2WSFJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wsfJ00
1JB0J 5KKZC 5KLIC 4Y28J 4I7ZB 4RKUJ 3C8VA 2D2CB 2QJYC 1S5LX 4H13B 4IL6X 2K9YA 4PV1B 3LW5J 2YIUC 2ZT9B 2QJPC 5L8RJ 1ZRTE 2WSCJ 1Q90D 2QIWA 2QSIA 1VF5B 2O01J 2E74B 4KT0J 2WSEJ 2WPVB 2QJKC 2FYNC 2WSFJ 4H44B 4H0LB 2E76B 4OGQB 2E75B
chains in the Genus database with same CATH superfamily
4N3YB 1RHZB 1BCCD 1SQXD 2HFED 3GF3A 1L0NE 1T2KD 4IL6X 1PFIA 4D6TJ 1PGOA 2QIWA 1BSHA 1KQSO 5CBNA 1KYOE 1L0LG 3EWKA 5AW9B 1QL2A 3CWBE 3D6ZA 4UB6H 2W6BA 4IOIH 2JR8A 1SQPJ 1SLQA 1N7LA 2OQQA 3NMDA 1USDA 1LT9B 1SQXK 3LIDA 3VP8A 3HTKB 3I55P 1VF5B 2M0BA 2CPBA 1K05A 1NTKJ 2HLOA 3OW2O 4I1LA 1K8AQ 3L74J 1SQQD 3RK3C 1M1KQ 4NPFX 1M56D 2Q9IA 1JMBA 2K9JA 2KXPB 1BGYJ 4U3FJ 3L70G 3PJSK 1EDJA 5KAIE 1P84D 2A45G 1NTZG 3B5NB 4QMAA 3O6QB 1BCCG 2PRRA 1KN7A 4WBAA 1SQXG 3CXHE 1FDOA 1JY2P 1SQQK 3SFEC 2D2CC 3A7OA 5CCHD 1KZUB 1KYOI 2FBWC 1KYOH 2IBZE 1DD4A 1IO4A 2E75B 4CPGA 2G3AA 2XNXA 1PV3A 1N73C 2E76D 4HH2A 3HUSA 4L75A 2E42A 1K9MQ 5H2FE 1YHQP 3VYIA 3R2PA 3TGUJ 1KILC 2OTLP 3O8ZA 4H0LB 2C9LY 3GHGC 2Q7CA 1UIIA 1Q86Q 4JBZA 2FYUD 1SQQG 1OVRA 1NJIQ 1VPCA 2CPSA 5KAIH 1E5WA 3AE3C 1BDDA 3CCEP 3G9RA 2W27A 3CL3D 1KMIZ 1S2EA 1OW7A 2RN0A 2AEMA 1EC5A 3AECC 1X22A 3CCQP 3CXHI 3CXHH 1VQNP 4C7NB 4W7YA 4W7ZA 1L0LE 1NWQA 2L5GB 3HRNA 4JYCA 1FAVA 1FZCB 1ZRTE 2IBZI 4K3AA 3QH9A 3RK3E 2FXPA 2FXMA 1OW6A 3G3ZA 2WSFJ 2GA1A 1SVFA 3A0BH 3HD7A 2YXQB 1JY3P 1BE3J 3R4YA 1SS1A 3BRTB 3TDKA 3UIAA 2KLUA 1VDFA 1JOCA 1M1JB 3D6YA 3L70E 1G2CB 1IK7A 4JYBA 1LTJA 1X0TA 3AE7C 1YJ9P 4I7ZC 3HE5A 1NU1J 1NTZE 2J5UA 1A02J 3T97B 1OFCX 1T8ZA 1BCCE 2V7QJ 1SQXE 1VQKP 1Y47A 1NYHA 1CZQA 2Q3EA 3SSUA 1PPJD 3CX5D 1GU5A 3BATA 5CJ4A 2JWAA 2ZYGA 1AQ5A 1VQ6P 2FYZA 1GZLA 1AA0A 4C7NA 3CD6P 3L35A 2OYIC 4L76A 1HUCA 3V4WA 1FZCA 3AEDC 3PLNA 2W6AA 1U57A 2WT7A 1IFNA 1FDMA 2QEXP 2WSCJ 1SQQE 3H1ID 1Q90D 1CW5A 3SFDC 3L37A 1NTMJ 3E7KA 2KZJA 2NRGA 2A45H 1P84E 2ZFCA 1N2DC 2KIKA 2R44A 3KYQA 3W67A 2WQYC 2YXRB 1RQUA 3KXDA 5KTBA 1EXJA 3FWNA 3H1JD 2E76B 3U1AA 4DJGA 3BCCD 2QM7A 3GMAA 3Q5SA 3T97A 1PPJG 3BVHA 4ZMDA 1KD1Q 2WTYA 2H88C 5AVRB 2Z5HA 2Y9YA 3L71J 2M5AB 1MFZA 4AYCA 3S1KA 4JQ0D 3ITKA 2LXCB 2ZXXA 2OYOA 3VTPC 2YKQA 3RL0B 2N9YB 5B5EH 2ZT9B 2BCCD 3SWFA 3H1IG 5AW0B 1SFCA 1S72P 1P84I 2XZRA 1P84H 1ZOYC 1JCCA 2QJPB 2HPCA 1J1EB 2KK7A 1G1JA 3L75D 2WSEH 1UIXA 1KQLA 2OYHB 1OIPA 5AW5B 5KKZB 3MUDA 3H1JG 3PTZA 1KFMA 1G1IA 2RKLA 3IAOA 2C9NY 2IYPA 2HODB 3GF7A 3BCCG 1OX3A 2BEZF 4NPDA 4HB1A 2LR2A 4DZOA 5AVSB 3CXHD 2B87B 4LC1A 3HE4B 2P10A 3H1HD 1VQ9P 2QJYB 1NO4A 5TJHA 1SQBJ 4KJMA 2ZXEB 1NKZB 5CCGA 2IBZD 2BCCG 3PRJA 3FGAD 4PV1C 5AVYB 3IN6A 5APUA 3L72D 4HYTB 1QVGO 3N4XA 5CMZA 1L0NJ 2AXTE 1T3JA 2ITAA 3H1LJ 1KB9D 3L75G 2R32A 3JCUE 4YPCA 1SQVD 3HD7D 3VP9A 1L4AB 1PPJE 3CX5E 4R4LA 1XTCC 2I1JA 5KLIB 1FC2C 4AUWA 3V2PA 4DOJA 4ZNCA 1X8YA 5KLVD 4WY4B 2E74B 3HUSC 2HODA 3AE5C 3H1HG 2KSJA 3H1IE 4GKGA 1DD3A 1Q82Q 1CI6B 3EFGA 3A3YB 1E79H 1NTKD 1RF1B 2IZ0A 1Y9BA 3L72G 3FXEA 1SQPK 2H89C 4U3FD 2AXTH 1JO5A 1AJYA 1FZGA 3H1JE 3JCUH 2LKMA 2D2CD 2OTJP 1NTKK 3BCCE 1SQVG 3RK2B 2K1AA 3OA7A 3II6A 2FFDA 2KNCB 2K3RA 1JCDA 1LP1B 4OGQC 3CCRP 5KLVG 2YKOA 3SWYA 4EI2A 3H1KJ 3HD7C 1VQ5P 2N1TB 2IFMA 1KILD 1KQFB 3G71P 3MHVA 2BCCE 5APVA 1AFOA 4GODA 1NTKG 1GL2B 4LGDE 1XTGB 3TNUA 1LTJC 1PL5A 2NPSB 2FY8A 3WU2H 3CC4P 5APWA 3S9OA 2E5TA 1N7SA 4U3FG 3L75E 1H89A 4H0LC 1EDIA 4XA4A 1L0LJ 4I2LC 1W5CE 2ZYDA 1S4XA 2Z4EA 4KT0J 2KLVA 1Z56A 2WPRA 1K04A 3WUTA 1R5LA 3Q5PA 1VQ4P 2GUVA 3CMEP 3M06A 1SFCD 2P58A 5AVXB 5AVVB 2GM4A 2R5DA 3H1HE 1NOHA 1S1CX 1DEEG 2QJKB 1IZNB 2KUBA 1FZCC 4KHXA 3ABVC 1ZLLA 3K5BA 1EQ7A 3L70J 4AQRD 3CCLP 3FX0A 2R3CA 5AW4B 2DW3A 4IL6E 3L72E 1USEA 1S5LX 1NTZJ 2KB7P 3A0BE 3U1CA 1GW3A 3VMXA 2YKPA 1BCCJ 1GTWA 3GLMA 3M9QA 4YXWH 2W90A 1OVVA 1KB9E 1URQB 3H32B 4GOEA 4RKUJ 1OW8A 1EXIA 1SQVE 4UB8H 1GL2A 1LT9A 2JDIH 5GTIH 3AEAC 1JMMA 2NPSA 3HTKA 1KFNA 5AVTB 2YMYA 2UWJE 5KLVE 2FYNC 3CMAP 3RK3B 2YMKA 4ZKPA 3M91A 1OWAA 5BU5A 1NU1K 2GUSA 1L2PA 3H25A 3RGUA 1LTIC 1ZW0A 3B5NA 3O6QA 1NTKE 5M1BA 4IL6H 4H44D 4EOTA 2Y9ZA 1SFCC 3LW5H 3NFQA 3PHLA 3I56P 4U3FE 1JM0A 1M90Q 1H0TB 1KB9I 1KB9H 4MN4C 1JY2N 1ZV8A 1N73B 1HH0A 2OGUA 2JJLA 1LTSC 5TISE 1NGMB 3MUDC 4HKZH 3JC22 2Q5UA 1NTMK 1URQA 3GHGB 3JSVC 3FXDA 1HJ0A 1PZQA 2AEJA 3C1LA 2H43A 1KILE 1HJBA 2FYUJ 2PFXA 2MJZA 5AW1B 2XV5A 5AW7B 3V5BA 1RE4A 2SPZA 5CCGC 5BVZA 2XDJA 2A06D 2AEFA 1WMKA 1RQVA 1LTAC 1HGZA 1HF9A 1VQ8P 4K35A 2QRXA 3M0DA 3AE1C 4L74A 4ZKUA 1ZP0C 3P7KA 3KQGA 2ZT9C 5B5EE 2WVRA 2B9BA 3D70A 2QA4P 1AQTA 2RH0A 5TISH 1YI2P 4H44C 5K5GB 1LNQA 2QJPC 2HG5D 2QE7H 1M1JA 1G2CA 2Q3IA 1JY3N 2M3BA 1PP9D 4Y99C 2J58A 3VMAA 2XU6A 2KSEA 2AXCA 2XNDH 3MTUE 1N7SD 3V6IA 1HVVA 3F89A 2H8PD 4PV1D 4XE5B 3M9BA 1FDIA 2A06G 2J59M 3ZDMA 4LLHA 1QEXA 3CCMP 1DEBA 2MKVA 2POHA 5GTHE 1JTHB 2OYIB 2P2UA 3MIWA 4PD4D 2M8RA 2JWDA 3KHUA 1AVOA 4GDOA 3H1LD 4O9BA 2O3JA 1KORA 3CPWO 3QWOC 5B66H 2FFDC 4JPZB 1LGHB 4H13C 2WSFH 5CCHA 2Q6QA 3Q3DA 4WVZA 4B86A 2W83C 1MV8A 1L0NK 1PP9G 4BXLA 1IFDA 2E5YA 5KLIC 3TK1A 3KZIE 2FXOA 3CCSP 2KP8A 3L73D 1LWUB 2M3EA 2B89A 1M7LA 1Q7YQ 2E74C 3USSA 1VF5D 3P8CD 1JNMA 3A2AA 5AVWB 2FKWB 4EYYQ 2O01N 3MD0A 3MZWB 2WMMA 3S4RA 1KV4A 5GTHH 1N7SC 2M5AA 1OVUA 2V7QH 2IDBA 1RE3A 1RF1C 2V4HA 3H1LG 1JB0J 1U7MA 3W68A 4OGQD 3B5ND 1JTHA 1LT1A 1OXZA 3EFFK 1N8RQ 1VQPP 1ZR4A 3Q5RA 2BCCJ 3CWBJ 3KZIH 3H1KD 1EZVI 3MGNA 4D6TD 2Z5IA 2E75D 3CC7P 3RBZA 5KJ7A 2YIUB 2IPPA 2P67A 2A06E 1GU4A 3SWKA 3L73G 1M8OB 2OYHA 3N7NA 1RH5B 1IFJA 2B88A 2OTKE 2LXBA 2W8ZA 1WT6A 1SQPD 3L75J 4H0LD 1LWUA 5AVZB 1J1DB 2I1KA 2Y0EA 3IF4A 1YQ4C 1YTZT 1FJKA 1KQGB 3A0HH 1GL2C 1LT9C 2B87A 3HE4A 3L74D 2NPSC 3WU2E 1VF5C 1BGYD 3CI9A 3AEBC 2VRSA 2QVAA 1AV1A 3L36A 4WB4A 1YYCA 1W2EA 5CBOA 4PV1B 1PP9E 3GW6A 2K9JB 4BWNA 1RY3A 2Q1KA 1L0LK 3H1KG 1KTMA 2BASA 4D6TG 3B5NC 1QGKB 1X79B 1K73Q 1MUUA 5CJ0A 1L4AA 3AE2C 2R3SA 2WSSH 4RO0A 2E43A 2WPVB 2Y0DA 1SQPG 1FZBA 4DCKA 3Q2YA 1SQVJ 4IFDK 3F5HA 2E75C 4PD4E 3TGUD 3H1LE 4WY4A 4TLFA 3HUSB 3GG2A 3L74G 5KLVJ 1EDLA 3P8MC 1BGYG 1CI6A 1URQC 1NTZK 1QVFO 2YO3A 4HJGH 1RF1A 4UB8E 5GTIE 1RF0A 3VMZA 3G6EP 3CC2P 2YO2A 2YNYA 3L73E 1LTBC 1MFTA 3AEEC 3CCUP 1RE4C 3P8CE 2HYNA 2KNCA 4R4MA 1LP1A 4OGQB 3M0DC 1BE3D 4PD4I 1X9VA 1IC2A 4PD4H 5DJTB 4N78D 3TGUG 5DJUB 3HD7B 2N1TA 2KS1B 3AE4C 1NAFA 1SQXJ 1IJDB 2P7JA 1NU1D 3MP7B 1NAYA 4OVNF 1M1JC 3FWLA 2IZ1A 1T2KC 1LTJB 1LTTC 3H1KE 3AEGC 5APXA 4L73A 2XKMA 2O01H 3HE5B 4D6TE 4EIJA 3TSIA 5CCGD 2I8DA 2PAJA 3B8EB 1Q81Q 1SQPE 1OZHA 2KYVA 4A7PA 1SQQJ 2Y0CA 1YIJP 3RL0D 1WRGA 2ZT9D 1IFPA 1YJNP 4JF7A 1HBWA 4W80A 1AVYA 1EZVD 3V2QA 1BE3G 3H6PA 1NH4A 3B71A 4PJ0E 3L74E 2FYUK 2C0WA 2D2CB 4IFFA 1NTMD 1BGYE 2JP3A 1MZ9A 3AE9C 4M3LA 3B4SA 2WT7B 1YTZI 2WSEJ 3AE8C 1FS0E 5KJ7D 1FZFA 3IR9A 1NU1G 3D71A 2R5BA 1S5LE 5H2FH 2KS1A 5CCHC 5CHXA 1KILB 3P32A 3H32A 3NXSA 1TU3F 1R5SA 3WUUA 1QL1A 2FYUG 2QM8A 1GW4A 2E76C 1ZXGA 1T3UA 3L71D 3E1IA 2WITA 1IFIA 2K9YA 4GOFA 4RESB 5E79E 2FYNB 4GT1A 3Q1MA 3TGUE 1ZR2A 4WWIA 3VN0A 3WMM0 1EZVG 2IFNA 1S9KD 4PJ0H 3VMYA 2KI7B 1RE3C 4TT3H 1NTMG 4RJTA 2WPQA 3AE6C 3AEFC 4EDFA 1A02F 4BRYB 4XFJA 3RL0C 3IFMA 1PGPA 4H13D 1N86A 1BDCA 1S3JA 1S5LH 1L4AD 2WWWA 1SFCB 1JUNA 1YJWP 1NHLA 1FU1A 3EQ2A 3U59A 1H0TA 3TYYA 2HPCB 1J1EC 1N73A 5B66E 1DX7A 4U7JA 4YXDC 1D7MA 5KJ7C 1FJPA 3OAKA 4YTPC 4WY4D 2G8YA 2E74D 4OWFA 4I6MC 2OYHC 5KKZC 2A45I 4I7ZB 1KILA 2WZ7A 3L71G 1VQ7P 1JEKA 2N9BA 3BASA 5E79H 3GHGA 5APQA 1ZMEC 1BE3E 3TF5A 3RBXA 1VQOP 4N78E 1LWUC 1SQBD 2W6JH 1HTLC 1IK9A 2QG4A 1MKMA 1R8EA 2K37A 1SP4A 2QJYC 1JY2O 1NU1E 1GDTA 2NZ2A 1L0ND 2O1JA 3KPEA 3RK2D 1SQBK 1YQ3C 1YITP 5KAFE 5EFWB 3CLQA 4BRYA 1KYOD 2FYUE 1J2JB 3CWBD 5L8RJ 1M57D 4DT0A 2K88A 4H44B 1L4AC 2N1TD 3V4QA 3H1IJ 4Y28J 1QX8A 1FOSF 3PH0A 1KC8Q 1EZVE 2YIUC 5AW2B 1BSNA 1GD2E 1PIXA 2BEQD 5C39A 1GL2D 1LTGC 1SQBG 4Y99B 1NTME 2NPSD 4WY4C 5APSA 1ZN5A 1PGJA 3H1JJ 4IFMA 2HR3A 1PP9J 1EDKA 1J1DC 3BCCJ 2JEEA 3G4SP 1GMJA 1L0NG 3A0HE 1RF0C 5KAFH 1W2BO 1HGVA 4GIFA 2ZVNB 1GK6A 1VQLP 3V2NA 5AVQB 4OH8B 3RL0g 1FE6A 1JY3O 2OYIA 3CWBG 4N6JA 3E1RA 2ZAEB 3I5CA 3L71E 2ZJSE 1FZEA 3RK2C 1DH3A 3NTNA 2FFDB 1FOSE 5AW6B 1GK4A 4C7RA 4H13B 1FZAA 1CSBA 1S9KE 2O1KA 2WSCH 1DIPA 2JO1A 1PGQA 2WPSA 1OMIA 1U7JA 5AVUB 1FBMA 2N1TC 3BRVB 3V2RA 3CCVP 1URQD 1NVOA 2JKVA 3M0AA 2ZYAA 1NKNA 5APYA 2QSIA 2O01J 3M9HA 1VL2A 1QLED 1SQVK 2OARA 1L0LD 3TNUB 3L73J 4ASWA 2KZIA 2KOGA 1ZRTD 2CK3H 1H8AA 2PGDA 4ASVA 3RK3D 4UB6E 3C8VA 1N7SB 3OJAB 2IBZG 3C9IA 1YBKA 3H1HJ 5KLVK 3VOPA 2H7HA 2PP6A 3CCJP 1T6AA 2L91A 1H88A 3LIEA 2IYOA 3L4FA 4Z1MH 5AW3B 1HWTC 1LJ2A 2IX7C 5BU8B 2ZVOB 5AW8B 3PP5A 1SQBE 2RMZA 3L72J 1Q2NA 1Y8AA 4C46A 1IFMA 3LW5J 3CX5I 3L70D 3CX5H 4NPEA 2C0XA 3A5TA 5APTA 3WUVA 2QJKC 2P1JA 3KDPB 1NTZD 1VQMP
chains in the Genus database with same CATH topology
5KLIC 2G3AA 1PV3A 4H44C 1YQ3C 4H44D 4H0LD 3Q5PA 1AJYA 2E76D 3AE7C 3GMAA 3Q5SA 4TT3H 3GF3A 4I7ZC 4H13B 4IL6X 3AE6C 1S1CX 2J5UA 2D2CD 2H88C 2QJPC 3AEFC 5L8RJ 1YQ4C 2JO1A 3T97B 1DIPA 4XFJA 1KQGB 1OMIA 2QIWA 1K04A 2V7QJ 4H13D 3FGAD 4PV1C 3ABVC 3IN6A 2ZT9D 4H44B 4H0LB 3EWKA 2E74C 1VF5C 1VF5D 3AEBC 1NYHA 3D6ZA 4Y28J 3B71A 3AEEC 4OGQC 2D2CB 1NGMB 1S5LX 2OQQA 2JP3A 4PV1B 2YIUC 2ZT9B 2IDBA 3AE9C 3AE3C 1PIXA 2BEQD 1VF5B 2O01J 2QSIA 3GLMA 4U7JA 4R4LA 1KQFB 2WSEJ 1VL2A 3AE8C 4PV1D 4YXDC 3G9RA 1K05A 4R4MA 1FDIA 1KMIZ 1HJ0A 1OW7A 4YTPC 4OGQB 3D71A 2G8YA 3AECC 2E74D 1JB0J 5KKZC 1KTMA 4I7ZB 1OW8A 4RKUJ 1ZOYC 1EXIA 3AEDC 1KILE 3C8VA 4OGQD 3AEAC 1U57A 1ZMEC 3AE2C 3AE4C 2MKVA 1ZRTE 2WSCJ 1PL5A 1Q90D 4Z1MH 3RK3E 1UIXA 2FXPA 2E74B 5M1BA 1OW6A 1GMJA 1TU3F 2WPVB 3AE5C 3SFDC 3Q5RA 2FYNC 2WSFJ 3S9OA 4GDOA 2YMKA 1WMKA 3IAOA 3Q2YA 1MKMA 1RQVA 4H0LC 1R8EA 1KORA 3GF7A 2E76C 1DD3A 2BEZF 1HF9A 2E75C 2E75D 3H25A 1FDOA 2QJYC 3RL0g 2K9YA 3SFEC 2D2CC 3LW5J 2WQYC 3AEGC 3R4YA 3AE1C 1Y9BA 1RQUA 1ZP0C 4H13C 2FBWC 2ZT9C 4KT0J 3Q1MA 3D70A 1EXJA 2NZ2A 2QJKC 3O6QA 3Q3DA 2E76B 3D6YA 1DD4A 2P10A 2E75B 1IK7A 2H89C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB0 J;  5KKZ C;  5KLI C;  4Y28 J;  4I7Z B;  4RKU J;  3C8V A;  2D2C B;  2QJY C;  1S5L X;  4H13 B;  4IL6 X;  2K9Y A;  4PV1 B;  3LW5 J;  2YIU C;  2ZT9 B;  2QJP C;  5L8R J;  1ZRT E;  2WSC J;  1Q90 D;  2QIW A;  2QSI A;  1VF5 B;  2O01 J;  2E74 B;  4KT0 J;  2WSE J;  2WPV B;  2QJK C;  2FYN C;  2WSF J;  4H44 B;  4H0L B;  2E76 B;  4OGQ B;  2E75 B; 
#chains in the Genus database with same CATH topology
 4N3Y B;  1RHZ B;  1BCC D;  1SQX D;  2HFE D;  3GF3 A;  1L0N E;  1T2K D;  4IL6 X;  1PFI A;  4D6T J;  1PGO A;  2QIW A;  1BSH A;  1KQS O;  5CBN A;  1KYO E;  1L0L G;  3EWK A;  5AW9 B;  1QL2 A;  3CWB E;  3D6Z A;  4UB6 H;  2W6B A;  4IOI H;  2JR8 A;  1SQP J;  1SLQ A;  1N7L A;  2OQQ A;  3NMD A;  1USD A;  1LT9 B;  1SQX K;  3LID A;  3VP8 A;  3HTK B;  3I55 P;  1VF5 B;  2M0B A;  2CPB A;  1K05 A;  1NTK J;  2HLO A;  3OW2 O;  4I1L A;  1K8A Q;  3L74 J;  1SQQ D;  3RK3 C;  1M1K Q;  4NPF X;  1M56 D;  2Q9I A;  1JMB A;  2K9J A;  2KXP B;  1BGY J;  4U3F J;  3L70 G;  3PJS K;  1EDJ A;  5KAI E;  1P84 D;  2A45 G;  1NTZ G;  3B5N B;  4QMA A;  3O6Q B;  1BCC G;  2PRR A;  1KN7 A;  4WBA A;  1SQX G;  3CXH E;  1FDO A;  1JY2 P;  1SQQ K;  3SFE C;  2D2C C;  3A7O A;  5CCH D;  1KZU B;  1KYO I;  2FBW C;  1KYO H;  2IBZ E;  1DD4 A;  1IO4 A;  2E75 B;  4CPG A;  2G3A A;  2XNX A;  1PV3 A;  1N73 C;  2E76 D;  4HH2 A;  3HUS A;  4L75 A;  2E42 A;  1K9M Q;  5H2F E;  1YHQ P;  3VYI A;  3R2P A;  3TGU J;  1KIL C;  2OTL P;  3O8Z A;  4H0L B;  2C9L Y;  3GHG C;  2Q7C A;  1UII A;  1Q86 Q;  4JBZ A;  2FYU D;  1SQQ G;  1OVR A;  1NJI Q;  1VPC A;  2CPS A;  5KAI H;  1E5W A;  3AE3 C;  1BDD A;  3CCE P;  3G9R A;  2W27 A;  3CL3 D;  1KMI Z;  1S2E A;  1OW7 A;  2RN0 A;  2AEM A;  1EC5 A;  3AEC C;  1X22 A;  3CCQ P;  3CXH I;  3CXH H;  1VQN P;  4C7N B;  4W7Y A;  4W7Z A;  1L0L E;  1NWQ A;  2L5G B;  3HRN A;  4JYC A;  1FAV A;  1FZC B;  1ZRT E;  2IBZ I;  4K3A A;  3QH9 A;  3RK3 E;  2FXP A;  2FXM A;  1OW6 A;  3G3Z A;  2WSF J;  2GA1 A;  1SVF A;  3A0B H;  3HD7 A;  2YXQ B;  1JY3 P;  1BE3 J;  3R4Y A;  1SS1 A;  3BRT B;  3TDK A;  3UIA A;  2KLU A;  1VDF A;  1JOC A;  1M1J B;  3D6Y A;  3L70 E;  1G2C B;  1IK7 A;  4JYB A;  1LTJ A;  1X0T A;  3AE7 C;  1YJ9 P;  4I7Z C;  3HE5 A;  1NU1 J;  1NTZ E;  2J5U A;  1A02 J;  3T97 B;  1OFC X;  1T8Z A;  1BCC E;  2V7Q J;  1SQX E;  1VQK P;  1Y47 A;  1NYH A;  1CZQ A;  2Q3E A;  3SSU A;  1PPJ D;  3CX5 D;  1GU5 A;  3BAT A;  5CJ4 A;  2JWA A;  2ZYG A;  1AQ5 A;  1VQ6 P;  2FYZ A;  1GZL A;  1AA0 A;  4C7N A;  3CD6 P;  3L35 A;  2OYI C;  4L76 A;  1HUC A;  3V4W A;  1FZC A;  3AED C;  3PLN A;  2W6A A;  1U57 A;  2WT7 A;  1IFN A;  1FDM A;  2QEX P;  2WSC J;  1SQQ E;  3H1I D;  1Q90 D;  1CW5 A;  3SFD C;  3L37 A;  1NTM J;  3E7K A;  2KZJ A;  2NRG A;  2A45 H;  1P84 E;  2ZFC A;  1N2D C;  2KIK A;  2R44 A;  3KYQ A;  3W67 A;  2WQY C;  2YXR B;  1RQU A;  3KXD A;  5KTB A;  1EXJ A;  3FWN A;  3H1J D;  2E76 B;  3U1A A;  4DJG A;  3BCC D;  2QM7 A;  3GMA A;  3Q5S A;  3T97 A;  1PPJ G;  3BVH A;  4ZMD A;  1KD1 Q;  2WTY A;  2H88 C;  5AVR B;  2Z5H A;  2Y9Y A;  3L71 J;  2M5A B;  1MFZ A;  4AYC A;  3S1K A;  4JQ0 D;  3ITK A;  2LXC B;  2ZXX A;  2OYO A;  3VTP C;  2YKQ A;  3RL0 B;  2N9Y B;  5B5E H;  2ZT9 B;  2BCC D;  3SWF A;  3H1I G;  5AW0 B;  1SFC A;  1S72 P;  1P84 I;  2XZR A;  1P84 H;  1ZOY C;  1JCC A;  2QJP B;  2HPC A;  1J1E B;  2KK7 A;  1G1J A;  3L75 D;  2WSE H;  1UIX A;  1KQL A;  2OYH B;  1OIP A;  5AW5 B;  5KKZ B;  3MUD A;  3H1J G;  3PTZ A;  1KFM A;  1G1I A;  2RKL A;  3IAO A;  2C9N Y;  2IYP A;  2HOD B;  3GF7 A;  3BCC G;  1OX3 A;  2BEZ F;  4NPD A;  4HB1 A;  2LR2 A;  4DZO A;  5AVS B;  3CXH D;  2B87 B;  4LC1 A;  3HE4 B;  2P10 A;  3H1H D;  1VQ9 P;  2QJY B;  1NO4 A;  5TJH A;  1SQB J;  4KJM A;  2ZXE B;  1NKZ B;  5CCG A;  2IBZ D;  2BCC G;  3PRJ A;  3FGA D;  4PV1 C;  5AVY B;  3IN6 A;  5APU A;  3L72 D;  4HYT B;  1QVG O;  3N4X A;  5CMZ A;  1L0N J;  2AXT E;  1T3J A;  2ITA A;  3H1L J;  1KB9 D;  3L75 G;  2R32 A;  3JCU E;  4YPC A;  1SQV D;  3HD7 D;  3VP9 A;  1L4A B;  1PPJ E;  3CX5 E;  4R4L A;  1XTC C;  2I1J A;  5KLI B;  1FC2 C;  4AUW A;  3V2P A;  4DOJ A;  4ZNC A;  1X8Y A;  5KLV D;  4WY4 B;  2E74 B;  3HUS C;  2HOD A;  3AE5 C;  3H1H G;  2KSJ A;  3H1I E;  4GKG A;  1DD3 A;  1Q82 Q;  1CI6 B;  3EFG A;  3A3Y B;  1E79 H;  1NTK D;  1RF1 B;  2IZ0 A;  1Y9B A;  3L72 G;  3FXE A;  1SQP K;  2H89 C;  4U3F D;  2AXT H;  1JO5 A;  1AJY A;  1FZG A;  3H1J E;  3JCU H;  2LKM A;  2D2C D;  2OTJ P;  1NTK K;  3BCC E;  1SQV G;  3RK2 B;  2K1A A;  3OA7 A;  3II6 A;  2FFD A;  2KNC B;  2K3R A;  1JCD A;  1LP1 B;  4OGQ C;  3CCR P;  5KLV G;  2YKO A;  3SWY A;  4EI2 A;  3H1K J;  3HD7 C;  1VQ5 P;  2N1T B;  2IFM A;  1KIL D;  1KQF B;  3G71 P;  3MHV A;  2BCC E;  5APV A;  1AFO A;  4GOD A;  1NTK G;  1GL2 B;  4LGD E;  1XTG B;  3TNU A;  1LTJ C;  1PL5 A;  2NPS B;  2FY8 A;  3WU2 H;  3CC4 P;  5APW A;  3S9O A;  2E5T A;  1N7S A;  4U3F G;  3L75 E;  1H89 A;  4H0L C;  1EDI A;  4XA4 A;  1L0L J;  4I2L C;  1W5C E;  2ZYD A;  1S4X A;  2Z4E A;  4KT0 J;  2KLV A;  1Z56 A;  2WPR A;  1K04 A;  3WUT A;  1R5L A;  3Q5P A;  1VQ4 P;  2GUV A;  3CME P;  3M06 A;  1SFC D;  2P58 A;  5AVX B;  5AVV B;  2GM4 A;  2R5D A;  3H1H E;  1NOH A;  1S1C X;  1DEE G;  2QJK B;  1IZN B;  2KUB A;  1FZC C;  4KHX A;  3ABV C;  1ZLL A;  3K5B A;  1EQ7 A;  3L70 J;  4AQR D;  3CCL P;  3FX0 A;  2R3C A;  5AW4 B;  2DW3 A;  4IL6 E;  3L72 E;  1USE A;  1S5L X;  1NTZ J;  2KB7 P;  3A0B E;  3U1C A;  1GW3 A;  3VMX A;  2YKP A;  1BCC J;  1GTW A;  3GLM A;  3M9Q A;  4YXW H;  2W90 A;  1OVV A;  1KB9 E;  1URQ B;  3H32 B;  4GOE A;  4RKU J;  1OW8 A;  1EXI A;  1SQV E;  4UB8 H;  1GL2 A;  1LT9 A;  2JDI H;  5GTI H;  3AEA C;  1JMM A;  2NPS A;  3HTK A;  1KFN A;  5AVT B;  2YMY A;  2UWJ E;  5KLV E;  2FYN C;  3CMA P;  3RK3 B;  2YMK A;  4ZKP A;  3M91 A;  1OWA A;  5BU5 A;  1NU1 K;  2GUS A;  1L2P A;  3H25 A;  3RGU A;  1LTI C;  1ZW0 A;  3B5N A;  3O6Q A;  1NTK E;  5M1B A;  4IL6 H;  4H44 D;  4EOT A;  2Y9Z A;  1SFC C;  3LW5 H;  3NFQ A;  3PHL A;  3I56 P;  4U3F E;  1JM0 A;  1M90 Q;  1H0T B;  1KB9 I;  1KB9 H;  4MN4 C;  1JY2 N;  1ZV8 A;  1N73 B;  1HH0 A;  2OGU A;  2JJL A;  1LTS C;  5TIS E;  1NGM B;  3MUD C;  4HKZ H;  3JC2 2;  2Q5U A;  1NTM K;  1URQ A;  3GHG B;  3JSV C;  3FXD A;  1HJ0 A;  1PZQ A;  2AEJ A;  3C1L A;  2H43 A;  1KIL E;  1HJB A;  2FYU J;  2PFX A;  2MJZ A;  5AW1 B;  2XV5 A;  5AW7 B;  3V5B A;  1RE4 A;  2SPZ A;  5CCG C;  5BVZ A;  2XDJ A;  2A06 D;  2AEF A;  1WMK A;  1RQV A;  1LTA C;  1HGZ A;  1HF9 A;  1VQ8 P;  4K35 A;  2QRX A;  3M0D A;  3AE1 C;  4L74 A;  4ZKU A;  1ZP0 C;  3P7K A;  3KQG A;  2ZT9 C;  5B5E E;  2WVR A;  2B9B A;  3D70 A;  2QA4 P;  1AQT A;  2RH0 A;  5TIS H;  1YI2 P;  4H44 C;  5K5G B;  1LNQ A;  2QJP C;  2HG5 D;  2QE7 H;  1M1J A;  1G2C A;  2Q3I A;  1JY3 N;  2M3B A;  1PP9 D;  4Y99 C;  2J58 A;  3VMA A;  2XU6 A;  2KSE A;  2AXC A;  2XND H;  3MTU E;  1N7S D;  3V6I A;  1HVV A;  3F89 A;  2H8P D;  4PV1 D;  4XE5 B;  3M9B A;  1FDI A;  2A06 G;  2J59 M;  3ZDM A;  4LLH A;  1QEX A;  3CCM P;  1DEB A;  2MKV A;  2POH A;  5GTH E;  1JTH B;  2OYI B;  2P2U A;  3MIW A;  4PD4 D;  2M8R A;  2JWD A;  3KHU A;  1AVO A;  4GDO A;  3H1L D;  4O9B A;  2O3J A;  1KOR A;  3CPW O;  3QWO C;  5B66 H;  2FFD C;  4JPZ B;  1LGH B;  4H13 C;  2WSF H;  5CCH A;  2Q6Q A;  3Q3D A;  4WVZ A;  4B86 A;  2W83 C;  1MV8 A;  1L0N K;  1PP9 G;  4BXL A;  1IFD A;  2E5Y A;  5KLI C;  3TK1 A;  3KZI E;  2FXO A;  3CCS P;  2KP8 A;  3L73 D;  1LWU B;  2M3E A;  2B89 A;  1M7L A;  1Q7Y Q;  2E74 C;  3USS A;  1VF5 D;  3P8C D;  1JNM A;  3A2A A;  5AVW B;  2FKW B;  4EYY Q;  2O01 N;  3MD0 A;  3MZW B;  2WMM A;  3S4R A;  1KV4 A;  5GTH H;  1N7S C;  2M5A A;  1OVU A;  2V7Q H;  2IDB A;  1RE3 A;  1RF1 C;  2V4H A;  3H1L G;  1JB0 J;  1U7M A;  3W68 A;  4OGQ D;  3B5N D;  1JTH A;  1LT1 A;  1OXZ A;  3EFF K;  1N8R Q;  1VQP P;  1ZR4 A;  3Q5R A;  2BCC J;  3CWB J;  3KZI H;  3H1K D;  1EZV I;  3MGN A;  4D6T D;  2Z5I A;  2E75 D;  3CC7 P;  3RBZ A;  5KJ7 A;  2YIU B;  2IPP A;  2P67 A;  2A06 E;  1GU4 A;  3SWK A;  3L73 G;  1M8O B;  2OYH A;  3N7N A;  1RH5 B;  1IFJ A;  2B88 A;  2OTK E;  2LXB A;  2W8Z A;  1WT6 A;  1SQP D;  3L75 J;  4H0L D;  1LWU A;  5AVZ B;  1J1D B;  2I1K A;  2Y0E A;  3IF4 A;  1YQ4 C;  1YTZ T;  1FJK A;  1KQG B;  3A0H H;  1GL2 C;  1LT9 C;  2B87 A;  3HE4 A;  3L74 D;  2NPS C;  3WU2 E;  1VF5 C;  1BGY D;  3CI9 A;  3AEB C;  2VRS A;  2QVA A;  1AV1 A;  3L36 A;  4WB4 A;  1YYC A;  1W2E A;  5CBO A;  4PV1 B;  1PP9 E;  3GW6 A;  2K9J B;  4BWN A;  1RY3 A;  2Q1K A;  1L0L K;  3H1K G;  1KTM A;  2BAS A;  4D6T G;  3B5N C;  1QGK B;  1X79 B;  1K73 Q;  1MUU A;  5CJ0 A;  1L4A A;  3AE2 C;  2R3S A;  2WSS H;  4RO0 A;  2E43 A;  2WPV B;  2Y0D A;  1SQP G;  1FZB A;  4DCK A;  3Q2Y A;  1SQV J;  4IFD K;  3F5H A;  2E75 C;  4PD4 E;  3TGU D;  3H1L E;  4WY4 A;  4TLF A;  3HUS B;  3GG2 A;  3L74 G;  5KLV J;  1EDL A;  3P8M C;  1BGY G;  1CI6 A;  1URQ C;  1NTZ K;  1QVF O;  2YO3 A;  4HJG H;  1RF1 A;  4UB8 E;  5GTI E;  1RF0 A;  3VMZ A;  3G6E P;  3CC2 P;  2YO2 A;  2YNY A;  3L73 E;  1LTB C;  1MFT A;  3AEE C;  3CCU P;  1RE4 C;  3P8C E;  2HYN A;  2KNC A;  4R4M A;  1LP1 A;  4OGQ B;  3M0D C;  1BE3 D;  4PD4 I;  1X9V A;  1IC2 A;  4PD4 H;  5DJT B;  4N78 D;  3TGU G;  5DJU B;  3HD7 B;  2N1T A;  2KS1 B;  3AE4 C;  1NAF A;  1SQX J;  1IJD B;  2P7J A;  1NU1 D;  3MP7 B;  1NAY A;  4OVN F;  1M1J C;  3FWL A;  2IZ1 A;  1T2K C;  1LTJ B;  1LTT C;  3H1K E;  3AEG C;  5APX A;  4L73 A;  2XKM A;  2O01 H;  3HE5 B;  4D6T E;  4EIJ A;  3TSI A;  5CCG D;  2I8D A;  2PAJ A;  3B8E B;  1Q81 Q;  1SQP E;  1OZH A;  2KYV A;  4A7P A;  1SQQ J;  2Y0C A;  1YIJ P;  3RL0 D;  1WRG A;  2ZT9 D;  1IFP A;  1YJN P;  4JF7 A;  1HBW A;  4W80 A;  1AVY A;  1EZV D;  3V2Q A;  1BE3 G;  3H6P A;  1NH4 A;  3B71 A;  4PJ0 E;  3L74 E;  2FYU K;  2C0W A;  2D2C B;  4IFF A;  1NTM D;  1BGY E;  2JP3 A;  1MZ9 A;  3AE9 C;  4M3L A;  3B4S A;  2WT7 B;  1YTZ I;  2WSE J;  3AE8 C;  1FS0 E;  5KJ7 D;  1FZF A;  3IR9 A;  1NU1 G;  3D71 A;  2R5B A;  1S5L E;  5H2F H;  2KS1 A;  5CCH C;  5CHX A;  1KIL B;  3P32 A;  3H32 A;  3NXS A;  1TU3 F;  1R5S A;  3WUU A;  1QL1 A;  2FYU G;  2QM8 A;  1GW4 A;  2E76 C;  1ZXG A;  1T3U A;  3L71 D;  3E1I A;  2WIT A;  1IFI A;  2K9Y A;  4GOF A;  4RES B;  5E79 E;  2FYN B;  4GT1 A;  3Q1M A;  3TGU E;  1ZR2 A;  4WWI A;  3VN0 A;  3WMM 0;  1EZV G;  2IFN A;  1S9K D;  4PJ0 H;  3VMY A;  2KI7 B;  1RE3 C;  4TT3 H;  1NTM G;  4RJT A;  2WPQ A;  3AE6 C;  3AEF C;  4EDF A;  1A02 F;  4BRY B;  4XFJ A;  3RL0 C;  3IFM A;  1PGP A;  4H13 D;  1N86 A;  1BDC A;  1S3J A;  1S5L H;  1L4A D;  2WWW A;  1SFC B;  1JUN A;  1YJW P;  1NHL A;  1FU1 A;  3EQ2 A;  3U59 A;  1H0T A;  3TYY A;  2HPC B;  1J1E C;  1N73 A;  5B66 E;  1DX7 A;  4U7J A;  4YXD C;  1D7M A;  5KJ7 C;  1FJP A;  3OAK A;  4YTP C;  4WY4 D;  2G8Y A;  2E74 D;  4OWF A;  4I6M C;  2OYH C;  5KKZ C;  2A45 I;  4I7Z B;  1KIL A;  2WZ7 A;  3L71 G;  1VQ7 P;  1JEK A;  2N9B A;  3BAS A;  5E79 H;  3GHG A;  5APQ A;  1ZME C;  1BE3 E;  3TF5 A;  3RBX A;  1VQO P;  4N78 E;  1LWU C;  1SQB D;  2W6J H;  1HTL C;  1IK9 A;  2QG4 A;  1MKM A;  1R8E A;  2K37 A;  1SP4 A;  2QJY C;  1JY2 O;  1NU1 E;  1GDT A;  2NZ2 A;  1L0N D;  2O1J A;  3KPE A;  3RK2 D;  1SQB K;  1YQ3 C;  1YIT P;  5KAF E;  5EFW B;  3CLQ A;  4BRY A;  1KYO D;  2FYU E;  1J2J B;  3CWB D;  5L8R J;  1M57 D;  4DT0 A;  2K88 A;  4H44 B;  1L4A C;  2N1T D;  3V4Q A;  3H1I J;  4Y28 J;  1QX8 A;  1FOS F;  3PH0 A;  1KC8 Q;  1EZV E;  2YIU C;  5AW2 B;  1BSN A;  1GD2 E;  1PIX A;  2BEQ D;  5C39 A;  1GL2 D;  1LTG C;  1SQB G;  4Y99 B;  1NTM E;  2NPS D;  4WY4 C;  5APS A;  1ZN5 A;  1PGJ A;  3H1J J;  4IFM A;  2HR3 A;  1PP9 J;  1EDK A;  1J1D C;  3BCC J;  2JEE A;  3G4S P;  1GMJ A;  1L0N G;  3A0H E;  1RF0 C;  5KAF H;  1W2B O;  1HGV A;  4GIF A;  2ZVN B;  1GK6 A;  1VQL P;  3V2N A;  5AVQ B;  4OH8 B;  3RL0 g;  1FE6 A;  1JY3 O;  2OYI A;  3CWB G;  4N6J A;  3E1R A;  2ZAE B;  3I5C A;  3L71 E;  2ZJS E;  1FZE A;  3RK2 C;  1DH3 A;  3NTN A;  2FFD B;  1FOS E;  5AW6 B;  1GK4 A;  4C7R A;  4H13 B;  1FZA A;  1CSB A;  1S9K E;  2O1K A;  2WSC H;  1DIP A;  2JO1 A;  1PGQ A;  2WPS A;  1OMI A;  1U7J A;  5AVU B;  1FBM A;  2N1T C;  3BRV B;  3V2R A;  3CCV P;  1URQ D;  1NVO A;  2JKV A;  3M0A A;  2ZYA A;  1NKN A;  5APY A;  2QSI A;  2O01 J;  3M9H A;  1VL2 A;  1QLE D;  1SQV K;  2OAR A;  1L0L D;  3TNU B;  3L73 J;  4ASW A;  2KZI A;  2KOG A;  1ZRT D;  2CK3 H;  1H8A A;  2PGD A;  4ASV A;  3RK3 D;  4UB6 E;  3C8V A;  1N7S B;  3OJA B;  2IBZ G;  3C9I A;  1YBK A;  3H1H J;  5KLV K;  3VOP A;  2H7H A;  2PP6 A;  3CCJ P;  1T6A A;  2L91 A;  1H88 A;  3LIE A;  2IYO A;  3L4F A;  4Z1M H;  5AW3 B;  1HWT C;  1LJ2 A;  2IX7 C;  5BU8 B;  2ZVO B;  5AW8 B;  3PP5 A;  1SQB E;  2RMZ A;  3L72 J;  1Q2N A;  1Y8A A;  4C46 A;  1IFM A;  3LW5 J;  3CX5 I;  3L70 D;  3CX5 H;  4NPE A;  2C0X A;  3A5T A;  5APT A;  3WUV A;  2QJK C;  2P1J A;  3KDP B;  1NTZ D;  1VQM P; 
#chains in the Genus database with same CATH homology
 5KLI C;  2G3A A;  1PV3 A;  4H44 C;  1YQ3 C;  4H44 D;  4H0L D;  3Q5P A;  1AJY A;  2E76 D;  3AE7 C;  3GMA A;  3Q5S A;  4TT3 H;  3GF3 A;  4I7Z C;  4H13 B;  4IL6 X;  3AE6 C;  1S1C X;  2J5U A;  2D2C D;  2H88 C;  2QJP C;  3AEF C;  5L8R J;  1YQ4 C;  2JO1 A;  3T97 B;  1DIP A;  4XFJ A;  1KQG B;  1OMI A;  2QIW A;  1K04 A;  2V7Q J;  4H13 D;  3FGA D;  4PV1 C;  3ABV C;  3IN6 A;  2ZT9 D;  4H44 B;  4H0L B;  3EWK A;  2E74 C;  1VF5 C;  1VF5 D;  3AEB C;  1NYH A;  3D6Z A;  4Y28 J;  3B71 A;  3AEE C;  4OGQ C;  2D2C B;  1NGM B;  1S5L X;  2OQQ A;  2JP3 A;  4PV1 B;  2YIU C;  2ZT9 B;  2IDB A;  3AE9 C;  3AE3 C;  1PIX A;  2BEQ D;  1VF5 B;  2O01 J;  2QSI A;  3GLM A;  4U7J A;  4R4L A;  1KQF B;  2WSE J;  1VL2 A;  3AE8 C;  4PV1 D;  4YXD C;  3G9R A;  1K05 A;  4R4M A;  1FDI A;  1KMI Z;  1HJ0 A;  1OW7 A;  4YTP C;  4OGQ B;  3D71 A;  2G8Y A;  3AEC C;  2E74 D;  1JB0 J;  5KKZ C;  1KTM A;  4I7Z B;  1OW8 A;  4RKU J;  1ZOY C;  1EXI A;  3AED C;  1KIL E;  3C8V A;  4OGQ D;  3AEA C;  1U57 A;  1ZME C;  3AE2 C;  3AE4 C;  2MKV A;  1ZRT E;  2WSC J;  1PL5 A;  1Q90 D;  4Z1M H;  3RK3 E;  1UIX A;  2FXP A;  2E74 B;  5M1B A;  1OW6 A;  1GMJ A;  1TU3 F;  2WPV B;  3AE5 C;  3SFD C;  3Q5R A;  2FYN C;  2WSF J;  3S9O A;  4GDO A;  2YMK A;  1WMK A;  3IAO A;  3Q2Y A;  1MKM A;  1RQV A;  4H0L C;  1R8E A;  1KOR A;  3GF7 A;  2E76 C;  1DD3 A;  2BEZ F;  1HF9 A;  2E75 C;  2E75 D;  3H25 A;  1FDO A;  2QJY C;  3RL0 g;  2K9Y A;  3SFE C;  2D2C C;  3LW5 J;  2WQY C;  3AEG C;  3R4Y A;  3AE1 C;  1Y9B A;  1RQU A;  1ZP0 C;  4H13 C;  2FBW C;  2ZT9 C;  4KT0 J;  3Q1M A;  3D70 A;  1EXJ A;  2NZ2 A;  2QJK C;  3O6Q A;  3Q3D A;  2E76 B;  3D6Y A;  1DD4 A;  2P10 A;  2E75 B;  1IK7 A;  2H89 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...