2WSFJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wsfJ00
2WPVB 2O01J 2QJYC 2WSEJ 2QJKC 2D2CB 2E76B 2E75B 5KLIC 3LW5J 5L8RJ 4I7ZB 2WSCJ 4IL6X 1Q90D 2ZT9B 1S5LX 4Y28J 1JB0J 5KKZC 2E74B 2FYNC 1VF5B 4OGQB 4RKUJ 1ZRTE 2K9YA 2WSFJ 2QSIA 4H13B 4KT0J 4PV1B 4H0LB 4H44B 2QJPC 2QIWA 3C8VA 2YIUC
chains in the Genus database with same CATH superfamily
1YJNP 1FJPA 3T97A 3B5ND 3IF4A 3TNUA 3B5NC 1L0LG 1L0LK 1KMIZ 3TGUG 1KYOI 1MUUA 1KB9D 1RF1C 1SFCA 2NPSB 1PGJA 2M8RA 1PGQA 2AXCA 3NTNA 1AFOA 3FGAD 2N9YB 1Q86Q 3CCUP 2Y0EA 2K37A 1BGYD 1KB9H 3RK2B 1FDIA 1M1JB 1OMIA 1UIIA 1AVOA 3VTPC 1QL2A 1A02F 1FZCA 1SP4A 2O1KA 1S5LX 3A0HE 5BU8B 3CXHE 3H1LD 1X8YA 5KKZC 1SLQA 3IFMA 1FJKA 1X79B 2FYNC 2J58A 2WPQA 4D6TD 1GL2A 2G3AA 3S4RA 3TK1A 5APWA 3AEFC 1MV8A 1KN7A 1PP9G 1YHQP 4EI2A 3L70G 5TISH 2P10A 1PFIA 1SQVJ 4DOJA 5AW9B 1NKZB 5AVUB 1HTLC 3Q1MA 1URQC 3V2PA 3A2AA 3NFQA 1R5LA 3GF7A 1DEBA 1RF1A 2KNCB 3VMYA 1ZOYC 2OYOA 1ZXGA 3W68A 4ZKPA 2VRSA 1L2PA 4YPCA 1RE3A 1JY2O 5AW8B 1LTBC 1NAFA 2KI7B 4YXWH 1IJDB 1J2JB 5B5EH 4AYCA 4Y28J 3NXSA 1EZVI 3S9OA 1SQVK 5AW2B 4U3FJ 2FYUJ 3VN0A 2KYVA 1CI6A 2K3RA 2M5AB 5APVA 2H43A 2LXCB 3WUVA 3L71E 4BRYB 3G4SP 4N6JA 3JSVC 3Q2YA 1NHLA 2XNDH 3BVHA 1FC2C 1T3JA 4ASVA 5CJ4A 1IK9A 1U7JA 1YYCA 2B9BA 2DW3A 2PP6A 2Q6QA 3A0BH 5H2FE 4UB6H 1LTJC 1U7MA 2IYOA 2XV5A 2D2CB 2ZAEB 1XTCC 2W90A 1BGYJ 1MKMA 4DZOA 1NWQA 1KV4A 1QVGO 3JC22 3Q5RA 3H1KG 2FYZA 3H1LG 1HWTC 4HJGH 1HH0A 1BSHA 2N9BA 3HUSA 3PHLA 2A06G 2KB7P 2BCCG 1GK6A 3E1IA 2K88A 3H1KJ 3L71J 1H0TB 4H44D 2HODA 2HG5D 3G9RA 3CXHI 3L35A 2ZVNB 3OJAB 1NU1E 3BRVB 3CWBG 2FYNB 2H88C 2IDBA 4L76A 1JNMA 2ZVOB 4IFDK 1LTGC 3A3YB 3L37A 2QM7A 3IN6A 5KLVG 1ZMEC 1J1DB 1LTJA 3BASA 1SQBE 3EFFK 1RE4C 2QVAA 1PL5A 5APXA 1GL2C 2BEQD 2D2CD 2O01H 2POHA 2XZRA 1S1CX 3GHGC 2HODB 4GDOA 3KZIH 3RK2C 1RF1B 5APUA 2BCCD 3AEDC 2E75D 2OYIC 2YKPA 1AV1A 1HJ0A 2IBZI 4NPEA 1L0NE 3I56P 1Y9BA 3CX5H 1LT9B 4ASWA 1URQA 3B4SA 1Q2NA 4TT3H 3CXHD 3H1LE 1BGYG 2WITA 2Y9ZA 1GDTA 1JB0J 2YXRB 2NZ2A 3TF5A 1JY2N 1VPCA 1Z56A 4IOIH 2AXTH 4WWIA 2KOGA 1SQXE 5KLVD 4OWFA 1NTMG 3A0BE 1W2BO 3M0AA 1H0TA 2W6BA 3O6QB 5GTIE 1NTKD 1OXZA 4GODA 1LTSC 1FZAA 1NYHA 1WRGA 2WQYC 1RE4A 1FZEA 3AECC 3H1JD 5AW3B 2W83C 3GHGA 1KYOE 1HVVA 1LGHB 4XA4A 2KSJA 5CCHA 1OW7A 1OW6A 1P84E 1NU1J 2OGUA 2KIKA 2KNCA 3PTZA 3PP5A 2QJKC 4B86A 4ZMDA 3H1IE 3LW5J 4L73A 3HD7B 2BASA 1EZVE 1HUCA 1KQLA 3KQGA 5KAIE 5AVSB 3CX5D 1EDKA 3C1LA 5KJ7C 4W7ZA 3Q5PA 4WB4A 1JUNA 2OTKE 5GTHH 1J1EB 1JM0A 3CL3D 5AW4B 3JCUH 1NTZD 4I1LA 3FX0A 3L73J 2SPZA 3L74J 4WY4D 3HE5A 1K04A 3WMM0 2QJPB 1HBWA 1JMBA 1GL2B 2MJZA 2PAJA 3MP7B 1M7LA 1IFDA 2IYPA 3L72E 4OGQB 4IL6H 1FDOA 3L71D 3FWLA 2HPCB 3TGUD 1Q82Q 1VF5C 5CCHC 1YQ3C 5AVXB 3IR9A 2IZ1A 2FYUD 3L73E 2H89C 3RK3D 2E74D 1K9MQ 3TSIA 3CC2P 1KFMA 1KILC 3GLMA 1SFCD 2M0BA 2UWJE 1SFCC 4A7PA 3RL0B 1DD4A 2O1JA 4W7YA 1NTMK 3Q5SA 1RHZB 2M5AA 3MGNA 1S72P 1KD1Q 1HF9A 5K5GB 3HD7D 2I1KA 2RH0A 2IPPA 2E76D 3H25A 2E76C 3R4YA 1FZCC 2FXPA 2C9LY 1PPJG 3PLNA 5KTBA 2WT7A 3FXEA 2ZYDA 3M91A 3CX5E 4WY4B 3D70A 3EQ2A 1GL2D 2D2CC 3FWNA 1SQXK 1KC8Q 3MTUE 3RK2D 4W80A 4YTPC 4RKUJ 2YNYA 3RL0C 1KZUB 1ZV8A 2RMZA 1VF5D 2J5UA 3P8MC 1YITP 3VYIA 4H13D 1MZ9A 4OGQC 1OX3A 2AEJA 2E74C 2NRGA 3HE4B 3L72G 4NPDA 5APYA 3HRNA 4U3FE 3TNUB 5B5EE 1G2CA 1NTKJ 1SQBD 3AE4C 3CCLP 1SQQE 4I6MC 1J1EC 3L75E 1KQSO 1L0NJ 2WSEH 2G8YA 3O6QA 4M3LA 5CMZA 1TU3F 1JCCA 1SQPE 1AQ5A 1PV3A 3BRTB 4C46A 3H1JG 1S5LE 1EZVG 3H32A 3PRJA 2FFDA 1VQLP 2QJKB 3OW2O 1KILE 3ITKA 1LWUC 1W5CE 1BCCD 1OW8A 2M3EA 1X22A 1GZLA 3WUTA 2KZJA 5AVZB 3CCRP 1NOHA 2A06D 4JPZB 1OVVA 4Z1MH 3SWYA 5CCGA 4H44C 1Q81Q 4H13B 2E42A 4I2LC 2Q7CA 5APTA 3WUUA 5KJ7A 4EYYQ 1VQ6P 1GMJA 1NTME 1KORA 3H1JE 3P32A 1NTZK 4RO0A 1L4AA 5KJ7D 3GMAA 3VOPA 1VQ7P 3C8VA 5AVWB 3USSA 1FZBA 1T8ZA 2ITAA 4TLFA 1K8AQ 1KB9E 1NTKG 2Z4EA 4RESB 1LT9C 1T6AA 4HH2A 2LR2A 3BCCE 1ZR2A 2K1AA 2C9NY 5CBNA 1LNQA 2WVRA 4JYCA 2OYHB 1AA0A 1L0LD 1GW4A 3L74E 4PJ0E 3CCSP 1T2KC 2E75C 3MHVA 4I7ZB 5KLIB 3VP8A 1VQ8P 3JCUE 1FAVA 3GHGB 2KZIA 3MD0A 5GTHE 1NTZE 1KILD 1ZLLA 2BCCJ 2Y0DA 1L0LJ 2YO2A 4NPFX 2YMKA 3H1JJ 2KK7A 1K73Q 1MFZA 1NTMJ 1BCCE 1BE3G 2JWAA 3CWBD 3H1HG 2N1TB 1RQVA 2QE7H 1DD3A 1SS1A 2WZ7A 3E7KA 2E74B 3L72D 4JBZA 3RK3B 1PP9E 1M57D 1LTAC 3H1HD 4GOEA 1M56D 3ABVC 1KQGB 3M9BA 4H0LB 3TYYA 3AE8C 1HJBA 1A02J 2CK3H 4IL6X 1N8RQ 1NTMD 3CWBJ 2A45G 2YIUC 4U7JA 3H1IG 5TISE 4AUWA 1XTGB 4UB8H 5B66H 4ZNCA 4N3YB 2HYNA 1RF0C 2OQQA 1SQPG 3QH9A 1SQPK 4JYBA 3TDKA 4WVZA 4PJ0H 1OZHA 3F5HA 3U59A 2XU6A 1YJ9P 2OYHA 2AXTE 4CPGA 2P67A 1SVFA 3G3ZA 3CCJP 1QLED 2QEXP 1P84H 3L75J 1SQQJ 1KYOH 1EXIA 1EQ7A 2WSCJ 1WMKA 1N7SB 3A7OA 5AW1B 1EDJA 1T3UA 2YIUB 2B87B 1EC5A 2ZXEB 5AVRB 4RJTA 2C0XA 2LKMA 2JWDA 2K9JB 3U1CA 1FOSF 4R4MA 1PGPA 2FFDC 2KSEA 1ZRTE 2V7QJ 2WSFJ 2QSIA 4PV1B 1SQBJ 4UB6E 5AW7B 1T2KD 1YQ4C 1H88A 1SQXD 1JCDA 1LJ2A 3HUSC 3II6A 4U3FD 5CCHD 3G71P 1M90Q 1LT1A 2QJPC 4UB8E 3N4XA 1X9VA 3RK3C 3K5BA 3HTKB 3V6IA 5B66E 1M1KQ 2GM4A 4BXLA 2Y9YA 5C39A 2FY8A 4PV1C 4WBAA 5CCGC 2FYUG 2Q3EA 2QJYC 3H32B 4JF7A 3VMXA 5AVQB 2RN0A 3HD7C 3M0DA 3I55P 3KPEA 2H8PD 3M06A 4JQ0D 1NTZG 1NTZJ 1L4AD 1IFIA 1X0TA 5AVYB 3RBZA 2KLVA 1BE3E 3V2RA 5KLVK 2WTYA 2ZYAA 1URQB 1VQ4P 2B88A 4IFMA 1N86A 5BVZA 3D71A 4D6TG 1DIPA 2KXPB 2PRRA 5AW6B 4U3FG 1Q7YQ 2XKMA 2R44A 1H8AA 1FOSE 1M8OB 1NU1D 1SQVG 1IFPA 1S4XA 1YTZI 2K9YA 3GF3A 3AE6C 1S2EA 4GKGA 4H13C 4KT0J 2P1JA 3LIEA 3P8CD 4H44B 4LGDE 1KILA 4N78E 4OVNF 3KHUA 2QIWA 4K35A 3TGUJ 2ZXXA 1VQNP 3CD6P 2J59M 4KJMA 4LLHA 2WPSA 5E79E 2WT7B 1FU1A 3CMAP 1QX8A 4GT1A 4ZKUA 4KHXA 1JTHA 3I5CA 2YXQB 3HD7A 3M0DC 1Y47A 1PPJD 1LWUB 1IFJA 1PGOA 1QEXA 4R4LA 1M1JC 2CPBA 5CJ0A 2AEFA 1VQOP 2KUBA 3EFGA 3EWKA 5KAFH 1FZGA 5H2FH 1YTZT 5APQA 1USEA 3AEAC 4GOFA 2IFNA 2QJYB 2R3SA 4PD4E 1OVUA 1SQVD 2Q9IA 3V4QA 3L36A 2ZT9B 4H0LD 1CZQA 2OYHC 1S5LH 2IBZE 5CHXA 1VQMP 3CCVP 2JKVA 2PFXA 2YKOA 2A45H 3CX5I 1BCCG 2KS1B 2Z5HA 3H1HE 1D7MA 2P58A 5KAIH 1NJIQ 1DX7A 1EDLA 1WT6A 1K05A 3B5NB 1MFTA 1NTKE 2CPSA 3QWOC 2I1JA 2NPSD 3PJSK 2JJLA 3AE5C 1SQQG 1NO4A 3HTKA 3L74G 1P84D 3FXDA 3H1HJ 3SFEC 1OFCX 4WY4C 1M1JA 3RBXA 3SSUA 1IFNA 2FXOA 1N2DC 2QM8A 1QVFO 2ZYGA 1G1IA 1JO5A 3C9IA 3V2NA 2JP3A 3H1ID 2WSEJ 3B5NA 1SQBK 1BE3J 3L75D 3RGUA 1VQ5P 2Y0CA 2JO1A 2C0WA 1P84I 3CXHH 2R5BA 2OTJP 1LTJB 3BATA 1N7SA 3T97B 1KQFB 3UIAA 1OVRA 3H6PA 4PV1D 1VDFA 1LTIC 1R5SA 4GIFA 1GW3A 3V4WA 4C7NB 2QA4P 1NTKK 2JEEA 1GU5A 2OARA 5GTIH 1JY2P 3B71A 3V2QA 3KYQA 1L0NK 2IBZD 2IZ0A 2Q3IA 2WWWA 3VMZA 1RY3A 4YXDC 3H1IJ 3MIWA 1ZN5A 2A06E 1GK4A 1L4AC 3TGUE 3U1AA 1VL2A 3AE7C 4DCKA 5CBOA 3IAOA 1EXJA 1N73C 3O8ZA 4WY4A 2W6AA 3AE1C 5E79H 3HUSB 1LTTC 1L4AB 2XNXA 3L70J 2FYUK 2FFDB 3CI9A 4HYTB 1USDA 1URQD 3RL0D 3NMDA 2Q1KA 3KZIE 2E75B 5KLIC 2KS1A 1Y8AA 1N7SC 3MUDA 2R5DA 3HE5B 1BE3D 2N1TA 4Y99C 5APSA 5TJHA 3L4FA 3KDPB 1GU4A 1CW5A 1E79H 4AQRD 2IBZG 1FZCB 2L91A 1G2CB 1LP1B 1RE3C 2E5TA 1NAYA 1DEEG 1L0ND 2O01N 2V7QH 2WSFH 1IK7A 3GW6A 4K3AA 4BRYA 5DJUB 4C7RA 4HKZH 1RH5B 2A45I 1E5WA 1AQTA 3CWBE 4O9BA 2KP8A 3WU2E 1JY3N 4OH8B 3P8CE 2K9JA 2MKVA 4N78D 1LWUA 2GUVA 1IC2A 4DJGA 1JTHB 1OWAA 1PIXA 3MZWB 1PP9J 5KLVE 3E1RA 2Z5IA 5KKZB 2OTLP 2XDJA 3AE9C 2HR3A 1S9KD 3AE2C 2OYIA 4H0LC 1SQXG 1S3JA 1SQXJ 2W6JH 3HE4A 3CCMP 1DH3A 1G1JA 2HFED 3MUDC 2YMYA 4IFFA 1NVOA 2LXBA 2N1TC 3H1LJ 3SFDC 2ZT9D 2PGDA 2KLUA 2B89A 2ZT9C 3AEBC 3P7KA 5L8RJ 2B87A 1JMMA 2YKQA 3SWFA 1JOCA 3A0HH 1EDIA 1SQVE 2NPSC 1YI2P 3L75G 1JY3O 1EZVD 1BGYE 1LP1A 3BCCJ 1LT9A 3GG2A 4I7ZC 1Q90D 1FDMA 3W67A 1KFNA 1W2EA 1HGVA 1N7LA 1OIPA 2P2UA 3L71G 3N7NA 1VQPP 4DT0A 1ZR4A 1RQUA 1BDCA 2L5GB 2AEMA 1CSBA 2JDIH 4L74A 4MN4C 1N7SD 2QG4A 2M3BA 1H89A 1AJYA 3BCCG 2IX7C 1NU1G 1S9KE 1SQQK 3OA7A 1NKNA 2FYUE 3L73D 5CCGD 3BCCD 3H1KE 4EDFA 3ZDMA 2W27A 2WPVB 3LIDA 3OAKA 2O01J 3R2PA 1L0LE 3L74D 4IL6E 2BCCE 3F89A 3L73G 2E76B 2IFMA 1ZW0A 5EFWB 3WU2H 1N73A 1NGMB 2BEZF 2QRXA 3V5BA 2JR8A 2RKLA 2O3JA 2W8ZA 5BU5A 4C7NA 3CPWO 3CMEP 1RF0A 2I8DA 2OYIB 3KXDA 4Y99B 3G6EP 1NU1K 4PD4H 1KILB 3S1KA 3M9QA 3RL0g 1FS0E 2GA1A 4XFJA 5M1BA 1PP9D 2FXMA 1GTWA 1YBKA 3VP9A 5KAFE 3D6YA 1U57A 2ZFCA 1VF5B 3AEGC 2N1TD 3L70D 3VMAA 4EIJA 1N73B 2FBWC 1J1DC 1JEKA 1VQ9P 1FBMA 1SQBG 4D6TJ 3CC4P 1IZNB 3M9HA 1KB9I 1YJWP 1KYOD 1JY3P 4LC1A 3A5TA 1R8EA 3CCQP 2E5YA 1PZQA 4HB1A 5KLVJ 2GUSA 1BDDA 2ZJSE 2V4HA 2P7JA 5AVTB 2R3CA 4BWNA 3D6ZA 1VQKP 1SQQD 3H1KD 2HLOA 4QMAA 3CC7P 2WPRA 1PPJE 3PH0A 2WSCH 1SQPD 5DJTB 1QGKB 1HGZA 1FE6A 3SWKA 1BCCJ 2H7HA 5AVVB 1IFMA 4OGQD 1NH4A 1YIJP 1UIXA 4PD4D 1SQPJ 2YO3A 3AEEC 4PD4I 3Q3DA 1FZFA 2FKWB 1BSNA 2WMMA 4D6TE 1ZP0C 4L75A 1ZRTD 5AW5B 2HPCA 3B8EB 1L0NG 1CI6B 3CLQA 5AW0B 1IO4A 1QL1A 1SFCB 1AVYA 2NPSA 3L70E 1GD2E 2R32A 3AE3C 3LW5H 4XE5B 3RK3E 3CCEP 1KTMA 3L72J 2Q5UA 2WSSH 4EOTA 2E43A
chains in the Genus database with same CATH topology
2OQQA 1OW7A 1KMIZ 1OW6A 2QJKC 2E75B 5KLIC 3LW5J 3FGAD 1FDIA 1OMIA 3Q5PA 2WSCJ 4IL6X 1WMKA 1IK7A 1S5LX 1K04A 5KKZC 2FYNC 4OGQB 4R4MA 2MKVA 2WSFJ 2V7QJ 1ZRTE 2G3AA 1FDOA 2QSIA 4PV1B 3AEFC 1YQ4C 1PIXA 1VF5C 1YQ3C 2QJPC 2H89C 2E74D 3AE9C 3AE2C 2P10A 4H0LC 3GLMA 4PV1C 3Q1MA 1DD4A 2QJYC 3GF7A 3Q5SA 1HF9A 3SFDC 2ZT9D 3AEBC 2ZT9C 1ZOYC 5L8RJ 2E76D 3H25A 2E76C 3R4YA 2FXPA 3D71A 4I7ZC 1Q90D 3AECC 1DIPA 3D70A 4Y28J 2D2CC 3S9OA 4YTPC 4RKUJ 1RQUA 2K9YA 4KT0J 3GF3A 1VF5D 2J5UA 3AE6C 4H13C 1AJYA 4H13D 4H44B 4OGQC 2E74C 3Q2YA 2QIWA 3AE4C 3O6QA 2G8YA 2WPVB 1TU3F 2O01J 4R4LA 1PV3A 2D2CB 2E76B 1MKMA 3EWKA 1NGMB 2BEZF 3Q5RA 3AEAC 1KILE 4H0LD 2ZT9B 1OW8A 3RL0g 4XFJA 5M1BA 3D6YA 1U57A 4Z1MH 1VF5B 3AEGC 4H44C 4H13B 1K05A 2FBWC 4H44D 3G9RA 1GMJA 1KORA 2H88C 2IDBA 3AE5C 3GMAA 1R8EA 3C8VA 3IN6A 3SFEC 1ZMEC 3D6ZA 1PL5A 2BEQD 2D2CD 2JP3A 1S1CX 2WSEJ 4GDOA 2JO1A 3AEDC 2E75C 4I7ZB 2E75D 1HJ0A 4OGQD 1KQFB 1Y9BA 3T97B 1UIXA 4PV1D 4TT3H 2YMKA 3AEEC 3AE1C 3Q3DA 1JB0J 2NZ2A 1RQVA 1ZP0C 1DD3A 3B71A 2E74B 4YXDC 1EXIA 3ABVC 1KQGB 4H0LB 1VL2A 3AE7C 3AE3C 3RK3E 3AE8C 1EXJA 3IAOA 1KTMA 2WQYC 1NYHA 4U7JA 2YIUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV B;  2O01 J;  2QJY C;  2WSE J;  2QJK C;  2D2C B;  2E76 B;  2E75 B;  5KLI C;  3LW5 J;  5L8R J;  4I7Z B;  2WSC J;  4IL6 X;  1Q90 D;  2ZT9 B;  1S5L X;  4Y28 J;  1JB0 J;  5KKZ C;  2E74 B;  2FYN C;  1VF5 B;  4OGQ B;  4RKU J;  1ZRT E;  2K9Y A;  2WSF J;  2QSI A;  4H13 B;  4KT0 J;  4PV1 B;  4H0L B;  4H44 B;  2QJP C;  2QIW A;  3C8V A;  2YIU C; 
#chains in the Genus database with same CATH topology
 1YJN P;  1FJP A;  3T97 A;  3B5N D;  3IF4 A;  3TNU A;  3B5N C;  1L0L G;  1L0L K;  1KMI Z;  3TGU G;  1KYO I;  1MUU A;  1KB9 D;  1RF1 C;  1SFC A;  2NPS B;  1PGJ A;  2M8R A;  1PGQ A;  2AXC A;  3NTN A;  1AFO A;  3FGA D;  2N9Y B;  1Q86 Q;  3CCU P;  2Y0E A;  2K37 A;  1BGY D;  1KB9 H;  3RK2 B;  1FDI A;  1M1J B;  1OMI A;  1UII A;  1AVO A;  3VTP C;  1QL2 A;  1A02 F;  1FZC A;  1SP4 A;  2O1K A;  1S5L X;  3A0H E;  5BU8 B;  3CXH E;  3H1L D;  1X8Y A;  5KKZ C;  1SLQ A;  3IFM A;  1FJK A;  1X79 B;  2FYN C;  2J58 A;  2WPQ A;  4D6T D;  1GL2 A;  2G3A A;  3S4R A;  3TK1 A;  5APW A;  3AEF C;  1MV8 A;  1KN7 A;  1PP9 G;  1YHQ P;  4EI2 A;  3L70 G;  5TIS H;  2P10 A;  1PFI A;  1SQV J;  4DOJ A;  5AW9 B;  1NKZ B;  5AVU B;  1HTL C;  3Q1M A;  1URQ C;  3V2P A;  3A2A A;  3NFQ A;  1R5L A;  3GF7 A;  1DEB A;  1RF1 A;  2KNC B;  3VMY A;  1ZOY C;  2OYO A;  1ZXG A;  3W68 A;  4ZKP A;  2VRS A;  1L2P A;  4YPC A;  1RE3 A;  1JY2 O;  5AW8 B;  1LTB C;  1NAF A;  2KI7 B;  4YXW H;  1IJD B;  1J2J B;  5B5E H;  4AYC A;  4Y28 J;  3NXS A;  1EZV I;  3S9O A;  1SQV K;  5AW2 B;  4U3F J;  2FYU J;  3VN0 A;  2KYV A;  1CI6 A;  2K3R A;  2M5A B;  5APV A;  2H43 A;  2LXC B;  3WUV A;  3L71 E;  4BRY B;  3G4S P;  4N6J A;  3JSV C;  3Q2Y A;  1NHL A;  2XND H;  3BVH A;  1FC2 C;  1T3J A;  4ASV A;  5CJ4 A;  1IK9 A;  1U7J A;  1YYC A;  2B9B A;  2DW3 A;  2PP6 A;  2Q6Q A;  3A0B H;  5H2F E;  4UB6 H;  1LTJ C;  1U7M A;  2IYO A;  2XV5 A;  2D2C B;  2ZAE B;  1XTC C;  2W90 A;  1BGY J;  1MKM A;  4DZO A;  1NWQ A;  1KV4 A;  1QVG O;  3JC2 2;  3Q5R A;  3H1K G;  2FYZ A;  3H1L G;  1HWT C;  4HJG H;  1HH0 A;  1BSH A;  2N9B A;  3HUS A;  3PHL A;  2A06 G;  2KB7 P;  2BCC G;  1GK6 A;  3E1I A;  2K88 A;  3H1K J;  3L71 J;  1H0T B;  4H44 D;  2HOD A;  2HG5 D;  3G9R A;  3CXH I;  3L35 A;  2ZVN B;  3OJA B;  1NU1 E;  3BRV B;  3CWB G;  2FYN B;  2H88 C;  2IDB A;  4L76 A;  1JNM A;  2ZVO B;  4IFD K;  1LTG C;  3A3Y B;  3L37 A;  2QM7 A;  3IN6 A;  5KLV G;  1ZME C;  1J1D B;  1LTJ A;  3BAS A;  1SQB E;  3EFF K;  1RE4 C;  2QVA A;  1PL5 A;  5APX A;  1GL2 C;  2BEQ D;  2D2C D;  2O01 H;  2POH A;  2XZR A;  1S1C X;  3GHG C;  2HOD B;  4GDO A;  3KZI H;  3RK2 C;  1RF1 B;  5APU A;  2BCC D;  3AED C;  2E75 D;  2OYI C;  2YKP A;  1AV1 A;  1HJ0 A;  2IBZ I;  4NPE A;  1L0N E;  3I56 P;  1Y9B A;  3CX5 H;  1LT9 B;  4ASW A;  1URQ A;  3B4S A;  1Q2N A;  4TT3 H;  3CXH D;  3H1L E;  1BGY G;  2WIT A;  2Y9Z A;  1GDT A;  1JB0 J;  2YXR B;  2NZ2 A;  3TF5 A;  1JY2 N;  1VPC A;  1Z56 A;  4IOI H;  2AXT H;  4WWI A;  2KOG A;  1SQX E;  5KLV D;  4OWF A;  1NTM G;  3A0B E;  1W2B O;  3M0A A;  1H0T A;  2W6B A;  3O6Q B;  5GTI E;  1NTK D;  1OXZ A;  4GOD A;  1LTS C;  1FZA A;  1NYH A;  1WRG A;  2WQY C;  1RE4 A;  1FZE A;  3AEC C;  3H1J D;  5AW3 B;  2W83 C;  3GHG A;  1KYO E;  1HVV A;  1LGH B;  4XA4 A;  2KSJ A;  5CCH A;  1OW7 A;  1OW6 A;  1P84 E;  1NU1 J;  2OGU A;  2KIK A;  2KNC A;  3PTZ A;  3PP5 A;  2QJK C;  4B86 A;  4ZMD A;  3H1I E;  3LW5 J;  4L73 A;  3HD7 B;  2BAS A;  1EZV E;  1HUC A;  1KQL A;  3KQG A;  5KAI E;  5AVS B;  3CX5 D;  1EDK A;  3C1L A;  5KJ7 C;  4W7Z A;  3Q5P A;  4WB4 A;  1JUN A;  2OTK E;  5GTH H;  1J1E B;  1JM0 A;  3CL3 D;  5AW4 B;  3JCU H;  1NTZ D;  4I1L A;  3FX0 A;  3L73 J;  2SPZ A;  3L74 J;  4WY4 D;  3HE5 A;  1K04 A;  3WMM 0;  2QJP B;  1HBW A;  1JMB A;  1GL2 B;  2MJZ A;  2PAJ A;  3MP7 B;  1M7L A;  1IFD A;  2IYP A;  3L72 E;  4OGQ B;  4IL6 H;  1FDO A;  3L71 D;  3FWL A;  2HPC B;  3TGU D;  1Q82 Q;  1VF5 C;  5CCH C;  1YQ3 C;  5AVX B;  3IR9 A;  2IZ1 A;  2FYU D;  3L73 E;  2H89 C;  3RK3 D;  2E74 D;  1K9M Q;  3TSI A;  3CC2 P;  1KFM A;  1KIL C;  3GLM A;  1SFC D;  2M0B A;  2UWJ E;  1SFC C;  4A7P A;  3RL0 B;  1DD4 A;  2O1J A;  4W7Y A;  1NTM K;  3Q5S A;  1RHZ B;  2M5A A;  3MGN A;  1S72 P;  1KD1 Q;  1HF9 A;  5K5G B;  3HD7 D;  2I1K A;  2RH0 A;  2IPP A;  2E76 D;  3H25 A;  2E76 C;  3R4Y A;  1FZC C;  2FXP A;  2C9L Y;  1PPJ G;  3PLN A;  5KTB A;  2WT7 A;  3FXE A;  2ZYD A;  3M91 A;  3CX5 E;  4WY4 B;  3D70 A;  3EQ2 A;  1GL2 D;  2D2C C;  3FWN A;  1SQX K;  1KC8 Q;  3MTU E;  3RK2 D;  4W80 A;  4YTP C;  4RKU J;  2YNY A;  3RL0 C;  1KZU B;  1ZV8 A;  2RMZ A;  1VF5 D;  2J5U A;  3P8M C;  1YIT P;  3VYI A;  4H13 D;  1MZ9 A;  4OGQ C;  1OX3 A;  2AEJ A;  2E74 C;  2NRG A;  3HE4 B;  3L72 G;  4NPD A;  5APY A;  3HRN A;  4U3F E;  3TNU B;  5B5E E;  1G2C A;  1NTK J;  1SQB D;  3AE4 C;  3CCL P;  1SQQ E;  4I6M C;  1J1E C;  3L75 E;  1KQS O;  1L0N J;  2WSE H;  2G8Y A;  3O6Q A;  4M3L A;  5CMZ A;  1TU3 F;  1JCC A;  1SQP E;  1AQ5 A;  1PV3 A;  3BRT B;  4C46 A;  3H1J G;  1S5L E;  1EZV G;  3H32 A;  3PRJ A;  2FFD A;  1VQL P;  2QJK B;  3OW2 O;  1KIL E;  3ITK A;  1LWU C;  1W5C E;  1BCC D;  1OW8 A;  2M3E A;  1X22 A;  1GZL A;  3WUT A;  2KZJ A;  5AVZ B;  3CCR P;  1NOH A;  2A06 D;  4JPZ B;  1OVV A;  4Z1M H;  3SWY A;  5CCG A;  4H44 C;  1Q81 Q;  4H13 B;  2E42 A;  4I2L C;  2Q7C A;  5APT A;  3WUU A;  5KJ7 A;  4EYY Q;  1VQ6 P;  1GMJ A;  1NTM E;  1KOR A;  3H1J E;  3P32 A;  1NTZ K;  4RO0 A;  1L4A A;  5KJ7 D;  3GMA A;  3VOP A;  1VQ7 P;  3C8V A;  5AVW B;  3USS A;  1FZB A;  1T8Z A;  2ITA A;  4TLF A;  1K8A Q;  1KB9 E;  1NTK G;  2Z4E A;  4RES B;  1LT9 C;  1T6A A;  4HH2 A;  2LR2 A;  3BCC E;  1ZR2 A;  2K1A A;  2C9N Y;  5CBN A;  1LNQ A;  2WVR A;  4JYC A;  2OYH B;  1AA0 A;  1L0L D;  1GW4 A;  3L74 E;  4PJ0 E;  3CCS P;  1T2K C;  2E75 C;  3MHV A;  4I7Z B;  5KLI B;  3VP8 A;  1VQ8 P;  3JCU E;  1FAV A;  3GHG B;  2KZI A;  3MD0 A;  5GTH E;  1NTZ E;  1KIL D;  1ZLL A;  2BCC J;  2Y0D A;  1L0L J;  2YO2 A;  4NPF X;  2YMK A;  3H1J J;  2KK7 A;  1K73 Q;  1MFZ A;  1NTM J;  1BCC E;  1BE3 G;  2JWA A;  3CWB D;  3H1H G;  2N1T B;  1RQV A;  2QE7 H;  1DD3 A;  1SS1 A;  2WZ7 A;  3E7K A;  2E74 B;  3L72 D;  4JBZ A;  3RK3 B;  1PP9 E;  1M57 D;  1LTA C;  3H1H D;  4GOE A;  1M56 D;  3ABV C;  1KQG B;  3M9B A;  4H0L B;  3TYY A;  3AE8 C;  1HJB A;  1A02 J;  2CK3 H;  4IL6 X;  1N8R Q;  1NTM D;  3CWB J;  2A45 G;  2YIU C;  4U7J A;  3H1I G;  5TIS E;  4AUW A;  1XTG B;  4UB8 H;  5B66 H;  4ZNC A;  4N3Y B;  2HYN A;  1RF0 C;  2OQQ A;  1SQP G;  3QH9 A;  1SQP K;  4JYB A;  3TDK A;  4WVZ A;  4PJ0 H;  1OZH A;  3F5H A;  3U59 A;  2XU6 A;  1YJ9 P;  2OYH A;  2AXT E;  4CPG A;  2P67 A;  1SVF A;  3G3Z A;  3CCJ P;  1QLE D;  2QEX P;  1P84 H;  3L75 J;  1SQQ J;  1KYO H;  1EXI A;  1EQ7 A;  2WSC J;  1WMK A;  1N7S B;  3A7O A;  5AW1 B;  1EDJ A;  1T3U A;  2YIU B;  2B87 B;  1EC5 A;  2ZXE B;  5AVR B;  4RJT A;  2C0X A;  2LKM A;  2JWD A;  2K9J B;  3U1C A;  1FOS F;  4R4M A;  1PGP A;  2FFD C;  2KSE A;  1ZRT E;  2V7Q J;  2WSF J;  2QSI A;  4PV1 B;  1SQB J;  4UB6 E;  5AW7 B;  1T2K D;  1YQ4 C;  1H88 A;  1SQX D;  1JCD A;  1LJ2 A;  3HUS C;  3II6 A;  4U3F D;  5CCH D;  3G71 P;  1M90 Q;  1LT1 A;  2QJP C;  4UB8 E;  3N4X A;  1X9V A;  3RK3 C;  3K5B A;  3HTK B;  3V6I A;  5B66 E;  1M1K Q;  2GM4 A;  4BXL A;  2Y9Y A;  5C39 A;  2FY8 A;  4PV1 C;  4WBA A;  5CCG C;  2FYU G;  2Q3E A;  2QJY C;  3H32 B;  4JF7 A;  3VMX A;  5AVQ B;  2RN0 A;  3HD7 C;  3M0D A;  3I55 P;  3KPE A;  2H8P D;  3M06 A;  4JQ0 D;  1NTZ G;  1NTZ J;  1L4A D;  1IFI A;  1X0T A;  5AVY B;  3RBZ A;  2KLV A;  1BE3 E;  3V2R A;  5KLV K;  2WTY A;  2ZYA A;  1URQ B;  1VQ4 P;  2B88 A;  4IFM A;  1N86 A;  5BVZ A;  3D71 A;  4D6T G;  1DIP A;  2KXP B;  2PRR A;  5AW6 B;  4U3F G;  1Q7Y Q;  2XKM A;  2R44 A;  1H8A A;  1FOS E;  1M8O B;  1NU1 D;  1SQV G;  1IFP A;  1S4X A;  1YTZ I;  2K9Y A;  3GF3 A;  3AE6 C;  1S2E A;  4GKG A;  4H13 C;  4KT0 J;  2P1J A;  3LIE A;  3P8C D;  4H44 B;  4LGD E;  1KIL A;  4N78 E;  4OVN F;  3KHU A;  2QIW A;  4K35 A;  3TGU J;  2ZXX A;  1VQN P;  3CD6 P;  2J59 M;  4KJM A;  4LLH A;  2WPS A;  5E79 E;  2WT7 B;  1FU1 A;  3CMA P;  1QX8 A;  4GT1 A;  4ZKU A;  4KHX A;  1JTH A;  3I5C A;  2YXQ B;  3HD7 A;  3M0D C;  1Y47 A;  1PPJ D;  1LWU B;  1IFJ A;  1PGO A;  1QEX A;  4R4L A;  1M1J C;  2CPB A;  5CJ0 A;  2AEF A;  1VQO P;  2KUB A;  3EFG A;  3EWK A;  5KAF H;  1FZG A;  5H2F H;  1YTZ T;  5APQ A;  1USE A;  3AEA C;  4GOF A;  2IFN A;  2QJY B;  2R3S A;  4PD4 E;  1OVU A;  1SQV D;  2Q9I A;  3V4Q A;  3L36 A;  2ZT9 B;  4H0L D;  1CZQ A;  2OYH C;  1S5L H;  2IBZ E;  5CHX A;  1VQM P;  3CCV P;  2JKV A;  2PFX A;  2YKO A;  2A45 H;  3CX5 I;  1BCC G;  2KS1 B;  2Z5H A;  3H1H E;  1D7M A;  2P58 A;  5KAI H;  1NJI Q;  1DX7 A;  1EDL A;  1WT6 A;  1K05 A;  3B5N B;  1MFT A;  1NTK E;  2CPS A;  3QWO C;  2I1J A;  2NPS D;  3PJS K;  2JJL A;  3AE5 C;  1SQQ G;  1NO4 A;  3HTK A;  3L74 G;  1P84 D;  3FXD A;  3H1H J;  3SFE C;  1OFC X;  4WY4 C;  1M1J A;  3RBX A;  3SSU A;  1IFN A;  2FXO A;  1N2D C;  2QM8 A;  1QVF O;  2ZYG A;  1G1I A;  1JO5 A;  3C9I A;  3V2N A;  2JP3 A;  3H1I D;  2WSE J;  3B5N A;  1SQB K;  1BE3 J;  3L75 D;  3RGU A;  1VQ5 P;  2Y0C A;  2JO1 A;  2C0W A;  1P84 I;  3CXH H;  2R5B A;  2OTJ P;  1LTJ B;  3BAT A;  1N7S A;  3T97 B;  1KQF B;  3UIA A;  1OVR A;  3H6P A;  4PV1 D;  1VDF A;  1LTI C;  1R5S A;  4GIF A;  1GW3 A;  3V4W A;  4C7N B;  2QA4 P;  1NTK K;  2JEE A;  1GU5 A;  2OAR A;  5GTI H;  1JY2 P;  3B71 A;  3V2Q A;  3KYQ A;  1L0N K;  2IBZ D;  2IZ0 A;  2Q3I A;  2WWW A;  3VMZ A;  1RY3 A;  4YXD C;  3H1I J;  3MIW A;  1ZN5 A;  2A06 E;  1GK4 A;  1L4A C;  3TGU E;  3U1A A;  1VL2 A;  3AE7 C;  4DCK A;  5CBO A;  3IAO A;  1EXJ A;  1N73 C;  3O8Z A;  4WY4 A;  2W6A A;  3AE1 C;  5E79 H;  3HUS B;  1LTT C;  1L4A B;  2XNX A;  3L70 J;  2FYU K;  2FFD B;  3CI9 A;  4HYT B;  1USD A;  1URQ D;  3RL0 D;  3NMD A;  2Q1K A;  3KZI E;  2E75 B;  5KLI C;  2KS1 A;  1Y8A A;  1N7S C;  3MUD A;  2R5D A;  3HE5 B;  1BE3 D;  2N1T A;  4Y99 C;  5APS A;  5TJH A;  3L4F A;  3KDP B;  1GU4 A;  1CW5 A;  1E79 H;  4AQR D;  2IBZ G;  1FZC B;  2L91 A;  1G2C B;  1LP1 B;  1RE3 C;  2E5T A;  1NAY A;  1DEE G;  1L0N D;  2O01 N;  2V7Q H;  2WSF H;  1IK7 A;  3GW6 A;  4K3A A;  4BRY A;  5DJU B;  4C7R A;  4HKZ H;  1RH5 B;  2A45 I;  1E5W A;  1AQT A;  3CWB E;  4O9B A;  2KP8 A;  3WU2 E;  1JY3 N;  4OH8 B;  3P8C E;  2K9J A;  2MKV A;  4N78 D;  1LWU A;  2GUV A;  1IC2 A;  4DJG A;  1JTH B;  1OWA A;  1PIX A;  3MZW B;  1PP9 J;  5KLV E;  3E1R A;  2Z5I A;  5KKZ B;  2OTL P;  2XDJ A;  3AE9 C;  2HR3 A;  1S9K D;  3AE2 C;  2OYI A;  4H0L C;  1SQX G;  1S3J A;  1SQX J;  2W6J H;  3HE4 A;  3CCM P;  1DH3 A;  1G1J A;  2HFE D;  3MUD C;  2YMY A;  4IFF A;  1NVO A;  2LXB A;  2N1T C;  3H1L J;  3SFD C;  2ZT9 D;  2PGD A;  2KLU A;  2B89 A;  2ZT9 C;  3AEB C;  3P7K A;  5L8R J;  2B87 A;  1JMM A;  2YKQ A;  3SWF A;  1JOC A;  3A0H H;  1EDI A;  1SQV E;  2NPS C;  1YI2 P;  3L75 G;  1JY3 O;  1EZV D;  1BGY E;  1LP1 A;  3BCC J;  1LT9 A;  3GG2 A;  4I7Z C;  1Q90 D;  1FDM A;  3W67 A;  1KFN A;  1W2E A;  1HGV A;  1N7L A;  1OIP A;  2P2U A;  3L71 G;  3N7N A;  1VQP P;  4DT0 A;  1ZR4 A;  1RQU A;  1BDC A;  2L5G B;  2AEM A;  1CSB A;  2JDI H;  4L74 A;  4MN4 C;  1N7S D;  2QG4 A;  2M3B A;  1H89 A;  1AJY A;  3BCC G;  2IX7 C;  1NU1 G;  1S9K E;  1SQQ K;  3OA7 A;  1NKN A;  2FYU E;  3L73 D;  5CCG D;  3BCC D;  3H1K E;  4EDF A;  3ZDM A;  2W27 A;  2WPV B;  3LID A;  3OAK A;  2O01 J;  3R2P A;  1L0L E;  3L74 D;  4IL6 E;  2BCC E;  3F89 A;  3L73 G;  2E76 B;  2IFM A;  1ZW0 A;  5EFW B;  3WU2 H;  1N73 A;  1NGM B;  2BEZ F;  2QRX A;  3V5B A;  2JR8 A;  2RKL A;  2O3J A;  2W8Z A;  5BU5 A;  4C7N A;  3CPW O;  3CME P;  1RF0 A;  2I8D A;  2OYI B;  3KXD A;  4Y99 B;  3G6E P;  1NU1 K;  4PD4 H;  1KIL B;  3S1K A;  3M9Q A;  3RL0 g;  1FS0 E;  2GA1 A;  4XFJ A;  5M1B A;  1PP9 D;  2FXM A;  1GTW A;  1YBK A;  3VP9 A;  5KAF E;  3D6Y A;  1U57 A;  2ZFC A;  1VF5 B;  3AEG C;  2N1T D;  3L70 D;  3VMA A;  4EIJ A;  1N73 B;  2FBW C;  1J1D C;  1JEK A;  1VQ9 P;  1FBM A;  1SQB G;  4D6T J;  3CC4 P;  1IZN B;  3M9H A;  1KB9 I;  1YJW P;  1KYO D;  1JY3 P;  4LC1 A;  3A5T A;  1R8E A;  3CCQ P;  2E5Y A;  1PZQ A;  4HB1 A;  5KLV J;  2GUS A;  1BDD A;  2ZJS E;  2V4H A;  2P7J A;  5AVT B;  2R3C A;  4BWN A;  3D6Z A;  1VQK P;  1SQQ D;  3H1K D;  2HLO A;  4QMA A;  3CC7 P;  2WPR A;  1PPJ E;  3PH0 A;  2WSC H;  1SQP D;  5DJT B;  1QGK B;  1HGZ A;  1FE6 A;  3SWK A;  1BCC J;  2H7H A;  5AVV B;  1IFM A;  4OGQ D;  1NH4 A;  1YIJ P;  1UIX A;  4PD4 D;  1SQP J;  2YO3 A;  3AEE C;  4PD4 I;  3Q3D A;  1FZF A;  2FKW B;  1BSN A;  2WMM A;  4D6T E;  1ZP0 C;  4L75 A;  1ZRT D;  5AW5 B;  2HPC A;  3B8E B;  1L0N G;  1CI6 B;  3CLQ A;  5AW0 B;  1IO4 A;  1QL1 A;  1SFC B;  1AVY A;  2NPS A;  3L70 E;  1GD2 E;  2R32 A;  3AE3 C;  3LW5 H;  4XE5 B;  3RK3 E;  3CCE P;  1KTM A;  3L72 J;  2Q5U A;  2WSS H;  4EOT A;  2E43 A; 
#chains in the Genus database with same CATH homology
 2OQQ A;  1OW7 A;  1KMI Z;  1OW6 A;  2QJK C;  2E75 B;  5KLI C;  3LW5 J;  3FGA D;  1FDI A;  1OMI A;  3Q5P A;  2WSC J;  4IL6 X;  1WMK A;  1IK7 A;  1S5L X;  1K04 A;  5KKZ C;  2FYN C;  4OGQ B;  4R4M A;  2MKV A;  2WSF J;  2V7Q J;  1ZRT E;  2G3A A;  1FDO A;  2QSI A;  4PV1 B;  3AEF C;  1YQ4 C;  1PIX A;  1VF5 C;  1YQ3 C;  2QJP C;  2H89 C;  2E74 D;  3AE9 C;  3AE2 C;  2P10 A;  4H0L C;  3GLM A;  4PV1 C;  3Q1M A;  1DD4 A;  2QJY C;  3GF7 A;  3Q5S A;  1HF9 A;  3SFD C;  2ZT9 D;  3AEB C;  2ZT9 C;  1ZOY C;  5L8R J;  2E76 D;  3H25 A;  2E76 C;  3R4Y A;  2FXP A;  3D71 A;  4I7Z C;  1Q90 D;  3AEC C;  1DIP A;  3D70 A;  4Y28 J;  2D2C C;  3S9O A;  4YTP C;  4RKU J;  1RQU A;  2K9Y A;  4KT0 J;  3GF3 A;  1VF5 D;  2J5U A;  3AE6 C;  4H13 C;  1AJY A;  4H13 D;  4H44 B;  4OGQ C;  2E74 C;  3Q2Y A;  2QIW A;  3AE4 C;  3O6Q A;  2G8Y A;  2WPV B;  1TU3 F;  2O01 J;  4R4L A;  1PV3 A;  2D2C B;  2E76 B;  1MKM A;  3EWK A;  1NGM B;  2BEZ F;  3Q5R A;  3AEA C;  1KIL E;  4H0L D;  2ZT9 B;  1OW8 A;  3RL0 g;  4XFJ A;  5M1B A;  3D6Y A;  1U57 A;  4Z1M H;  1VF5 B;  3AEG C;  4H44 C;  4H13 B;  1K05 A;  2FBW C;  4H44 D;  3G9R A;  1GMJ A;  1KOR A;  2H88 C;  2IDB A;  3AE5 C;  3GMA A;  1R8E A;  3C8V A;  3IN6 A;  3SFE C;  1ZME C;  3D6Z A;  1PL5 A;  2BEQ D;  2D2C D;  2JP3 A;  1S1C X;  2WSE J;  4GDO A;  2JO1 A;  3AED C;  2E75 C;  4I7Z B;  2E75 D;  1HJ0 A;  4OGQ D;  1KQF B;  1Y9B A;  3T97 B;  1UIX A;  4PV1 D;  4TT3 H;  2YMK A;  3AEE C;  3AE1 C;  3Q3D A;  1JB0 J;  2NZ2 A;  1RQV A;  1ZP0 C;  1DD3 A;  3B71 A;  2E74 B;  4YXD C;  1EXI A;  3ABV C;  1KQG B;  4H0L B;  1VL2 A;  3AE7 C;  3AE3 C;  3RK3 E;  3AE8 C;  1EXJ A;  3IAO A;  1KTM A;  2WQY C;  1NYH A;  4U7J A;  2YIU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...