2WSSV

The structure of the membrane extrinsic region of bovine atp synthase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
total genus 5
structure length 66
sequence length 66
chains with identical sequence Z
ec nomenclature
pdb deposition date 2009-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wssV01
2CLYC 2WSSV
chains in the Genus database with same CATH superfamily
4YXDA 3ONJA 4X1KE 2LSGA 4ADZA 1E7PA 4XZCA 4HWDA 3IA3A 3PUAA 3AAIA 1CUNA 1J1JA 3PUWF 2V6YB 1IJ6A 4IE0A 2X0YA 4LF8T 5L2LA 4DR1T 5GONE 1MNDA 5AQJB 4QX8B 1NENA 3FBZA 1V9DA 3L39A 3UT5E 1O3XA 2WSSV 1KEYA 1X9BA 3CK6A 3MJXA 2JJ9A 3MZKB 3RYIE 3T1HT 1JNZA 5LP6E 4IT4A 2WS3A 3OKQA 2V26A 4ILBA 2BG9E 4ILCA 5L3DB 3AA6B 5AQVB 2GK9A 1Z8UA 1M7KA 4PNIA 3PDYA 3B13A 1VRBA 4UVBB 4EZ4A 4JLEA 4DV3T 2BG9B 2X67A 4ZOLE 1J5WA 3O1HA 3Q2MA 5AQMB 1HCIA 1T8BA 2Q9QD 5LBMA 3UFGA 3P4SA 2RA1A 1SHZC 2XSAA 3N9LA 2J62A 1BR4A 3EDVA 5LHIB 3PU3A 4UVCB 5JRCA 1OEDC 1MIYA 2YEVC 2A2FX 4UXNB 3VKGA 2CHNA 1UK5A 2XQ8A 3KBTA 4JBWF 3AE6A 2D9DA 2WZHA 4AQFC 4LMJA 5LGNB 2KMFA 3LK2B 3C4WA 3KINB 4CXXA 1OXZA 3RLFF 1G8XA 1T72A 3LBXA 3UTKA 5AQOB 3ZSSA 3LBXB 4ZS3A 3IHRA 4GK0E 4UIGA 5AQIB 2YDRA 4CN1A 3HR0A 3SOLA 2XHEB 4GYSA 3DP7A 2MBGA 2X0LB 4U7YA 3M3ZB 1WR6A 3O1IA 3UU4A 1OEDB 4JI0T 2PJQA 4A5XA 1XMOT 1OEDA 2CCQA 4KI0F 4B6XA 4PJNA 4XAXB 2IC9A 5ABGA 2W2UA 3RGLA 3TLUA 3ZKRA 5DQWA 4EZHA 4E7SA 3QOFA 2XQ9A 3FZKB 3FHNA 4GIWA 3RYCE 1U4QA 5FXWA 5JDGA 2VKDA 2FJEA 3AAAB 3CX6B 4DUZT 4IREA 5HXSA 4A56A 3HL6A 4QKNA 1ZP0A 4HGAA 5FL0A 5FY0A 1WYCA 4XBFB 3PUSA 1FMWA 4BJNA 2SPCA 2W0GA 2WM9A 2X0HA 2BVLA 3ETVA 3QC9A 5BR8T 2WMNA 5AQGB 4IE7A 3ZN1B 4FJOA 4PK6A 3K1SA 5HWYA 1J5ET 4DNDA 3F57A 3EVYA 4P1NA 2VKOA 2H88A 1IBMT 5ADXL 4DR3T 4HTEA 2JRKA 2L8KA 3CQXC 3MA9A 4WNKA 1XDOA 2BS2A 2BS3A 2E2AA 5F8PA 5FXZA 4KUMB 2HN1A 3Q5XA 4OYJA 4ERRA 2VQFT 2CXFA 2P9BA 3AE2A 3OBVE 3JADA 5AQKB 2Y48B 3T8OA 2UXNB 3LFMA 5JR9C 3KV4A 3PTRB 4EIWA 1D1CA 3GN5A 1WR0A 2LHRA 5AQFB 5IUXA 3UUBA 3N2GE 1KNPA 1XWMA 2XQYA 3PJAJ 4TX5A 4ILUA 5AQUB 4COFA 3AXJB 3ZT5A 2NTXA 5J2TE 2FJAA 4B3ST 2IDOB 2M6IA 2DCFA 2QYWA 4LF5T 2M6BA 5J2UE 4C90A 3EUHA 2VQET 2IIUA 1UGOA 2HPLA 3AA1B 3ZMVB 4LF6T 5C3JA 4ISTA 2XZEA 2FJBA 4QXHB 2IUBA 2KNDA 2V6YA 3LJCA 4U31A 5LBQB 3ZC1A 3ZMSB 2CXDA 4EOZB 1W09A 2XJ7A 2E9XA 2EHOC 3NVOA 3QB5A 4ILAA 3I9WA 2CBJA 4H9SE 4NUUA 2LEHA 3NZQA 2NWBA 3UQ4A 1N34T 3J9X1 1OWAA 4PFPA 5KDMC 2WP9A 3KV5A 3C98B 4KP3C 2WAUA 4LMKA 4UF0A 2ZM0A 3L3PA 3R84B 2B76A 2M67A 4AKRB 4Q25A 4TUYE 4G63A 4ZEYA 1I6ZA 4HFVA 5HYAA 5A1LA 2Y8DA 2WU2A 5AQNB 1JNRA 5ABEA 3HKCE 5KX5E 2D0UA 2CE7A 3CX8B 4I55E 5DQVA 5HXHA 5KMGP 2WCAA 3MKDA 4GK5E 2LOPA 1MMNA 2XUEA 3QB5K 4P0BA 4X20E 3CWZB 4WYVA 5IHYA 2JMKA 3SFEA 5LGTB 4EEBA 3J7Yq 3KDSE 2VKHA 5KXJA 2D5UA 5JRCB 2BBJA 4Z91A 1HX1B 3P4WA 3LG7A 2XQ3A 5LCYA 4UVAB 3HKDE 5AQHB 2NOXA 3I9YA 2LKGA 1FIOA 3AB3B 4DV6T 2FBWA 2I6HA 4AIUA 2LSKA 3S4UA 3AA7B 4IDPA 5IYZE 2A9UA 2WWVA 1ZHCA 2WDVA 3I1AA 4DMWA 4GKJT 1S35A 1ZOYA 5EK3A 5IWAT 3ZT7A 3AE8A 4YJ2E 1QLBA 2VVSA 4HWCA 2UUBT 3ZC0A 2W61A 1AJ3A 2H3RA 2X9WA 4TWDA 4DR6T 1KK7A 4PJMA 4DVDA 3H3MA 4PW8A 3VRAA 5LG4A 2E9XD 2AE9A 2XPKA 3CQCB 3NZPA 4HFDA 4QH4A 5HEJA 5LHHB 2NW8A 1WYBA 3E0ZA 2UXXB 2V1DB 3UU3A 2QGSA 4BA9A 2NTYA 1HFAA 2WBLA 4O2AE 2V8SV 4AQGA 4X66T 3RRCA 3RYHE 2ZM6T 4X65T 5JQGE 3E22E 1T7SA 5L3CB 4ZS2A 3PUXF 4LFCT 2EHOD 5JDMA 4PJJA 2BBHA 2PFVA 4I4TE 4CN4A 4ZI3C 2IHR1 4P09A 2XTLA 3E08A 3KBUA 5E0OA 3SWHA 3L09A 4U2YA 2F4VT 2JQQA 3N2OA 2BG9C 3K3QC 3NRXA 5AQSB 2IW5B 4DR5T 3C64A 4HWHA 2W66A 4KMCA 2FUPA 1WFDA 4IDZA 1YQ4A 4UR9A 5ABHA 3OTOT 1BR0A 4X5TA 3AE9A 1YKHB 2YOEA 2LT3A 2RP4A 2X68A 3AE1A 4GYRA 4A98A 1QSDA 3FZHB 2OA5A 4PAGA 3ZPOA 3N2KE 2C5KT 2V5DA 3TLSA 3C51A 2WU5A 2N1GA 2XASB 2YDSA 2HH7A 5FVKA 3C4XA 5LGUB 3JC6D 4JEUB 2JPFA 4TWHA 4WBNE 1IBLT 4GKKT 4ZXLA 1VCTA 1WLXA 2YKSA 4IIJE 4ZI2D 2VB6A 2VK9A 5FYMA 3AXJA 2VL8A 4UEMA 5LB7B 5JDLA 4ZI7E 1XNRT 2W4XA 4ANJA 5FL1A 2VKJA 1W0AA 3ZMZB 5LG3A 4EV6A 3QUJA 1KF6A 3O4XE 1MMGA 4AI6A 2HN2A 3ABVA 4IDQA 3RC8A 3WAJA 2V7MA 2XQ4A 5HEGA 4AKGA 4P0AA 3PUZF 5FY7A 4PFOA 3RRWA 3CKDA 1FMVA 2ZM2A 2Z6EA 4ZZCA 1I94T 1SUMB 4HWIB 1LVKA 1NWMX 1UUSA 3MACA 5FY1A 1D0XA 4LFBT 4AKIA 2YU1A 4O4IE 4JYAT 2LHNA 4DV7T 3AEBA 2CLYB 5AQRB 2CRBA 2XQ6A 3DJBA 4JI2T 2UU9T 1IBKT 4X1IE 4LMLA 1MIWA 4QX7B 4F8HA 4HE8A 4MBQA 4IL9A 3RKGA 3BQLA 5CA0E 4O4LE 3K3OA 5EZYE 3M65A 2W63A 3P4PA 3RIUC 5LOVE 4KX6A 1WRDA 2MYSA 3AEAA 2BG9A 2UXDT 3CIRA 4LFAT 2JIWA 4WBOA 5HCMA 3ZT6A 2KSRA 2MAWA 2WWUA 4YSYA 4FI5A 3OPCA 3LSVA 4PK4A 3G06A 4Z90A 3RF1A 5JREA 4MLKA 3ZLIA 2BVMA 4LF4T 2ZLYA 1Y64B 4H63V 5DABA 1LVFA 3N9OA 4B3RT 4YJ3E 3AE5A 2HHHT 2X51A 3CMLA 5CA1E 2MOZA 1SA0E 3UUMA 1HNZT 5JR9B 4H9PC 3T1YT 2DLRA 2H7VC 3OYZA 4YLHA 3ETUA 4OHFA 3NKZA 3ZCIA 4YTNA 2KZ7B 1IZNB 5AQQB 5JH7E 4DIDB 4NXMT 3KVAA 3ONXA 1HR0T 4DR4T 5LMUT 2IC6A 4YTPA 5L3GB 3Q5WA 4PK5A 4NIQA 3UULA 1T98A 1MMAA 3N9PA 2XAJB 4Z8XA 1L0VA 4B3MT 4IE4A 3RH3A 1D1AA 1XDPA 2K5BB 4V1Av 2C5IT 3AEDA 2LOSA 3RHWA 3ZMUB 3UU8A 2Q9QC 5FXVA 4AQFA 3N5LA 4HFBA 3V5SA 2C0SA 3U78A 4N78D 3ZYKA 3B5MA 2PBIA 5CFBA 2V7LA 4TWFA 3ONLC 4IGUA 5LYJE 3ZSTA 2X66A 2CMRA 2DWGA 4ISSA 2BKNA 4A97A 2YDQA 5C2TA 2DI4A 2YK0A 1H7CA 2EHOB 3HA4A 4H9OC 2WY2A 3ZYLA 2EHOA 4NXNT 1IAPA 3CX7B 3AVRA 2CWOA 3QK6A 3P50A 3PV0F 4M1PA 2K48A 3AECA 4DV1T 2KWIB 4K0UA 5ABFA 1CHUA 1HG2A 2LKHA 4TZ4C 5LJMA 2J1DG 1UURA 2Q9QB 3HKBE 5HXCA 4EYYR 4KHPT 2Q9QA 4YY3T 4DV5T 3LK3B 1N36T 4O2BE 4L5GA 3ZJ1A 4YHHT 3AVSA 3CPZA 4K0KT 1Z0PA 4HFHA 4WW0A 2NW7A 4E7ZA 2E5LT 3D0TA 3UU6A 2CPTA 3SS1A 2XAFB 4ASKA 4OFZA 2RPAA 2KWHA 1NAFA 4DO0A 2D2SA 2X9YA 5L4EA 3KV9A 5BMVE 2DNXA 3MXZA 3NBXX 3KFWX 3QNUA 3EAMA 4DBRA 3K3NA 4OK0A 1UX4A 3RPUA 5HXEA 1HNXT 2JQKA 3U3IA 2DHRA 2PTFA 3AEGA 3ZCJA 1FEWA 3ZJ2A 3HI2A 2XQAA 5HAXA 2YN6A 3IBPA 4I0UA 2BKPA 2CXLA 3JCFA 4X62T 4DUYT 3VKHA 3AEEA 2QA7A 3WI3A 5EK4A 5EK2A 5H6RB 4EB6E 2C5JA 2CBIA 3RX6A 5FXXA 3OYXA 3SFDA 3UUNA 4BJMA 4DV2T 4OX9T 1D1BA 3VR9A 4DV0T 4U7IA 2VL0A 5JTGA 4JV5T 2E8IA 1U5PA 1E1HB 1W9RA 3EI0A 2CHOA 2WDRA 1OEDE 5F5WA 2IAKA 2UXCT 3NWIA 1Y01A 3CQGB 3RIUA 2W00A 2KINB 2YINA 1LRZA 2NP9A 3HKEE 4QH1A 3PUGA 3EDUA 2BKOA 5FKYA 1BR1A 4LF7T 1VCSA 3FXDB 5L4HA 3N9QA 4MFRA 3OVUA 4G2AA 2I59A 5LXTE 1G73A 3DTOA 4UF0B 4WZXA 4B3TT 2LLYA 1YKEB 2ODUA 4TNVA 4PJLA 4KHZF 2FJDA 2W67A 5JVDE 4MALA 3AE3A 2CWYA 1BR2A 1E2AA 1HG5A 3TLTA 3IEEA 2BS4A 3F31A 3Q9DA 5CJ5A 5DJQC 4CI3B 5FP3A 2XAGB 2A72A 4TNWA 2UXBT 5J1GA 5TAOA 3FB2A 1XMQT 4KBMB 4U74A 3WAKA 4H63H 3RC3A 1XNQT 3AA0B 3A5XA 4U2ZA 1HS7A 1MMDA 4X64T 3TKLB 3GN5B 2PG8A 3GWHA 5FMNA 5HEHA 5LJNA 4LF9T 2CEAA 2ACXA 2LM2A 3FZFB 4C91A 3PU8A 2QRXA 4IHJE 1MIVA 2JQ9A 1WCRA 2E5VA 1EZ3A 4YSXA 4CXYA 2W62A 1DU2A 5FNVE 1US7B 2XAQB 1S94A 2LM9A 3OJAA 3UUXB 3KVBA 3TLWA 5LA6E 2NW9A 3A7MA 5H6QB 4ZZBA 5LMNT 2A3DA 4HFEA 2YU2A 1X79A 2K24A 5LHGB 4JI8T 3C50A 3N9MA 2ES0A 2X9HA 3F2EA 2DWKA 2N2NA 2VVNA 3I0QA 2ODVA 4IL4A 3RIAA 3IF8B 2K3WA 3P4QA 1VOMA 3AE7A 3L8RA 4U72A 4UV9B 2K9AA 3RKOA 3FZLB 4AKHA 1QUUA 1ZV4X 4TV8E 5HEUA 4CI2B 3ZEFB 4DV4T 3LK42 3K8PC 2KXPB 5M4YA 2H7OA 3AEFA 4HFIA 2L9QA 3KV6A 2WB5A 5JDFA 2V7IA 1KNRA 3RI5A 2LRLA 1R8IA 1ZKEA 2I0MA 3LDQB 2G0UA 4HFCA 4IDOA 4YHJA 4ZI2C 4BAYB 4CQIA 2CLYC 3BK9A 4GOUA 3JC6C 4QHOA 4EAHA 2VWAA 4UELA 2J47A 3BQKA 1IJ5A 1YD8G 4O8SA 3VR8A 5ABFB 2JQHA 3O1JA 4EEDA 3CVRA 1NEKA 2D0TA 4QXBB 5CB4E 3A8YC 2N9DA 3EABA 4NPPA 1HTJF 3ANWB 3UU5A 5HXRA 3ANWA 2XM1A 5JDNA 5JDQA 1UX5A 4HN9A 3FXEB 4U33A 4CXWA 4JUYA 3MK7C 4DMVA 5J0ZA 1YW0A 2IMLA 3B57A 3ESLA 4I43B 2XSBA 4IE5A 3GA8A 2E9XB 1UCUA 2V6XA 4ZI3D 4X1YE 2B1EA 3JAEA 4JI7T 1M62A 2LJLA 3PUVF 4TN7B 3ZN0B 3PUYF 4YT0A 4J2CA 5L3FB 3Q5EA 4JI1T 4I50E 2VASA 4HEAA 2KLQA 5L3BB 4JI3T 2WQYA 2XAHB 3PUQA 4YTMA 3AE4A 2BZBA 3W15B 2LE8A 3RIFA 2WDQA 2AXDS 5L3EB 4IDNA 4TV9E 5AQPB 3VU7H 1KFYA 1YXRA 3X1DA 4CI1B 3AAEB 5F3JA 3RQUA 1XZYA 3P8CD 5C8YE 1N32T 3UFEA 3RYFE 2E9XC 4QXCB 4AQYT 2CA5A 1HX8A 2KT9A 4DBQA 3FZMB 4DR2T 5HCJA 2LSJA 3I0OA 2LSYA 4JEHB 2BDEA 3RQWA 4H9NC 3TLVA 4CZZB 2J4GA 1D0ZA 1FJGT 2WMOA 2X9XA 1B7TA 1LKXA 2Y6XA 4HKAA 4H9QC 5AFUL 4JI4T 5HWXA 3FBLA 1SE7A 4H9RC 2HPJA 5JDHA 5CGMA 4JI5T 2V5CA 5AQTB 3ZMTB 5L47A 4NUVA 4O4JE 2MTQA 4AISA 3ZYMA 3P4RA 2MPKA 2XQ7A 4AXPA 1N33T 2VURA 2WZIA 3EHZA 4QH5A 2QVAA 2LSIA 4L0RA 4YFSA 3V5UA 4QWNB 3VHLA 3O9XA 2UUAT 1KNZA 4UV8B 4JI6T 3N9NA 4EYUA 2XQ5A 1D0YA 2JMHA 2V7JA 3H3AA 4YSZA 2R6GF 3JAFA 5AQLB 3PE0A 3R6NA 3PJAA 4EXTA 5ETWA 2NR4A 3UQ7A 4DR7T 4CN6A 3GMIA 1HNWT 1YQ3A 3SRZA 3Q5DA 3VRBA 2UUCT 2CM0A 3H37A 1GQEA 2H89A 2V7KA 3PURA 2OLTA 1ZEEA 4MHCA 4OYKA 5HEOA 2DL1A 2OV9A 4U3CA 2ACZA 3BQIA 4EGWA 4F6RC 4HWFA 3NRYA 1MNEA 2LRKA 3C4ZA 3P7IA 5LNKA 5JR9A 4ZHQE 1W0BA 2L3LA 2ZMAA 1HF8A 2XM2A 4L9IA 4AKLA 5FVLA 4O4HE 2ZM8A 4IE6A 2XY8B
chains in the Genus database with same CATH topology
4X1KE 2LSGA 4ADZA 4XZCA 3PUAA 3AAIA 1CUNA 1IJ6A 4IE0A 5L2LA 5GONE 1MNDA 3UT5E 4QX8B 3FBZA 1V9DA 1O3XA 2WSSV 3MJXA 2JJ9A 3MZKB 3RYIE 5LP6E 3OKQA 2V26A 5L3DB 3AA6B 2GK9A 4PNIA 3PDYA 3B13A 1VRBA 4UVBB 4EZ4A 4JLEA 2X67A 4ZOLE 3O1HA 3Q2MA 1HCIA 2Q9QD 5LBMA 2RA1A 1SHZC 3N9LA 1BR4A 3EDVA 5LHIB 3PU3A 4UVCB 5JRCA 1MIYA 2YEVC 2A2FX 4UXNB 3VKGA 3KBTA 4AQFC 5LGNB 2KMFA 3LK2B 3C4WA 3KINB 4CXXA 1OXZA 1G8XA 3LBXA 3UTKA 3LBXB 4ZS3A 3IHRA 4GK0E 4UIGA 3HR0A 3SOLA 2XHEB 4GYSA 3DP7A 2MBGA 2X0LB 1WR6A 3O1IA 2PJQA 2CCQA 4PJNA 4XAXB 2IC9A 4EZHA 5DQWA 4E7SA 3RYCE 5JDGA 3FHNA 4GIWA 1U4QA 5FXWA 2VKDA 3AAAB 3CX6B 5HXSA 4A56A 3HL6A 4QKNA 4HGAA 5FY0A 1WYCA 4XBFB 3PUSA 1FMWA 4BJNA 2SPCA 2W0GA 2WM9A 2BVLA 3ETVA 3QC9A 2WMNA 4IE7A 3ZN1B 4FJOA 4PK6A 5HWYA 4DNDA 3F57A 3EVYA 2VKOA 5ADXL 4HTEA 3CQXC 2JRKA 2L8KA 3MA9A 4WNKA 5F8PA 5FXZA 4KUMB 4OYJA 3Q5XA 4ERRA 2CXFA 2P9BA 3OBVE 3T8OA 2Y48B 2UXNB 3LFMA 5JR9C 3KV4A 3PTRB 4EIWA 1D1CA 3GN5A 2LHRA 3N2GE 2XQYA 4TX5A 4ILUA 2NTXA 5J2TE 2DCFA 5J2UE 4C90A 3EUHA 2HPLA 3ZMVB 3AA1B 4ISTA 4QXHB 3ZC1A 2KNDA 3LJCA 5LBQB 3ZMSB 4EOZB 2CXDA 2E9XA 2EHOC 3I9WA 4H9SE 4NUUA 2LEHA 3NZQA 2NWBA 3J9X1 1OWAA 4PFPA 5KDMC 4KP3C 3KV5A 3C98B 4AQGA 2WAUA 4UF0A 3R84B 2ZM0A 3L3PA 4B6XA 3VKHA 2M67A 4AKRB 4TUYE 4G63A 4HFVA 5HYAA 5A1LA 2Y8DA 5KX5E 3HKCE 2D0UA 2CE7A 3CX8B 4I55E 5DQVA 5HXHA 5KMGP 4GK5E 3MKDA 5JREA 2LOPA 1MMNA 2XUEA 4P0BA 5IHYA 4X20E 3CWZB 5CA0E 2JMKA 5LGTB 3J7Yq 3KDSE 2VKHA 2D5UA 5JRCB 3LG7A 5LCYA 4UVAB 3HKDE 2NOXA 3I9YA 1FIOA 3AB3B 2LSKA 3S4UA 3AA7B 5IYZE 4DMWA 1ZHCA 3I1AA 1S35A 5EK3A 4YJ2E 3ZC0A 2W61A 1AJ3A 2H3RA 2X9WA 1KK7A 4PJMA 4DVDA 4PW8A 5LG4A 2E9XD 3CQCB 3NZPA 5LHHB 2NW8A 1WYBA 3E0ZA 2UXXB 2V1DB 2QGSA 4BA9A 2NTYA 1HFAA 2WBLA 4O2AE 3RRCA 3RYHE 5JQGE 3E22E 5L3CB 4ZS2A 2EHOD 5JDMA 4PJJA 2PFVA 4I4TE 4ZI3C 4P09A 2XTLA 3E08A 3KBUA 5E0OA 3SWHA 3L09A 2JQQA 3N2OA 3K3QC 3NRXA 2IW5B 3C64A 4KMCA 4IDZA 1BR0A 1YKHB 2LT3A 2RP4A 2X68A 4GYRA 1QSDA 4PAGA 2OA5A 3ZPOA 3N2KE 2C5KT 3C51A 2XASB 2N1GA 2HH7A 3C4XA 5LGUB 3JC6D 4JEUB 2JPFA 4WBNE 1WLXA 4ZI2D 4IIJE 2VB6A 2VK9A 5FYMA 2VL8A 4UEMA 5JDLA 4ZI7E 4ANJA 2VKJA 3ZMZB 3QUJA 3O4XE 1MMGA 4AI6A 4AKGA 3RC8A 3WAJA 2V7MA 4P0AA 3RRWA 5FY7A 4PFOA 3CKDA 1FMVA 2ZM2A 2Z6EA 1LVKA 1NWMX 3MACA 5FY1A 1D0XA 4AKIA 2YU1A 4O4IE 2LHNA 2CLYB 3DJBA 4X1IE 1MIWA 4QX7B 4HE8A 4MBQA 3BQLA 4O4LE 3K3OA 5EZYE 3M65A 2W63A 5LOVE 1WRDA 2MYSA 4WBOA 2WWUA 4FI5A 4PK4A 4MLKA 3ZLIA 2BVMA 2ZLYA 1Y64B 4H63V 5DABA 1LVFA 3N9OA 4YJ3E 2X51A 3CMLA 5CA1E 2MOZA 1SA0E 3UUMA 5JR9B 4H9PC 2DLRA 2H7VC 3OYZA 4YLHA 3ETUA 4OHFA 3ZCIA 2KZ7B 1IZNB 5JH7E 3KVAA 3ONXA 2IC6A 5L3GB 3Q5WA 4PK5A 3UULA 1T98A 1MMAA 3N9PA 2XAJB 4Z8XA 4IE4A 3RH3A 1D1AA 3ZCJA 2K5BB 4V1Av 2C5IT 3ZMUB 2LOSA 2Q9QC 5FXVA 4AQFA 3N5LA 3V5SA 2C0SA 3U78A 4N78D 3ZYKA 2PBIA 5LYJE 2V7LA 4IGUA 2X66A 2CMRA 2DWGA 4ISSA 2DI4A 2YK0A 1H7CA 2EHOB 3HA4A 4H9OC 3ZYLA 2EHOA 1IAPA 3CX7B 3AVRA 2CWOA 3QK6A 4M1PA 2K48A 2KWIB 4K0UA 1HG2A 4TZ4C 5LJMA 2J1DG 5HXCA 2Q9QB 3HKBE 4EYYR 2Q9QA 3LK3B 4O2BE 4L5GA 3ZJ1A 3AVSA 3CPZA 1Z0PA 4WW0A 2NW7A 4E7ZA 3D0TA 3SS1A 4ASKA 2XAFB 4OFZA 2KWHA 1NAFA 4DO0A 2D2SA 2X9YA 3KV9A 5BMVE 2DNXA 3MXZA 3NBXX 3KFWX 4DBRA 3K3NA 4OK0A 1UX4A 3RPUA 5HXEA 3U3IA 2DHRA 3ZJ2A 1FEWA 3HI2A 5HAXA 3IBPA 2CXLA 2QA7A 3WI3A 5EK4A 5EK2A 5H6RB 4EB6E 2C5JA 3RX6A 5FXXA 3OYXA 3UUNA 4BJMA 1D1BA 2E8IA 1U5PA 1E1HB 2IAKA 3CQGB 2W00A 2KINB 2YINA 1LRZA 2NP9A 3HKEE 3PUGA 3EDUA 1BR1A 3FXDB 3N9QA 4MFRA 4G2AA 2I59A 5LXTE 1G73A 3DTOA 4UF0B 1YKEB 2ODUA 4PJLA 5JVDE 4MALA 2CWYA 1BR2A 1HG5A 3IEEA 3F31A 3Q9DA 5DJQC 4CI3B 5FP3A 2XAGB 2A72A 5J1GA 5TAOA 3FB2A 4KBMB 4U74A 3WAKA 4H63H 3RC3A 3AA0B 3A5XA 1HS7A 1MMDA 3TKLB 3GN5B 3GWHA 2PG8A 5FMNA 5LJNA 2CEAA 2ACXA 4C91A 3PU8A 4IHJE 1MIVA 1EZ3A 4CXYA 2W62A 5FNVE 1US7B 2XAQB 1S94A 2LM9A 3OJAA 3UUXB 3KVBA 5LA6E 2NW9A 5H6QB 2A3DA 2YU2A 1X79A 2K24A 5LHGB 3C50A 3N9MA 2ES0A 2X9HA 3F2EA 2DWKA 2N2NA 3I0QA 2ODVA 3IF8B 1VOMA 4U72A 4UV9B 2K9AA 3RKOA 4AKHA 1QUUA 1ZV4X 4TV8E 4CI2B 3ZEFB 3LK42 3K8PC 2KXPB 5M4YA 2H7OA 2L9QA 3KV6A 5JDFA 2V7IA 1ZKEA 2G0UA 4YHJA 4ZI2C 4BAYB 4CQIA 2CLYC 3BK9A 4GOUA 3JC6C 4QHOA 4EAHA 2VWAA 4UELA 3BQKA 1IJ5A 1YD8G 4O8SA 3O1JA 3CVRA 2D0TA 4QXBB 5CB4E 2N9DA 1HTJF 3ANWB 5HXRA 3ANWA 5JDNA 5JDQA 1UX5A 4HN9A 3FXEB 4CXWA 4JUYA 3MK7C 4DMVA 1YW0A 3ESLA 3B57A 4I43B 4IE5A 3GA8A 2E9XB 1UCUA 4ZI3D 4X1YE 2B1EA 2LJLA 4TN7B 3ZN0B 5L3FB 4J2CA 4I50E 2VASA 4HEAA 2KLQA 5L3BB 2XAHB 3PUQA 3W15B 2BZBA 2LE8A 5L3EB 4TV9E 5F3JA 3VU7H 4CI1B 3AAEB 5C8YE 3P8CD 3UFEA 3RYFE 2E9XC 4QXCB 2CA5A 1HX8A 2KT9A 4DBQA 2LSJA 3I0OA 2LSYA 4JEHB 2BDEA 4H9NC 4CZZB 1D0ZA 2WMOA 2X9XA 1B7TA 1LKXA 2Y6XA 4HKAA 4H9QC 5AFUL 5HWXA 3FBLA 4H9RC 5JDHA 2HPJA 3ZMTB 4NUVA 4O4JE 2MTQA 3ZYMA 4AXPA 1KNZA 2LSIA 4L0RA 4YFSA 3V5UA 4QWNB 3VHLA 3O9XA 4UV8B 3N9NA 4EYUA 1D0YA 2JMHA 2V7JA 3H3AA 3R6NA 4EXTA 3PE0A 5ETWA 3GMIA 3SRZA 2CM0A 3H37A 2V7KA 3PURA 4MHCA 1ZEEA 4OYKA 3BQIA 4F6RC 3NRYA 1MNEA 3C4ZA 3P7IA 5LNKA 5JR9A 4ZHQE 2L3LA 2ZMAA 1HF8A 4AKLA 4L9IA 4O4HE 2ZM8A 4IE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLY C;  2WSS V; 
#chains in the Genus database with same CATH topology
 4YXD A;  3ONJ A;  4X1K E;  2LSG A;  4ADZ A;  1E7P A;  4XZC A;  4HWD A;  3IA3 A;  3PUA A;  3AAI A;  1CUN A;  1J1J A;  3PUW F;  2V6Y B;  1IJ6 A;  4IE0 A;  2X0Y A;  4LF8 T;  5L2L A;  4DR1 T;  5GON E;  1MND A;  5AQJ B;  4QX8 B;  1NEN A;  3FBZ A;  1V9D A;  3L39 A;  3UT5 E;  1O3X A;  2WSS V;  1KEY A;  1X9B A;  3CK6 A;  3MJX A;  2JJ9 A;  3MZK B;  3RYI E;  3T1H T;  1JNZ A;  5LP6 E;  4IT4 A;  2WS3 A;  3OKQ A;  2V26 A;  4ILB A;  2BG9 E;  4ILC A;  5L3D B;  3AA6 B;  5AQV B;  2GK9 A;  1Z8U A;  1M7K A;  4PNI A;  3PDY A;  3B13 A;  1VRB A;  4UVB B;  4EZ4 A;  4JLE A;  4DV3 T;  2BG9 B;  2X67 A;  4ZOL E;  1J5W A;  3O1H A;  3Q2M A;  5AQM B;  1HCI A;  1T8B A;  2Q9Q D;  5LBM A;  3UFG A;  3P4S A;  2RA1 A;  1SHZ C;  2XSA A;  3N9L A;  2J62 A;  1BR4 A;  3EDV A;  5LHI B;  3PU3 A;  4UVC B;  5JRC A;  1OED C;  1MIY A;  2YEV C;  2A2F X;  4UXN B;  3VKG A;  2CHN A;  1UK5 A;  2XQ8 A;  3KBT A;  4JBW F;  3AE6 A;  2D9D A;  2WZH A;  4AQF C;  4LMJ A;  5LGN B;  2KMF A;  3LK2 B;  3C4W A;  3KIN B;  4CXX A;  1OXZ A;  3RLF F;  1G8X A;  1T72 A;  3LBX A;  3UTK A;  5AQO B;  3ZSS A;  3LBX B;  4ZS3 A;  3IHR A;  4GK0 E;  4UIG A;  5AQI B;  2YDR A;  4CN1 A;  3HR0 A;  3SOL A;  2XHE B;  4GYS A;  3DP7 A;  2MBG A;  2X0L B;  4U7Y A;  3M3Z B;  1WR6 A;  3O1I A;  3UU4 A;  1OED B;  4JI0 T;  2PJQ A;  4A5X A;  1XMO T;  1OED A;  2CCQ A;  4KI0 F;  4B6X A;  4PJN A;  4XAX B;  2IC9 A;  5ABG A;  2W2U A;  3RGL A;  3TLU A;  3ZKR A;  5DQW A;  4EZH A;  4E7S A;  3QOF A;  2XQ9 A;  3FZK B;  3FHN A;  4GIW A;  3RYC E;  1U4Q A;  5FXW A;  5JDG A;  2VKD A;  2FJE A;  3AAA B;  3CX6 B;  4DUZ T;  4IRE A;  5HXS A;  4A56 A;  3HL6 A;  4QKN A;  1ZP0 A;  4HGA A;  5FL0 A;  5FY0 A;  1WYC A;  4XBF B;  3PUS A;  1FMW A;  4BJN A;  2SPC A;  2W0G A;  2WM9 A;  2X0H A;  2BVL A;  3ETV A;  3QC9 A;  5BR8 T;  2WMN A;  5AQG B;  4IE7 A;  3ZN1 B;  4FJO A;  4PK6 A;  3K1S A;  5HWY A;  1J5E T;  4DND A;  3F57 A;  3EVY A;  4P1N A;  2VKO A;  2H88 A;  1IBM T;  5ADX L;  4DR3 T;  4HTE A;  2JRK A;  2L8K A;  3CQX C;  3MA9 A;  4WNK A;  1XDO A;  2BS2 A;  2BS3 A;  2E2A A;  5F8P A;  5FXZ A;  4KUM B;  2HN1 A;  3Q5X A;  4OYJ A;  4ERR A;  2VQF T;  2CXF A;  2P9B A;  3AE2 A;  3OBV E;  3JAD A;  5AQK B;  2Y48 B;  3T8O A;  2UXN B;  3LFM A;  5JR9 C;  3KV4 A;  3PTR B;  4EIW A;  1D1C A;  3GN5 A;  1WR0 A;  2LHR A;  5AQF B;  5IUX A;  3UUB A;  3N2G E;  1KNP A;  1XWM A;  2XQY A;  3PJA J;  4TX5 A;  4ILU A;  5AQU B;  4COF A;  3AXJ B;  3ZT5 A;  2NTX A;  5J2T E;  2FJA A;  4B3S T;  2IDO B;  2M6I A;  2DCF A;  2QYW A;  4LF5 T;  2M6B A;  5J2U E;  4C90 A;  3EUH A;  2VQE T;  2IIU A;  1UGO A;  2HPL A;  3AA1 B;  3ZMV B;  4LF6 T;  5C3J A;  4IST A;  2XZE A;  2FJB A;  4QXH B;  2IUB A;  2KND A;  2V6Y A;  3LJC A;  4U31 A;  5LBQ B;  3ZC1 A;  3ZMS B;  2CXD A;  4EOZ B;  1W09 A;  2XJ7 A;  2E9X A;  2EHO C;  3NVO A;  3QB5 A;  4ILA A;  3I9W A;  2CBJ A;  4H9S E;  4NUU A;  2LEH A;  3NZQ A;  2NWB A;  3UQ4 A;  1N34 T;  3J9X 1;  1OWA A;  4PFP A;  5KDM C;  2WP9 A;  3KV5 A;  3C98 B;  4KP3 C;  2WAU A;  4LMK A;  4UF0 A;  2ZM0 A;  3L3P A;  3R84 B;  2B76 A;  2M67 A;  4AKR B;  4Q25 A;  4TUY E;  4G63 A;  4ZEY A;  1I6Z A;  4HFV A;  5HYA A;  5A1L A;  2Y8D A;  2WU2 A;  5AQN B;  1JNR A;  5ABE A;  3HKC E;  5KX5 E;  2D0U A;  2CE7 A;  3CX8 B;  4I55 E;  5DQV A;  5HXH A;  5KMG P;  2WCA A;  3MKD A;  4GK5 E;  2LOP A;  1MMN A;  2XUE A;  3QB5 K;  4P0B A;  4X20 E;  3CWZ B;  4WYV A;  5IHY A;  2JMK A;  3SFE A;  5LGT B;  4EEB A;  3J7Y q;  3KDS E;  2VKH A;  5KXJ A;  2D5U A;  5JRC B;  2BBJ A;  4Z91 A;  1HX1 B;  3P4W A;  3LG7 A;  2XQ3 A;  5LCY A;  4UVA B;  3HKD E;  5AQH B;  2NOX A;  3I9Y A;  2LKG A;  1FIO A;  3AB3 B;  4DV6 T;  2FBW A;  2I6H A;  4AIU A;  2LSK A;  3S4U A;  3AA7 B;  4IDP A;  5IYZ E;  2A9U A;  2WWV A;  1ZHC A;  2WDV A;  3I1A A;  4DMW A;  4GKJ T;  1S35 A;  1ZOY A;  5EK3 A;  5IWA T;  3ZT7 A;  3AE8 A;  4YJ2 E;  1QLB A;  2VVS A;  4HWC A;  2UUB T;  3ZC0 A;  2W61 A;  1AJ3 A;  2H3R A;  2X9W A;  4TWD A;  4DR6 T;  1KK7 A;  4PJM A;  4DVD A;  3H3M A;  4PW8 A;  3VRA A;  5LG4 A;  2E9X D;  2AE9 A;  2XPK A;  3CQC B;  3NZP A;  4HFD A;  4QH4 A;  5HEJ A;  5LHH B;  2NW8 A;  1WYB A;  3E0Z A;  2UXX B;  2V1D B;  3UU3 A;  2QGS A;  4BA9 A;  2NTY A;  1HFA A;  2WBL A;  4O2A E;  2V8S V;  4AQG A;  4X66 T;  3RRC A;  3RYH E;  2ZM6 T;  4X65 T;  5JQG E;  3E22 E;  1T7S A;  5L3C B;  4ZS2 A;  3PUX F;  4LFC T;  2EHO D;  5JDM A;  4PJJ A;  2BBH A;  2PFV A;  4I4T E;  4CN4 A;  4ZI3 C;  2IHR 1;  4P09 A;  2XTL A;  3E08 A;  3KBU A;  5E0O A;  3SWH A;  3L09 A;  4U2Y A;  2F4V T;  2JQQ A;  3N2O A;  2BG9 C;  3K3Q C;  3NRX A;  5AQS B;  2IW5 B;  4DR5 T;  3C64 A;  4HWH A;  2W66 A;  4KMC A;  2FUP A;  1WFD A;  4IDZ A;  1YQ4 A;  4UR9 A;  5ABH A;  3OTO T;  1BR0 A;  4X5T A;  3AE9 A;  1YKH B;  2YOE A;  2LT3 A;  2RP4 A;  2X68 A;  3AE1 A;  4GYR A;  4A98 A;  1QSD A;  3FZH B;  2OA5 A;  4PAG A;  3ZPO A;  3N2K E;  2C5K T;  2V5D A;  3TLS A;  3C51 A;  2WU5 A;  2N1G A;  2XAS B;  2YDS A;  2HH7 A;  5FVK A;  3C4X A;  5LGU B;  3JC6 D;  4JEU B;  2JPF A;  4TWH A;  4WBN E;  1IBL T;  4GKK T;  4ZXL A;  1VCT A;  1WLX A;  2YKS A;  4IIJ E;  4ZI2 D;  2VB6 A;  2VK9 A;  5FYM A;  3AXJ A;  2VL8 A;  4UEM A;  5LB7 B;  5JDL A;  4ZI7 E;  1XNR T;  2W4X A;  4ANJ A;  5FL1 A;  2VKJ A;  1W0A A;  3ZMZ B;  5LG3 A;  4EV6 A;  3QUJ A;  1KF6 A;  3O4X E;  1MMG A;  4AI6 A;  2HN2 A;  3ABV A;  4IDQ A;  3RC8 A;  3WAJ A;  2V7M A;  2XQ4 A;  5HEG A;  4AKG A;  4P0A A;  3PUZ F;  5FY7 A;  4PFO A;  3RRW A;  3CKD A;  1FMV A;  2ZM2 A;  2Z6E A;  4ZZC A;  1I94 T;  1SUM B;  4HWI B;  1LVK A;  1NWM X;  1UUS A;  3MAC A;  5FY1 A;  1D0X A;  4LFB T;  4AKI A;  2YU1 A;  4O4I E;  4JYA T;  2LHN A;  4DV7 T;  3AEB A;  2CLY B;  5AQR B;  2CRB A;  2XQ6 A;  3DJB A;  4JI2 T;  2UU9 T;  1IBK T;  4X1I E;  4LML A;  1MIW A;  4QX7 B;  4F8H A;  4HE8 A;  4MBQ A;  4IL9 A;  3RKG A;  3BQL A;  5CA0 E;  4O4L E;  3K3O A;  5EZY E;  3M65 A;  2W63 A;  3P4P A;  3RIU C;  5LOV E;  4KX6 A;  1WRD A;  2MYS A;  3AEA A;  2BG9 A;  2UXD T;  3CIR A;  4LFA T;  2JIW A;  4WBO A;  5HCM A;  3ZT6 A;  2KSR A;  2MAW A;  2WWU A;  4YSY A;  4FI5 A;  3OPC A;  3LSV A;  4PK4 A;  3G06 A;  4Z90 A;  3RF1 A;  5JRE A;  4MLK A;  3ZLI A;  2BVM A;  4LF4 T;  2ZLY A;  1Y64 B;  4H63 V;  5DAB A;  1LVF A;  3N9O A;  4B3R T;  4YJ3 E;  3AE5 A;  2HHH T;  2X51 A;  3CML A;  5CA1 E;  2MOZ A;  1SA0 E;  3UUM A;  1HNZ T;  5JR9 B;  4H9P C;  3T1Y T;  2DLR A;  2H7V C;  3OYZ A;  4YLH A;  3ETU A;  4OHF A;  3NKZ A;  3ZCI A;  4YTN A;  2KZ7 B;  1IZN B;  5AQQ B;  5JH7 E;  4DID B;  4NXM T;  3KVA A;  3ONX A;  1HR0 T;  4DR4 T;  5LMU T;  2IC6 A;  4YTP A;  5L3G B;  3Q5W A;  4PK5 A;  4NIQ A;  3UUL A;  1T98 A;  1MMA A;  3N9P A;  2XAJ B;  4Z8X A;  1L0V A;  4B3M T;  4IE4 A;  3RH3 A;  1D1A A;  1XDP A;  2K5B B;  4V1A v;  2C5I T;  3AED A;  2LOS A;  3RHW A;  3ZMU B;  3UU8 A;  2Q9Q C;  5FXV A;  4AQF A;  3N5L A;  4HFB A;  3V5S A;  2C0S A;  3U78 A;  4N78 D;  3ZYK A;  3B5M A;  2PBI A;  5CFB A;  2V7L A;  4TWF A;  3ONL C;  4IGU A;  5LYJ E;  3ZST A;  2X66 A;  2CMR A;  2DWG A;  4ISS A;  2BKN A;  4A97 A;  2YDQ A;  5C2T A;  2DI4 A;  2YK0 A;  1H7C A;  2EHO B;  3HA4 A;  4H9O C;  2WY2 A;  3ZYL A;  2EHO A;  4NXN T;  1IAP A;  3CX7 B;  3AVR A;  2CWO A;  3QK6 A;  3P50 A;  3PV0 F;  4M1P A;  2K48 A;  3AEC A;  4DV1 T;  2KWI B;  4K0U A;  5ABF A;  1CHU A;  1HG2 A;  2LKH A;  4TZ4 C;  5LJM A;  2J1D G;  1UUR A;  2Q9Q B;  3HKB E;  5HXC A;  4EYY R;  4KHP T;  2Q9Q A;  4YY3 T;  4DV5 T;  3LK3 B;  1N36 T;  4O2B E;  4L5G A;  3ZJ1 A;  4YHH T;  3AVS A;  3CPZ A;  4K0K T;  1Z0P A;  4HFH A;  4WW0 A;  2NW7 A;  4E7Z A;  2E5L T;  3D0T A;  3UU6 A;  2CPT A;  3SS1 A;  2XAF B;  4ASK A;  4OFZ A;  2RPA A;  2KWH A;  1NAF A;  4DO0 A;  2D2S A;  2X9Y A;  5L4E A;  3KV9 A;  5BMV E;  2DNX A;  3MXZ A;  3NBX X;  3KFW X;  3QNU A;  3EAM A;  4DBR A;  3K3N A;  4OK0 A;  1UX4 A;  3RPU A;  5HXE A;  1HNX T;  2JQK A;  3U3I A;  2DHR A;  2PTF A;  3AEG A;  3ZCJ A;  1FEW A;  3ZJ2 A;  3HI2 A;  2XQA A;  5HAX A;  2YN6 A;  3IBP A;  4I0U A;  2BKP A;  2CXL A;  3JCF A;  4X62 T;  4DUY T;  3VKH A;  3AEE A;  2QA7 A;  3WI3 A;  5EK4 A;  5EK2 A;  5H6R B;  4EB6 E;  2C5J A;  2CBI A;  3RX6 A;  5FXX A;  3OYX A;  3SFD A;  3UUN A;  4BJM A;  4DV2 T;  4OX9 T;  1D1B A;  3VR9 A;  4DV0 T;  4U7I A;  2VL0 A;  5JTG A;  4JV5 T;  2E8I A;  1U5P A;  1E1H B;  1W9R A;  3EI0 A;  2CHO A;  2WDR A;  1OED E;  5F5W A;  2IAK A;  2UXC T;  3NWI A;  1Y01 A;  3CQG B;  3RIU A;  2W00 A;  2KIN B;  2YIN A;  1LRZ A;  2NP9 A;  3HKE E;  4QH1 A;  3PUG A;  3EDU A;  2BKO A;  5FKY A;  1BR1 A;  4LF7 T;  1VCS A;  3FXD B;  5L4H A;  3N9Q A;  4MFR A;  3OVU A;  4G2A A;  2I59 A;  5LXT E;  1G73 A;  3DTO A;  4UF0 B;  4WZX A;  4B3T T;  2LLY A;  1YKE B;  2ODU A;  4TNV A;  4PJL A;  4KHZ F;  2FJD A;  2W67 A;  5JVD E;  4MAL A;  3AE3 A;  2CWY A;  1BR2 A;  1E2A A;  1HG5 A;  3TLT A;  3IEE A;  2BS4 A;  3F31 A;  3Q9D A;  5CJ5 A;  5DJQ C;  4CI3 B;  5FP3 A;  2XAG B;  2A72 A;  4TNW A;  2UXB T;  5J1G A;  5TAO A;  3FB2 A;  1XMQ T;  4KBM B;  4U74 A;  3WAK A;  4H63 H;  3RC3 A;  1XNQ T;  3AA0 B;  3A5X A;  4U2Z A;  1HS7 A;  1MMD A;  4X64 T;  3TKL B;  3GN5 B;  2PG8 A;  3GWH A;  5FMN A;  5HEH A;  5LJN A;  4LF9 T;  2CEA A;  2ACX A;  2LM2 A;  3FZF B;  4C91 A;  3PU8 A;  2QRX A;  4IHJ E;  1MIV A;  2JQ9 A;  1WCR A;  2E5V A;  1EZ3 A;  4YSX A;  4CXY A;  2W62 A;  1DU2 A;  5FNV E;  1US7 B;  2XAQ B;  1S94 A;  2LM9 A;  3OJA A;  3UUX B;  3KVB A;  3TLW A;  5LA6 E;  2NW9 A;  3A7M A;  5H6Q B;  4ZZB A;  5LMN T;  2A3D A;  4HFE A;  2YU2 A;  1X79 A;  2K24 A;  5LHG B;  4JI8 T;  3C50 A;  3N9M A;  2ES0 A;  2X9H A;  3F2E A;  2DWK A;  2N2N A;  2VVN A;  3I0Q A;  2ODV A;  4IL4 A;  3RIA A;  3IF8 B;  2K3W A;  3P4Q A;  1VOM A;  3AE7 A;  3L8R A;  4U72 A;  4UV9 B;  2K9A A;  3RKO A;  3FZL B;  4AKH A;  1QUU A;  1ZV4 X;  4TV8 E;  5HEU A;  4CI2 B;  3ZEF B;  4DV4 T;  3LK4 2;  3K8P C;  2KXP B;  5M4Y A;  2H7O A;  3AEF A;  4HFI A;  2L9Q A;  3KV6 A;  2WB5 A;  5JDF A;  2V7I A;  1KNR A;  3RI5 A;  2LRL A;  1R8I A;  1ZKE A;  2I0M A;  3LDQ B;  2G0U A;  4HFC A;  4IDO A;  4YHJ A;  4ZI2 C;  4BAY B;  4CQI A;  2CLY C;  3BK9 A;  4GOU A;  3JC6 C;  4QHO A;  4EAH A;  2VWA A;  4UEL A;  2J47 A;  3BQK A;  1IJ5 A;  1YD8 G;  4O8S A;  3VR8 A;  5ABF B;  2JQH A;  3O1J A;  4EED A;  3CVR A;  1NEK A;  2D0T A;  4QXB B;  5CB4 E;  3A8Y C;  2N9D A;  3EAB A;  4NPP A;  1HTJ F;  3ANW B;  3UU5 A;  5HXR A;  3ANW A;  2XM1 A;  5JDN A;  5JDQ A;  1UX5 A;  4HN9 A;  3FXE B;  4U33 A;  4CXW A;  4JUY A;  3MK7 C;  4DMV A;  5J0Z A;  1YW0 A;  2IML A;  3B57 A;  3ESL A;  4I43 B;  2XSB A;  4IE5 A;  3GA8 A;  2E9X B;  1UCU A;  2V6X A;  4ZI3 D;  4X1Y E;  2B1E A;  3JAE A;  4JI7 T;  1M62 A;  2LJL A;  3PUV F;  4TN7 B;  3ZN0 B;  3PUY F;  4YT0 A;  4J2C A;  5L3F B;  3Q5E A;  4JI1 T;  4I50 E;  2VAS A;  4HEA A;  2KLQ A;  5L3B B;  4JI3 T;  2WQY A;  2XAH B;  3PUQ A;  4YTM A;  3AE4 A;  2BZB A;  3W15 B;  2LE8 A;  3RIF A;  2WDQ A;  2AXD S;  5L3E B;  4IDN A;  4TV9 E;  5AQP B;  3VU7 H;  1KFY A;  1YXR A;  3X1D A;  4CI1 B;  3AAE B;  5F3J A;  3RQU A;  1XZY A;  3P8C D;  5C8Y E;  1N32 T;  3UFE A;  3RYF E;  2E9X C;  4QXC B;  4AQY T;  2CA5 A;  1HX8 A;  2KT9 A;  4DBQ A;  3FZM B;  4DR2 T;  5HCJ A;  2LSJ A;  3I0O A;  2LSY A;  4JEH B;  2BDE A;  3RQW A;  4H9N C;  3TLV A;  4CZZ B;  2J4G A;  1D0Z A;  1FJG T;  2WMO A;  2X9X A;  1B7T A;  1LKX A;  2Y6X A;  4HKA A;  4H9Q C;  5AFU L;  4JI4 T;  5HWX A;  3FBL A;  1SE7 A;  4H9R C;  2HPJ A;  5JDH A;  5CGM A;  4JI5 T;  2V5C A;  5AQT B;  3ZMT B;  5L47 A;  4NUV A;  4O4J E;  2MTQ A;  4AIS A;  3ZYM A;  3P4R A;  2MPK A;  2XQ7 A;  4AXP A;  1N33 T;  2VUR A;  2WZI A;  3EHZ A;  4QH5 A;  2QVA A;  2LSI A;  4L0R A;  4YFS A;  3V5U A;  4QWN B;  3VHL A;  3O9X A;  2UUA T;  1KNZ A;  4UV8 B;  4JI6 T;  3N9N A;  4EYU A;  2XQ5 A;  1D0Y A;  2JMH A;  2V7J A;  3H3A A;  4YSZ A;  2R6G F;  3JAF A;  5AQL B;  3PE0 A;  3R6N A;  3PJA A;  4EXT A;  5ETW A;  2NR4 A;  3UQ7 A;  4DR7 T;  4CN6 A;  3GMI A;  1HNW T;  1YQ3 A;  3SRZ A;  3Q5D A;  3VRB A;  2UUC T;  2CM0 A;  3H37 A;  1GQE A;  2H89 A;  2V7K A;  3PUR A;  2OLT A;  1ZEE A;  4MHC A;  4OYK A;  5HEO A;  2DL1 A;  2OV9 A;  4U3C A;  2ACZ A;  3BQI A;  4EGW A;  4F6R C;  4HWF A;  3NRY A;  1MNE A;  2LRK A;  3C4Z A;  3P7I A;  5LNK A;  5JR9 A;  4ZHQ E;  1W0B A;  2L3L A;  2ZMA A;  1HF8 A;  2XM2 A;  4L9I A;  4AKL A;  5FVL A;  4O4H E;  2ZM8 A;  4IE6 A;  2XY8 B; 
#chains in the Genus database with same CATH homology
 4X1K E;  2LSG A;  4ADZ A;  4XZC A;  3PUA A;  3AAI A;  1CUN A;  1IJ6 A;  4IE0 A;  5L2L A;  5GON E;  1MND A;  3UT5 E;  4QX8 B;  3FBZ A;  1V9D A;  1O3X A;  2WSS V;  3MJX A;  2JJ9 A;  3MZK B;  3RYI E;  5LP6 E;  3OKQ A;  2V26 A;  5L3D B;  3AA6 B;  2GK9 A;  4PNI A;  3PDY A;  3B13 A;  1VRB A;  4UVB B;  4EZ4 A;  4JLE A;  2X67 A;  4ZOL E;  3O1H A;  3Q2M A;  1HCI A;  2Q9Q D;  5LBM A;  2RA1 A;  1SHZ C;  3N9L A;  1BR4 A;  3EDV A;  5LHI B;  3PU3 A;  4UVC B;  5JRC A;  1MIY A;  2YEV C;  2A2F X;  4UXN B;  3VKG A;  3KBT A;  4AQF C;  5LGN B;  2KMF A;  3LK2 B;  3C4W A;  3KIN B;  4CXX A;  1OXZ A;  1G8X A;  3LBX A;  3UTK A;  3LBX B;  4ZS3 A;  3IHR A;  4GK0 E;  4UIG A;  3HR0 A;  3SOL A;  2XHE B;  4GYS A;  3DP7 A;  2MBG A;  2X0L B;  1WR6 A;  3O1I A;  2PJQ A;  2CCQ A;  4PJN A;  4XAX B;  2IC9 A;  4EZH A;  5DQW A;  4E7S A;  3RYC E;  5JDG A;  3FHN A;  4GIW A;  1U4Q A;  5FXW A;  2VKD A;  3AAA B;  3CX6 B;  5HXS A;  4A56 A;  3HL6 A;  4QKN A;  4HGA A;  5FY0 A;  1WYC A;  4XBF B;  3PUS A;  1FMW A;  4BJN A;  2SPC A;  2W0G A;  2WM9 A;  2BVL A;  3ETV A;  3QC9 A;  2WMN A;  4IE7 A;  3ZN1 B;  4FJO A;  4PK6 A;  5HWY A;  4DND A;  3F57 A;  3EVY A;  2VKO A;  5ADX L;  4HTE A;  3CQX C;  2JRK A;  2L8K A;  3MA9 A;  4WNK A;  5F8P A;  5FXZ A;  4KUM B;  4OYJ A;  3Q5X A;  4ERR A;  2CXF A;  2P9B A;  3OBV E;  3T8O A;  2Y48 B;  2UXN B;  3LFM A;  5JR9 C;  3KV4 A;  3PTR B;  4EIW A;  1D1C A;  3GN5 A;  2LHR A;  3N2G E;  2XQY A;  4TX5 A;  4ILU A;  2NTX A;  5J2T E;  2DCF A;  5J2U E;  4C90 A;  3EUH A;  2HPL A;  3ZMV B;  3AA1 B;  4IST A;  4QXH B;  3ZC1 A;  2KND A;  3LJC A;  5LBQ B;  3ZMS B;  4EOZ B;  2CXD A;  2E9X A;  2EHO C;  3I9W A;  4H9S E;  4NUU A;  2LEH A;  3NZQ A;  2NWB A;  3J9X 1;  1OWA A;  4PFP A;  5KDM C;  4KP3 C;  3KV5 A;  3C98 B;  4AQG A;  2WAU A;  4UF0 A;  3R84 B;  2ZM0 A;  3L3P A;  4B6X A;  3VKH A;  2M67 A;  4AKR B;  4TUY E;  4G63 A;  4HFV A;  5HYA A;  5A1L A;  2Y8D A;  5KX5 E;  3HKC E;  2D0U A;  2CE7 A;  3CX8 B;  4I55 E;  5DQV A;  5HXH A;  5KMG P;  4GK5 E;  3MKD A;  5JRE A;  2LOP A;  1MMN A;  2XUE A;  4P0B A;  5IHY A;  4X20 E;  3CWZ B;  5CA0 E;  2JMK A;  5LGT B;  3J7Y q;  3KDS E;  2VKH A;  2D5U A;  5JRC B;  3LG7 A;  5LCY A;  4UVA B;  3HKD E;  2NOX A;  3I9Y A;  1FIO A;  3AB3 B;  2LSK A;  3S4U A;  3AA7 B;  5IYZ E;  4DMW A;  1ZHC A;  3I1A A;  1S35 A;  5EK3 A;  4YJ2 E;  3ZC0 A;  2W61 A;  1AJ3 A;  2H3R A;  2X9W A;  1KK7 A;  4PJM A;  4DVD A;  4PW8 A;  5LG4 A;  2E9X D;  3CQC B;  3NZP A;  5LHH B;  2NW8 A;  1WYB A;  3E0Z A;  2UXX B;  2V1D B;  2QGS A;  4BA9 A;  2NTY A;  1HFA A;  2WBL A;  4O2A E;  3RRC A;  3RYH E;  5JQG E;  3E22 E;  5L3C B;  4ZS2 A;  2EHO D;  5JDM A;  4PJJ A;  2PFV A;  4I4T E;  4ZI3 C;  4P09 A;  2XTL A;  3E08 A;  3KBU A;  5E0O A;  3SWH A;  3L09 A;  2JQQ A;  3N2O A;  3K3Q C;  3NRX A;  2IW5 B;  3C64 A;  4KMC A;  4IDZ A;  1BR0 A;  1YKH B;  2LT3 A;  2RP4 A;  2X68 A;  4GYR A;  1QSD A;  4PAG A;  2OA5 A;  3ZPO A;  3N2K E;  2C5K T;  3C51 A;  2XAS B;  2N1G A;  2HH7 A;  3C4X A;  5LGU B;  3JC6 D;  4JEU B;  2JPF A;  4WBN E;  1WLX A;  4ZI2 D;  4IIJ E;  2VB6 A;  2VK9 A;  5FYM A;  2VL8 A;  4UEM A;  5JDL A;  4ZI7 E;  4ANJ A;  2VKJ A;  3ZMZ B;  3QUJ A;  3O4X E;  1MMG A;  4AI6 A;  4AKG A;  3RC8 A;  3WAJ A;  2V7M A;  4P0A A;  3RRW A;  5FY7 A;  4PFO A;  3CKD A;  1FMV A;  2ZM2 A;  2Z6E A;  1LVK A;  1NWM X;  3MAC A;  5FY1 A;  1D0X A;  4AKI A;  2YU1 A;  4O4I E;  2LHN A;  2CLY B;  3DJB A;  4X1I E;  1MIW A;  4QX7 B;  4HE8 A;  4MBQ A;  3BQL A;  4O4L E;  3K3O A;  5EZY E;  3M65 A;  2W63 A;  5LOV E;  1WRD A;  2MYS A;  4WBO A;  2WWU A;  4FI5 A;  4PK4 A;  4MLK A;  3ZLI A;  2BVM A;  2ZLY A;  1Y64 B;  4H63 V;  5DAB A;  1LVF A;  3N9O A;  4YJ3 E;  2X51 A;  3CML A;  5CA1 E;  2MOZ A;  1SA0 E;  3UUM A;  5JR9 B;  4H9P C;  2DLR A;  2H7V C;  3OYZ A;  4YLH A;  3ETU A;  4OHF A;  3ZCI A;  2KZ7 B;  1IZN B;  5JH7 E;  3KVA A;  3ONX A;  2IC6 A;  5L3G B;  3Q5W A;  4PK5 A;  3UUL A;  1T98 A;  1MMA A;  3N9P A;  2XAJ B;  4Z8X A;  4IE4 A;  3RH3 A;  1D1A A;  3ZCJ A;  2K5B B;  4V1A v;  2C5I T;  3ZMU B;  2LOS A;  2Q9Q C;  5FXV A;  4AQF A;  3N5L A;  3V5S A;  2C0S A;  3U78 A;  4N78 D;  3ZYK A;  2PBI A;  5LYJ E;  2V7L A;  4IGU A;  2X66 A;  2CMR A;  2DWG A;  4ISS A;  2DI4 A;  2YK0 A;  1H7C A;  2EHO B;  3HA4 A;  4H9O C;  3ZYL A;  2EHO A;  1IAP A;  3CX7 B;  3AVR A;  2CWO A;  3QK6 A;  4M1P A;  2K48 A;  2KWI B;  4K0U A;  1HG2 A;  4TZ4 C;  5LJM A;  2J1D G;  5HXC A;  2Q9Q B;  3HKB E;  4EYY R;  2Q9Q A;  3LK3 B;  4O2B E;  4L5G A;  3ZJ1 A;  3AVS A;  3CPZ A;  1Z0P A;  4WW0 A;  2NW7 A;  4E7Z A;  3D0T A;  3SS1 A;  4ASK A;  2XAF B;  4OFZ A;  2KWH A;  1NAF A;  4DO0 A;  2D2S A;  2X9Y A;  3KV9 A;  5BMV E;  2DNX A;  3MXZ A;  3NBX X;  3KFW X;  4DBR A;  3K3N A;  4OK0 A;  1UX4 A;  3RPU A;  5HXE A;  3U3I A;  2DHR A;  3ZJ2 A;  1FEW A;  3HI2 A;  5HAX A;  3IBP A;  2CXL A;  2QA7 A;  3WI3 A;  5EK4 A;  5EK2 A;  5H6R B;  4EB6 E;  2C5J A;  3RX6 A;  5FXX A;  3OYX A;  3UUN A;  4BJM A;  1D1B A;  2E8I A;  1U5P A;  1E1H B;  2IAK A;  3CQG B;  2W00 A;  2KIN B;  2YIN A;  1LRZ A;  2NP9 A;  3HKE E;  3PUG A;  3EDU A;  1BR1 A;  3FXD B;  3N9Q A;  4MFR A;  4G2A A;  2I59 A;  5LXT E;  1G73 A;  3DTO A;  4UF0 B;  1YKE B;  2ODU A;  4PJL A;  5JVD E;  4MAL A;  2CWY A;  1BR2 A;  1HG5 A;  3IEE A;  3F31 A;  3Q9D A;  5DJQ C;  4CI3 B;  5FP3 A;  2XAG B;  2A72 A;  5J1G A;  5TAO A;  3FB2 A;  4KBM B;  4U74 A;  3WAK A;  4H63 H;  3RC3 A;  3AA0 B;  3A5X A;  1HS7 A;  1MMD A;  3TKL B;  3GN5 B;  3GWH A;  2PG8 A;  5FMN A;  5LJN A;  2CEA A;  2ACX A;  4C91 A;  3PU8 A;  4IHJ E;  1MIV A;  1EZ3 A;  4CXY A;  2W62 A;  5FNV E;  1US7 B;  2XAQ B;  1S94 A;  2LM9 A;  3OJA A;  3UUX B;  3KVB A;  5LA6 E;  2NW9 A;  5H6Q B;  2A3D A;  2YU2 A;  1X79 A;  2K24 A;  5LHG B;  3C50 A;  3N9M A;  2ES0 A;  2X9H A;  3F2E A;  2DWK A;  2N2N A;  3I0Q A;  2ODV A;  3IF8 B;  1VOM A;  4U72 A;  4UV9 B;  2K9A A;  3RKO A;  4AKH A;  1QUU A;  1ZV4 X;  4TV8 E;  4CI2 B;  3ZEF B;  3LK4 2;  3K8P C;  2KXP B;  5M4Y A;  2H7O A;  2L9Q A;  3KV6 A;  5JDF A;  2V7I A;  1ZKE A;  2G0U A;  4YHJ A;  4ZI2 C;  4BAY B;  4CQI A;  2CLY C;  3BK9 A;  4GOU A;  3JC6 C;  4QHO A;  4EAH A;  2VWA A;  4UEL A;  3BQK A;  1IJ5 A;  1YD8 G;  4O8S A;  3O1J A;  3CVR A;  2D0T A;  4QXB B;  5CB4 E;  2N9D A;  1HTJ F;  3ANW B;  5HXR A;  3ANW A;  5JDN A;  5JDQ A;  1UX5 A;  4HN9 A;  3FXE B;  4CXW A;  4JUY A;  3MK7 C;  4DMV A;  1YW0 A;  3ESL A;  3B57 A;  4I43 B;  4IE5 A;  3GA8 A;  2E9X B;  1UCU A;  4ZI3 D;  4X1Y E;  2B1E A;  2LJL A;  4TN7 B;  3ZN0 B;  5L3F B;  4J2C A;  4I50 E;  2VAS A;  4HEA A;  2KLQ A;  5L3B B;  2XAH B;  3PUQ A;  3W15 B;  2BZB A;  2LE8 A;  5L3E B;  4TV9 E;  5F3J A;  3VU7 H;  4CI1 B;  3AAE B;  5C8Y E;  3P8C D;  3UFE A;  3RYF E;  2E9X C;  4QXC B;  2CA5 A;  1HX8 A;  2KT9 A;  4DBQ A;  2LSJ A;  3I0O A;  2LSY A;  4JEH B;  2BDE A;  4H9N C;  4CZZ B;  1D0Z A;  2WMO A;  2X9X A;  1B7T A;  1LKX A;  2Y6X A;  4HKA A;  4H9Q C;  5AFU L;  5HWX A;  3FBL A;  4H9R C;  5JDH A;  2HPJ A;  3ZMT B;  4NUV A;  4O4J E;  2MTQ A;  3ZYM A;  4AXP A;  1KNZ A;  2LSI A;  4L0R A;  4YFS A;  3V5U A;  4QWN B;  3VHL A;  3O9X A;  4UV8 B;  3N9N A;  4EYU A;  1D0Y A;  2JMH A;  2V7J A;  3H3A A;  3R6N A;  4EXT A;  3PE0 A;  5ETW A;  3GMI A;  3SRZ A;  2CM0 A;  3H37 A;  2V7K A;  3PUR A;  4MHC A;  1ZEE A;  4OYK A;  3BQI A;  4F6R C;  3NRY A;  1MNE A;  3C4Z A;  3P7I A;  5LNK A;  5JR9 A;  4ZHQ E;  2L3L A;  2ZMA A;  1HF8 A;  4AKL A;  4L9I A;  4O4H E;  2ZM8 A;  4IE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...