2WSFF

Improved model of plant photosystem i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
154
structure length
154
Chain Sequence
b'DIAGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASSLLFRGFSWPVAAYRELLNGELVDNNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
molecule tags Photosynthesis
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
total genus 19
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02507 PSI_PsaF Photosystem I reaction centre subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Photosystem I PsaF, reaction centre subunit III 2wsfF00
1JB0F 4KT0F 4RKUF 4XK8F 2O01F 4L6V6 2WSEF 2WSFF 4Y28F 5L8RF 2WSCF 3LW5F
chains in the Genus database with same CATH superfamily
3ILKA 3TPZA 1Q02A 3ZCBB 1QDRA 5ITYA 2CHQA 2OOBA 5L8RF 1ZMUA 1J7KA 3PNYA 2ERCA 5ITTA 1TR8A 2G8LA 2R6FA 5H37D 5IWAM 2QHOB 1MJGM 2MGWA 3NBXX 4KO8A 2EJSA 3B89A 2XSZA 2XEPA 1TDZA 2GNOA 1HJPA 3IECA 3GRUA 2DNAA 2DZLA 3M7GA 2UUAM 2QNJA 1D0KA 4IJFA 2ZTDA 3HJ8A 1IBMM 5E26A 2A5YB 4UN2B 1GL7A 1IY1A 1EFUB 3GRVA 1E32A 1J5EM 5KO3A 1SXJD 2R44A 1QUTA 2D7HA 5A2QS 2XFSA 3L29A 4EIWA 2F5SA 3GLFE 2CV2A 3JAMS 1DO0A 3I01M 4B7FA 1A5TA 4K0KM 2D7EA 2KZUA 3GO8A 2CHVA 2QBYB 1OFIA 4DR2M 2C99A 1GJSA 2YR0A 1G4AE 1AUAA 2FNAA 2V6ZM 4LGMA 1QUSA 4LGYA 4BB9A 4ZPXA 1OIPA 1MX0A 4CHTB 2DKLA 3HWSA 4LRTA 4AW4A 4G6ZA 2DWLA 1N36M 2APLA 2F5OA 2WSCF 2UUBM 1QQWA 3L25A 3I51A 1K3WA 4OU7A 2VIIA 5FTJA 3LVVA 3L28A 2VQEM 4QNRA 3U6MA 3KOZE 4CGYB 5FTLA 3JR4A 3K1JA 3U6EA 1ZV1A 3SAWA 3FTEA 2DWNA 3C58A 2GQFA 4FD2A 4HLQA 3FE3A 4CISA 4FWDA 4D80A 4RNAA 1L8QA 3U5ZB 1YUBA 2ZAMA 4G3OA 2AHMA 4DV1M 3E9SA 3K2LA 4XGIA 2F5NA 4RF1A 2X4AA 1XB2B 2LVAA 2EUCA 1TDHA 1OAOC 4JYAM 2KDLA 2R65A 3SMPA 2XFTA 1EIJA 3K92A 4AG6A 4JXJA 4R7GA 3J81S 3U60B 1E9SA 1H6UA 4DV7M 1TF0B 1HT1E 1UM8A 2BJVA 3B7QA 1WJ7A 2UXDM 4DV5M 4I5SA 4LF9M 3ZQJA 1LV7A 4II7A 2LHCA 2RRUA 3SMSA 2DAKA 4GC9A 4P16A 4Z8XA 1I94M 2VF8A 3RGSA 3T15A 4WP2A 5ITXE 2B3TA 4B3RM 3MK6A 1QANA 5KQ8A 4AI6A 2M5ZA 3GRYA 3SHFA 1YSYA 1TGUA 2Y20A 3GQ3A 3C3EA 3HU3A 2O5RA 4NL4H 3U6SA 4FCTA 4DV0M 4G4OA 3K9PA 2DHRA 3DZDA 4IBBA 3U6PA 1QDTA 3LQRA 5EP4A 1G8PA 2MR9A 3A45A 4XBOA 4B3MM 4M0WA 2P5TA 4QOSA 1OAIA 2OOAA 4DR5M 2QBYA 4CIZA 1XXHA 5ITUA 4P17A 4JI8M 2EA0A 3LQQA 2KW0A 4Z6YA 5IT9S 3GLHB 1D0LA 3GQ5A 4FCWA 1GJTA 2K0BX 1Z59A 3KVWA 2CHGA 1TH2A 4A3VB 4BBAA 4JI3M 4DV2M 3L27A 5DNYA 2DAMA 1T3TA 3QWLA 1T6OA 3VDPA 3Q8GA 3R9XB 1BVSA 4LJ9A 4LF4M 3GPXA 1TTEA 3ZH9B 2KNZA 4KHPM 1DGHB 1JQJC 4GITA 3FUVA 5EJCA 4NXMM 4QHTA 3KOXE 2O01F 5EXXA 1SXJB 1OTRA 5EP3A 4NC6A 3GLHE 2XF3A 3AOEC 1NSFA 3VK7A 1PRBA 2X49A 4IBIA 4QOZC 4AKHA 3H4JA 2N35A 1JR3A 2JY6B 3CF6E 2LNHC 3V76A 4BLCA 3GLFB 4I8OA 2OPFA 1NVMA 3FD9A 4AKIA 3UGJA 2Z8YM 3VDUA 1N34M 1N33M 4MM3B 3GPYA 3KOWE 4LRSA 1QVRA 5FTKA 4CJ6A 3BBZA 2LVPC 5ITRA 1N32M 3M6AA 2MJ5B 2CV0A 1V34A 2QP9X 1GVNA 2L7HA 2R18A 2KXEA 2MROB 1OKSA 3GLHA 2UUCM 1XNRM 3PVSA 2CP8A 3HX3A 2ZM6M 1XHBA 2CFOA 1HNXM 2KZSA 2VQFM 4LFCM 4FCVA 5FTNA 3U6OA 4LFBM 2JY7A 2UXBM 1FJGM 2C98A 1IXRC 3GLIB 2K47A 1IQPA 4M9SA 3UMMA 4LZZA 3HU2A 2XGNA 2NQ8C 3E21A 4AG5A 4LY6A 2VF7A 5EQTA 4PDIA 4IBEA 3PNVA 3FTCA 1SXJA 2I7NA 1IBLM 1IXSA 1VDDA 3HGIA 2R4JA 2DVWB 1SG9A 3LCUA 1NHWC 1Z5CA 4B3SM 1F4IA 2L2DA 2R4EA 4X62M 3GLIE 1IFYA 3QYBA 1YLAA 2YFQA 3THGA 5BR8M 3AKZA 2M60A 2XSZD 3J80S 5GKNA 3RFWA 2HWJA 3FYDA 3KXEC 3VKHA 2WSFF 1HQCA 4GHLA 1JR3D 3I4VA 3IG5A 3B7ZA 1QYRA 1XXHB 2LH0A 1AIPC 1G3IA 3E4RA 1WHCA 3F92A 4FVMA 2FOIC 4IBDA 2BWBA 4PCZA 5JI2E 3LW5F 2FE8A 3GPPA 3HU1A 3GLIA 1IBKM 4ANRA 3TWKA 1GKIA 4R71A 4DR3M 2L6OA 2CE7A 3T1HM 1QAQA 2Z7JA 4LF6M 4DV3M 1KYIA 1MU5A 2JP7A 3HHYA 1P3QQ 2DHYA 3D8LA 3TL4X 2LTUA 3CF2A 3UZUA 1NNJA 4IBGA 2L7IA 4G4RA 1OFHA 2JNHA 1IY2A 3U5ZA 3B7NA 3HHXA 2DI0A 1HNWM 2QPAA 4G4NA 4LJ8A 1DO2A 5ITXA 4F2LA 1QZMA 1RU3A 2CRUA 2Z4SA 4GH9A 5F3WA 2DWMA 1GABA 3UJNA 4MH0E 3RGPA 2JUJA 3WHLA 2KEBA 4JN6A 2FS1A 1Q39A 1UFZA 4L6V6 3U60A 4JI1M 2H1RA 4DR7M 4YHHM 2H5XA 3W0LB 3W67A 1D2NA 5LMNM 5EXSA 1XXHE 5FTMA 3TWMA 4KODA 4S12A 2Y0QA 3U6LA 1XC8A 4RF0A 1Y8GA 1KFVA 4JV5M 3AJIB 3SBJA 1IN8A 1XMOM 1NJGA 2LVOC 5KPRA 3HY5A 3T6PA 1W5SA 2HAKA 2ZTCA 2G3QA 5C18A 4MGZE 2HCBA 4JI0M 5EP1A 1XMQM 4NRVA 3PFIA 3SFZA 2LWXA 2EKKA 3D8BA 2QCUA 4DBGB 1HT2E 3AOEA 4HL4A 1R4GA 2L4FA 1GLNA 8CATA 3C3DA 1QAMA 4NXNM 4GRIA 4REZA 2CUZA 4LJAA 2F4VM 4OVZB 3IHPA 2BWEA 3KFUG 3A98B 2XZUA 2C9OA 3HKPA 3FTDA 3CF0A 3SYKA 5KQDA 3TWLA 3SYLA 4OX9M 5IZ7D 4HEOA 4IBKA 1SXJC 2C96A 3FUTA 1R6BX 2Y0TA 1IN5A 3FYCA 3FKEA 2XZFA 1R2YA 4LF7M 4MGHA 3ZC7B 1L1TA 3VKGA 1PJSA 3KS4A 4L16A 2R46A 1OIZA 3AFHA 3DA1A 3I4YA 5DFLA 4X65M 2JZ1A 4LJ4A 2BJWA 4NSRA 4JI4M 3SAVA 1PJTA 3HJSA 4IIWA 1VDLA 1Z6TA 2V1CA 3J27B 2HL7A 5DYGA 2R0IA 2Z4RA 3L2AA 4D81A 1IN4A 3QAUA 3SATA 5DYIA 2DWZB 2UU9M 1R2ZA 4L8RC 2DAEA 4FWHA 2DZOB 2VDBB 1ZMVA 1SXJE 1Q3CA 4IBJA 3GLFA 1L2CA 2G5GX 2KNAA 2J7NA 3J7BA 2JXNA 3H4MA 4ITQA 3KW6A 3GLGA 3NBIA 1XWIA 3DOAA 4PD2A 3LMMA 3MJ5A 3GPUA 1DGBA 5JI3E 3A42A 2E5LM 2HKJA 4JI6M 4LF8M 4L78A 3W68A 3L26A 4XK8F 4FW9A 1DV0A 4B7GA 2DXIA 2LHGA 3KSJA 3FRIA 2LVNC 5FSWA 2LXEA 1WR1B 2OO9A 3CGWA 1NNUC 3Q8XA 1NY6A 3UK6A 3U6QA 3A46A 3U6CA 4GEWA 4IBFA 2KNVA 1PJJA 1HQYE 4TUWA 1DGGA 4LJ6A 3W0FA 1K82A 2ZAOA 2BNKA 1IN6A 5C1BA 2JA2A 2Q2EB 4AKGA 3J2PB 1R5LA 2YNMD 4DR4M 2R45A 2WZJA 2K9DA 1TH4A 1NY5A 4WW0A 3KOYE 5EXPA 2DZNB 3QYEA 5EP2A 3T1YM 4NOOB 1L1ZA 1JR3E 4QHSA 4M0DA 4JI2M 3R8FA 4RKUF 1IY0A 4OVZA 4DR6M 3I04M 3SHGB 2CV1A 3GRRA 3VFDA 2FFJA 2JZ0A 1ZMWA 4JI7M 1N77A 2EKFA 3C9PA 2YQZA 4M9ZA 1T43A 2MH8A 3T38A 1KSFX 5LMUM 3LVWA 1C7YA 2KHHA 3E46A 3TE6A 4MGKE 2FH0A 3GP1A 1G41A 2I7PA 3EIHA 4NSOB 4B7HA 2OQ4A 3AOGA 3VLFB 1Z5BA 2K6BA 1Q3BA 3AV0A 4D82A 1HNZM 3CTWB 3FUWA 2F5PA 4YY3M 2QQ8A 3VK8A 3SASA 2JY8A 4I81A 4KLNA 4WURA 3KDSE 4GMQA 3FTFA 4GHAA 1R7RA 4PDGA 1L2BA 3SC3A 5EXTA 1OQYA 2RKOA 4PT5A 1NV8A 4M9XA 5E6JA 1V33A 3EIEA 2XLJA 2F5QA 2WSEF 3M0EA 4B3TM 1GL6A 2O25A 3DFZA 4LCBA 4DR1M 2RGOA 1K3XA 3MMPA 3GLGB 4G4QA 3IG8A 1IN7A 4I4LA 1IXZA 7CATA 2KRUA 2KA6B 1WGNA 4L4UA 2HHHM 4DUYM 3KP1E 1TH3A 5FLXS 3OTOM 3LCVB 4DV6M 3U6DA 2QZ4A 1GO5A 1OJLA 1QZEA 1ZAEA 1VEKA 3MHVC 4MB7A 5KPTA 2J5YA 3KSXA 3U61A 3FRHA 3HJQA 1PJIA 2QSFX 1WXQA 4DV4M 2XH9A 2R62A 3HHWA 3WHKA 2DAIA 2DENA 4R3DA 2LVQD 3NWLA 1HR0M 3SAUA 1N78A 4OW0A 1G71A 4LJ5A 1PGYA 4IBCA 2DAGA 3BXWA 1VG5A 4NRWA 1C1KA 1PM5A 1Z5AA 2ZANA 1E94E 2QENA 1CUKA 1N75A 3FUXA 4MGIE 1G59A 2W82A 4LG2A 2JWSA 2C9CA 1ORYB 1D0MA 1FNNA 1EE8A 2Y21A 1JB0F 3SARA 4LJ7A 4B08A 4AZFA 2V1UA 1ZQ9A 4L15A 4GIPA 2EO2A 1S3SA 1NHGC 4IJEA 3RE8A 2LBCA 4MGYE 4QNMA 1LTMA 1L2DA 1V92A 4Y28F 2X8AA 1DGFA 4JI5M 3K8ZA 3GLGE 2C5RA 3K9OA 2ZBKB 1J09A 1VEGA 4X64M 3U61B 2D7GA 2Z3XA 4GKJM 2UXCM 1VEJA 4FWGA 3KS8A 1NO1A 3BOSA 1XNQM 3KP0E 2J7OA 1QAOA 1WGLA 1MN3A 4LZJA 5BPVA 4DUZM 2CWBA 2L09A 3GQ4A 3B9PA 1IXSB 1W5TA 1X37A 5ITQA 3PXGA 3J7AS 1NV9A 4LFAM 1DGHA 1I4WA 4KT0F 3TQSA 1NJFA 2JY5A 2CEAA 4X66M 5IREB 3HZJA 3HHZA 4LF5M 2L4EA 1VQ1A 2KRKA 1PJQA 2RGHA 3AL0C 3FUUA 4W5WA 3JR5A 4AQYM 1WIVA 4GKKM 1IM2A 3B74A 1YE9A 4Q7JA 1E9RA 5KPZA 4GC5A 4F1IA
chains in the Genus database with same CATH topology
1JB0F 4KT0F 4RKUF 4XK8F 2O01F 4L6V6 2WSEF 2WSFF 4Y28F 5L8RF 2WSCF 3LW5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB0 F;  4KT0 F;  4RKU F;  4XK8 F;  2O01 F;  4L6V 6;  2WSE F;  2WSF F;  4Y28 F;  5L8R F;  2WSC F;  3LW5 F; 
#chains in the Genus database with same CATH topology
 3ILK A;  3TPZ A;  1Q02 A;  3ZCB B;  1QDR A;  5ITY A;  2CHQ A;  2OOB A;  5L8R F;  1ZMU A;  1J7K A;  3PNY A;  2ERC A;  5ITT A;  1TR8 A;  2G8L A;  2R6F A;  5H37 D;  5IWA M;  2QHO B;  1MJG M;  2MGW A;  3NBX X;  4KO8 A;  2EJS A;  3B89 A;  2XSZ A;  2XEP A;  1TDZ A;  2GNO A;  1HJP A;  3IEC A;  3GRU A;  2DNA A;  2DZL A;  3M7G A;  2UUA M;  2QNJ A;  1D0K A;  4IJF A;  2ZTD A;  3HJ8 A;  1IBM M;  5E26 A;  2A5Y B;  4UN2 B;  1GL7 A;  1IY1 A;  1EFU B;  3GRV A;  1E32 A;  1J5E M;  5KO3 A;  1SXJ D;  2R44 A;  1QUT A;  2D7H A;  5A2Q S;  2XFS A;  3L29 A;  4EIW A;  2F5S A;  3GLF E;  2CV2 A;  3JAM S;  1DO0 A;  3I01 M;  4B7F A;  1A5T A;  4K0K M;  2D7E A;  2KZU A;  3GO8 A;  2CHV A;  2QBY B;  1OFI A;  4DR2 M;  2C99 A;  1GJS A;  2YR0 A;  1G4A E;  1AUA A;  2FNA A;  2V6Z M;  4LGM A;  1QUS A;  4LGY A;  4BB9 A;  4ZPX A;  1OIP A;  1MX0 A;  4CHT B;  2DKL A;  3HWS A;  4LRT A;  4AW4 A;  4G6Z A;  2DWL A;  1N36 M;  2APL A;  2F5O A;  2WSC F;  2UUB M;  1QQW A;  3L25 A;  3I51 A;  1K3W A;  4OU7 A;  2VII A;  5FTJ A;  3LVV A;  3L28 A;  2VQE M;  4QNR A;  3U6M A;  3KOZ E;  4CGY B;  5FTL A;  3JR4 A;  3K1J A;  3U6E A;  1ZV1 A;  3SAW A;  3FTE A;  2DWN A;  3C58 A;  2GQF A;  4FD2 A;  4HLQ A;  3FE3 A;  4CIS A;  4FWD A;  4D80 A;  4RNA A;  1L8Q A;  3U5Z B;  1YUB A;  2ZAM A;  4G3O A;  2AHM A;  4DV1 M;  3E9S A;  3K2L A;  4XGI A;  2F5N A;  4RF1 A;  2X4A A;  1XB2 B;  2LVA A;  2EUC A;  1TDH A;  1OAO C;  4JYA M;  2KDL A;  2R65 A;  3SMP A;  2XFT A;  1EIJ A;  3K92 A;  4AG6 A;  4JXJ A;  4R7G A;  3J81 S;  3U60 B;  1E9S A;  1H6U A;  4DV7 M;  1TF0 B;  1HT1 E;  1UM8 A;  2BJV A;  3B7Q A;  1WJ7 A;  2UXD M;  4DV5 M;  4I5S A;  4LF9 M;  3ZQJ A;  1LV7 A;  4II7 A;  2LHC A;  2RRU A;  3SMS A;  2DAK A;  4GC9 A;  4P16 A;  4Z8X A;  1I94 M;  2VF8 A;  3RGS A;  3T15 A;  4WP2 A;  5ITX E;  2B3T A;  4B3R M;  3MK6 A;  1QAN A;  5KQ8 A;  4AI6 A;  2M5Z A;  3GRY A;  3SHF A;  1YSY A;  1TGU A;  2Y20 A;  3GQ3 A;  3C3E A;  3HU3 A;  2O5R A;  4NL4 H;  3U6S A;  4FCT A;  4DV0 M;  4G4O A;  3K9P A;  2DHR A;  3DZD A;  4IBB A;  3U6P A;  1QDT A;  3LQR A;  5EP4 A;  1G8P A;  2MR9 A;  3A45 A;  4XBO A;  4B3M M;  4M0W A;  2P5T A;  4QOS A;  1OAI A;  2OOA A;  4DR5 M;  2QBY A;  4CIZ A;  1XXH A;  5ITU A;  4P17 A;  4JI8 M;  2EA0 A;  3LQQ A;  2KW0 A;  4Z6Y A;  5IT9 S;  3GLH B;  1D0L A;  3GQ5 A;  4FCW A;  1GJT A;  2K0B X;  1Z59 A;  3KVW A;  2CHG A;  1TH2 A;  4A3V B;  4BBA A;  4JI3 M;  4DV2 M;  3L27 A;  5DNY A;  2DAM A;  1T3T A;  3QWL A;  1T6O A;  3VDP A;  3Q8G A;  3R9X B;  1BVS A;  4LJ9 A;  4LF4 M;  3GPX A;  1TTE A;  3ZH9 B;  2KNZ A;  4KHP M;  1DGH B;  1JQJ C;  4GIT A;  3FUV A;  5EJC A;  4NXM M;  4QHT A;  3KOX E;  2O01 F;  5EXX A;  1SXJ B;  1OTR A;  5EP3 A;  4NC6 A;  3GLH E;  2XF3 A;  3AOE C;  1NSF A;  3VK7 A;  1PRB A;  2X49 A;  4IBI A;  4QOZ C;  4AKH A;  3H4J A;  2N35 A;  1JR3 A;  2JY6 B;  3CF6 E;  2LNH C;  3V76 A;  4BLC A;  3GLF B;  4I8O A;  2OPF A;  1NVM A;  3FD9 A;  4AKI A;  3UGJ A;  2Z8Y M;  3VDU A;  1N34 M;  1N33 M;  4MM3 B;  3GPY A;  3KOW E;  4LRS A;  1QVR A;  5FTK A;  4CJ6 A;  3BBZ A;  2LVP C;  5ITR A;  1N32 M;  3M6A A;  2MJ5 B;  2CV0 A;  1V34 A;  2QP9 X;  1GVN A;  2L7H A;  2R18 A;  2KXE A;  2MRO B;  1OKS A;  3GLH A;  2UUC M;  1XNR M;  3PVS A;  2CP8 A;  3HX3 A;  2ZM6 M;  1XHB A;  2CFO A;  1HNX M;  2KZS A;  2VQF M;  4LFC M;  4FCV A;  5FTN A;  3U6O A;  4LFB M;  2JY7 A;  2UXB M;  1FJG M;  2C98 A;  1IXR C;  3GLI B;  2K47 A;  1IQP A;  4M9S A;  3UMM A;  4LZZ A;  3HU2 A;  2XGN A;  2NQ8 C;  3E21 A;  4AG5 A;  4LY6 A;  2VF7 A;  5EQT A;  4PDI A;  4IBE A;  3PNV A;  3FTC A;  1SXJ A;  2I7N A;  1IBL M;  1IXS A;  1VDD A;  3HGI A;  2R4J A;  2DVW B;  1SG9 A;  3LCU A;  1NHW C;  1Z5C A;  4B3S M;  1F4I A;  2L2D A;  2R4E A;  4X62 M;  3GLI E;  1IFY A;  3QYB A;  1YLA A;  2YFQ A;  3THG A;  5BR8 M;  3AKZ A;  2M60 A;  2XSZ D;  3J80 S;  5GKN A;  3RFW A;  2HWJ A;  3FYD A;  3KXE C;  3VKH A;  2WSF F;  1HQC A;  4GHL A;  1JR3 D;  3I4V A;  3IG5 A;  3B7Z A;  1QYR A;  1XXH B;  2LH0 A;  1AIP C;  1G3I A;  3E4R A;  1WHC A;  3F92 A;  4FVM A;  2FOI C;  4IBD A;  2BWB A;  4PCZ A;  5JI2 E;  3LW5 F;  2FE8 A;  3GPP A;  3HU1 A;  3GLI A;  1IBK M;  4ANR A;  3TWK A;  1GKI A;  4R71 A;  4DR3 M;  2L6O A;  2CE7 A;  3T1H M;  1QAQ A;  2Z7J A;  4LF6 M;  4DV3 M;  1KYI A;  1MU5 A;  2JP7 A;  3HHY A;  1P3Q Q;  2DHY A;  3D8L A;  3TL4 X;  2LTU A;  3CF2 A;  3UZU A;  1NNJ A;  4IBG A;  2L7I A;  4G4R A;  1OFH A;  2JNH A;  1IY2 A;  3U5Z A;  3B7N A;  3HHX A;  2DI0 A;  1HNW M;  2QPA A;  4G4N A;  4LJ8 A;  1DO2 A;  5ITX A;  4F2L A;  1QZM A;  1RU3 A;  2CRU A;  2Z4S A;  4GH9 A;  5F3W A;  2DWM A;  1GAB A;  3UJN A;  4MH0 E;  3RGP A;  2JUJ A;  3WHL A;  2KEB A;  4JN6 A;  2FS1 A;  1Q39 A;  1UFZ A;  4L6V 6;  3U60 A;  4JI1 M;  2H1R A;  4DR7 M;  4YHH M;  2H5X A;  3W0L B;  3W67 A;  1D2N A;  5LMN M;  5EXS A;  1XXH E;  5FTM A;  3TWM A;  4KOD A;  4S12 A;  2Y0Q A;  3U6L A;  1XC8 A;  4RF0 A;  1Y8G A;  1KFV A;  4JV5 M;  3AJI B;  3SBJ A;  1IN8 A;  1XMO M;  1NJG A;  2LVO C;  5KPR A;  3HY5 A;  3T6P A;  1W5S A;  2HAK A;  2ZTC A;  2G3Q A;  5C18 A;  4MGZ E;  2HCB A;  4JI0 M;  5EP1 A;  1XMQ M;  4NRV A;  3PFI A;  3SFZ A;  2LWX A;  2EKK A;  3D8B A;  2QCU A;  4DBG B;  1HT2 E;  3AOE A;  4HL4 A;  1R4G A;  2L4F A;  1GLN A;  8CAT A;  3C3D A;  1QAM A;  4NXN M;  4GRI A;  4REZ A;  2CUZ A;  4LJA A;  2F4V M;  4OVZ B;  3IHP A;  2BWE A;  3KFU G;  3A98 B;  2XZU A;  2C9O A;  3HKP A;  3FTD A;  3CF0 A;  3SYK A;  5KQD A;  3TWL A;  3SYL A;  4OX9 M;  5IZ7 D;  4HEO A;  4IBK A;  1SXJ C;  2C96 A;  3FUT A;  1R6B X;  2Y0T A;  1IN5 A;  3FYC A;  3FKE A;  2XZF A;  1R2Y A;  4LF7 M;  4MGH A;  3ZC7 B;  1L1T A;  3VKG A;  1PJS A;  3KS4 A;  4L16 A;  2R46 A;  1OIZ A;  3AFH A;  3DA1 A;  3I4Y A;  5DFL A;  4X65 M;  2JZ1 A;  4LJ4 A;  2BJW A;  4NSR A;  4JI4 M;  3SAV A;  1PJT A;  3HJS A;  4IIW A;  1VDL A;  1Z6T A;  2V1C A;  3J27 B;  2HL7 A;  5DYG A;  2R0I A;  2Z4R A;  3L2A A;  4D81 A;  1IN4 A;  3QAU A;  3SAT A;  5DYI A;  2DWZ B;  2UU9 M;  1R2Z A;  4L8R C;  2DAE A;  4FWH A;  2DZO B;  2VDB B;  1ZMV A;  1SXJ E;  1Q3C A;  4IBJ A;  3GLF A;  1L2C A;  2G5G X;  2KNA A;  2J7N A;  3J7B A;  2JXN A;  3H4M A;  4ITQ A;  3KW6 A;  3GLG A;  3NBI A;  1XWI A;  3DOA A;  4PD2 A;  3LMM A;  3MJ5 A;  3GPU A;  1DGB A;  5JI3 E;  3A42 A;  2E5L M;  2HKJ A;  4JI6 M;  4LF8 M;  4L78 A;  3W68 A;  3L26 A;  4XK8 F;  4FW9 A;  1DV0 A;  4B7G A;  2DXI A;  2LHG A;  3KSJ A;  3FRI A;  2LVN C;  5FSW A;  2LXE A;  1WR1 B;  2OO9 A;  3CGW A;  1NNU C;  3Q8X A;  1NY6 A;  3UK6 A;  3U6Q A;  3A46 A;  3U6C A;  4GEW A;  4IBF A;  2KNV A;  1PJJ A;  1HQY E;  4TUW A;  1DGG A;  4LJ6 A;  3W0F A;  1K82 A;  2ZAO A;  2BNK A;  1IN6 A;  5C1B A;  2JA2 A;  2Q2E B;  4AKG A;  3J2P B;  1R5L A;  2YNM D;  4DR4 M;  2R45 A;  2WZJ A;  2K9D A;  1TH4 A;  1NY5 A;  4WW0 A;  3KOY E;  5EXP A;  2DZN B;  3QYE A;  5EP2 A;  3T1Y M;  4NOO B;  1L1Z A;  1JR3 E;  4QHS A;  4M0D A;  4JI2 M;  3R8F A;  4RKU F;  1IY0 A;  4OVZ A;  4DR6 M;  3I04 M;  3SHG B;  2CV1 A;  3GRR A;  3VFD A;  2FFJ A;  2JZ0 A;  1ZMW A;  4JI7 M;  1N77 A;  2EKF A;  3C9P A;  2YQZ A;  4M9Z A;  1T43 A;  2MH8 A;  3T38 A;  1KSF X;  5LMU M;  3LVW A;  1C7Y A;  2KHH A;  3E46 A;  3TE6 A;  4MGK E;  2FH0 A;  3GP1 A;  1G41 A;  2I7P A;  3EIH A;  4NSO B;  4B7H A;  2OQ4 A;  3AOG A;  3VLF B;  1Z5B A;  2K6B A;  1Q3B A;  3AV0 A;  4D82 A;  1HNZ M;  3CTW B;  3FUW A;  2F5P A;  4YY3 M;  2QQ8 A;  3VK8 A;  3SAS A;  2JY8 A;  4I81 A;  4KLN A;  4WUR A;  3KDS E;  4GMQ A;  3FTF A;  4GHA A;  1R7R A;  4PDG A;  1L2B A;  3SC3 A;  5EXT A;  1OQY A;  2RKO A;  4PT5 A;  1NV8 A;  4M9X A;  5E6J A;  1V33 A;  3EIE A;  2XLJ A;  2F5Q A;  2WSE F;  3M0E A;  4B3T M;  1GL6 A;  2O25 A;  3DFZ A;  4LCB A;  4DR1 M;  2RGO A;  1K3X A;  3MMP A;  3GLG B;  4G4Q A;  3IG8 A;  1IN7 A;  4I4L A;  1IXZ A;  7CAT A;  2KRU A;  2KA6 B;  1WGN A;  4L4U A;  2HHH M;  4DUY M;  3KP1 E;  1TH3 A;  5FLX S;  3OTO M;  3LCV B;  4DV6 M;  3U6D A;  2QZ4 A;  1GO5 A;  1OJL A;  1QZE A;  1ZAE A;  1VEK A;  3MHV C;  4MB7 A;  5KPT A;  2J5Y A;  3KSX A;  3U61 A;  3FRH A;  3HJQ A;  1PJI A;  2QSF X;  1WXQ A;  4DV4 M;  2XH9 A;  2R62 A;  3HHW A;  3WHK A;  2DAI A;  2DEN A;  4R3D A;  2LVQ D;  3NWL A;  1HR0 M;  3SAU A;  1N78 A;  4OW0 A;  1G71 A;  4LJ5 A;  1PGY A;  4IBC A;  2DAG A;  3BXW A;  1VG5 A;  4NRW A;  1C1K A;  1PM5 A;  1Z5A A;  2ZAN A;  1E94 E;  2QEN A;  1CUK A;  1N75 A;  3FUX A;  4MGI E;  1G59 A;  2W82 A;  4LG2 A;  2JWS A;  2C9C A;  1ORY B;  1D0M A;  1FNN A;  1EE8 A;  2Y21 A;  1JB0 F;  3SAR A;  4LJ7 A;  4B08 A;  4AZF A;  2V1U A;  1ZQ9 A;  4L15 A;  4GIP A;  2EO2 A;  1S3S A;  1NHG C;  4IJE A;  3RE8 A;  2LBC A;  4MGY E;  4QNM A;  1LTM A;  1L2D A;  1V92 A;  4Y28 F;  2X8A A;  1DGF A;  4JI5 M;  3K8Z A;  3GLG E;  2C5R A;  3K9O A;  2ZBK B;  1J09 A;  1VEG A;  4X64 M;  3U61 B;  2D7G A;  2Z3X A;  4GKJ M;  2UXC M;  1VEJ A;  4FWG A;  3KS8 A;  1NO1 A;  3BOS A;  1XNQ M;  3KP0 E;  2J7O A;  1QAO A;  1WGL A;  1MN3 A;  4LZJ A;  5BPV A;  4DUZ M;  2CWB A;  2L09 A;  3GQ4 A;  3B9P A;  1IXS B;  1W5T A;  1X37 A;  5ITQ A;  3PXG A;  3J7A S;  1NV9 A;  4LFA M;  1DGH A;  1I4W A;  4KT0 F;  3TQS A;  1NJF A;  2JY5 A;  2CEA A;  4X66 M;  5IRE B;  3HZJ A;  3HHZ A;  4LF5 M;  2L4E A;  1VQ1 A;  2KRK A;  1PJQ A;  2RGH A;  3AL0 C;  3FUU A;  4W5W A;  3JR5 A;  4AQY M;  1WIV A;  4GKK M;  1IM2 A;  3B74 A;  1YE9 A;  4Q7J A;  1E9R A;  5KPZ A;  4GC5 A;  4F1I A; 
#chains in the Genus database with same CATH homology
 1JB0 F;  4KT0 F;  4RKU F;  4XK8 F;  2O01 F;  4L6V 6;  2WSE F;  2WSF F;  4Y28 F;  5L8R F;  2WSC F;  3LW5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...