG A;  4PD2 A;  4CGY B;  8CAT A;  4IBE A;  3FRH A;  2H1R A;  3QYB A;  3UZU A;  1D0K A;  2N35 A;  3MMP A;  2XLJ A;  3VK8 A;  2VDB B;  3B7Z A;  2CFO A;  2DAG A;  3SAT A;  4R7G A;  1HJP A;  2DHR A;  2DZL A;  4F1I A;  3SAR A;  4LG2 A;  3KFU G;  4JI6 M;  3J2P B;  1J7K A;  3AOE C;  1J09 A;  1G3I A;  1V34 A;  2K47 A;  1PJQ A;  3TE6 A;  3U6E A;  1OFH A;  2Z4S A;  1OJL A;  4DBG B;  4NRW A;  2UUA M;  3L25 A;  5LMN M;  3IG8 A;  4BBA A;  1PJI A;  1SXJ A;  1NV9 A;  1SG9 A;  2DZO B;  1HNZ M;  3U6P A;  1PJJ A;  2MRO B;  2QBY A;  2ZBK B;  4JI8 M;  1Q02 A;  3HHW A;  3RFW A;  1T43 A;  1ZMU A;  2UUB M;  1K82 A;  3U6C A;  2M5Z A;  4B7F A;  2UU9 M;  4IBI A;  3K9O A;  2LVA A;  3GPP A;  2MR9 A;  2JUJ A;  2KNA A;  4OVZ A;  4B7H A;  4DR1 M;  3DOA A;  3DA1 A;  3VDU A;  3VLF B;  2QPA A;  3HHY A;  4B08 A;  2MH8 A;  3UGJ A;  3IEC A;  1IXS A;  1TH3 A;  4JI0 M;  1EE8 A;  4QOS A;  3GRY A;  4PDI A;  4D82 A;  3W0L B;  4L6V 6;  3GLG E;  5FTL A;  3U6S A;  4LY6 A;  1ZMW A;  3I04 M;  1HQC A;  2ERC A;  4MGK E;  1WR1 B;  4G6Z A;  2L2D A;  2KEB A;  4MGH A;  2BNK A;  1HNW M;  3SYL A;  1DGH B;  2XSZ A;  3HU1 A;  4ANR A;  4B3S M;  4FWH A;  1C1K A;  2R62 A;  4AG5 A;  1Z5B A;  5L8R F;  1TDZ A;  2Y0Q A;  4AG6 A;  2LNH C;  2VF7 A;  3HX3 A;  4GMQ A;  4B3T M;  3UMM A;  5EXX A;  5BPV A;  3J7B A;  3W68 A;  1XB2 B;  1NO1 A;  3A45 A;  1R4G A;  3KOW E;  3W0F A;  1Z59 A;  5IT9 S;  4X64 M;  3V76 A;  2RKO A;  1UM8 A;  2R65 A;  5ITQ A;  3GQ4 A;  4L8R C;  2LVP C;  5H37 D;  4LZJ A;  4KHP M;  1V92 A;  4MGY E;  3A46 A;  3U60 A;  4TUW A;  4LF5 M;  1NSF A;  1Z5C A;  4CHT B;  3GLI E;  2C98 A;  3PNY A;  4IIW A;  4AI6 A;  2FNA A;  1GL6 A;  2EKK A;  4DV0 M;  1V33 A;  4P17 A;  1QAN A;  5C18 A;  1IM2 A;  5ITT A;  1ZAE A;  3LCV B;  2ZAM A;  1OFI A;  5KQ8 A;  3I4Y A;  4L78 A;  3H4M A;  3VDP A;  4DV1 M;  5A2Q S;  2C96 A;  1N78 A;  4GIT A;  1XMO M;  3JAM S;  1Y8G A;  1L2B A;  4DV2 M;  1GKI A;  5KPZ A;  1IBL M;  4IBD A;  2WSC F;  2HHH M;  3GRV A;  1JR3 D;  2CHV A;  3KDS E;  4Z8X A;  1E94 E;  2EJS A;  1LTM A;  3JR5 A;  3PNV A;  3FUX A;  3SMS A;  3VK7 A;  4JYA M;  1QAO A;  1QDR A;  5EP3 A;  2HWJ A;  2DWZ B;  4B3M M;  3HZJ A;  4AW4 A;  4CIS A;  3HJQ A;  3I51 A;  3KXE C;  1XNQ M;  2APL A;  1RU3 A;  1TH2 A;  5JI3 E;  4MH0 E;  4NOO B;  4LJ4 A;  2YR0 A;  4W5W A;  4GKJ M;  3PXG A;  4LJ6 A;  3GPX A;  1OIZ A;  1IBM M;  1GLN A;  3AFH A;  3HWS A;  5ITY A;  2QEN A;  3SYK A;  4FVM A;  2L4F A;  1NVM A;  1W5T A;  2CWB A;  3FUV A;  3TQS A;  4PCZ A;  1GJT A;  3SFZ A;  4JXJ A;  4DUZ M; 
#chains in the Genus database with same CATH homology
 1JB0 F;  3LW5 F;  4L6V 6;  4Y28 F;  2O01 F;  4RKU F;  4KT0 F;  5L8R F;  4XK8 F;  2WSE F;  2WSF F;  2WSC F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...