2WSFJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
b'MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
molecule tags Photosynthesis
publication title Structure determination and improved model of plant photosystem I.
pubmed doi rcsb
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wsfJ00
4H13B 1VF5B 2WSEJ 2O01J 2QJYC 2QJPC 2YIUC 2WPVB 5L8RJ 1S5LX 4I7ZB 2QSIA 2E74B 1Q90D 2ZT9B 2QIWA 2K9YA 4KT0J 4IL6X 4OGQB 5KLIC 2D2CB 4RKUJ 2FYNC 1JB0J 2WSFJ 3LW5J 2E75B 1ZRTE 2WSCJ 2E76B 4PV1B 2QJKC 5KKZC 4Y28J 3C8VA 4H44B 4H0LB
chains in the Genus database with same CATH superfamily
1Q81Q 3H1LG 4HB1A 1AFOA 1FBMA 5APVA 3TGUE 3EQ2A 3L71E 3RK3C 1FJPA 2ZXXA 1EC5A 1P84D 1K73Q 2KS1A 2OARA 4W7YA 1YQ4C 2LXBA 3FWLA 3Q5SA 2BCCJ 3Q5RA 2V7QH 3B5ND 1SQBK 3L74G 3HE5A 5KLVE 2LR2A 2R32A 2G3AA 1NH4A 4R4LA 3TYYA 1N7SC 1KB9I 1RE3A 1JEKA 2P58A 3MD0A 3C1LA 2HG5D 2QM8A 4N78E 1ZP0C 2P7JA 4ZKUA 1KB9D 2MKVA 1RH5B 4BRYA 1PP9D 2KNCA 3VP9A 3G71P 2A45H 4PD4D 1SFCB 2WTYA 3CD6P 3TGUJ 2GUSA 4WY4C 2AXTE 2HFED 2ZAEB 3H1KD 1R8EA 1N73B 1T2KD 1LP1B 4TLFA 3M0DC 3KHUA 2I8DA 3CI9A 3H1JE 4O9BA 4OH8B 3WU2H 3H1ID 1SQPE 5AW6B 3RL0B 1T2KC 1EDJA 2WSEJ 4I1LA 5AW7B 3L73E 1M90Q 1FDMA 1JM0A 2OTKE 4EDFA 3Q2YA 1URQD 1K04A 1QLED 2C0XA 1HJBA 1BDCA 4PJ0E 4NPDA 1L2PA 2QSIA 1URQB 4U7JA 3VN0A 2C9NY 1L0LD 2E76C 3SWFA 2W83C 2NPSB 1H89A 3IF4A 4JF7A 1L4AC 4JYBA 1H0TA 2YXRB 3RGUA 3L71D 1D7MA 3H1IE 3NMDA 1NU1E 4IOIH 5C39A 4PD4E 2A06G 2WSFJ 1FZCA 1MFTA 1KC8Q 1L0NG 1KORA 1NTZE 3HD7B 2D2CD 2YMKA 3FXEA 3K5BA 3FWNA 2XNDH 4LLHA 1R5SA 2YO2A 4W80A 4AQRD 5CBNA 3Q1MA 3H1KE 1FOSE 2N9BA 5KLVD 1LTJB 1KB9H 3F89A 3JSVC 2JWAA 3VMZA 1SQQG 2L5GB 3B5NA 4L76A 1KILC 3CXHH 1QGKB 4KHXA 1U7MA 1PV3A 3L74D 3A0HH 2KP8A 3WUUA 5KJ7A 1MUUA 2XDJA 2N9YB 1FC2C 1NHLA 1KILD 3MUDA 4H13D 1GMJA 5B66E 4GOFA 5DJUB 3D71A 1KQSO 1RF1B 2FFDA 1VQKP 2QJPB 1G1JA 1LT9A 5TJHA 4N3YB 1H8AA 2ZVNB 1U7JA 1L0LK 1SS1A 1KB9E 2KSEA 5KLIC 4U3FG 1NTMD 5CCGC 2WT7B 3CXHE 3H1HD 1MFZA 2IFMA 3R2PA 2NPSC 3H32B 4NPFX 4XA4A 1QVGO 2OQQA 3A0HE 4WB4A 3L72G 1PP9J 1A02J 1U57A 2Y9YA 1N86A 2GA1A 1LJ2A 1FOSF 4OVNF 3AEAC 1OZHA 3AE5C 1SQQJ 2E5TA 2IBZE 2KUBA 3CWBG 1KYOI 3LIEA 3OA7A 3GHGB 1SQBE 1PFIA 2WITA 4PV1D 3WMM0 3AEBC 4OWFA 2VRSA 2Z5IA 2BEZF 1LNQA 1FZFA 2NZ2A 4OGQD 1JMMA 2FYUG 2I1JA 2Z5HA 3AE3C 3H1IJ 2Q1KA 2YIUC 1PZQA 3CC4P 3BATA 3CC7P 1NU1G 2SPZA 1EXJA 1SQXG 1GW4A 5L8RJ 3V4QA 2FYUE 1EDKA 2E74B 3WUTA 3IN6A 1L4AB 1LTGC 1SFCA 4M3LA 5AW1B 3HUSA 3M9BA 1IJDB 1SQPJ 2B87B 5TISH 2JR8A 4IFMA 3CWBD 1R5LA 4WY4B 3L70J 2PFXA 3VTPC 3GF7A 1S4XA 2H89C 1NTZG 1SQVK 2AEMA 5BU5A 4WBAA 2BCCG 2E43A 1SQPG 1VQPP 3PRJA 4GDOA 3AE7C 3P7KA 2IBZD 1JMBA 1KYOE 3AE8C 3T97B 3CLQA 4Z1MH 1M57D 1LTIC 1BE3G 2KK7A 1GK4A 1NAYA 1XTGB 1BCCJ 1DD4A 1IO4A 2LXCB 1FJKA 1NKZB 1JTHB 3H1LJ 3RK2B 3TK1A 3CPWO 2HODB 1ZR2A 5AVRB 4HYTB 1VQ9P 1SQVD 2OYIB 1NU1K 1SQXE 1AA0A 2M0BA 3BRVB 3F5HA 3CCSP 3U1CA 1N7SA 2WPVB 2K9JA 1J2JB 2H7HA 4AUWA 1QVFO 2C0WA 2QRXA 2ITAA 1YYCA 1X8YA 2RH0A 2CK3H 1LWUC 1DEEG 3CWBJ 2MJZA 3HD7A 3KDPB 2M5AA 3L70G 2K3RA 4OGQB 4IL6X 2E74C 1FS0E 1EZVD 2FY8A 2NRGA 4LC1A 4D6TD 1PPJD 2D2CB 2FYNC 5AVXB 2R44A 3GF3A 2A45G 3H1HJ 1AVYA 1L0ND 4EIJA 2YXQB 1IFPA 2O01N 3E1RA 1FZAA 1L0LE 3PTZA 3SWKA 5CCHD 2N1TA 1SQBG 2W8ZA 3HTKB 3Q3DA 4U3FE 1YITP 5AW3B 1SQQD 3MZWB 2OYHB 3AE9C 1VQNP 2IYPA 1ZOYC 2E75D 5GTIE 3GW6A 3VOPA 3L73D 4H0LD 2WPRA 4XFJA 1IK9A 2ZJSE 3EFGA 2B9BA 3GMAA 3ZDMA 4ZNCA 1N73A 1KQGB 2KLUA 3A0BE 1M1JC 2E75C 1SLQA 3GLMA 1PGPA 2ZFCA 3M06A 4DJGA 2JP3A 2OYHC 1RE4C 1QEXA 2AEFA 2G8YA 2DW3A 2P67A 3H1IG 3TGUG 2C9LY 3IR9A 2H43A 1LTAC 4UB8H 3N7NA 1SQBD 1LTJC 1X79B 1L0NJ 1Y9BA 1SQPD 3O8ZA 5GTIH 5E79H 3GHGA 3LIDA 2NPSA 3CCUP 4JYCA 1ZR4A 2WSCJ 1TU3F 1PGQA 1KMIZ 3AEGC 3PJSK 2FYNB 2E76B 4PV1B 4QMAA 1KD1Q 2AXCA 3M9HA 1Q2NA 2KZIA 3AE2C 3H1JJ 2IYOA 5TISE 5AVZB 4U3FJ 5AW0B 1LT9C 2H8PD 1RQVA 1BCCD 4WVZA 4K3AA 2O01J 2OYIC 1UIXA 3L35A 3RL0C 4EI2A 3CCEP 1RHZB 3MHVA 1BGYJ 4W7ZA 5CHXA 2B87A 4AYCA 3A5TA 1G2CA 2RKLA 1J1EB 1RE3C 1M56D 1Q90D 5AVVB 1JY3P 4UB6E 3VMAA 1ZXGA 1RF1A 2HPCA 1LGHB 2QIWA 2HR3A 4L74A 3B71A 1URQC 5CCHA 2PRRA 3AEFC 1JY2O 1SQXK 4CPGA 1JNMA 3EWKA 1VQ8P 2WWWA 3L71J 2E76D 1P84H 5B5EE 1KILE 1NTZD 3HE4B 1SQXJ 1ZRTD 4D6TJ 1FZCC 1FDOA 1X9VA 1YJ9P 2HODA 1VDFA 3AEDC 2KOGA 1PGJA 5H2FH 1DEBA 2ZYDA 4U3FD 4PJ0H 3RK2C 2QEXP 1RF0A 3BRTB 2KI7B 1IC2A 4UB6H 4TT3H 1GZLA 2WPQA 3TNUB 2IBZG 1EDIA 1YTZI 1BGYD 1J1DC 1KV4A 1VF5D 1PL5A 2JWDA 2M5AB 3L72E 3CX5H 4ZKPA 1GL2D 2WSSH 4JPZB 5B5EH 3G9RA 3GHGC 2NPSD 2YNYA 3L72J 3H1JG 3KPEA 5AW8B 1YQ3C 2I1KA 1OX3A 1IFIA 2KIKA 3L75G 3L74E 4HJGH 5H2FE 1X0TA 2K9YA 3FX0A 4KT0J 1GTWA 1SQQE 1MV8A 3AECC 1RF0C 3P32A 1M1KQ 2IX7C 1SQXD 1SQBJ 3U1AA 2E42A 1NU1D 1HBWA 1BSHA 3BCCG 4GODA 1Q82Q 1ZN5A 5KLIB 1FZGA 1YHQP 1YBKA 1E5WA 1BGYG 2ZT9C 1PIXA 2KNCB 2QJKC 1EXIA 4UB8E 1OIPA 1EZVE 2KXPB 2W90A 1LT9B 3NTNA 3S9OA 1Q86Q 1VQ5P 1RF1C 4C7NA 4RESB 4YTPC 1KFMA 2BCCD 5AW2B 1KQLA 1OVUA 2K1AA 1JCCA 2QJPC 2XKMA 1NVOA 3L72D 4RJTA 3L4FA 1JY3O 1LTSC 2ZYGA 5AVYB 5BU8B 3RK3D 2Z4EA 3MP7B 4IL6E 5B66H 2JDIH 3KQGA 2OYIA 2QG4A 1RY3A 1EDLA 4JQ0D 1KFNA 3PH0A 4Y99C 3A7OA 3HD7C 2M8RA 5KLVG 1FU1A 1ZLLA 3ITKA 4DCKA 4L73A 2CPSA 1NTKD 2P10A 1M1JB 1OFCX 1Z56A 1ZRTE 2E75B 5APXA 3CX5I 3G4SP 1VQMP 1UIIA 2FYUD 3AEEC 4PD4I 1H0TB 1L0NE 2QA4P 1WT6A 1OMIA 2KZJA 3VP8A 5DJTB 1NTZJ 3QWOC 1EZVG 3CCVP 1KTMA 2WQYC 3P8MC 2JKVA 2KS1B 2XU6A 2Y0CA 1CI6A 3H1LE 3PP5A 4H44C 5APUA 4YXWH 1HGVA 2V7QJ 2W6AA 3JC22 1QL2A 3M91A 1JUNA 1VF5B 1S9KE 1G2CB 3G3ZA 3RL0g 1P84E 2N1TB 2R5BA 3HE5B 1NWQA 3CMEP 2Y0DA 4C46A 2OYHA 1YTZT 3KZIE 5AVTB 3CCQP 3OW2O 3L73G 1M7LA 3H1HG 2OYOA 4I7ZB 2IFNA 4HH2A 1N7LA 1NYHA 1S5LE 3L75E 2AEJA 3O6QA 1KYOH 4GT1A 4ASVA 1VQ4P 3V2NA 1YIJP 3CC2P 1DH3A 2ZXEB 1L0LJ 1GL2C 3S4RA 1VQLP 1BSNA 3TDKA 1AV1A 3WU2E 1T8ZA 2FYUJ 1S9KD 1GL2A 1NOHA 2XNXA 3CX5E 1GDTA 1W5CE 3SFDC 2GUVA 5APYA 1M8OB 1SVFA 4DZOA 1YJNP 2OTLP 2K88A 1PP9G 2OGUA 3TNUA 4ASWA 3Q5PA 1HJ0A 3JCUE 5AVWB 5APTA 1J1DB 2W27A 5KLVJ 1S5LH 3SWYA 1GU4A 4D6TE 3AE6C 2FXOA 2P2UA 3E1IA 2RMZA 1LWUA 4MN4C 2A45I 2BCCE 3N4XA 1SQQK 5CCHC 2K37A 2QJYC 4PD4H 4BXLA 1T6AA 2Q5UA 2YKOA 3D6ZA 1WRGA 1PPJG 5APWA 1IFMA 1FZCB 1IFNA 2KB7P 3CMAP 1IFJA 5KTBA 4YXDC 2ZVOB 3JCUH 1CZQA 2POHA 4C7RA 3CCMP 3E7KA 1CSBA 2WSCH 1N7SD 1LT1A 2J58A 2YKPA 2Y0EA 2XZRA 3H25A 1J1EC 2FBWC 2FYUK 2QJYB 3BCCD 2PP6A 5KAIE 2O3JA 3OAKA 3HD7D 5GTHH 4BRYB 4IFDK 1IFDA 2XV5A 2YIUB 4Y28J 1K8AQ 1NTMK 2IDBA 2GM4A 2LKMA 3ABVC 1X22A 3II6A 2R3CA 3HUSC 2IZ1A 3B5NC 1HTLC 3T97A 1T3JA 1FDIA 1LP1A 1HF9A 1JY2P 2AXTH 1NGMB 4JBZA 5E79E 5CBOA 1JTHA 2WVRA 1T3UA 2O1KA 3RK3E 1KQFB 5APQA 1S2EA 5KAIH 1M1JA 3CXHI 2FKWB 3L70D 1E79H 1N8RQ 1JO5A 3CL3D 2ZYAA 4IFFA 1EQ7A 1MZ9A 2P1JA 1NTKK 3QH9A 3BCCJ 3CX5D 2WMMA 1URQA 1K9MQ 1FZBA 2IPPA 3KZIH 3B8EB 3MGNA 3D6YA 2IBZI 5KJ7D 1KZUB 2Q9IA 3V2RA 1WMKA 4R4MA 3M9QA 3V2PA 3L71G 1NTMG 3H1LD 3FXDA 2KYVA 1DD3A 3R4YA 4N78D 4OGQC 1NKNA 5CMZA 1BE3D 2CPBA 3U59A 1NO4A 3A2AA 4L75A 3TSIA 4RO0A 3H1HE 4LGDE 4HKZH 1EZVI 2V4HA 3TF5A 2WPSA 1USEA 3RK2D 1YI2P 3HTKA 1USDA 3EFFK 3O6QB 3B5NB 2HPCB 3HUSB 3V6IA 2WSEH 2YO3A 4WY4A 1SQVJ 3NFQA 2J59M 1IZNB 3MUDC 3PLNA 2JO1A 1GD2E 4EYYQ 1DIPA 3CCJP 2FFDB 3CXHD 3W68A 3FGAD 3CWBE 1KILA 3VMXA 3H1KG 3KYQA 3A0BH 1BCCE 3M0AA 4RKUJ 3CCLP 2QVAA 1W2EA 1RQUA 1OXZA 3MTUE 1JY3N 5APSA 4DT0A 1CW5A 1ZV8A 1FE6A 1L4AD 1NTKG 1NU1J 3L37A 2RN0A 4WWIA 1XTCC 1LWUB 2WT7A 1VQ7P 1BE3J 2JJLA 4H13C 2Y9ZA 1FZEA 3V5BA 3L74J 2PGDA 1W2BO 3D70A 3V4WA 1VPCA 1L0LG 1N7SB 1GK6A 1VL2A 2M3BA 1SFCD 2QJKB 2K9JB 5CJ4A 3I56P 2R3SA 4EOTA 5AVSB 5AW4B 1ZMEC 1OW6A 1CI6B 1SFCC 1PGOA 2FXMA 2E5YA 2M3EA 1P84I 3L73J 3UIAA 5GTHE 1HVVA 2A06D 1AVOA 1OW7A 1MKMA 1S5LX 3AE4C 5KAFE 2KSJA 1NAFA 2UWJE 3L75J 3L70E 2OTJP 2H88C 1NTMJ 1VQOP 5K5GB 1IK7A 5KKZB 1SQPK 1N2DC 3SFEC 5M1BA 1OVVA 1NTME 4N6JA 1G1IA 2W6JH 1GU5A 1HGZA 1Y47A 4GKGA 3WUVA 2FYZA 1S72P 1AQ5A 1OW8A 1LTJA 3LW5J 4GOEA 2Q7CA 3LW5H 2Q3IA 3PHLA 2WSFH 1H88A 3SSUA 1NTKJ 1KYOD 1AJYA 4D6TG 1JOCA 3RBXA 1KN7A 3MIWA 1RE4A 1GL2B 1BE3E 3A3YB 4H0LC 4I7ZC 4WY4D 1FAVA 3RL0D 2HYNA 3HE4A 3RK3B 5KLVK 4YPCA 3P8CE 4H13B 1PP9E 3H1JD 3VYIA 5BVZA 1PPJE 1SQVE 5CCGA 2HLOA 1BGYE 3USSA 1VQ6P 2Q3EA 4I6MC 4PV1C 5CJ0A 2QM7A 1OVRA 1QL1A 1NJIQ 2N1TC 3VMYA 2YMYA 3H32A 1VF5C 1L0NK 1JY2N 3AE1C 1LTTC 2BASA 2N1TD 4B86A 1K05A 1HH0A 2B88A 3OJAB 5KJ7C 3TGUD 3BVHA 2FFDC 1S1CX 1JB0J 4ZMDA 1AQTA 3V2QA 1JCDA 3BASA 1DX7A 1OWAA 3H1KJ 2KLVA 1A02F 3BCCE 2BEQD 4H44D 3RBZA 4A7PA 3W67A 3I5CA 1LTBC 2Q6QA 2O1JA 3C8VA 4NPEA 4H44B 4I2LC 4XE5B 2J5UA 4BWNA 1GW3A 1NTZK 1YJWP 1L4AA 3HRNA 1NTKE 1S3JA 3B4SA 5AW9B 2FXPA 2A06E 2E74D 1KILB 1Y8AA 2QE7H 3I55P 1BCCG 4Y99B 4C7NB 3L36A 3CCRP 2PAJA 4K35A 1HWTC 1BDDA 2JEEA 2ZT9B 2WZ7A 3C9IA 2D2CC 3H6PA 3L75D 3P8CD 5AVUB 3S1KA 3NXSA 2ZT9D 1N73C 3IAOA 1HUCA 1QX8A 3M0DA 2IZ0A 2L91A 4KJMA 5EFWB 2YKQA 1SQVG 1ZW0A 4DOJA 5CCGD 5KAFH 5AW5B 3IFMA 2W6BA 4IL6H 4GIFA 5AVQB 1SP4A 3KXDA 2O01H 5KKZC 3GG2A 3G6EP 2R5DA 1Q7YQ 2B89A 4H0LB
chains in the Genus database with same CATH topology
3S9OA 4YTPC 2QJPC 1YQ4C 2WPVB 3Q5SA 3Q5RA 2JO1A 2G3AA 4R4LA 1DIPA 3D6ZA 4OGQB 4IL6X 2E74C 1ZP0C 3FGAD 2MKVA 3R4YA 2D2CB 4RKUJ 2FYNC 2P10A 2E75B 1RQUA 1ZRTE 3GF3A 3AEEC 1OMIA 4H13C 1R8EA 1KTMA 2WQYC 3Q3DA 3D70A 4H44C 3AE9C 1VL2A 2V7QJ 1ZOYC 2E75D 1VF5B 4H0LD 2WSEJ 3RL0g 4XFJA 3GMAA 1ZMEC 1OW6A 1KQGB 3Q2YA 2E75C 3GLMA 1K04A 2JP3A 1OW7A 1MKMA 1S5LX 2G8YA 3AE4C 4I7ZB 2QSIA 4U7JA 1NYHA 2H88C 2E76C 3O6QA 1IK7A 3SFEC 5M1BA 1Y9BA 2WSFJ 1OW8A 3LW5J 1KORA 3SFDC 2D2CD 2YMKA 2WSCJ 1TU3F 3Q1MA 1AJYA 1KMIZ 3AEGC 2E76B 4PV1B 3Q5PA 1HJ0A 4I7ZC 4H0LC 3AE2C 4H13B 1PV3A 3AE6C 1RQVA 2O01J 1UIXA 4H13D 2QJYC 1GMJA 3D71A 4PV1C 1VF5C 1Q90D 4YXDC 2QIWA 3AE1C 3B71A 5KLIC 1K05A 3AEFC 1S1CX 1JB0J 2OQQA 3EWKA 2E76D 2FBWC 3H25A 1KILE 1U57A 1FDOA 4H44D 2BEQD 3AEAC 3AE5C 3AEDC 4Y28J 3C8VA 4H44B 2IDBA 4PV1D 3ABVC 3AEBC 2J5UA 4TT3H 2BEZF 2NZ2A 1FDIA 4OGQD 3AE3C 1HF9A 1VF5D 1PL5A 2FXPA 2YIUC 1NGMB 2E74D 1EXJA 5L8RJ 3G9RA 3RK3E 2E74B 1KQFB 3IN6A 1YQ3C 2ZT9B 2D2CC 2K9YA 4KT0J 2ZT9D 3AECC 3IAOA 3GF7A 2H89C 3D6YA 1WMKA 4R4MA 4GDOA 3AE7C 2ZT9C 3T97B 1PIXA 2QJKC 3AE8C 4Z1MH 5KKZC 1EXIA 1DD3A 4OGQC 4H0LB 1DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H13 B;  1VF5 B;  2WSE J;  2O01 J;  2QJY C;  2QJP C;  2YIU C;  2WPV B;  5L8R J;  1S5L X;  4I7Z B;  2QSI A;  2E74 B;  1Q90 D;  2ZT9 B;  2QIW A;  2K9Y A;  4KT0 J;  4IL6 X;  4OGQ B;  5KLI C;  2D2C B;  4RKU J;  2FYN C;  1JB0 J;  2WSF J;  3LW5 J;  2E75 B;  1ZRT E;  2WSC J;  2E76 B;  4PV1 B;  2QJK C;  5KKZ C;  4Y28 J;  3C8V A;  4H44 B;  4H0L B; 
#chains in the Genus database with same CATH topology
 1Q81 Q;  3H1L G;  4HB1 A;  1AFO A;  1FBM A;  5APV A;  3TGU E;  3EQ2 A;  3L71 E;  3RK3 C;  1FJP A;  2ZXX A;  1EC5 A;  1P84 D;  1K73 Q;  2KS1 A;  2OAR A;  4W7Y A;  1YQ4 C;  2LXB A;  3FWL A;  3Q5S A;  2BCC J;  3Q5R A;  2V7Q H;  3B5N D;  1SQB K;  3L74 G;  3HE5 A;  5KLV E;  2LR2 A;  2R32 A;  2G3A A;  1NH4 A;  4R4L A;  3TYY A;  1N7S C;  1KB9 I;  1RE3 A;  1JEK A;  2P58 A;  3MD0 A;  3C1L A;  2HG5 D;  2QM8 A;  4N78 E;  1ZP0 C;  2P7J A;  4ZKU A;  1KB9 D;  2MKV A;  1RH5 B;  4BRY A;  1PP9 D;  2KNC A;  3VP9 A;  3G71 P;  2A45 H;  4PD4 D;  1SFC B;  2WTY A;  3CD6 P;  3TGU J;  2GUS A;  4WY4 C;  2AXT E;  2HFE D;  2ZAE B;  3H1K D;  1R8E A;  1N73 B;  1T2K D;  1LP1 B;  4TLF A;  3M0D C;  3KHU A;  2I8D A;  3CI9 A;  3H1J E;  4O9B A;  4OH8 B;  3WU2 H;  3H1I D;  1SQP E;  5AW6 B;  3RL0 B;  1T2K C;  1EDJ A;  2WSE J;  4I1L A;  5AW7 B;  3L73 E;  1M90 Q;  1FDM A;  1JM0 A;  2OTK E;  4EDF A;  3Q2Y A;  1URQ D;  1K04 A;  1QLE D;  2C0X A;  1HJB A;  1BDC A;  4PJ0 E;  4NPD A;  1L2P A;  2QSI A;  1URQ B;  4U7J A;  3VN0 A;  2C9N Y;  1L0L D;  2E76 C;  3SWF A;  2W83 C;  2NPS B;  1H89 A;  3IF4 A;  4JF7 A;  1L4A C;  4JYB A;  1H0T A;  2YXR B;  3RGU A;  3L71 D;  1D7M A;  3H1I E;  3NMD A;  1NU1 E;  4IOI H;  5C39 A;  4PD4 E;  2A06 G;  2WSF J;  1FZC A;  1MFT A;  1KC8 Q;  1L0N G;  1KOR A;  1NTZ E;  3HD7 B;  2D2C D;  2YMK A;  3FXE A;  3K5B A;  3FWN A;  2XND H;  4LLH A;  1R5S A;  2YO2 A;  4W80 A;  4AQR D;  5CBN A;  3Q1M A;  3H1K E;  1FOS E;  2N9B A;  5KLV D;  1LTJ B;  1KB9 H;  3F89 A;  3JSV C;  2JWA A;  3VMZ A;  1SQQ G;  2L5G B;  3B5N A;  4L76 A;  1KIL C;  3CXH H;  1QGK B;  4KHX A;  1U7M A;  1PV3 A;  3L74 D;  3A0H H;  2KP8 A;  3WUU A;  5KJ7 A;  1MUU A;  2XDJ A;  2N9Y B;  1FC2 C;  1NHL A;  1KIL D;  3MUD A;  4H13 D;  1GMJ A;  5B66 E;  4GOF A;  5DJU B;  3D71 A;  1KQS O;  1RF1 B;  2FFD A;  1VQK P;  2QJP B;  1G1J A;  1LT9 A;  5TJH A;  4N3Y B;  1H8A A;  2ZVN B;  1U7J A;  1L0L K;  1SS1 A;  1KB9 E;  2KSE A;  5KLI C;  4U3F G;  1NTM D;  5CCG C;  2WT7 B;  3CXH E;  3H1H D;  1MFZ A;  2IFM A;  3R2P A;  2NPS C;  3H32 B;  4NPF X;  4XA4 A;  1QVG O;  2OQQ A;  3A0H E;  4WB4 A;  3L72 G;  1PP9 J;  1A02 J;  1U57 A;  2Y9Y A;  1N86 A;  2GA1 A;  1LJ2 A;  1FOS F;  4OVN F;  3AEA C;  1OZH A;  3AE5 C;  1SQQ J;  2E5T A;  2IBZ E;  2KUB A;  3CWB G;  1KYO I;  3LIE A;  3OA7 A;  3GHG B;  1SQB E;  1PFI A;  2WIT A;  4PV1 D;  3WMM 0;  3AEB C;  4OWF A;  2VRS A;  2Z5I A;  2BEZ F;  1LNQ A;  1FZF A;  2NZ2 A;  4OGQ D;  1JMM A;  2FYU G;  2I1J A;  2Z5H A;  3AE3 C;  3H1I J;  2Q1K A;  2YIU C;  1PZQ A;  3CC4 P;  3BAT A;  3CC7 P;  1NU1 G;  2SPZ A;  1EXJ A;  1SQX G;  1GW4 A;  5L8R J;  3V4Q A;  2FYU E;  1EDK A;  2E74 B;  3WUT A;  3IN6 A;  1L4A B;  1LTG C;  1SFC A;  4M3L A;  5AW1 B;  3HUS A;  3M9B A;  1IJD B;  1SQP J;  2B87 B;  5TIS H;  2JR8 A;  4IFM A;  3CWB D;  1R5L A;  4WY4 B;  3L70 J;  2PFX A;  3VTP C;  3GF7 A;  1S4X A;  2H89 C;  1NTZ G;  1SQV K;  2AEM A;  5BU5 A;  4WBA A;  2BCC G;  2E43 A;  1SQP G;  1VQP P;  3PRJ A;  4GDO A;  3AE7 C;  3P7K A;  2IBZ D;  1JMB A;  1KYO E;  3AE8 C;  3T97 B;  3CLQ A;  4Z1M H;  1M57 D;  1LTI C;  1BE3 G;  2KK7 A;  1GK4 A;  1NAY A;  1XTG B;  1BCC J;  1DD4 A;  1IO4 A;  2LXC B;  1FJK A;  1NKZ B;  1JTH B;  3H1L J;  3RK2 B;  3TK1 A;  3CPW O;  2HOD B;  1ZR2 A;  5AVR B;  4HYT B;  1VQ9 P;  1SQV D;  2OYI B;  1NU1 K;  1SQX E;  1AA0 A;  2M0B A;  3BRV B;  3F5H A;  3CCS P;  3U1C A;  1N7S A;  2WPV B;  2K9J A;  1J2J B;  2H7H A;  4AUW A;  1QVF O;  2C0W A;  2QRX A;  2ITA A;  1YYC A;  1X8Y A;  2RH0 A;  2CK3 H;  1LWU C;  1DEE G;  3CWB J;  2MJZ A;  3HD7 A;  3KDP B;  2M5A A;  3L70 G;  2K3R A;  4OGQ B;  4IL6 X;  2E74 C;  1FS0 E;  1EZV D;  2FY8 A;  2NRG A;  4LC1 A;  4D6T D;  1PPJ D;  2D2C B;  2FYN C;  5AVX B;  2R44 A;  3GF3 A;  2A45 G;  3H1H J;  1AVY A;  1L0N D;  4EIJ A;  2YXQ B;  1IFP A;  2O01 N;  3E1R A;  1FZA A;  1L0L E;  3PTZ A;  3SWK A;  5CCH D;  2N1T A;  1SQB G;  2W8Z A;  3HTK B;  3Q3D A;  4U3F E;  1YIT P;  5AW3 B;  1SQQ D;  3MZW B;  2OYH B;  3AE9 C;  1VQN P;  2IYP A;  1ZOY C;  2E75 D;  5GTI E;  3GW6 A;  3VOP A;  3L73 D;  4H0L D;  2WPR A;  4XFJ A;  1IK9 A;  2ZJS E;  3EFG A;  2B9B A;  3GMA A;  3ZDM A;  4ZNC A;  1N73 A;  1KQG B;  2KLU A;  3A0B E;  1M1J C;  2E75 C;  1SLQ A;  3GLM A;  1PGP A;  2ZFC A;  3M06 A;  4DJG A;  2JP3 A;  2OYH C;  1RE4 C;  1QEX A;  2AEF A;  2G8Y A;  2DW3 A;  2P67 A;  3H1I G;  3TGU G;  2C9L Y;  3IR9 A;  2H43 A;  1LTA C;  4UB8 H;  3N7N A;  1SQB D;  1LTJ C;  1X79 B;  1L0N J;  1Y9B A;  1SQP D;  3O8Z A;  5GTI H;  5E79 H;  3GHG A;  3LID A;  2NPS A;  3CCU P;  4JYC A;  1ZR4 A;  2WSC J;  1TU3 F;  1PGQ A;  1KMI Z;  3AEG C;  3PJS K;  2FYN B;  2E76 B;  4PV1 B;  4QMA A;  1KD1 Q;  2AXC A;  3M9H A;  1Q2N A;  2KZI A;  3AE2 C;  3H1J J;  2IYO A;  5TIS E;  5AVZ B;  4U3F J;  5AW0 B;  1LT9 C;  2H8P D;  1RQV A;  1BCC D;  4WVZ A;  4K3A A;  2O01 J;  2OYI C;  1UIX A;  3L35 A;  3RL0 C;  4EI2 A;  3CCE P;  1RHZ B;  3MHV A;  1BGY J;  4W7Z A;  5CHX A;  2B87 A;  4AYC A;  3A5T A;  1G2C A;  2RKL A;  1J1E B;  1RE3 C;  1M56 D;  1Q90 D;  5AVV B;  1JY3 P;  4UB6 E;  3VMA A;  1ZXG A;  1RF1 A;  2HPC A;  1LGH B;  2QIW A;  2HR3 A;  4L74 A;  3B71 A;  1URQ C;  5CCH A;  2PRR A;  3AEF C;  1JY2 O;  1SQX K;  4CPG A;  1JNM A;  3EWK A;  1VQ8 P;  2WWW A;  3L71 J;  2E76 D;  1P84 H;  5B5E E;  1KIL E;  1NTZ D;  3HE4 B;  1SQX J;  1ZRT D;  4D6T J;  1FZC C;  1FDO A;  1X9V A;  1YJ9 P;  2HOD A;  1VDF A;  3AED C;  2KOG A;  1PGJ A;  5H2F H;  1DEB A;  2ZYD A;  4U3F D;  4PJ0 H;  3RK2 C;  2QEX P;  1RF0 A;  3BRT B;  2KI7 B;  1IC2 A;  4UB6 H;  4TT3 H;  1GZL A;  2WPQ A;  3TNU B;  2IBZ G;  1EDI A;  1YTZ I;  1BGY D;  1J1D C;  1KV4 A;  1VF5 D;  1PL5 A;  2JWD A;  2M5A B;  3L72 E;  3CX5 H;  4ZKP A;  1GL2 D;  2WSS H;  4JPZ B;  5B5E H;  3G9R A;  3GHG C;  2NPS D;  2YNY A;  3L72 J;  3H1J G;  3KPE A;  5AW8 B;  1YQ3 C;  2I1K A;  1OX3 A;  1IFI A;  2KIK A;  3L75 G;  3L74 E;  4HJG H;  5H2F E;  1X0T A;  2K9Y A;  3FX0 A;  4KT0 J;  1GTW A;  1SQQ E;  1MV8 A;  3AEC C;  1RF0 C;  3P32 A;  1M1K Q;  2IX7 C;  1SQX D;  1SQB J;  3U1A A;  2E42 A;  1NU1 D;  1HBW A;  1BSH A;  3BCC G;  4GOD A;  1Q82 Q;  1ZN5 A;  5KLI B;  1FZG A;  1YHQ P;  1YBK A;  1E5W A;  1BGY G;  2ZT9 C;  1PIX A;  2KNC B;  2QJK C;  1EXI A;  4UB8 E;  1OIP A;  1EZV E;  2KXP B;  2W90 A;  1LT9 B;  3NTN A;  3S9O A;  1Q86 Q;  1VQ5 P;  1RF1 C;  4C7N A;  4RES B;  4YTP C;  1KFM A;  2BCC D;  5AW2 B;  1KQL A;  1OVU A;  2K1A A;  1JCC A;  2QJP C;  2XKM A;  1NVO A;  3L72 D;  4RJT A;  3L4F A;  1JY3 O;  1LTS C;  2ZYG A;  5AVY B;  5BU8 B;  3RK3 D;  2Z4E A;  3MP7 B;  4IL6 E;  5B66 H;  2JDI H;  3KQG A;  2OYI A;  2QG4 A;  1RY3 A;  1EDL A;  4JQ0 D;  1KFN A;  3PH0 A;  4Y99 C;  3A7O A;  3HD7 C;  2M8R A;  5KLV G;  1FU1 A;  1ZLL A;  3ITK A;  4DCK A;  4L73 A;  2CPS A;  1NTK D;  2P10 A;  1M1J B;  1OFC X;  1Z56 A;  1ZRT E;  2E75 B;  5APX A;  3CX5 I;  3G4S P;  1VQM P;  1UII A;  2FYU D;  3AEE C;  4PD4 I;  1H0T B;  1L0N E;  2QA4 P;  1WT6 A;  1OMI A;  2KZJ A;  3VP8 A;  5DJT B;  1NTZ J;  3QWO C;  1EZV G;  3CCV P;  1KTM A;  2WQY C;  3P8M C;  2JKV A;  2KS1 B;  2XU6 A;  2Y0C A;  1CI6 A;  3H1L E;  3PP5 A;  4H44 C;  5APU A;  4YXW H;  1HGV A;  2V7Q J;  2W6A A;  3JC2 2;  1QL2 A;  3M91 A;  1JUN A;  1VF5 B;  1S9K E;  1G2C B;  3G3Z A;  3RL0 g;  1P84 E;  2N1T B;  2R5B A;  3HE5 B;  1NWQ A;  3CME P;  2Y0D A;  4C46 A;  2OYH A;  1YTZ T;  3KZI E;  5AVT B;  3CCQ P;  3OW2 O;  3L73 G;  1M7L A;  3H1H G;  2OYO A;  4I7Z B;  2IFN A;  4HH2 A;  1N7L A;  1NYH A;  1S5L E;  3L75 E;  2AEJ A;  3O6Q A;  1KYO H;  4GT1 A;  4ASV A;  1VQ4 P;  3V2N A;  1YIJ P;  3CC2 P;  1DH3 A;  2ZXE B;  1L0L J;  1GL2 C;  3S4R A;  1VQL P;  1BSN A;  3TDK A;  1AV1 A;  3WU2 E;  1T8Z A;  2FYU J;  1S9K D;  1GL2 A;  1NOH A;  2XNX A;  3CX5 E;  1GDT A;  1W5C E;  3SFD C;  2GUV A;  5APY A;  1M8O B;  1SVF A;  4DZO A;  1YJN P;  2OTL P;  2K88 A;  1PP9 G;  2OGU A;  3TNU A;  4ASW A;  3Q5P A;  1HJ0 A;  3JCU E;  5AVW B;  5APT A;  1J1D B;  2W27 A;  5KLV J;  1S5L H;  3SWY A;  1GU4 A;  4D6T E;  3AE6 C;  2FXO A;  2P2U A;  3E1I A;  2RMZ A;  1LWU A;  4MN4 C;  2A45 I;  2BCC E;  3N4X A;  1SQQ K;  5CCH C;  2K37 A;  2QJY C;  4PD4 H;  4BXL A;  1T6A A;  2Q5U A;  2YKO A;  3D6Z A;  1WRG A;  1PPJ G;  5APW A;  1IFM A;  1FZC B;  1IFN A;  2KB7 P;  3CMA P;  1IFJ A;  5KTB A;  4YXD C;  2ZVO B;  3JCU H;  1CZQ A;  2POH A;  4C7R A;  3CCM P;  3E7K A;  1CSB A;  2WSC H;  1N7S D;  1LT1 A;  2J58 A;  2YKP A;  2Y0E A;  2XZR A;  3H25 A;  1J1E C;  2FBW C;  2FYU K;  2QJY B;  3BCC D;  2PP6 A;  5KAI E;  2O3J A;  3OAK A;  3HD7 D;  5GTH H;  4BRY B;  4IFD K;  1IFD A;  2XV5 A;  2YIU B;  4Y28 J;  1K8A Q;  1NTM K;  2IDB A;  2GM4 A;  2LKM A;  3ABV C;  1X22 A;  3II6 A;  2R3C A;  3HUS C;  2IZ1 A;  3B5N C;  1HTL C;  3T97 A;  1T3J A;  1FDI A;  1LP1 A;  1HF9 A;  1JY2 P;  2AXT H;  1NGM B;  4JBZ A;  5E79 E;  5CBO A;  1JTH A;  2WVR A;  1T3U A;  2O1K A;  3RK3 E;  1KQF B;  5APQ A;  1S2E A;  5KAI H;  1M1J A;  3CXH I;  2FKW B;  3L70 D;  1E79 H;  1N8R Q;  1JO5 A;  3CL3 D;  2ZYA A;  4IFF A;  1EQ7 A;  1MZ9 A;  2P1J A;  1NTK K;  3QH9 A;  3BCC J;  3CX5 D;  2WMM A;  1URQ A;  1K9M Q;  1FZB A;  2IPP A;  3KZI H;  3B8E B;  3MGN A;  3D6Y A;  2IBZ I;  5KJ7 D;  1KZU B;  2Q9I A;  3V2R A;  1WMK A;  4R4M A;  3M9Q A;  3V2P A;  3L71 G;  1NTM G;  3H1L D;  3FXD A;  2KYV A;  1DD3 A;  3R4Y A;  4N78 D;  4OGQ C;  1NKN A;  5CMZ A;  1BE3 D;  2CPB A;  3U59 A;  1NO4 A;  3A2A A;  4L75 A;  3TSI A;  4RO0 A;  3H1H E;  4LGD E;  4HKZ H;  1EZV I;  2V4H A;  3TF5 A;  2WPS A;  1USE A;  3RK2 D;  1YI2 P;  3HTK A;  1USD A;  3EFF K;  3O6Q B;  3B5N B;  2HPC B;  3HUS B;  3V6I A;  2WSE H;  2YO3 A;  4WY4 A;  1SQV J;  3NFQ A;  2J59 M;  1IZN B;  3MUD C;  3PLN A;  2JO1 A;  1GD2 E;  4EYY Q;  1DIP A;  3CCJ P;  2FFD B;  3CXH D;  3W68 A;  3FGA D;  3CWB E;  1KIL A;  3VMX A;  3H1K G;  3KYQ A;  3A0B H;  1BCC E;  3M0A A;  4RKU J;  3CCL P;  2QVA A;  1W2E A;  1RQU A;  1OXZ A;  3MTU E;  1JY3 N;  5APS A;  4DT0 A;  1CW5 A;  1ZV8 A;  1FE6 A;  1L4A D;  1NTK G;  1NU1 J;  3L37 A;  2RN0 A;  4WWI A;  1XTC C;  1LWU B;  2WT7 A;  1VQ7 P;  1BE3 J;  2JJL A;  4H13 C;  2Y9Z A;  1FZE A;  3V5B A;  3L74 J;  2PGD A;  1W2B O;  3D70 A;  3V4W A;  1VPC A;  1L0L G;  1N7S B;  1GK6 A;  1VL2 A;  2M3B A;  1SFC D;  2QJK B;  2K9J B;  5CJ4 A;  3I56 P;  2R3S A;  4EOT A;  5AVS B;  5AW4 B;  1ZME C;  1OW6 A;  1CI6 B;  1SFC C;  1PGO A;  2FXM A;  2E5Y A;  2M3E A;  1P84 I;  3L73 J;  3UIA A;  5GTH E;  1HVV A;  2A06 D;  1AVO A;  1OW7 A;  1MKM A;  1S5L X;  3AE4 C;  5KAF E;  2KSJ A;  1NAF A;  2UWJ E;  3L75 J;  3L70 E;  2OTJ P;  2H88 C;  1NTM J;  1VQO P;  5K5G B;  1IK7 A;  5KKZ B;  1SQP K;  1N2D C;  3SFE C;  5M1B A;  1OVV A;  1NTM E;  4N6J A;  1G1I A;  2W6J H;  1GU5 A;  1HGZ A;  1Y47 A;  4GKG A;  3WUV A;  2FYZ A;  1S72 P;  1AQ5 A;  1OW8 A;  1LTJ A;  3LW5 J;  4GOE A;  2Q7C A;  3LW5 H;  2Q3I A;  3PHL A;  2WSF H;  1H88 A;  3SSU A;  1NTK J;  1KYO D;  1AJY A;  4D6T G;  1JOC A;  3RBX A;  1KN7 A;  3MIW A;  1RE4 A;  1GL2 B;  1BE3 E;  3A3Y B;  4H0L C;  4I7Z C;  4WY4 D;  1FAV A;  3RL0 D;  2HYN A;  3HE4 A;  3RK3 B;  5KLV K;  4YPC A;  3P8C E;  4H13 B;  1PP9 E;  3H1J D;  3VYI A;  5BVZ A;  1PPJ E;  1SQV E;  5CCG A;  2HLO A;  1BGY E;  3USS A;  1VQ6 P;  2Q3E A;  4I6M C;  4PV1 C;  5CJ0 A;  2QM7 A;  1OVR A;  1QL1 A;  1NJI Q;  2N1T C;  3VMY A;  2YMY A;  3H32 A;  1VF5 C;  1L0N K;  1JY2 N;  3AE1 C;  1LTT C;  2BAS A;  2N1T D;  4B86 A;  1K05 A;  1HH0 A;  2B88 A;  3OJA B;  5KJ7 C;  3TGU D;  3BVH A;  2FFD C;  1S1C X;  1JB0 J;  4ZMD A;  1AQT A;  3V2Q A;  1JCD A;  3BAS A;  1DX7 A;  1OWA A;  3H1K J;  2KLV A;  1A02 F;  3BCC E;  2BEQ D;  4H44 D;  3RBZ A;  4A7P A;  3W67 A;  3I5C A;  1LTB C;  2Q6Q A;  2O1J A;  3C8V A;  4NPE A;  4H44 B;  4I2L C;  4XE5 B;  2J5U A;  4BWN A;  1GW3 A;  1NTZ K;  1YJW P;  1L4A A;  3HRN A;  1NTK E;  1S3J A;  3B4S A;  5AW9 B;  2FXP A;  2A06 E;  2E74 D;  1KIL B;  1Y8A A;  2QE7 H;  3I55 P;  1BCC G;  4Y99 B;  4C7N B;  3L36 A;  3CCR P;  2PAJ A;  4K35 A;  1HWT C;  1BDD A;  2JEE A;  2ZT9 B;  2WZ7 A;  3C9I A;  2D2C C;  3H6P A;  3L75 D;  3P8C D;  5AVU B;  3S1K A;  3NXS A;  2ZT9 D;  1N73 C;  3IAO A;  1HUC A;  1QX8 A;  3M0D A;  2IZ0 A;  2L91 A;  4KJM A;  5EFW B;  2YKQ A;  1SQV G;  1ZW0 A;  4DOJ A;  5CCG D;  5KAF H;  5AW5 B;  3IFM A;  2W6B A;  4IL6 H;  4GIF A;  5AVQ B;  1SP4 A;  3KXD A;  2O01 H;  5KKZ C;  3GG2 A;  3G6E P;  2R5D A;  1Q7Y Q;  2B89 A;  4H0L B; 
#chains in the Genus database with same CATH homology
 3S9O A;  4YTP C;  2QJP C;  1YQ4 C;  2WPV B;  3Q5S A;  3Q5R A;  2JO1 A;  2G3A A;  4R4L A;  1DIP A;  3D6Z A;  4OGQ B;  4IL6 X;  2E74 C;  1ZP0 C;  3FGA D;  2MKV A;  3R4Y A;  2D2C B;  4RKU J;  2FYN C;  2P10 A;  2E75 B;  1RQU A;  1ZRT E;  3GF3 A;  3AEE C;  1OMI A;  4H13 C;  1R8E A;  1KTM A;  2WQY C;  3Q3D A;  3D70 A;  4H44 C;  3AE9 C;  1VL2 A;  2V7Q J;  1ZOY C;  2E75 D;  1VF5 B;  4H0L D;  2WSE J;  3RL0 g;  4XFJ A;  3GMA A;  1ZME C;  1OW6 A;  1KQG B;  3Q2Y A;  2E75 C;  3GLM A;  1K04 A;  2JP3 A;  1OW7 A;  1MKM A;  1S5L X;  2G8Y A;  3AE4 C;  4I7Z B;  2QSI A;  4U7J A;  1NYH A;  2H88 C;  2E76 C;  3O6Q A;  1IK7 A;  3SFE C;  5M1B A;  1Y9B A;  2WSF J;  1OW8 A;  3LW5 J;  1KOR A;  3SFD C;  2D2C D;  2YMK A;  2WSC J;  1TU3 F;  3Q1M A;  1AJY A;  1KMI Z;  3AEG C;  2E76 B;  4PV1 B;  3Q5P A;  1HJ0 A;  4I7Z C;  4H0L C;  3AE2 C;  4H13 B;  1PV3 A;  3AE6 C;  1RQV A;  2O01 J;  1UIX A;  4H13 D;  2QJY C;  1GMJ A;  3D71 A;  4PV1 C;  1VF5 C;  1Q90 D;  4YXD C;  2QIW A;  3AE1 C;  3B71 A;  5KLI C;  1K05 A;  3AEF C;  1S1C X;  1JB0 J;  2OQQ A;  3EWK A;  2E76 D;  2FBW C;  3H25 A;  1KIL E;  1U57 A;  1FDO A;  4H44 D;  2BEQ D;  3AEA C;  3AE5 C;  3AED C;  4Y28 J;  3C8V A;  4H44 B;  2IDB A;  4PV1 D;  3ABV C;  3AEB C;  2J5U A;  4TT3 H;  2BEZ F;  2NZ2 A;  1FDI A;  4OGQ D;  3AE3 C;  1HF9 A;  1VF5 D;  1PL5 A;  2FXP A;  2YIU C;  1NGM B;  2E74 D;  1EXJ A;  5L8R J;  3G9R A;  3RK3 E;  2E74 B;  1KQF B;  3IN6 A;  1YQ3 C;  2ZT9 B;  2D2C C;  2K9Y A;  4KT0 J;  2ZT9 D;  3AEC C;  3IAO A;  3GF7 A;  2H89 C;  3D6Y A;  1WMK A;  4R4M A;  4GDO A;  3AE7 C;  2ZT9 C;  3T97 B;  1PIX A;  2QJK C;  3AE8 C;  4Z1M H;  5KKZ C;  1EXI A;  1DD3 A;  4OGQ C;  4H0L B;  1DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...