2WSFJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wsfJ00
1ZRTE 4PV1B 2E75B 2YIUC 2D2CB 5KKZC 1JB0J 2ZT9B 2WSFJ 4IL6X 5L8RJ 2QJYC 2WSEJ 1Q90D 2E76B 5KLIC 2FYNC 4H44B 2WSCJ 2QJPC 3C8VA 4Y28J 4H0LB 2QIWA 2QSIA 2E74B 4KT0J 2QJKC 2K9YA 4RKUJ 4H13B 4I7ZB 1VF5B 1S5LX 2WPVB 3LW5J 4OGQB 2O01J
chains in the Genus database with same CATH superfamily
2G8YA 1SQXE 2O1KA 1P84I 1VQ8P 1ZMEC 4H13D 1ZV8A 1FU1A 1RQVA 1FJKA 2ZT9B 3EFGA 3L73G 3SWFA 1NTZJ 3RL0g 2FFDC 3NTNA 2E42A 3FGAD 3N7NA 2Z5IA 3RK3D 1JMMA 2M5AB 2YO2A 1GDTA 3M0DA 5E79E 5CHXA 1SVFA 4ZKPA 1HTLC 2IYPA 1AVYA 2K9JB 2K37A 3MIWA 1DH3A 2XNDH 4OGQC 2QEXP 3R4YA 2QRXA 4GODA 1DD4A 1FOSF 2HFED 2FFDB 5CJ0A 1SQQD 2E76D 4OVNF 2AXCA 2P67A 3HUSB 1MUUA 3K5BA 1PIXA 4JF7A 2JP3A 3NFQA 2OQQA 5AVWB 2ZVNB 1L0NE 1KB9E 3AE8C 3CC4P 3GLMA 5KAFE 1K73Q 1SQBD 2PP6A 1NTMD 2QJPB 3H1JJ 5AVTB 2Y9ZA 2IBZG 1VF5B 3LW5J 2P1JA 4LGDE 3NMDA 2Q7CA 2FYUE 1CSBA 3P8MC 2OYHA 1L0LG 1NYHA 1X9VA 1EZVD 1ZRTE 3CCJP 2IBZI 1BGYJ 2YIUC 1J1DB 2JJLA 2WPSA 2ZXXA 3MUDC 4ASVA 1NVOA 1SQVG 4WY4A 1TU3F 4XE5B 2KP8A 1GU4A 2K3RA 1XTGB 2W90A 3L71E 4H44C 2O1JA 1LT1A 1M1JC 3MUDA 4L75A 1DD3A 1Q90D 2N1TC 5APYA 3RK2B 4I2LC 3E1RA 4D6TE 5BVZA 2JR8A 2BEQD 4R4MA 4EI2A 1Q7YQ 2IDBA 4YTPC 3Q2YA 2OYOA 4PD4D 4B86A 1KN7A 2CPSA 1NH4A 3VMXA 5KJ7D 1SQVJ 1VDFA 3G4SP 1RY3A 3AEBC 3CCEP 3JCUE 5AVSB 2N1TA 1KILB 2KB7P 2AXTE 4H44D 1G1JA 2KNCB 4CPGA 4N78D 1DEEG 5AW7B 1WRGA 1RF0C 4WY4C 4NPFX 1NU1E 1SFCC 5E79H 5KLVD 1NHLA 3AE3C 3V5BA 1KQSO 2LXCB 1LTSC 5TJHA 1KFMA 1VQ7P 1JB0J 1RE4A 4PV1C 1NTKG 4IFDK 2PGDA 4UB6E 2KUBA 5CCGA 2KSEA 5GTIE 2OTJP 1HF9A 3VYIA 1G2CB 5KAIH 2PFXA 2GM4A 3SWKA 3RBZA 5KLVK 2ZAEB 1N8RQ 2KYVA 4K3AA 2WT7A 2IX7C 1EDKA 1LTJC 2RMZA 5CBOA 1OVUA 2I1JA 2WZ7A 5CCGD 1YTZI 3H1IE 2AEMA 1SQPK 2FYUJ 3S1KA 3HTKA 3P7KA 4KHXA 1KYOH 3MHVA 4ZKUA 1JO5A 4JQ0D 1SFCD 4H0LC 2YXQB 2E5YA 1LP1A 1LWUB 4BWNA 3I55P 4U3FG 2K9YA 4IL6H 4H0LD 2D2CD 1OFCX 4DCKA 3RK3B 2A06D 2HLOA 2WMMA 3Q5RA 3G3ZA 1SQVK 2AXTH 1QVGO 2CPBA 2XKMA 4TT3H 1SQBJ 1RF1B 2WSEH 1GK4A 3VMZA 2Q3IA 3ABVC 2E74C 3CX5H 2Q9IA 1OWAA 1NU1K 2KLVA 1M57D 1YITP 3A0BE 3HE4B 1GD2E 1SQQJ 3PTZA 1BE3D 1X8YA 2IYOA 1KZUB 1NTZE 2KI7B 2W6AA 3HE5A 4U3FJ 4BRYA 1JMBA 1LTBC 2QM7A 2WSFH 2R5BA 3L71D 2ZYDA 3SSUA 5CJ4A 3KPEA 2Y0EA 1N73B 4GDOA 2QA4P 2QJPC 3O8ZA 3TK1A 4HKZH 3HE5B 1GL2B 2C0WA 3L73J 1NTZG 1KYOD 1L4AB 2HR3A 3HUSC 3AECC 2Q6QA 1SQBE 3CWBD 4RKUJ 1FS0E 1QEXA 2A45G 1NO4A 1FE6A 5KJ7C 1PL5A 3LIEA 5B5EH 1IFDA 1PZQA 4GT1A 1KILD 3WUVA 2QG4A 1NKNA 2ZFCA 2JDIH 1S9KD 2FXPA 3U1CA 1YIJP 3RL0D 1DIPA 1SS1A 4O9BA 4GOFA 5L8RJ 2O3JA 1J1EB 3CC7P 1SQVD 2WSEJ 4K35A 3W68A 5KLVE 3RK3C 3HTKB 3CCSP 2OTLP 2NPSC 3HD7C 4AYCA 1L0NK 3L73E 1FBMA 3VP9A 1EQ7A 3ZDMA 5AW2B 5KAIE 1Q81Q 1JM0A 1PP9J 1QL2A 2H88C 2B9BA 4PD4I 3H32A 1Z56A 4UB8E 3CLQA 1IO4A 3MZWB 3QWOC 1JY2O 3SFDC 3WU2H 1VQLP 2V7QH 3G9RA 3L74G 3OA7A 3KZIH 4EIJA 1NTME 3GF7A 3KHUA 5BU8B 3EFFK 1YHQP 1LTGC 2ZVOB 3V2NA 3B5ND 4I7ZB 5APUA 2HODB 1D7MA 1HGZA 1S5LX 2W27A 1H0TA 4LLHA 2QE7H 5AVZB 3H25A 1FZFA 3BVHA 1VQ6P 3ITKA 2HG5D 4C46A 1VQNP 5AVUB 3M0DC 1NU1G 2D2CB 1OIPA 1P84E 1L0NJ 5APVA 2WVRA 3L74J 5EFWB 1T6AA 3AE5C 5B5EE 3TGUD 4WBAA 2I1KA 3B5NC 1SFCB 1PV3A 3M9BA 5APQA 5GTHE 4H13C 4IOIH 2FBWC 3A0BH 4JYCA 3WUTA 2E74D 4GIFA 4ZNCA 3BRVB 1L0LJ 4KJMA 3Q5SA 1LTAC 1BGYG 1SQXD 3CWBG 1LTTC 1IK7A 4PD4H 2GUVA 4PD4E 2R44A 3TNUA 3U1AA 5B66E 1PPJD 3L71J 1H0TB 3CXHI 1ZLLA 1NKZB 2D2CC 3B4SA 3PH0A 4C7NA 1RQUA 3B5NA 4IL6E 1SQXJ 3M91A 1URQC 1FDOA 1S72P 2B89A 2E5TA 1P84D 1N7SB 4L76A 2R5DA 3F5HA 1PGJA 3CWBJ 2FYUG 5CMZA 2XZRA 4XFJA 2IBZE 2MJZA 1M56D 1LT9A 1J1DC 2NPSB 1RH5B 2WQYC 3HD7B 1RE3C 4I1LA 1BDDA 1JY3P 1NAYA 1UIXA 1G1IA 2FXMA 1VPCA 2QJYC 4PJ0E 3TDKA 1S9KE 1JCCA 3GG2A 1KILE 1MFTA 2M8RA 1FDMA 3L75D 2GUSA 3L70D 1H8AA 3PJSK 2K88A 1MZ9A 1NTMK 1SQBK 2IPPA 2JWAA 3IR9A 5AW1B 3I5CA 4N3YB 5KLIB 2B87A 2Q1KA 1LJ2A 1K04A 2XNXA 3H1LE 3M9HA 4L74A 4DOJA 3E7KA 1A02F 2QIWA 2P10A 1NTKJ 4W7ZA 3L75J 4WWIA 3LIDA 1M1KQ 3A7OA 2NPSA 3HD7A 4Y99B 3BCCG 4IFMA 5AVRB 1L4AC 1BDCA 3CC2P 2PAJA 1HJBA 3G6EP 2M0BA 1IFIA 3W67A 2A06G 1JNMA 2OYIC 2POHA 3KDPB 3AE2C 3B5NB 1M8OB 5KKZC 1E79H 4HB1A 3V6IA 1FZCC 2KLUA 2Y9YA 2QM8A 3IFMA 3L75E 3L75G 3D6YA 1VQ9P 1KQGB 2LR2A 1FZAA 3CI9A 1IFJA 1XTCC 1IC2A 1JTHB 1GK6A 1T8ZA 2A06E 2IZ1A 2JEEA 1BCCJ 2O01H 1EZVI 3CCQP 2W8ZA 1RF1A 3AEDC 1AJYA 1LGHB 1OZHA 2NPSD 1HH0A 3GF3A 3H1HG 3HD7D 3L4FA 3T97B 3TGUE 1U57A 1JUNA 1GZLA 2FXOA 4BRYB 3IAOA 2BCCJ 3O6QA 1NGMB 3HE4A 1FDIA 5KTBA 3CCLP 2E74B 4RJTA 1SQPE 1CI6B 1KMIZ 1NTZD 3MP7B 2FYUD 5AVYB 3BATA 2IFMA 3Q1MA 4HH2A 3PP5A 1PPJG 2P2UA 3M0AA 2IZ0A 4D6TJ 2GA1A 2A45H 1PP9G 5CCHD 5AVVB 2DW3A 1EZVG 2HODA 1BSNA 2XV5A 3FWLA 1GW3A 2BASA 5APWA 5APSA 3CCRP 2Z4EA 2WSFJ 1VQ5P 1URQD 1G2CA 3USSA 1A02J 1EDJA 3L73D 3N4XA 2KZJA 2WSSH 3H1IJ 5H2FH 2E75D 3H32B 2BCCE 5TISH 1H88A 1FJPA 4JPZB 1N7SA 3M06A 2W6JH 4Y28J 1S5LE 3M9QA 3L37A 2H43A 4AQRD 1R5LA 2QSIA 4C7NB 3L36A 1AQ5A 3FWNA 1LTJA 2JWDA 4OWFA 1SLQA 2KS1A 2MKVA 3VOPA 1IK9A 3A2AA 1OXZA 2WPRA 3S4RA 1PP9E 2E76C 1N73C 1QVFO 4N6JA 2O01J 4ZMDA 4NPEA 1IFMA 1R5SA 2NRGA 1FZBA 2P7JA 1AV1A 2YKQA 3L70J 4ASWA 2HPCB 1PFIA 1S4XA 3GHGC 1SFCA 3B8EB 3VN0A 1L4AA 2N1TB 3SFEC 4HJGH 2V7QJ 3WMM0 1GU5A 1EC5A 3TGUG 5K5GB 2FYUK 1NTZK 1NTKD 1SQPJ 2JKVA 3H1JG 1FZGA 1S3JA 3GMAA 5GTHH 2L5GB 2JO1A 3I56P 5DJUB 1N73A 3CXHH 4OH8B 5KLVJ 1IJDB 3L70G 2IFNA 1GTWA 1LWUC 5APTA 2WWWA 1KYOE 1NTMG 1Q2NA 3OAKA 5AW0B 4U7JA 1VQMP 1RHZB 4BXLA 2XU6A 1RE3A 5BU5A 4H13B 3Q3DA 1ZR4A 2WSCH 2BCCD 1WMKA 1ZP0C 2KSJA 1GMJA 3BRTB 3GHGA 3QH9A 3SWYA 4Y99C 3MD0A 3CCUP 1L4AD 2OYHB 1JEKA 1OVVA 2RH0A 3BCCE 3FX0A 5KLVG 1ZW0A 1YI2P 3HRNA 1AFOA 1BCCD 3S9OA 1ZR2A 4IL6X 2H7HA 2KIKA 3H1KE 3H1KG 3KYQA 1KB9H 3OJAB 1YTZT 1ZXGA 2CK3H 3L74D 4XA4A 2I8DA 1Q82Q 3EQ2A 1Y9BA 1T2KD 1GL2C 2KOGA 2B88A 3MTUE 2H8PD 1SQBG 4OGQD 1KC8Q 1W2EA 3JCUH 4W7YA 1H89A 4IFFA 3VMYA 3WUUA 3BCCD 1T3JA 5H2FE 3JSVC 1PGQA 5TISE 2M3BA 3CXHE 1KQFB 3H1KJ 3PRJA 1E5WA 3U59A 4EDFA 1GL2A 3CX5I 3P32A 4JBZA 1EDLA 4QMAA 1AVOA 1AQTA 1T2KC 1K05A 2RN0A 3V4QA 3OW2O 2E75B 3H1ID 4MN4C 3MGNA 1SP4A 3H1KD 3RK2D 2OARA 2YO3A 2ZJSE 1BE3G 3H1JE 3RL0C 3V2PA 1KB9D 3FXEA 1SQQE 1FZCA 1UIIA 1BSHA 3CWBE 1L0LK 3RK2C 3TNUB 1IFPA 1PGOA 1VF5C 2UWJE 2FYNB 2N1TD 2KXPB 2YMYA 2WTYA 2P58A 4W80A 1T3UA 4YXWH 1EXIA 2YIUB 1U7JA 3A0HE 3C9IA 5AW6B 3P8CE 1N7LA 1NWQA 2YNYA 1KD1Q 1FZCB 1X22A 1QGKB 3PLNA 1LP1B 1LWUA 1LTJB 1SQQG 2QJKC 2W83C 1S5LH 2YMKA 3CL3D 1BE3E 2RKLA 4EYYQ 1K9MQ 1HUCA 1LNQA 2Y0CA 3H1IG 3A3YB 1JY3O 2OGUA 2N9BA 3AEFC 1HGVA 1OX3A 3CX5D 3IF4A 4M3LA 2AEFA 4OGQB 5CCGC 1HBWA 1X79B 1W5CE 1L0LD 1RE4C 5AVQB 4PV1B 3V2RA 1HJ0A 3AE9C 3CD6P 3LW5H 3KXDA 2BCCG 1JCDA 1YQ3C 3TF5A 3D6ZA 1J2JB 1LT9C 1W2BO 3HUSA 3P8CD 1YBKA 3H1HD 3V4WA 1AA0A 1JOCA 5M1BA 1CW5A 5GTIH 1URQA 4N78E 3RBXA 2ZT9C 2K9JA 1EZVE 2NZ2A 4H0LB 2LKMA 1R8EA 2J59M 1HVVA 4UB8H 5AVXB 1PPJE 1YJ9P 5B66H 5CCHA 2KNCA 1CI6A 1VQOP 2OYIA 5KAFH 1KILA 2ZYGA 4L73A 1KFNA 3KQGA 3TGUJ 3O6QB 1U7MA 1SQPG 2C0XA 4PJ0H 2E43A 1N7SC 2J5UA 1M90Q 1DEBA 1USEA 2R3CA 1KV4A 1OMIA 2IBZD 2R32A 2Y0DA 1QLED 4RO0A 3H1HE 3GHGB 1OVRA 1FOSE 4WVZA 2Q5UA 1JTHA 5AW8B 2FKWB 2SPZA 2V4HA 3L71G 1FC2C 2ITAA 1IZNB 4EOTA 2PRRA 4A7PA 1JY3N 3NXSA 3RGUA 1X0TA 1YQ4C 3CPWO 1SQVE 1NAFA 2LXBA 1EDIA 2G3AA 2FYZA 2QJKB 1PGPA 4WY4B 1GW4A 2J58A 3CMAP 1GL2D 1YJWP 3L70E 1JY2N 3CMEP 4C7RA 1JY2P 1KILC 1SQQK 5C39A 1VQ4P 1NU1J 3L72D 3KZIE 1L0NG 4YXDC 2E75C 1CZQA 1S1CX 2WPQA 1M7LA 1L2PA 3AE1C 1MKMA 2YKOA 3AEEC 5AW5B 2HPCA 3FXDA 3RL0B 1OW7A 3TSIA 4R4LA 3UIAA 1QX8A 2BEZF 4I6MC 1NU1D 3A5TA 1DX7A 2FFDA 1VQKP 2B87B 5KKZB 1NTKK 1RF1C 1LTIC 2ZYAA 2YKPA 4GKGA 4I7ZC 4LC1A 3AEAC 1NOHA 3H1LG 3H6PA 4U3FE 5AW9B 3VP8A 1Y8AA 1MFZA 2L91A 1QL1A 4JYBA 1RF0A 4DJGA 3BASA 1NTMJ 3H1JD 2M5AA 4WB4A 1YJNP 1NJIQ 2OYIB 4AUWA 1S2EA 1N2DC 1VL2A 3E1IA 1LT9B 2E76B 2KK7A 5APXA 5KLIC 1BGYD 1SQXG 2FY8A 2YXRB 5CCHC 4D6TD 1URQB 1OW6A 2N9YB 2WSCJ 3GW6A 1EXJA 2H89C 1MV8A 3H1LJ 1KTMA 1KORA 1SQPD 2WT7B 1J1EC 1ZOYC 1FZEA 3CXHD 4YPCA 3Q5PA 3A0HH 1NTKE 4PV1D 3CCVP 1BE3J 4U3FD 1WT6A 1M1JA 4KT0J 1SQXK 1KYOI 3PHLA 2ZT9D 4GOEA 1ZRTD 2VRSA 3II6A 3H1LD 3IN6A 5AW4B 1BCCG 4UB6H 3CCMP 1Y47A 1OW8A 1BGYE 3H1HJ 1IFNA 3L72E 2OYHC 1YYCA 2R3SA 5KJ7A 2HYNA 4NPDA 2AEJA 4HYTB 1FAVA 2OTKE 3TYYA 2XDJA 1K8AQ 3BCCJ 5AW3B 3V2QA 3G71P 2W6BA 3L72G 2C9LY 3VTPC 3R2PA 3AE6C 2FYNC 3T97A 2QVAA 1HWTC 4D6TG 2O01N 4RESB 1BCCE 4H44B 3AE4C 1Q86Q 5DJTB 3C8VA 3D71A 1N86A 1VF5D 3EWKA 2K1AA 3D70A 2KZIA 1KQLA 4WY4D 1P84H 1USDA 2A45I 2ZXEB 3RK3E 1ZN5A 1KB9I 2M3EA 3WU2E 4TLFA 3L35A 1N7SD 3F89A 2KS1B 3B71A 1M1JB 3VMAA 1VQPP 2Z5HA 3C1LA 3JC22 3AE7C 3L72J 4DT0A 1L0LE 4DZOA 2WITA 3AEGC 5CBNA 2C9NY 1PP9D 1L0ND 2QJYB 2WPVB 3L74E 3CX5E 4Z1MH 2Q3EA
chains in the Genus database with same CATH topology
2G8YA 1ZMEC 4PV1B 1HJ0A 2FXPA 3AE9C 4H13D 1DIPA 1RQVA 2WSFJ 2ZT9B 1YQ3C 3D6ZA 5L8RJ 3RL0g 3FGAD 2WSEJ 2E75D 5M1BA 4OGQC 2H88C 3R4YA 1DD4A 2ZT9C 4Y28J 2NZ2A 4H0LB 3SFDC 1R8EA 2E76D 2QSIA 3G9RA 1PIXA 2JP3A 3GF7A 2OQQA 2MKVA 3AE8C 3GLMA 2J5UA 4I7ZB 2E76C 1VF5B 1S5LX 3LW5J 2O01J 1OMIA 3H25A 1NYHA 1ZRTE 2YIUC 2D2CB 1TU3F 3AE5C 3SFEC 1YQ4C 2V7QJ 4H44C 2G3AA 1DD3A 1Q90D 1PV3A 3GMAA 4H13C 2FBWC 2JO1A 2E74D 2BEQD 4R4MA 2IDBA 4YTPC 3Q2YA 3Q5SA 1IK7A 3AEBC 4YXDC 2E75C 1S1CX 4U7JA 4H44D 2D2CC 3AE1C 1MKMA 3AEEC 3Q3DA 1RQUA 4H13B 1OW7A 4R4LA 2BEZF 1WMKA 1ZP0C 1FDOA 1GMJA 4I7ZC 3AE3C 3AEAC 1JB0J 4XFJA 4PV1C 3S9OA 2WQYC 4IL6X 1EXIA 1HF9A 1UIXA 2QJYC 1VL2A 1KILE 2E76B 5KLIC 1OW6A 2WSCJ 1EXJA 2H89C 1Y9BA 4OGQD 1K04A 1KTMA 1KORA 1ZOYC 2QIWA 3Q5PA 2P10A 4H0LC 4PV1D 4KT0J 1KQFB 2K9YA 2ZT9D 4H0LD 2D2CD 3IN6A 3Q5RA 1K05A 1OW8A 2E75B 3AE2C 4TT3H 5KKZC 3ABVC 2E74C 3D6YA 1KQGB 3AE6C 2FYNC 1VF5C 4H44B 3AE4C 4GDOA 3AEDC 1AJYA 2QJPC 3C8VA 3D71A 1VF5D 3GF3A 3EWKA 3T97B 3D70A 1U57A 3RK3E 3IAOA 3O6QA 1NGMB 1FDIA 2E74B 3B71A 2QJKC 3AECC 1KMIZ 2YMKA 3AE7C 4RKUJ 3Q1MA 3AEGC 3AEFC 4OGQB 1PL5A 2WPVB 4Z1MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT E;  4PV1 B;  2E75 B;  2YIU C;  2D2C B;  5KKZ C;  1JB0 J;  2ZT9 B;  2WSF J;  4IL6 X;  5L8R J;  2QJY C;  2WSE J;  1Q90 D;  2E76 B;  5KLI C;  2FYN C;  4H44 B;  2WSC J;  2QJP C;  3C8V A;  4Y28 J;  4H0L B;  2QIW A;  2QSI A;  2E74 B;  4KT0 J;  2QJK C;  2K9Y A;  4RKU J;  4H13 B;  4I7Z B;  1VF5 B;  1S5L X;  2WPV B;  3LW5 J;  4OGQ B;  2O01 J; 
#chains in the Genus database with same CATH topology
 2G8Y A;  1SQX E;  2O1K A;  1P84 I;  1VQ8 P;  1ZME C;  4H13 D;  1ZV8 A;  1FU1 A;  1RQV A;  1FJK A;  2ZT9 B;  3EFG A;  3L73 G;  3SWF A;  1NTZ J;  3RL0 g;  2FFD C;  3NTN A;  2E42 A;  3FGA D;  3N7N A;  2Z5I A;  3RK3 D;  1JMM A;  2M5A B;  2YO2 A;  1GDT A;  3M0D A;  5E79 E;  5CHX A;  1SVF A;  4ZKP A;  1HTL C;  2IYP A;  1AVY A;  2K9J B;  2K37 A;  3MIW A;  1DH3 A;  2XND H;  4OGQ C;  2QEX P;  3R4Y A;  2QRX A;  4GOD A;  1DD4 A;  1FOS F;  2HFE D;  2FFD B;  5CJ0 A;  1SQQ D;  2E76 D;  4OVN F;  2AXC A;  2P67 A;  3HUS B;  1MUU A;  3K5B A;  1PIX A;  4JF7 A;  2JP3 A;  3NFQ A;  2OQQ A;  5AVW B;  2ZVN B;  1L0N E;  1KB9 E;  3AE8 C;  3CC4 P;  3GLM A;  5KAF E;  1K73 Q;  1SQB D;  2PP6 A;  1NTM D;  2QJP B;  3H1J J;  5AVT B;  2Y9Z A;  2IBZ G;  1VF5 B;  3LW5 J;  2P1J A;  4LGD E;  3NMD A;  2Q7C A;  2FYU E;  1CSB A;  3P8M C;  2OYH A;  1L0L G;  1NYH A;  1X9V A;  1EZV D;  1ZRT E;  3CCJ P;  2IBZ I;  1BGY J;  2YIU C;  1J1D B;  2JJL A;  2WPS A;  2ZXX A;  3MUD C;  4ASV A;  1NVO A;  1SQV G;  4WY4 A;  1TU3 F;  4XE5 B;  2KP8 A;  1GU4 A;  2K3R A;  1XTG B;  2W90 A;  3L71 E;  4H44 C;  2O1J A;  1LT1 A;  1M1J C;  3MUD A;  4L75 A;  1DD3 A;  1Q90 D;  2N1T C;  5APY A;  3RK2 B;  4I2L C;  3E1R A;  4D6T E;  5BVZ A;  2JR8 A;  2BEQ D;  4R4M A;  4EI2 A;  1Q7Y Q;  2IDB A;  4YTP C;  3Q2Y A;  2OYO A;  4PD4 D;  4B86 A;  1KN7 A;  2CPS A;  1NH4 A;  3VMX A;  5KJ7 D;  1SQV J;  1VDF A;  3G4S P;  1RY3 A;  3AEB C;  3CCE P;  3JCU E;  5AVS B;  2N1T A;  1KIL B;  2KB7 P;  2AXT E;  4H44 D;  1G1J A;  2KNC B;  4CPG A;  4N78 D;  1DEE G;  5AW7 B;  1WRG A;  1RF0 C;  4WY4 C;  4NPF X;  1NU1 E;  1SFC C;  5E79 H;  5KLV D;  1NHL A;  3AE3 C;  3V5B A;  1KQS O;  2LXC B;  1LTS C;  5TJH A;  1KFM A;  1VQ7 P;  1JB0 J;  1RE4 A;  4PV1 C;  1NTK G;  4IFD K;  2PGD A;  4UB6 E;  2KUB A;  5CCG A;  2KSE A;  5GTI E;  2OTJ P;  1HF9 A;  3VYI A;  1G2C B;  5KAI H;  2PFX A;  2GM4 A;  3SWK A;  3RBZ A;  5KLV K;  2ZAE B;  1N8R Q;  2KYV A;  4K3A A;  2WT7 A;  2IX7 C;  1EDK A;  1LTJ C;  2RMZ A;  5CBO A;  1OVU A;  2I1J A;  2WZ7 A;  5CCG D;  1YTZ I;  3H1I E;  2AEM A;  1SQP K;  2FYU J;  3S1K A;  3HTK A;  3P7K A;  4KHX A;  1KYO H;  3MHV A;  4ZKU A;  1JO5 A;  4JQ0 D;  1SFC D;  4H0L C;  2YXQ B;  2E5Y A;  1LP1 A;  1LWU B;  4BWN A;  3I55 P;  4U3F G;  2K9Y A;  4IL6 H;  4H0L D;  2D2C D;  1OFC X;  4DCK A;  3RK3 B;  2A06 D;  2HLO A;  2WMM A;  3Q5R A;  3G3Z A;  1SQV K;  2AXT H;  1QVG O;  2CPB A;  2XKM A;  4TT3 H;  1SQB J;  1RF1 B;  2WSE H;  1GK4 A;  3VMZ A;  2Q3I A;  3ABV C;  2E74 C;  3CX5 H;  2Q9I A;  1OWA A;  1NU1 K;  2KLV A;  1M57 D;  1YIT P;  3A0B E;  3HE4 B;  1GD2 E;  1SQQ J;  3PTZ A;  1BE3 D;  1X8Y A;  2IYO A;  1KZU B;  1NTZ E;  2KI7 B;  2W6A A;  3HE5 A;  4U3F J;  4BRY A;  1JMB A;  1LTB C;  2QM7 A;  2WSF H;  2R5B A;  3L71 D;  2ZYD A;  3SSU A;  5CJ4 A;  3KPE A;  2Y0E A;  1N73 B;  4GDO A;  2QA4 P;  2QJP C;  3O8Z A;  3TK1 A;  4HKZ H;  3HE5 B;  1GL2 B;  2C0W A;  3L73 J;  1NTZ G;  1KYO D;  1L4A B;  2HR3 A;  3HUS C;  3AEC C;  2Q6Q A;  1SQB E;  3CWB D;  4RKU J;  1FS0 E;  1QEX A;  2A45 G;  1NO4 A;  1FE6 A;  5KJ7 C;  1PL5 A;  3LIE A;  5B5E H;  1IFD A;  1PZQ A;  4GT1 A;  1KIL D;  3WUV A;  2QG4 A;  1NKN A;  2ZFC A;  2JDI H;  1S9K D;  2FXP A;  3U1C A;  1YIJ P;  3RL0 D;  1DIP A;  1SS1 A;  4O9B A;  4GOF A;  5L8R J;  2O3J A;  1J1E B;  3CC7 P;  1SQV D;  2WSE J;  4K35 A;  3W68 A;  5KLV E;  3RK3 C;  3HTK B;  3CCS P;  2OTL P;  2NPS C;  3HD7 C;  4AYC A;  1L0N K;  3L73 E;  1FBM A;  3VP9 A;  1EQ7 A;  3ZDM A;  5AW2 B;  5KAI E;  1Q81 Q;  1JM0 A;  1PP9 J;  1QL2 A;  2H88 C;  2B9B A;  4PD4 I;  3H32 A;  1Z56 A;  4UB8 E;  3CLQ A;  1IO4 A;  3MZW B;  3QWO C;  1JY2 O;  3SFD C;  3WU2 H;  1VQL P;  2V7Q H;  3G9R A;  3L74 G;  3OA7 A;  3KZI H;  4EIJ A;  1NTM E;  3GF7 A;  3KHU A;  5BU8 B;  3EFF K;  1YHQ P;  1LTG C;  2ZVO B;  3V2N A;  3B5N D;  4I7Z B;  5APU A;  2HOD B;  1D7M A;  1HGZ A;  1S5L X;  2W27 A;  1H0T A;  4LLH A;  2QE7 H;  5AVZ B;  3H25 A;  1FZF A;  3BVH A;  1VQ6 P;  3ITK A;  2HG5 D;  4C46 A;  1VQN P;  5AVU B;  3M0D C;  1NU1 G;  2D2C B;  1OIP A;  1P84 E;  1L0N J;  5APV A;  2WVR A;  3L74 J;  5EFW B;  1T6A A;  3AE5 C;  5B5E E;  3TGU D;  4WBA A;  2I1K A;  3B5N C;  1SFC B;  1PV3 A;  3M9B A;  5APQ A;  5GTH E;  4H13 C;  4IOI H;  2FBW C;  3A0B H;  4JYC A;  3WUT A;  2E74 D;  4GIF A;  4ZNC A;  3BRV B;  1L0L J;  4KJM A;  3Q5S A;  1LTA C;  1BGY G;  1SQX D;  3CWB G;  1LTT C;  1IK7 A;  4PD4 H;  2GUV A;  4PD4 E;  2R44 A;  3TNU A;  3U1A A;  5B66 E;  1PPJ D;  3L71 J;  1H0T B;  3CXH I;  1ZLL A;  1NKZ B;  2D2C C;  3B4S A;  3PH0 A;  4C7N A;  1RQU A;  3B5N A;  4IL6 E;  1SQX J;  3M91 A;  1URQ C;  1FDO A;  1S72 P;  2B89 A;  2E5T A;  1P84 D;  1N7S B;  4L76 A;  2R5D A;  3F5H A;  1PGJ A;  3CWB J;  2FYU G;  5CMZ A;  2XZR A;  4XFJ A;  2IBZ E;  2MJZ A;  1M56 D;  1LT9 A;  1J1D C;  2NPS B;  1RH5 B;  2WQY C;  3HD7 B;  1RE3 C;  4I1L A;  1BDD A;  1JY3 P;  1NAY A;  1UIX A;  1G1I A;  2FXM A;  1VPC A;  2QJY C;  4PJ0 E;  3TDK A;  1S9K E;  1JCC A;  3GG2 A;  1KIL E;  1MFT A;  2M8R A;  1FDM A;  3L75 D;  2GUS A;  3L70 D;  1H8A A;  3PJS K;  2K88 A;  1MZ9 A;  1NTM K;  1SQB K;  2IPP A;  2JWA A;  3IR9 A;  5AW1 B;  3I5C A;  4N3Y B;  5KLI B;  2B87 A;  2Q1K A;  1LJ2 A;  1K04 A;  2XNX A;  3H1L E;  3M9H A;  4L74 A;  4DOJ A;  3E7K A;  1A02 F;  2QIW A;  2P10 A;  1NTK J;  4W7Z A;  3L75 J;  4WWI A;  3LID A;  1M1K Q;  3A7O A;  2NPS A;  3HD7 A;  4Y99 B;  3BCC G;  4IFM A;  5AVR B;  1L4A C;  1BDC A;  3CC2 P;  2PAJ A;  1HJB A;  3G6E P;  2M0B A;  1IFI A;  3W67 A;  2A06 G;  1JNM A;  2OYI C;  2POH A;  3KDP B;  3AE2 C;  3B5N B;  1M8O B;  5KKZ C;  1E79 H;  4HB1 A;  3V6I A;  1FZC C;  2KLU A;  2Y9Y A;  2QM8 A;  3IFM A;  3L75 E;  3L75 G;  3D6Y A;  1VQ9 P;  1KQG B;  2LR2 A;  1FZA A;  3CI9 A;  1IFJ A;  1XTC C;  1IC2 A;  1JTH B;  1GK6 A;  1T8Z A;  2A06 E;  2IZ1 A;  2JEE A;  1BCC J;  2O01 H;  1EZV I;  3CCQ P;  2W8Z A;  1RF1 A;  3AED C;  1AJY A;  1LGH B;  1OZH A;  2NPS D;  1HH0 A;  3GF3 A;  3H1H G;  3HD7 D;  3L4F A;  3T97 B;  3TGU E;  1U57 A;  1JUN A;  1GZL A;  2FXO A;  4BRY B;  3IAO A;  2BCC J;  3O6Q A;  1NGM B;  3HE4 A;  1FDI A;  5KTB A;  3CCL P;  2E74 B;  4RJT A;  1SQP E;  1CI6 B;  1KMI Z;  1NTZ D;  3MP7 B;  2FYU D;  5AVY B;  3BAT A;  2IFM A;  3Q1M A;  4HH2 A;  3PP5 A;  1PPJ G;  2P2U A;  3M0A A;  2IZ0 A;  4D6T J;  2GA1 A;  2A45 H;  1PP9 G;  5CCH D;  5AVV B;  2DW3 A;  1EZV G;  2HOD A;  1BSN A;  2XV5 A;  3FWL A;  1GW3 A;  2BAS A;  5APW A;  5APS A;  3CCR P;  2Z4E A;  2WSF J;  1VQ5 P;  1URQ D;  1G2C A;  3USS A;  1A02 J;  1EDJ A;  3L73 D;  3N4X A;  2KZJ A;  2WSS H;  3H1I J;  5H2F H;  2E75 D;  3H32 B;  2BCC E;  5TIS H;  1H88 A;  1FJP A;  4JPZ B;  1N7S A;  3M06 A;  2W6J H;  4Y28 J;  1S5L E;  3M9Q A;  3L37 A;  2H43 A;  4AQR D;  1R5L A;  2QSI A;  4C7N B;  3L36 A;  1AQ5 A;  3FWN A;  1LTJ A;  2JWD A;  4OWF A;  1SLQ A;  2KS1 A;  2MKV A;  3VOP A;  1IK9 A;  3A2A A;  1OXZ A;  2WPR A;  3S4R A;  1PP9 E;  2E76 C;  1N73 C;  1QVF O;  4N6J A;  2O01 J;  4ZMD A;  4NPE A;  1IFM A;  1R5S A;  2NRG A;  1FZB A;  2P7J A;  1AV1 A;  2YKQ A;  3L70 J;  4ASW A;  2HPC B;  1PFI A;  1S4X A;  3GHG C;  1SFC A;  3B8E B;  3VN0 A;  1L4A A;  2N1T B;  3SFE C;  4HJG H;  2V7Q J;  3WMM 0;  1GU5 A;  1EC5 A;  3TGU G;  5K5G B;  2FYU K;  1NTZ K;  1NTK D;  1SQP J;  2JKV A;  3H1J G;  1FZG A;  1S3J A;  3GMA A;  5GTH H;  2L5G B;  2JO1 A;  3I56 P;  5DJU B;  1N73 A;  3CXH H;  4OH8 B;  5KLV J;  1IJD B;  3L70 G;  2IFN A;  1GTW A;  1LWU C;  5APT A;  2WWW A;  1KYO E;  1NTM G;  1Q2N A;  3OAK A;  5AW0 B;  4U7J A;  1VQM P;  1RHZ B;  4BXL A;  2XU6 A;  1RE3 A;  5BU5 A;  4H13 B;  3Q3D A;  1ZR4 A;  2WSC H;  2BCC D;  1WMK A;  1ZP0 C;  2KSJ A;  1GMJ A;  3BRT B;  3GHG A;  3QH9 A;  3SWY A;  4Y99 C;  3MD0 A;  3CCU P;  1L4A D;  2OYH B;  1JEK A;  1OVV A;  2RH0 A;  3BCC E;  3FX0 A;  5KLV G;  1ZW0 A;  1YI2 P;  3HRN A;  1AFO A;  1BCC D;  3S9O A;  1ZR2 A;  4IL6 X;  2H7H A;  2KIK A;  3H1K E;  3H1K G;  3KYQ A;  1KB9 H;  3OJA B;  1YTZ T;  1ZXG A;  2CK3 H;  3L74 D;  4XA4 A;  2I8D A;  1Q82 Q;  3EQ2 A;  1Y9B A;  1T2K D;  1GL2 C;  2KOG A;  2B88 A;  3MTU E;  2H8P D;  1SQB G;  4OGQ D;  1KC8 Q;  1W2E A;  3JCU H;  4W7Y A;  1H89 A;  4IFF A;  3VMY A;  3WUU A;  3BCC D;  1T3J A;  5H2F E;  3JSV C;  1PGQ A;  5TIS E;  2M3B A;  3CXH E;  1KQF B;  3H1K J;  3PRJ A;  1E5W A;  3U59 A;  4EDF A;  1GL2 A;  3CX5 I;  3P32 A;  4JBZ A;  1EDL A;  4QMA A;  1AVO A;  1AQT A;  1T2K C;  1K05 A;  2RN0 A;  3V4Q A;  3OW2 O;  2E75 B;  3H1I D;  4MN4 C;  3MGN A;  1SP4 A;  3H1K D;  3RK2 D;  2OAR A;  2YO3 A;  2ZJS E;  1BE3 G;  3H1J E;  3RL0 C;  3V2P A;  1KB9 D;  3FXE A;  1SQQ E;  1FZC A;  1UII A;  1BSH A;  3CWB E;  1L0L K;  3RK2 C;  3TNU B;  1IFP A;  1PGO A;  1VF5 C;  2UWJ E;  2FYN B;  2N1T D;  2KXP B;  2YMY A;  2WTY A;  2P58 A;  4W80 A;  1T3U A;  4YXW H;  1EXI A;  2YIU B;  1U7J A;  3A0H E;  3C9I A;  5AW6 B;  3P8C E;  1N7L A;  1NWQ A;  2YNY A;  1KD1 Q;  1FZC B;  1X22 A;  1QGK B;  3PLN A;  1LP1 B;  1LWU A;  1LTJ B;  1SQQ G;  2QJK C;  2W83 C;  1S5L H;  2YMK A;  3CL3 D;  1BE3 E;  2RKL A;  4EYY Q;  1K9M Q;  1HUC A;  1LNQ A;  2Y0C A;  3H1I G;  3A3Y B;  1JY3 O;  2OGU A;  2N9B A;  3AEF C;  1HGV A;  1OX3 A;  3CX5 D;  3IF4 A;  4M3L A;  2AEF A;  4OGQ B;  5CCG C;  1HBW A;  1X79 B;  1W5C E;  1L0L D;  1RE4 C;  5AVQ B;  4PV1 B;  3V2R A;  1HJ0 A;  3AE9 C;  3CD6 P;  3LW5 H;  3KXD A;  2BCC G;  1JCD A;  1YQ3 C;  3TF5 A;  3D6Z A;  1J2J B;  1LT9 C;  1W2B O;  3HUS A;  3P8C D;  1YBK A;  3H1H D;  3V4W A;  1AA0 A;  1JOC A;  5M1B A;  1CW5 A;  5GTI H;  1URQ A;  4N78 E;  3RBX A;  2ZT9 C;  2K9J A;  1EZV E;  2NZ2 A;  4H0L B;  2LKM A;  1R8E A;  2J59 M;  1HVV A;  4UB8 H;  5AVX B;  1PPJ E;  1YJ9 P;  5B66 H;  5CCH A;  2KNC A;  1CI6 A;  1VQO P;  2OYI A;  5KAF H;  1KIL A;  2ZYG A;  4L73 A;  1KFN A;  3KQG A;  3TGU J;  3O6Q B;  1U7M A;  1SQP G;  2C0X A;  4PJ0 H;  2E43 A;  1N7S C;  2J5U A;  1M90 Q;  1DEB A;  1USE A;  2R3C A;  1KV4 A;  1OMI A;  2IBZ D;  2R32 A;  2Y0D A;  1QLE D;  4RO0 A;  3H1H E;  3GHG B;  1OVR A;  1FOS E;  4WVZ A;  2Q5U A;  1JTH A;  5AW8 B;  2FKW B;  2SPZ A;  2V4H A;  3L71 G;  1FC2 C;  2ITA A;  1IZN B;  4EOT A;  2PRR A;  4A7P A;  1JY3 N;  3NXS A;  3RGU A;  1X0T A;  1YQ4 C;  3CPW O;  1SQV E;  1NAF A;  2LXB A;  1EDI A;  2G3A A;  2FYZ A;  2QJK B;  1PGP A;  4WY4 B;  1GW4 A;  2J58 A;  3CMA P;  1GL2 D;  1YJW P;  3L70 E;  1JY2 N;  3CME P;  4C7R A;  1JY2 P;  1KIL C;  1SQQ K;  5C39 A;  1VQ4 P;  1NU1 J;  3L72 D;  3KZI E;  1L0N G;  4YXD C;  2E75 C;  1CZQ A;  1S1C X;  2WPQ A;  1M7L A;  1L2P A;  3AE1 C;  1MKM A;  2YKO A;  3AEE C;  5AW5 B;  2HPC A;  3FXD A;  3RL0 B;  1OW7 A;  3TSI A;  4R4L A;  3UIA A;  1QX8 A;  2BEZ F;  4I6M C;  1NU1 D;  3A5T A;  1DX7 A;  2FFD A;  1VQK P;  2B87 B;  5KKZ B;  1NTK K;  1RF1 C;  1LTI C;  2ZYA A;  2YKP A;  4GKG A;  4I7Z C;  4LC1 A;  3AEA C;  1NOH A;  3H1L G;  3H6P A;  4U3F E;  5AW9 B;  3VP8 A;  1Y8A A;  1MFZ A;  2L91 A;  1QL1 A;  4JYB A;  1RF0 A;  4DJG A;  3BAS A;  1NTM J;  3H1J D;  2M5A A;  4WB4 A;  1YJN P;  1NJI Q;  2OYI B;  4AUW A;  1S2E A;  1N2D C;  1VL2 A;  3E1I A;  1LT9 B;  2E76 B;  2KK7 A;  5APX A;  5KLI C;  1BGY D;  1SQX G;  2FY8 A;  2YXR B;  5CCH C;  4D6T D;  1URQ B;  1OW6 A;  2N9Y B;  2WSC J;  3GW6 A;  1EXJ A;  2H89 C;  1MV8 A;  3H1L J;  1KTM A;  1KOR A;  1SQP D;  2WT7 B;  1J1E C;  1ZOY C;  1FZE A;  3CXH D;  4YPC A;  3Q5P A;  3A0H H;  1NTK E;  4PV1 D;  3CCV P;  1BE3 J;  4U3F D;  1WT6 A;  1M1J A;  4KT0 J;  1SQX K;  1KYO I;  3PHL A;  2ZT9 D;  4GOE A;  1ZRT D;  2VRS A;  3II6 A;  3H1L D;  3IN6 A;  5AW4 B;  1BCC G;  4UB6 H;  3CCM P;  1Y47 A;  1OW8 A;  1BGY E;  3H1H J;  1IFN A;  3L72 E;  2OYH C;  1YYC A;  2R3S A;  5KJ7 A;  2HYN A;  4NPD A;  2AEJ A;  4HYT B;  1FAV A;  2OTK E;  3TYY A;  2XDJ A;  1K8A Q;  3BCC J;  5AW3 B;  3V2Q A;  3G71 P;  2W6B A;  3L72 G;  2C9L Y;  3VTP C;  3R2P A;  3AE6 C;  2FYN C;  3T97 A;  2QVA A;  1HWT C;  4D6T G;  2O01 N;  4RES B;  1BCC E;  4H44 B;  3AE4 C;  1Q86 Q;  5DJT B;  3C8V A;  3D71 A;  1N86 A;  1VF5 D;  3EWK A;  2K1A A;  3D70 A;  2KZI A;  1KQL A;  4WY4 D;  1P84 H;  1USD A;  2A45 I;  2ZXE B;  3RK3 E;  1ZN5 A;  1KB9 I;  2M3E A;  3WU2 E;  4TLF A;  3L35 A;  1N7S D;  3F89 A;  2KS1 B;  3B71 A;  1M1J B;  3VMA A;  1VQP P;  2Z5H A;  3C1L A;  3JC2 2;  3AE7 C;  3L72 J;  4DT0 A;  1L0L E;  4DZO A;  2WIT A;  3AEG C;  5CBN A;  2C9N Y;  1PP9 D;  1L0N D;  2QJY B;  2WPV B;  3L74 E;  3CX5 E;  4Z1M H;  2Q3E A; 
#chains in the Genus database with same CATH homology
 2G8Y A;  1ZME C;  4PV1 B;  1HJ0 A;  2FXP A;  3AE9 C;  4H13 D;  1DIP A;  1RQV A;  2WSF J;  2ZT9 B;  1YQ3 C;  3D6Z A;  5L8R J;  3RL0 g;  3FGA D;  2WSE J;  2E75 D;  5M1B A;  4OGQ C;  2H88 C;  3R4Y A;  1DD4 A;  2ZT9 C;  4Y28 J;  2NZ2 A;  4H0L B;  3SFD C;  1R8E A;  2E76 D;  2QSI A;  3G9R A;  1PIX A;  2JP3 A;  3GF7 A;  2OQQ A;  2MKV A;  3AE8 C;  3GLM A;  2J5U A;  4I7Z B;  2E76 C;  1VF5 B;  1S5L X;  3LW5 J;  2O01 J;  1OMI A;  3H25 A;  1NYH A;  1ZRT E;  2YIU C;  2D2C B;  1TU3 F;  3AE5 C;  3SFE C;  1YQ4 C;  2V7Q J;  4H44 C;  2G3A A;  1DD3 A;  1Q90 D;  1PV3 A;  3GMA A;  4H13 C;  2FBW C;  2JO1 A;  2E74 D;  2BEQ D;  4R4M A;  2IDB A;  4YTP C;  3Q2Y A;  3Q5S A;  1IK7 A;  3AEB C;  4YXD C;  2E75 C;  1S1C X;  4U7J A;  4H44 D;  2D2C C;  3AE1 C;  1MKM A;  3AEE C;  3Q3D A;  1RQU A;  4H13 B;  1OW7 A;  4R4L A;  2BEZ F;  1WMK A;  1ZP0 C;  1FDO A;  1GMJ A;  4I7Z C;  3AE3 C;  3AEA C;  1JB0 J;  4XFJ A;  4PV1 C;  3S9O A;  2WQY C;  4IL6 X;  1EXI A;  1HF9 A;  1UIX A;  2QJY C;  1VL2 A;  1KIL E;  2E76 B;  5KLI C;  1OW6 A;  2WSC J;  1EXJ A;  2H89 C;  1Y9B A;  4OGQ D;  1K04 A;  1KTM A;  1KOR A;  1ZOY C;  2QIW A;  3Q5P A;  2P10 A;  4H0L C;  4PV1 D;  4KT0 J;  1KQF B;  2K9Y A;  2ZT9 D;  4H0L D;  2D2C D;  3IN6 A;  3Q5R A;  1K05 A;  1OW8 A;  2E75 B;  3AE2 C;  4TT3 H;  5KKZ C;  3ABV C;  2E74 C;  3D6Y A;  1KQG B;  3AE6 C;  2FYN C;  1VF5 C;  4H44 B;  3AE4 C;  4GDO A;  3AED C;  1AJY A;  2QJP C;  3C8V A;  3D71 A;  1VF5 D;  3GF3 A;  3EWK A;  3T97 B;  3D70 A;  1U57 A;  3RK3 E;  3IAO A;  3O6Q A;  1NGM B;  1FDI A;  2E74 B;  3B71 A;  2QJK C;  3AEC C;  1KMI Z;  2YMK A;  3AE7 C;  4RKU J;  3Q1M A;  3AEG C;  3AEF C;  4OGQ B;  1PL5 A;  2WPV B;  4Z1M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...