2WSSV

The structure of the membrane extrinsic region of bovine atp synthase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
total genus 5
structure length 66
sequence length 66
chains with identical sequence Z
ec nomenclature
pdb deposition date 2009-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wssV01
2CLYC 2WSSV
chains in the Genus database with same CATH superfamily
1HS7A 2WDRA 4A56A 2JQ9A 2DWGA 2J62A 3ZT6A 4B3TT 4X20E 2CRBA 4UVBB 2XQ6A 4O4LE 5LB7B 3TKLB 4UR9A 3ESLA 2X51A 3K3NA 3I1AA 4HN9A 2KWIB 1KFYA 3H3AA 5F8PA 2X9WA 3P8CD 1YD8G 1WR6A 2JPFA 2XQ9A 2N9DA 3ANWA 3EDVA 5FMNA 5H6RB 3RC3A 4KI0F 4YTNA 4JI6T 3ETVA 3RF1A 3AA7B 1HG2A 3Q5WA 4ZS3A 3LDQB 2IAKA 1SHZC 3W15B 2QYWA 2V7LA 1ZOYA 3DTOA 4DV5T 3EABA 3GMIA 4A5XA 5LP6E 2Y6XA 5BR8T 4TV9E 4JUYA 4ZI2D 4QX7B 2BDEA 3SFEA 2F4VT 4JYAT 4ISSA 2D0TA 4JEUB 4P0AA 2K48A 2OA5A 2V26A 4ZZBA 1XMQT 2JQKA 2MPKA 3KINB 5CA0E 2KNDA 5HCJA 5AQLB 3ZMZB 4WBNE 4WW0A 3RYCE 4DNDA 3UUMA 3UULA 4U72A 3PE0A 1NENA 1SUMB 3LSVA 4QXBB 1E7PA 3KV6A 3S4UA 3K8PC 4ASKA 1OWAA 3K3OA 3CQXC 3OYZA 4GYSA 2D5UA 1FMWA 2KT9A 3CKDA 2WSSV 2WY2A 3E22E 5FP3A 1QLBA 1LKXA 3HL6A 4YTMA 3LK3B 5ETWA 4COFA 2W62A 3MKDA 4Z90A 5FY7A 2M6IA 2VB6A 3KV5A 3RYHE 5HXHA 3KBTA 4FI5A 3ZN0B 2GK9A 4AKRB 2CCQA 4HFCA 1HNXT 4IDOA 2H3RA 1HFAA 2LM9A 2WQYA 5FXWA 3SWHA 3RQUA 2H89A 3LBXA 5IWAT 2BKNA 1IAPA 2V7KA 2VASA 3AE5A 1VRBA 3C4XA 3C50A 3QOFA 4PK4A 4U33A 4UXNB 2WMOA 1Y01A 4YY3T 3I0QA 4DR6T 2Y8DA 5KXJA 5AQJB 3RYFE 2W4XA 1T8BA 1BR2A 2YDQA 5AQOB 3X1DA 2OLTA 5CA1E 4GKJT 2YDRA 1L0VA 1MIVA 3I9WA 4X1IE 1YKHB 4QH5A 3L09A 3U78A 4DUZT 2J1DG 2JQQA 2XQ4A 3D0TA 3GN5B 3MACA 4YJ2E 3DJBA 3N2OA 2IIUA 4HGAA 2IW5B 1UX4A 4IIJE 4UVCB 3RH3A 2LSYA 3CK6A 3EDUA 5DQVA 3PUGA 3SFDA 2BG9B 4X1KE 5AQIB 1YXRA 4DMVA 2E5LT 2EHOA 2JJ9A 4ZXLA 2J47A 3RX6A 3TLTA 3ZLIA 4DMWA 2XQ7A 2BG9C 2H7OA 3H37A 4EZ4A 4PK5A 3MXZA 5ABFB 4B3RT 3RQWA 3IF8B 3LFMA 4OHFA 2RPAA 3RHWA 1VCSA 1WLXA 2UU9T 2ZM6T 1XNQT 2NP9A 3IA3A 4U7YA 2UXCT 3EHZA 2ES0A 2VQET 4HWDA 4L0RA 2LRLA 3F31A 5LG4A 4KX6A 4DV2T 2LRKA 3CPZA 5L3FB 2CWYA 3B13A 3GA8A 1XZYA 2VVNA 5HEOA 5EK3A 3FBZA 2YEVC 2XQAA 4ILBA 4N78D 1W09A 2D9DA 4IDPA 4IE7A 4U74A 5JDLA 1T7SA 3UUBA 2LSKA 2M67A 3N9LA 3GN5A 4I55E 4ILCA 5J0ZA 4DBRA 4KMCA 2H7VC 2A72A 5FL1A 5LMNT 4UIGA 2VKJA 4CXYA 4EEDA 4JI8T 5EK2A 4DR2T 1D0YA 2C5IT 1G73A 2G0UA 1I94T 1X9BA 2BKPA 2K5BB 5GONE 4HTEA 5JDFA 4JI2T 2DNXA 3A5XA 1UUSA 2JMHA 4IREA 5LGUB 5JRCA 5J2UE 2ZLYA 2M6BA 1US7B 3OVUA 3ZYMA 2HH7A 2NW8A 1UGOA 5AFUL 3SOLA 2CM0A 2YN6A 2LE8A 1KNZA 4PFOA 2W63A 2X9XA 3ZMVB 5JH7E 5LGNB 4AKIA 2C5KT 3NWIA 4I43B 2HHHT 1WR0A 3AEBA 3HKBE 2W66A 2CXDA 4ILUA 4X62T 4EOZB 2E9XD 4PJMA 3P4SA 4TUYE 4DR4T 4WNKA 3UU4A 3AB3B 4O4JE 2ODUA 2IC9A 2UUBT 3P7IA 4H63H 3FHNA 5IYZE 2I0MA 3HKCE 5LHIB 3L8RA 5LXTE 4JI3T 2V1DB 2V8SV 3AEAA 4JLEA 3ZN1B 3WAJA 3ZSTA 5FXZA 2IC6A 1I6ZA 3PDYA 2LT3A 2ZM0A 3L39A 3ZMUB 5JDHA 4B3ST 4DV4T 4MLKA 5J2TE 2MYSA 3A7MA 3EAMA 2BZBA 4DV1T 3K1SA 3CIRA 5DQWA 2FUPA 4ZEYA 3CQGB 4B6XA 5L4EA 5HWXA 4LFCT 3DP7A 2KXPB 4IE5A 2QVAA 4OFZA 2WZHA 5LHHB 3E08A 4JI5T 2OV9A 4EAHA 4I50E 1ZEEA 1E2AA 2LHNA 2XSAA 2KINB 3UT5E 1YQ3A 2XZEA 4Z91A 3RKOA 4BAYB 2XAGB 5LBQB 3VR8A 3ZYLA 2WAUA 4NXMT 3V5UA 1HTJF 2WU2A 5HEGA 2E2AA 1N36T 1N33T 2CEAA 1UURA 2VQFT 2XM1A 2A9UA 4TX5A 5LJNA 3O4XE 3ZMTB 3IHRA 1FJGT 3MJXA 3JAEA 3AAEB 5C8YE 1IBKT 2FBWA 5L3CB 3KBUA 4LFBT 2MOZA 4H9NC 1UK5A 2D2SA 4DV0T 2WCAA 2BS2A 4DR1T 3NZPA 2L8KA 3N9QA 3P4RA 3ZYKA 4EYUA 4X65T 2XY8B 4FJOA 2L3LA 4LMJA 2CHOA 4CQIA 1HNZT 3UQ7A 5KDMC 2JRKA 3PUXF 4BA9A 5L3EB 2Q9QB 4NXNT 4YSZA 4O2AE 3FZKB 1S94A 4MFRA 3TLVA 3TLUA 2IMLA 4ANJA 3UU6A 2Q9QC 4CXXA 2WM9A 1BR4A 3RLFF 1XDOA 3WI3A 1VOMA 2V5CA 3H3MA 2YOEA 4XBFB 3ZT7A 4AI6A 2CLYC 4H9PC 5AQPB 4CI1B 4DR5T 3ZMSB 3FZLB 2WWUA 4UV8B 5DJQC 5FYMA 3AE2A 4F8HA 3OBVE 2K24A 1S35A 2XJ7A 3AECA 3FZMB 3JC6D 3PU8A 3PV0F 3ONLC 4HFEA 1OEDC 4O8SA 4PFPA 4AXPA 1U5PA 5FL0A 4K0KT 2DCFA 2XAJB 4QH1A 2WP9A 2ACZA 1J1JA 3PURA 1XDPA 2NTYA 4X66T 4YFSA 4UF0B 2LM2A 1G8XA 1YKEB 5LOVE 5F3JA 4B3MT 2AE9A 2UXNB 3CQCB 5CB4E 3LBXB 4ZI2C 2FJEA 3AE9A 3N9OA 3FB2A 2CXLA 3EI0A 1M7KA 2NWBA 2CMRA 4YSYA 2E9XB 2XAHB 2WU5A 2W67A 1W0AA 3AE4A 3N2GE 4Q25A 2Q9QA 4C91A 4QX8B 2RP4A 3QB5K 4KUMB 3VR9A 2CWOA 4L9IA 4U2ZA 4TWFA 2LSIA 1ZV4X 3PUSA 1FEWA 3NBXX 4EGWA 5L3GB 2PBIA 4HFDA 4PK6A 2V7MA 3RIFA 3C64A 2C0SA 1V9DA 3QC9A 4Z8XA 1OEDE 4PAGA 2XM2A 3LK2B 4QH4A 3UU8A 3K3QC 3O1HA 3RC8A 5C3JA 5L47A 2BG9A 1B7TA 1HCIA 3N9NA 3ZT5A 4EEBA 4GIWA 5LGTB 4CI2B 3OPCA 3R84B 2V7IA 4M1PA 3AEEA 1MMNA 1HX1B 4LF8T 3MK7C 5AQTB 2WS3A 4E7SA 3VKGA 1X79A 2ZM2A 2V7JA 4HE8A 4QKNA 3P4WA 4EZHA 1JNZA 4AISA 5JDQA 3CX8B 4ZOLE 4YLHA 3C4WA 2DL1A 2HPLA 4IL4A 4DO0A 5LA6E 1HR0T 4CN4A 4NUVA 1WCRA 4H9SE 4TWHA 2FJDA 3OJAA 4IE4A 3VU7H 4F6RC 1KEYA 1D1AA 4PNIA 3KFWX 5JDGA 2W61A 2XQ5A 4U7IA 4ZHQE 4ADZA 1FMVA 1UCUA 2HN1A 1OEDB 3B57A 4OYKA 3PUZF 2CBIA 3R6NA 4IL9A 3TLWA 5L2LA 3NRYA 2C5JA 1KNRA 2LHRA 3ZCIA 4LF9T 3CVRA 2JMKA 3Q2MA 4HFHA 4EB6E 4UELA 3VHLA 5C2TA 2VKDA 2IUBA 2X9YA 4KBMB 3AA1B 3JCFA 5LYJE 3J7Yq 2IDOB 5LBMA 4ILAA 2LSJA 2QA7A 3PUQA 2BS3A 3PJAA 3VRBA 3CX7B 3C4ZA 1HG5A 5CJ5A 3T1YT 1N34T 4LF5T 1D1CA 5HEJA 3ONJA 2Y48B 2HN2A 1ZHCA 5JDMA 3LG7A 1WRDA 2LKGA 2BBHA 2CXFA 3P4PA 3AE3A 3EUHA 3E0ZA 4BJMA 3OTOT 4NPPA 4IDNA 5HWYA 5IHYA 2X0YA 5FXVA 1SA0E 4TWDA 4ERRA 4JI1T 4LF4T 1N32T 1SE7A 1W0BA 3OKQA 4O4HE 5HEHA 3RPUA 3LJCA 3TLSA 3UQ4A 5HXRA 4CI3B 4O2BE 2BBJA 3QK6A 4AIUA 1D0ZA 3JC6C 3AA0B 3RGLA 4DIDB 4JI7T 2JQHA 4IT4A 4LMLA 3UFEA 3UUXB 3AE7A 1WYCA 1IJ5A 1YW0A 2LJLA 4IDZA 4AQFC 2W2UA 5HCMA 1J5WA 1Z0PA 4X64T 4QHOA 3AAAB 2BG9E 1QUUA 3ABVA 3U3IA 3Q9DA 2XQYA 3BQIA 5FXXA 3BQKA 3IBPA 4HFVA 3V5SA 4GK0E 2KMFA 4DVDA 2VWAA 5BMVE 5JTGA 2NW9A 4DBQA 3G06A 4HKAA 4TZ4C 3A8YC 1HNWT 1CHUA 1MMAA 4QXCB 4JBWF 2PG8A 4YHHT 1Y64B 1NWMX 2XHEB 2CHNA 3CMLA 4I0UA 3ZPOA 3NKZA 5LMUT 2VL0A 3I9YA 2VL8A 4P09A 3ZC0A 4CN6A 1KF6A 1FIOA 3CWZB 5J1GA 2FJAA 2QGSA 1NEKA 1D0XA 5HAXA 3F57A 1BR1A 4JI4T 2VURA 4L5GA 5AQQB 4LFAT 1J5ET 5FVLA 2N2NA 5AQFB 1Z8UA 1ZKEA 3AVRA 4OK0A 5AQKB 4YT0A 2J4GA 3M65A 4ISTA 5FY0A 2JIWA 1XNRT 1MNDA 3O1JA 2WB5A 5LNKA 2A2FX 2B76A 1KK7A 4TV8E 4ZI7E 2Z6EA 3BK9A 4U3CA 4HEAA 2SPCA 2V5DA 3RKGA 3WAKA 1M62A 3GWHA 2KLQA 2NOXA 3Q5EA 4TNVA 3RIUA 3ZJ1A 4DV3T 2Q9QD 1E1HB 4AQGA 5ABHA 4MALA 3UTKA 3FZHB 4MBQA 4PW8A 5A1LA 1QSDA 2HPJA 3KDSE 3AEFA 2KSRA 5KX5E 5FY1A 3AE8A 5LG3A 5TAOA 3P50A 3PUVF 4DV6T 3FBLA 1EZ3A 2DHRA 2YK0A 4G63A 5JR9B 1MIYA 4GK5E 1UX5A 2B1EA 2NW7A 2EHOC 2ZMAA 4EXTA 2XAQB 3M3ZB 4AKHA 3P4QA 5HXSA 2WWVA 3I0OA 2FJBA 3UFGA 4P1NA 4YTPA 3OYXA 2X0LB 4AKLA 2LSGA 3C51A 2NR4A 3HKEE 1XWMA 2E8IA 1O3XA 2NTXA 4J2CA 1H7CA 3SS1A 4WZXA 4DUYT 5L4HA 1VCTA 3T8OA 1GQEA 2V6XA 2BVLA 1W9RA 2I6HA 2W0GA 3FZFB 2E5VA 1WFDA 2ZM8A 3JADA 2XSBA 3LK42 3AA6B 3PTRB 2E9XC 2EHOD 4KHZF 4NUUA 1XMOT 5AQMB 2PFVA 3ZKRA 2X66A 4AKGA 4IGUA 3ZSSA 4JV5T 4OX9T 5EZYE 5AQGB 1LRZA 4TN7B 4P0BA 1JNRA 2XUEA 4U31A 4UV9B 4WYVA 4GKKT 3RRWA 1LVKA 2XQ8A 5HEUA 4DR3T 5ABGA 5LHGB 4A98A 4WBOA 4IDQA 2XASB 4DV7T 4IE0A 5JREA 4E7ZA 3O9XA 2UUCT 5IUXA 1MIWA 4BJNA 4YHJA 5ABFA 4UF0A 2CLYB 2LEHA 3MZKB 5FVKA 2MAWA 4PJNA 5EK4A 2YINA 3RIAA 2VVSA 4XAXB 3KVBA 2DWKA 3ZEFB 5FNVE 4IHJE 3ONXA 2E9XA 1BR0A 3AEGA 2WMNA 3N5LA 3AEDA 3N9MA 4DR7T 1IBMT 4ZS2A 2DI4A 4UEMA 2VKHA 2H88A 4AQFA 2N1GA 2YU1A 5DABA 5E0OA 3HI2A 4KHPT 5HXCA 4HFIA 4I4TE 5JVDE 3AXJB 3CX6B 3NZQA 5CFBA 2EHOB 4G2AA 2KZ7B 2UXXB 4HWFA 3RYIE 5JDNA 1CUNA 5JR9C 3KVAA 3VRAA 3KV4A 2LLYA 2XQ3A 3HKDE 3ANWB 4K0UA 4U2YA 5LCYA 3RI5A 2BKOA 3UUNA 4CZZB 3QUJA 1OEDA 2V6YB 4HWHA 4MHCA 4V1Av 2K3WA 1T98A 2LOPA 3NRXA 4LMKA 2K9AA 5AQNB 2PTFA 5F5WA 4X5TA 4C90A 2KWHA 3FXDB 4JI0T 4CN1A 4H9OC 1AJ3A 2W00A 2UXBT 1KNPA 2L9QA 3Q5DA 4AQYT 2LKHA 2CE7A 2ODVA 5JR9A 2ACXA 3RIUC 2X0HA 3ZCJA 2X68A 3FXEB 2VKOA 1IZNB 4H9QC 2P9BA 3C98B 2WDVA 3HR0A 3PUAA 4NIQA 2YDSA 2WBLA 3AE1A 4O4IE 4PJJA 1LVFA 3VKHA 2MTQA 3QB5A 4H9RC 4UVAB 3AE6A 5M4YA 4LF7T 3NVOA 4YSXA 3ETUA 1YQ4A 4X1YE 2CPTA 2DLRA 1OXZA 3PJAJ 3QNUA 5JRCB 3PUYF 3SRZA 4KP3C 1WYBA 5AQRB 3Q5XA 3HA4A 4CXWA 2WDQA 4EV6A 2XAFB 3T1HT 4YJ3E 3AXJA 3IEEA 3J9X1 5HXEA 3B5MA 3O1IA 2AXDS 2V6YA 4GYRA 3JAFA 1HF8A 2XPKA 2WZIA 5AQVB 1NAFA 3AVSA 3L3PA 1U4QA 5JQGE 2BVMA 2CA5A 5FKYA 2PJQA 4ZI3C 2UUAT 2XTLA 4EIWA 4LF6T 1T72A 5AQUB 5AQHB 4QWNB 4YXDA 4H63V 4GOUA 1R8IA 3AAIA 5CGMA 5KMGP 5H6QB 1DU2A 1IJ6A 1MMDA 3BQLA 5AQSB 2IHR1 3ZJ2A 1HX8A 3N9PA 3UU3A 2VK9A 1MMGA 2X9HA 2A3DA 2R6GF 2YU2A 3MA9A 4HWIB 3ZC1A 3PU3A 5LJMA 2UXDT 1ZP0A 2MBGA 4XZCA 1IBLT 4PJLA 1D1BA 2YKSA 4JEHB 4ZZCA 4IE6A 3N2KE 3UU5A 3EVYA 3KV9A 5HYAA 4HFBA 4HWCA 2X67A 5ABEA 5L3BB 2QRXA 3PUWF 4QXHB 4OYJA 5L3DB 1MNEA 2D0UA 2RA1A 4TNWA 4A97A 2CBJA 3F2EA 2BS4A 2I59A 4EYYR 4ZI3D 2LOSA 3RRCA 5ADXL
chains in the Genus database with same CATH topology
1HS7A 4A56A 2DWGA 4X20E 4UVBB 4O4LE 3TKLB 3ESLA 2X51A 3K3NA 3I1AA 4HN9A 2KWIB 5F8PA 3H3AA 3ZYLA 2X9WA 3P8CD 1YD8G 1WR6A 2JPFA 3ANWA 2N9DA 3EDVA 5H6RB 5FMNA 3RC3A 3V5UA 3VHLA 3ETVA 3AA7B 1HG2A 3Q5WA 4ZS3A 2IAKA 1SHZC 3W15B 2V7LA 3DTOA 5LP6E 3GMIA 2Y6XA 4TV9E 4JUYA 4ZI2D 4QX7B 2BDEA 4ISSA 2D0TA 4JEUB 4P0AA 2K48A 2OA5A 2V26A 3KINB 5CA0E 2KNDA 3ZMZB 4WBNE 4WW0A 3RYCE 4DNDA 3UUMA 3UULA 4U72A 3PE0A 4QXBB 3S4UA 3KV6A 3K8PC 4ASKA 1OWAA 3K3OA 3CQXC 3OYZA 4GYSA 2D5UA 1FMWA 2KT9A 3CKDA 2WSSV 3E22E 5FP3A 1LKXA 3HL6A 3LK3B 5ETWA 2W62A 3MKDA 5FY7A 2VB6A 3KV5A 3RYHE 5HXHA 3KBTA 4FI5A 3ZN0B 2GK9A 4AKRB 2CCQA 2H3RA 1HFAA 2LM9A 5FXWA 3SWHA 3LBXA 3C4XA 1IAPA 2V7KA 2VASA 1VRBA 3C50A 4UXNB 2WMOA 3I0QA 2Y8DA 3RYFE 1BR2A 5CA1E 1MIVA 3I9WA 4X1IE 1YKHB 3L09A 3U78A 2J1DG 2JQQA 3D0TA 3GN5B 3MACA 4YJ2E 3DJBA 3N2OA 4HGAA 2IW5B 1UX4A 4IIJE 4UVCB 3RH3A 2LSYA 3EDUA 5DQVA 3PUGA 4X1KE 4DMVA 2EHOA 2JJ9A 3RX6A 3ZLIA 4DMWA 2H7OA 3H37A 4EZ4A 4PK5A 3MXZA 3IF8B 3LFMA 4OHFA 1WLXA 2NP9A 2ES0A 4L0RA 3F31A 5LG4A 3CPZA 5L3FB 2CWYA 3B13A 3GA8A 5EK3A 3FBZA 2YEVC 4U74A 4N78D 5L3GB 4IE7A 5JDLA 2LSKA 2M67A 3N9LA 3GN5A 4I55E 4DBRA 4KMCA 2H7VC 2A72A 4UIGA 2VKJA 4CXYA 5EK2A 1D0YA 2C5IT 1G73A 2G0UA 5GONE 2K5BB 5JDFA 4HTEA 5JRCA 2DNXA 3A5XA 2JMHA 5LGUB 5J2UE 2ZLYA 1US7B 3ZYMA 2HH7A 2NW8A 5AFUL 3SOLA 2CM0A 1KNZA 2LE8A 4PFOA 2W63A 2X9XA 3ZMVB 5JH7E 5LGNB 4AKIA 2C5KT 4I43B 3HKBE 2CXDA 4ILUA 4EOZB 2E9XD 4PJMA 4TUYE 4WNKA 3AB3B 4O4JE 2ODUA 2IC9A 3P7IA 4H63H 3FHNA 5IYZE 5LHIB 3HKCE 5LXTE 2V1DB 4JLEA 3WAJA 3ZN1B 5FXZA 2IC6A 3PDYA 2LT3A 2ZM0A 3ZMUB 5JDHA 4MLKA 2MYSA 2BZBA 5DQWA 3CQGB 4B6XA 5HWXA 3DP7A 2KXPB 4IE5A 4OFZA 5LHHB 3E08A 4EAHA 4I50E 1ZEEA 2LHNA 3UT5E 2KINB 3RKOA 4BAYB 2XAGB 5LBQB 2WAUA 1HTJF 2CEAA 4TX5A 5LJNA 3O4XE 3ZMTB 3IHRA 3MJXA 5C8YE 3AAEB 5L3CB 3KBUA 2MOZA 4H9NC 2D2SA 3NZPA 2L8KA 3N9QA 4EYUA 3ZYKA 4FJOA 2L3LA 4CQIA 5KDMC 2JRKA 4BA9A 2Q9QB 4O2AE 1S94A 4MFRA 4ANJA 2Q9QC 4CXXA 2WM9A 1BR4A 3WI3A 1VOMA 4AI6A 4XBFB 2CLYC 4H9PC 4CI1B 3ZMSB 2WWUA 4UV8B 5DJQC 5FYMA 3OBVE 2K24A 1S35A 3JC6D 4PK4A 4AXPA 3PU8A 4PFPA 4O8SA 1U5PA 2DCFA 2XAJB 3PURA 2NTYA 4YFSA 4UF0B 5LOVE 1G8XA 1YKEB 5F3JA 2UXNB 3CQCB 5CB4E 3LBXB 4ZI2C 3N9OA 3FB2A 2CXLA 2NWBA 2CMRA 2E9XB 2XAHB 3N2GE 2Q9QA 4C91A 4QX8B 2RP4A 4KUMB 2CWOA 4L9IA 2LSIA 1ZV4X 3PUSA 1FEWA 3NBXX 2PBIA 4PK6A 2V7MA 3C64A 2C0SA 1V9DA 3QC9A 4PAGA 3LK2B 3RC8A 3K3QC 3O1HA 1B7TA 1HCIA 3N9NA 4GIWA 5LGTB 4CI2B 3R84B 2V7IA 4M1PA 1MMNA 3MK7C 4E7SA 3VKGA 1X79A 2ZM2A 2V7JA 4HE8A 4QKNA 5JDQA 3CX8B 4ZOLE 4YLHA 3C4WA 2HPLA 4DO0A 5LA6E 4NUVA 4F6RC 4IE4A 3OJAA 3VU7H 1D1AA 4PNIA 3KFWX 5JDGA 2W61A 4ADZA 1FMVA 1UCUA 3B57A 4OYKA 3R6NA 5L2LA 3NRYA 2C5JA 3ZCIA 2LHRA 3CVRA 2JMKA 3Q2MA 4EB6E 4UELA 2VKDA 3J7Yq 2X9YA 4KBMB 3AA1B 5LYJE 5LBMA 2LSJA 2QA7A 3PUQA 3CX7B 3C4ZA 1HG5A 1D1CA 2Y48B 1ZHCA 5JDMA 3LG7A 1WRDA 2CXFA 3EUHA 3E0ZA 4BJMA 5HWYA 5IHYA 5FXVA 1SA0E 4ERRA 3OKQA 4O4HE 3RPUA 5L3EB 3LJCA 5HXRA 4O2BE 3QK6A 1D0ZA 3JC6C 3AA0B 3UFEA 3UUXB 1WYCA 1IJ5A 1YW0A 2LJLA 4IDZA 4AQFC 1Z0PA 4QHOA 3AAAB 1QUUA 3U3IA 3Q9DA 2XQYA 3BQIA 5FXXA 3BQKA 3IBPA 4HFVA 3V5SA 4GK0E 2KMFA 4DVDA 2VWAA 5BMVE 2NW9A 4DBQA 4HKAA 4TZ4C 1MMAA 4QXCB 2PG8A 1Y64B 1NWMX 2XHEB 3CMLA 3ZPOA 3I9YA 2VL8A 4P09A 3ZC0A 1FIOA 3CWZB 5J1GA 2QGSA 5HAXA 1D0XA 3F57A 1BR1A 4L5GA 2N2NA 1ZKEA 3AVRA 4OK0A 3M65A 4ISTA 5FY0A 1MNDA 3O1JA 5LNKA 2A2FX 4ZI7E 1KK7A 4TV8E 3BK9A 2Z6EA 4HEAA 2SPCA 3WAKA 3GWHA 3ZJ1A 2KLQA 2NOXA 2Q9QD 1E1HB 4AQGA 4MALA 3UTKA 4MBQA 4PW8A 5A1LA 1QSDA 2HPJA 3KDSE 5KX5E 5FY1A 5TAOA 3FBLA 1EZ3A 2DHRA 2YK0A 4G63A 5JR9B 1MIYA 4GK5E 1UX5A 2B1EA 2NW7A 2EHOC 2ZMAA 4EXTA 2XAQB 4AKHA 5HXSA 3I0OA 3OYXA 2X0LB 4AKLA 2LSGA 3C51A 3HKEE 2E8IA 1O3XA 2NTXA 4J2CA 1H7CA 3SS1A 3T8OA 2BVLA 4H9SE 2W0GA 3PTRB 4Z8XA 4CI3B 2ZM8A 4EZHA 3LK42 4ZHQE 4NUUA 3AA6B 2E9XC 2EHOD 2PFVA 2X66A 4AKGA 4IGUA 5EZYE 1LRZA 4TN7B 4P0BA 4UV9B 2XUEA 3RRWA 1LVKA 4WBOA 2XASB 4IE0A 5JREA 4E7ZA 3O9XA 1MIWA 4YHJA 4UF0A 2CLYB 2LEHA 3MZKB 4PJNA 5EK4A 2YINA 4XAXB 3KVBA 2DWKA 3ZEFB 5FNVE 4IHJE 3ONXA 2E9XA 1BR0A 2WMNA 3N5LA 3N9MA 4ZS2A 2DI4A 4UEMA 2VKHA 4AQFA 2N1GA 2YU1A 5DABA 5E0OA 3HI2A 5HXCA 4I4TE 5JVDE 3CX6B 3NZQA 2EHOB 4G2AA 2KZ7B 2UXXB 3RYIE 5JDNA 1CUNA 5JR9C 3KVAA 5LHGB 3KV4A 3HKDE 5J2TE 3UUNA 3ANWB 4K0UA 5LCYA 4CZZB 3QUJA 4MHCA 4V1Av 4BJNA 3NRXA 1T98A 2LOPA 4C90A 2K9AA 2KWHA 3FXDB 4H9OC 1AJ3A 2W00A 2L9QA 2CE7A 2ODVA 5JR9A 2ACXA 3ZCJA 2X68A 3FXEB 2VKOA 1IZNB 4H9QC 2P9BA 3C98B 3PUAA 3HR0A 2WBLA 4PJJA 4O4IE 3VKHA 1LVFA 2MTQA 4H9RC 4UVAB 5M4YA 3ETUA 4X1YE 2DLRA 1OXZA 5JRCB 3SRZA 4KP3C 1WYBA 3Q5XA 3HA4A 4CXWA 2XAFB 4YJ3E 3IEEA 3J9X1 5HXEA 3O1IA 4GYRA 1HF8A 1NAFA 3AVSA 3L3PA 1U4QA 5JQGE 2BVMA 2CA5A 2PJQA 4ZI3C 2XTLA 4EIWA 4QWNB 4H63V 4GOUA 3AAIA 5KMGP 5H6QB 1IJ6A 1MMDA 3BQLA 3ZJ2A 1HX8A 3N9PA 2VK9A 1MMGA 2YU2A 2X9HA 2A3DA 3MA9A 3ZC1A 3PU3A 5LJMA 2MBGA 4XZCA 4PJLA 1D1BA 4JEHB 4IE6A 3N2KE 3EVYA 3KV9A 5HYAA 2X67A 5L3BB 4QXHB 5L3DB 4OYJA 1MNEA 2D0UA 2RA1A 3F2EA 2I59A 4EYYR 4ZI3D 2LOSA 3RRCA 5ADXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLY C;  2WSS V; 
#chains in the Genus database with same CATH topology
 1HS7 A;  2WDR A;  4A56 A;  2JQ9 A;  2DWG A;  2J62 A;  3ZT6 A;  4B3T T;  4X20 E;  2CRB A;  4UVB B;  2XQ6 A;  4O4L E;  5LB7 B;  3TKL B;  4UR9 A;  3ESL A;  2X51 A;  3K3N A;  3I1A A;  4HN9 A;  2KWI B;  1KFY A;  3H3A A;  5F8P A;  2X9W A;  3P8C D;  1YD8 G;  1WR6 A;  2JPF A;  2XQ9 A;  2N9D A;  3ANW A;  3EDV A;  5FMN A;  5H6R B;  3RC3 A;  4KI0 F;  4YTN A;  4JI6 T;  3ETV A;  3RF1 A;  3AA7 B;  1HG2 A;  3Q5W A;  4ZS3 A;  3LDQ B;  2IAK A;  1SHZ C;  3W15 B;  2QYW A;  2V7L A;  1ZOY A;  3DTO A;  4DV5 T;  3EAB A;  3GMI A;  4A5X A;  5LP6 E;  2Y6X A;  5BR8 T;  4TV9 E;  4JUY A;  4ZI2 D;  4QX7 B;  2BDE A;  3SFE A;  2F4V T;  4JYA T;  4ISS A;  2D0T A;  4JEU B;  4P0A A;  2K48 A;  2OA5 A;  2V26 A;  4ZZB A;  1XMQ T;  2JQK A;  2MPK A;  3KIN B;  5CA0 E;  2KND A;  5HCJ A;  5AQL B;  3ZMZ B;  4WBN E;  4WW0 A;  3RYC E;  4DND A;  3UUM A;  3UUL A;  4U72 A;  3PE0 A;  1NEN A;  1SUM B;  3LSV A;  4QXB B;  1E7P A;  3KV6 A;  3S4U A;  3K8P C;  4ASK A;  1OWA A;  3K3O A;  3CQX C;  3OYZ A;  4GYS A;  2D5U A;  1FMW A;  2KT9 A;  3CKD A;  2WSS V;  2WY2 A;  3E22 E;  5FP3 A;  1QLB A;  1LKX A;  3HL6 A;  4YTM A;  3LK3 B;  5ETW A;  4COF A;  2W62 A;  3MKD A;  4Z90 A;  5FY7 A;  2M6I A;  2VB6 A;  3KV5 A;  3RYH E;  5HXH A;  3KBT A;  4FI5 A;  3ZN0 B;  2GK9 A;  4AKR B;  2CCQ A;  4HFC A;  1HNX T;  4IDO A;  2H3R A;  1HFA A;  2LM9 A;  2WQY A;  5FXW A;  3SWH A;  3RQU A;  2H89 A;  3LBX A;  5IWA T;  2BKN A;  1IAP A;  2V7K A;  2VAS A;  3AE5 A;  1VRB A;  3C4X A;  3C50 A;  3QOF A;  4PK4 A;  4U33 A;  4UXN B;  2WMO A;  1Y01 A;  4YY3 T;  3I0Q A;  4DR6 T;  2Y8D A;  5KXJ A;  5AQJ B;  3RYF E;  2W4X A;  1T8B A;  1BR2 A;  2YDQ A;  5AQO B;  3X1D A;  2OLT A;  5CA1 E;  4GKJ T;  2YDR A;  1L0V A;  1MIV A;  3I9W A;  4X1I E;  1YKH B;  4QH5 A;  3L09 A;  3U78 A;  4DUZ T;  2J1D G;  2JQQ A;  2XQ4 A;  3D0T A;  3GN5 B;  3MAC A;  4YJ2 E;  3DJB A;  3N2O A;  2IIU A;  4HGA A;  2IW5 B;  1UX4 A;  4IIJ E;  4UVC B;  3RH3 A;  2LSY A;  3CK6 A;  3EDU A;  5DQV A;  3PUG A;  3SFD A;  2BG9 B;  4X1K E;  5AQI B;  1YXR A;  4DMV A;  2E5L T;  2EHO A;  2JJ9 A;  4ZXL A;  2J47 A;  3RX6 A;  3TLT A;  3ZLI A;  4DMW A;  2XQ7 A;  2BG9 C;  2H7O A;  3H37 A;  4EZ4 A;  4PK5 A;  3MXZ A;  5ABF B;  4B3R T;  3RQW A;  3IF8 B;  3LFM A;  4OHF A;  2RPA A;  3RHW A;  1VCS A;  1WLX A;  2UU9 T;  2ZM6 T;  1XNQ T;  2NP9 A;  3IA3 A;  4U7Y A;  2UXC T;  3EHZ A;  2ES0 A;  2VQE T;  4HWD A;  4L0R A;  2LRL A;  3F31 A;  5LG4 A;  4KX6 A;  4DV2 T;  2LRK A;  3CPZ A;  5L3F B;  2CWY A;  3B13 A;  3GA8 A;  1XZY A;  2VVN A;  5HEO A;  5EK3 A;  3FBZ A;  2YEV C;  2XQA A;  4ILB A;  4N78 D;  1W09 A;  2D9D A;  4IDP A;  4IE7 A;  4U74 A;  5JDL A;  1T7S A;  3UUB A;  2LSK A;  2M67 A;  3N9L A;  3GN5 A;  4I55 E;  4ILC A;  5J0Z A;  4DBR A;  4KMC A;  2H7V C;  2A72 A;  5FL1 A;  5LMN T;  4UIG A;  2VKJ A;  4CXY A;  4EED A;  4JI8 T;  5EK2 A;  4DR2 T;  1D0Y A;  2C5I T;  1G73 A;  2G0U A;  1I94 T;  1X9B A;  2BKP A;  2K5B B;  5GON E;  4HTE A;  5JDF A;  4JI2 T;  2DNX A;  3A5X A;  1UUS A;  2JMH A;  4IRE A;  5LGU B;  5JRC A;  5J2U E;  2ZLY A;  2M6B A;  1US7 B;  3OVU A;  3ZYM A;  2HH7 A;  2NW8 A;  1UGO A;  5AFU L;  3SOL A;  2CM0 A;  2YN6 A;  2LE8 A;  1KNZ A;  4PFO A;  2W63 A;  2X9X A;  3ZMV B;  5JH7 E;  5LGN B;  4AKI A;  2C5K T;  3NWI A;  4I43 B;  2HHH T;  1WR0 A;  3AEB A;  3HKB E;  2W66 A;  2CXD A;  4ILU A;  4X62 T;  4EOZ B;  2E9X D;  4PJM A;  3P4S A;  4TUY E;  4DR4 T;  4WNK A;  3UU4 A;  3AB3 B;  4O4J E;  2ODU A;  2IC9 A;  2UUB T;  3P7I A;  4H63 H;  3FHN A;  5IYZ E;  2I0M A;  3HKC E;  5LHI B;  3L8R A;  5LXT E;  4JI3 T;  2V1D B;  2V8S V;  3AEA A;  4JLE A;  3ZN1 B;  3WAJ A;  3ZST A;  5FXZ A;  2IC6 A;  1I6Z A;  3PDY A;  2LT3 A;  2ZM0 A;  3L39 A;  3ZMU B;  5JDH A;  4B3S T;  4DV4 T;  4MLK A;  5J2T E;  2MYS A;  3A7M A;  3EAM A;  2BZB A;  4DV1 T;  3K1S A;  3CIR A;  5DQW A;  2FUP A;  4ZEY A;  3CQG B;  4B6X A;  5L4E A;  5HWX A;  4LFC T;  3DP7 A;  2KXP B;  4IE5 A;  2QVA A;  4OFZ A;  2WZH A;  5LHH B;  3E08 A;  4JI5 T;  2OV9 A;  4EAH A;  4I50 E;  1ZEE A;  1E2A A;  2LHN A;  2XSA A;  2KIN B;  3UT5 E;  1YQ3 A;  2XZE A;  4Z91 A;  3RKO A;  4BAY B;  2XAG B;  5LBQ B;  3VR8 A;  3ZYL A;  2WAU A;  4NXM T;  3V5U A;  1HTJ F;  2WU2 A;  5HEG A;  2E2A A;  1N36 T;  1N33 T;  2CEA A;  1UUR A;  2VQF T;  2XM1 A;  2A9U A;  4TX5 A;  5LJN A;  3O4X E;  3ZMT B;  3IHR A;  1FJG T;  3MJX A;  3JAE A;  3AAE B;  5C8Y E;  1IBK T;  2FBW A;  5L3C B;  3KBU A;  4LFB T;  2MOZ A;  4H9N C;  1UK5 A;  2D2S A;  4DV0 T;  2WCA A;  2BS2 A;  4DR1 T;  3NZP A;  2L8K A;  3N9Q A;  3P4R A;  3ZYK A;  4EYU A;  4X65 T;  2XY8 B;  4FJO A;  2L3L A;  4LMJ A;  2CHO A;  4CQI A;  1HNZ T;  3UQ7 A;  5KDM C;  2JRK A;  3PUX F;  4BA9 A;  5L3E B;  2Q9Q B;  4NXN T;  4YSZ A;  4O2A E;  3FZK B;  1S94 A;  4MFR A;  3TLV A;  3TLU A;  2IML A;  4ANJ A;  3UU6 A;  2Q9Q C;  4CXX A;  2WM9 A;  1BR4 A;  3RLF F;  1XDO A;  3WI3 A;  1VOM A;  2V5C A;  3H3M A;  2YOE A;  4XBF B;  3ZT7 A;  4AI6 A;  2CLY C;  4H9P C;  5AQP B;  4CI1 B;  4DR5 T;  3ZMS B;  3FZL B;  2WWU A;  4UV8 B;  5DJQ C;  5FYM A;  3AE2 A;  4F8H A;  3OBV E;  2K24 A;  1S35 A;  2XJ7 A;  3AEC A;  3FZM B;  3JC6 D;  3PU8 A;  3PV0 F;  3ONL C;  4HFE A;  1OED C;  4O8S A;  4PFP A;  4AXP A;  1U5P A;  5FL0 A;  4K0K T;  2DCF A;  2XAJ B;  4QH1 A;  2WP9 A;  2ACZ A;  1J1J A;  3PUR A;  1XDP A;  2NTY A;  4X66 T;  4YFS A;  4UF0 B;  2LM2 A;  1G8X A;  1YKE B;  5LOV E;  5F3J A;  4B3M T;  2AE9 A;  2UXN B;  3CQC B;  5CB4 E;  3LBX B;  4ZI2 C;  2FJE A;  3AE9 A;  3N9O A;  3FB2 A;  2CXL A;  3EI0 A;  1M7K A;  2NWB A;  2CMR A;  4YSY A;  2E9X B;  2XAH B;  2WU5 A;  2W67 A;  1W0A A;  3AE4 A;  3N2G E;  4Q25 A;  2Q9Q A;  4C91 A;  4QX8 B;  2RP4 A;  3QB5 K;  4KUM B;  3VR9 A;  2CWO A;  4L9I A;  4U2Z A;  4TWF A;  2LSI A;  1ZV4 X;  3PUS A;  1FEW A;  3NBX X;  4EGW A;  5L3G B;  2PBI A;  4HFD A;  4PK6 A;  2V7M A;  3RIF A;  3C64 A;  2C0S A;  1V9D A;  3QC9 A;  4Z8X A;  1OED E;  4PAG A;  2XM2 A;  3LK2 B;  4QH4 A;  3UU8 A;  3K3Q C;  3O1H A;  3RC8 A;  5C3J A;  5L47 A;  2BG9 A;  1B7T A;  1HCI A;  3N9N A;  3ZT5 A;  4EEB A;  4GIW A;  5LGT B;  4CI2 B;  3OPC A;  3R84 B;  2V7I A;  4M1P A;  3AEE A;  1MMN A;  1HX1 B;  4LF8 T;  3MK7 C;  5AQT B;  2WS3 A;  4E7S A;  3VKG A;  1X79 A;  2ZM2 A;  2V7J A;  4HE8 A;  4QKN A;  3P4W A;  4EZH A;  1JNZ A;  4AIS A;  5JDQ A;  3CX8 B;  4ZOL E;  4YLH A;  3C4W A;  2DL1 A;  2HPL A;  4IL4 A;  4DO0 A;  5LA6 E;  1HR0 T;  4CN4 A;  4NUV A;  1WCR A;  4H9S E;  4TWH A;  2FJD A;  3OJA A;  4IE4 A;  3VU7 H;  4F6R C;  1KEY A;  1D1A A;  4PNI A;  3KFW X;  5JDG A;  2W61 A;  2XQ5 A;  4U7I A;  4ZHQ E;  4ADZ A;  1FMV A;  1UCU A;  2HN1 A;  1OED B;  3B57 A;  4OYK A;  3PUZ F;  2CBI A;  3R6N A;  4IL9 A;  3TLW A;  5L2L A;  3NRY A;  2C5J A;  1KNR A;  2LHR A;  3ZCI A;  4LF9 T;  3CVR A;  2JMK A;  3Q2M A;  4HFH A;  4EB6 E;  4UEL A;  3VHL A;  5C2T A;  2VKD A;  2IUB A;  2X9Y A;  4KBM B;  3AA1 B;  3JCF A;  5LYJ E;  3J7Y q;  2IDO B;  5LBM A;  4ILA A;  2LSJ A;  2QA7 A;  3PUQ A;  2BS3 A;  3PJA A;  3VRB A;  3CX7 B;  3C4Z A;  1HG5 A;  5CJ5 A;  3T1Y T;  1N34 T;  4LF5 T;  1D1C A;  5HEJ A;  3ONJ A;  2Y48 B;  2HN2 A;  1ZHC A;  5JDM A;  3LG7 A;  1WRD A;  2LKG A;  2BBH A;  2CXF A;  3P4P A;  3AE3 A;  3EUH A;  3E0Z A;  4BJM A;  3OTO T;  4NPP A;  4IDN A;  5HWY A;  5IHY A;  2X0Y A;  5FXV A;  1SA0 E;  4TWD A;  4ERR A;  4JI1 T;  4LF4 T;  1N32 T;  1SE7 A;  1W0B A;  3OKQ A;  4O4H E;  5HEH A;  3RPU A;  3LJC A;  3TLS A;  3UQ4 A;  5HXR A;  4CI3 B;  4O2B E;  2BBJ A;  3QK6 A;  4AIU A;  1D0Z A;  3JC6 C;  3AA0 B;  3RGL A;  4DID B;  4JI7 T;  2JQH A;  4IT4 A;  4LML A;  3UFE A;  3UUX B;  3AE7 A;  1WYC A;  1IJ5 A;  1YW0 A;  2LJL A;  4IDZ A;  4AQF C;  2W2U A;  5HCM A;  1J5W A;  1Z0P A;  4X64 T;  4QHO A;  3AAA B;  2BG9 E;  1QUU A;  3ABV A;  3U3I A;  3Q9D A;  2XQY A;  3BQI A;  5FXX A;  3BQK A;  3IBP A;  4HFV A;  3V5S A;  4GK0 E;  2KMF A;  4DVD A;  2VWA A;  5BMV E;  5JTG A;  2NW9 A;  4DBQ A;  3G06 A;  4HKA A;  4TZ4 C;  3A8Y C;  1HNW T;  1CHU A;  1MMA A;  4QXC B;  4JBW F;  2PG8 A;  4YHH T;  1Y64 B;  1NWM X;  2XHE B;  2CHN A;  3CML A;  4I0U A;  3ZPO A;  3NKZ A;  5LMU T;  2VL0 A;  3I9Y A;  2VL8 A;  4P09 A;  3ZC0 A;  4CN6 A;  1KF6 A;  1FIO A;  3CWZ B;  5J1G A;  2FJA A;  2QGS A;  1NEK A;  1D0X A;  5HAX A;  3F57 A;  1BR1 A;  4JI4 T;  2VUR A;  4L5G A;  5AQQ B;  4LFA T;  1J5E T;  5FVL A;  2N2N A;  5AQF B;  1Z8U A;  1ZKE A;  3AVR A;  4OK0 A;  5AQK B;  4YT0 A;  2J4G A;  3M65 A;  4IST A;  5FY0 A;  2JIW A;  1XNR T;  1MND A;  3O1J A;  2WB5 A;  5LNK A;  2A2F X;  2B76 A;  1KK7 A;  4TV8 E;  4ZI7 E;  2Z6E A;  3BK9 A;  4U3C A;  4HEA A;  2SPC A;  2V5D A;  3RKG A;  3WAK A;  1M62 A;  3GWH A;  2KLQ A;  2NOX A;  3Q5E A;  4TNV A;  3RIU A;  3ZJ1 A;  4DV3 T;  2Q9Q D;  1E1H B;  4AQG A;  5ABH A;  4MAL A;  3UTK A;  3FZH B;  4MBQ A;  4PW8 A;  5A1L A;  1QSD A;  2HPJ A;  3KDS E;  3AEF A;  2KSR A;  5KX5 E;  5FY1 A;  3AE8 A;  5LG3 A;  5TAO A;  3P50 A;  3PUV F;  4DV6 T;  3FBL A;  1EZ3 A;  2DHR A;  2YK0 A;  4G63 A;  5JR9 B;  1MIY A;  4GK5 E;  1UX5 A;  2B1E A;  2NW7 A;  2EHO C;  2ZMA A;  4EXT A;  2XAQ B;  3M3Z B;  4AKH A;  3P4Q A;  5HXS A;  2WWV A;  3I0O A;  2FJB A;  3UFG A;  4P1N A;  4YTP A;  3OYX A;  2X0L B;  4AKL A;  2LSG A;  3C51 A;  2NR4 A;  3HKE E;  1XWM A;  2E8I A;  1O3X A;  2NTX A;  4J2C A;  1H7C A;  3SS1 A;  4WZX A;  4DUY T;  5L4H A;  1VCT A;  3T8O A;  1GQE A;  2V6X A;  2BVL A;  1W9R A;  2I6H A;  2W0G A;  3FZF B;  2E5V A;  1WFD A;  2ZM8 A;  3JAD A;  2XSB A;  3LK4 2;  3AA6 B;  3PTR B;  2E9X C;  2EHO D;  4KHZ F;  4NUU A;  1XMO T;  5AQM B;  2PFV A;  3ZKR A;  2X66 A;  4AKG A;  4IGU A;  3ZSS A;  4JV5 T;  4OX9 T;  5EZY E;  5AQG B;  1LRZ A;  4TN7 B;  4P0B A;  1JNR A;  2XUE A;  4U31 A;  4UV9 B;  4WYV A;  4GKK T;  3RRW A;  1LVK A;  2XQ8 A;  5HEU A;  4DR3 T;  5ABG A;  5LHG B;  4A98 A;  4WBO A;  4IDQ A;  2XAS B;  4DV7 T;  4IE0 A;  5JRE A;  4E7Z A;  3O9X A;  2UUC T;  5IUX A;  1MIW A;  4BJN A;  4YHJ A;  5ABF A;  4UF0 A;  2CLY B;  2LEH A;  3MZK B;  5FVK A;  2MAW A;  4PJN A;  5EK4 A;  2YIN A;  3RIA A;  2VVS A;  4XAX B;  3KVB A;  2DWK A;  3ZEF B;  5FNV E;  4IHJ E;  3ONX A;  2E9X A;  1BR0 A;  3AEG A;  2WMN A;  3N5L A;  3AED A;  3N9M A;  4DR7 T;  1IBM T;  4ZS2 A;  2DI4 A;  4UEM A;  2VKH A;  2H88 A;  4AQF A;  2N1G A;  2YU1 A;  5DAB A;  5E0O A;  3HI2 A;  4KHP T;  5HXC A;  4HFI A;  4I4T E;  5JVD E;  3AXJ B;  3CX6 B;  3NZQ A;  5CFB A;  2EHO B;  4G2A A;  2KZ7 B;  2UXX B;  4HWF A;  3RYI E;  5JDN A;  1CUN A;  5JR9 C;  3KVA A;  3VRA A;  3KV4 A;  2LLY A;  2XQ3 A;  3HKD E;  3ANW B;  4K0U A;  4U2Y A;  5LCY A;  3RI5 A;  2BKO A;  3UUN A;  4CZZ B;  3QUJ A;  1OED A;  2V6Y B;  4HWH A;  4MHC A;  4V1A v;  2K3W A;  1T98 A;  2LOP A;  3NRX A;  4LMK A;  2K9A A;  5AQN B;  2PTF A;  5F5W A;  4X5T A;  4C90 A;  2KWH A;  3FXD B;  4JI0 T;  4CN1 A;  4H9O C;  1AJ3 A;  2W00 A;  2UXB T;  1KNP A;  2L9Q A;  3Q5D A;  4AQY T;  2LKH A;  2CE7 A;  2ODV A;  5JR9 A;  2ACX A;  3RIU C;  2X0H A;  3ZCJ A;  2X68 A;  3FXE B;  2VKO A;  1IZN B;  4H9Q C;  2P9B A;  3C98 B;  2WDV A;  3HR0 A;  3PUA A;  4NIQ A;  2YDS A;  2WBL A;  3AE1 A;  4O4I E;  4PJJ A;  1LVF A;  3VKH A;  2MTQ A;  3QB5 A;  4H9R C;  4UVA B;  3AE6 A;  5M4Y A;  4LF7 T;  3NVO A;  4YSX A;  3ETU A;  1YQ4 A;  4X1Y E;  2CPT A;  2DLR A;  1OXZ A;  3PJA J;  3QNU A;  5JRC B;  3PUY F;  3SRZ A;  4KP3 C;  1WYB A;  5AQR B;  3Q5X A;  3HA4 A;  4CXW A;  2WDQ A;  4EV6 A;  2XAF B;  3T1H T;  4YJ3 E;  3AXJ A;  3IEE A;  3J9X 1;  5HXE A;  3B5M A;  3O1I A;  2AXD S;  2V6Y A;  4GYR A;  3JAF A;  1HF8 A;  2XPK A;  2WZI A;  5AQV B;  1NAF A;  3AVS A;  3L3P A;  1U4Q A;  5JQG E;  2BVM A;  2CA5 A;  5FKY A;  2PJQ A;  4ZI3 C;  2UUA T;  2XTL A;  4EIW A;  4LF6 T;  1T72 A;  5AQU B;  5AQH B;  4QWN B;  4YXD A;  4H63 V;  4GOU A;  1R8I A;  3AAI A;  5CGM A;  5KMG P;  5H6Q B;  1DU2 A;  1IJ6 A;  1MMD A;  3BQL A;  5AQS B;  2IHR 1;  3ZJ2 A;  1HX8 A;  3N9P A;  3UU3 A;  2VK9 A;  1MMG A;  2X9H A;  2A3D A;  2R6G F;  2YU2 A;  3MA9 A;  4HWI B;  3ZC1 A;  3PU3 A;  5LJM A;  2UXD T;  1ZP0 A;  2MBG A;  4XZC A;  1IBL T;  4PJL A;  1D1B A;  2YKS A;  4JEH B;  4ZZC A;  4IE6 A;  3N2K E;  3UU5 A;  3EVY A;  3KV9 A;  5HYA A;  4HFB A;  4HWC A;  2X67 A;  5ABE A;  5L3B B;  2QRX A;  3PUW F;  4QXH B;  4OYJ A;  5L3D B;  1MNE A;  2D0U A;  2RA1 A;  4TNW A;  4A97 A;  2CBJ A;  3F2E A;  2BS4 A;  2I59 A;  4EYY R;  4ZI3 D;  2LOS A;  3RRC A;  5ADX L; 
#chains in the Genus database with same CATH homology
 1HS7 A;  4A56 A;  2DWG A;  4X20 E;  4UVB B;  4O4L E;  3TKL B;  3ESL A;  2X51 A;  3K3N A;  3I1A A;  4HN9 A;  2KWI B;  5F8P A;  3H3A A;  3ZYL A;  2X9W A;  3P8C D;  1YD8 G;  1WR6 A;  2JPF A;  3ANW A;  2N9D A;  3EDV A;  5H6R B;  5FMN A;  3RC3 A;  3V5U A;  3VHL A;  3ETV A;  3AA7 B;  1HG2 A;  3Q5W A;  4ZS3 A;  2IAK A;  1SHZ C;  3W15 B;  2V7L A;  3DTO A;  5LP6 E;  3GMI A;  2Y6X A;  4TV9 E;  4JUY A;  4ZI2 D;  4QX7 B;  2BDE A;  4ISS A;  2D0T A;  4JEU B;  4P0A A;  2K48 A;  2OA5 A;  2V26 A;  3KIN B;  5CA0 E;  2KND A;  3ZMZ B;  4WBN E;  4WW0 A;  3RYC E;  4DND A;  3UUM A;  3UUL A;  4U72 A;  3PE0 A;  4QXB B;  3S4U A;  3KV6 A;  3K8P C;  4ASK A;  1OWA A;  3K3O A;  3CQX C;  3OYZ A;  4GYS A;  2D5U A;  1FMW A;  2KT9 A;  3CKD A;  2WSS V;  3E22 E;  5FP3 A;  1LKX A;  3HL6 A;  3LK3 B;  5ETW A;  2W62 A;  3MKD A;  5FY7 A;  2VB6 A;  3KV5 A;  3RYH E;  5HXH A;  3KBT A;  4FI5 A;  3ZN0 B;  2GK9 A;  4AKR B;  2CCQ A;  2H3R A;  1HFA A;  2LM9 A;  5FXW A;  3SWH A;  3LBX A;  3C4X A;  1IAP A;  2V7K A;  2VAS A;  1VRB A;  3C50 A;  4UXN B;  2WMO A;  3I0Q A;  2Y8D A;  3RYF E;  1BR2 A;  5CA1 E;  1MIV A;  3I9W A;  4X1I E;  1YKH B;  3L09 A;  3U78 A;  2J1D G;  2JQQ A;  3D0T A;  3GN5 B;  3MAC A;  4YJ2 E;  3DJB A;  3N2O A;  4HGA A;  2IW5 B;  1UX4 A;  4IIJ E;  4UVC B;  3RH3 A;  2LSY A;  3EDU A;  5DQV A;  3PUG A;  4X1K E;  4DMV A;  2EHO A;  2JJ9 A;  3RX6 A;  3ZLI A;  4DMW A;  2H7O A;  3H37 A;  4EZ4 A;  4PK5 A;  3MXZ A;  3IF8 B;  3LFM A;  4OHF A;  1WLX A;  2NP9 A;  2ES0 A;  4L0R A;  3F31 A;  5LG4 A;  3CPZ A;  5L3F B;  2CWY A;  3B13 A;  3GA8 A;  5EK3 A;  3FBZ A;  2YEV C;  4U74 A;  4N78 D;  5L3G B;  4IE7 A;  5JDL A;  2LSK A;  2M67 A;  3N9L A;  3GN5 A;  4I55 E;  4DBR A;  4KMC A;  2H7V C;  2A72 A;  4UIG A;  2VKJ A;  4CXY A;  5EK2 A;  1D0Y A;  2C5I T;  1G73 A;  2G0U A;  5GON E;  2K5B B;  5JDF A;  4HTE A;  5JRC A;  2DNX A;  3A5X A;  2JMH A;  5LGU B;  5J2U E;  2ZLY A;  1US7 B;  3ZYM A;  2HH7 A;  2NW8 A;  5AFU L;  3SOL A;  2CM0 A;  1KNZ A;  2LE8 A;  4PFO A;  2W63 A;  2X9X A;  3ZMV B;  5JH7 E;  5LGN B;  4AKI A;  2C5K T;  4I43 B;  3HKB E;  2CXD A;  4ILU A;  4EOZ B;  2E9X D;  4PJM A;  4TUY E;  4WNK A;  3AB3 B;  4O4J E;  2ODU A;  2IC9 A;  3P7I A;  4H63 H;  3FHN A;  5IYZ E;  5LHI B;  3HKC E;  5LXT E;  2V1D B;  4JLE A;  3WAJ A;  3ZN1 B;  5FXZ A;  2IC6 A;  3PDY A;  2LT3 A;  2ZM0 A;  3ZMU B;  5JDH A;  4MLK A;  2MYS A;  2BZB A;  5DQW A;  3CQG B;  4B6X A;  5HWX A;  3DP7 A;  2KXP B;  4IE5 A;  4OFZ A;  5LHH B;  3E08 A;  4EAH A;  4I50 E;  1ZEE A;  2LHN A;  3UT5 E;  2KIN B;  3RKO A;  4BAY B;  2XAG B;  5LBQ B;  2WAU A;  1HTJ F;  2CEA A;  4TX5 A;  5LJN A;  3O4X E;  3ZMT B;  3IHR A;  3MJX A;  5C8Y E;  3AAE B;  5L3C B;  3KBU A;  2MOZ A;  4H9N C;  2D2S A;  3NZP A;  2L8K A;  3N9Q A;  4EYU A;  3ZYK A;  4FJO A;  2L3L A;  4CQI A;  5KDM C;  2JRK A;  4BA9 A;  2Q9Q B;  4O2A E;  1S94 A;  4MFR A;  4ANJ A;  2Q9Q C;  4CXX A;  2WM9 A;  1BR4 A;  3WI3 A;  1VOM A;  4AI6 A;  4XBF B;  2CLY C;  4H9P C;  4CI1 B;  3ZMS B;  2WWU A;  4UV8 B;  5DJQ C;  5FYM A;  3OBV E;  2K24 A;  1S35 A;  3JC6 D;  4PK4 A;  4AXP A;  3PU8 A;  4PFP A;  4O8S A;  1U5P A;  2DCF A;  2XAJ B;  3PUR A;  2NTY A;  4YFS A;  4UF0 B;  5LOV E;  1G8X A;  1YKE B;  5F3J A;  2UXN B;  3CQC B;  5CB4 E;  3LBX B;  4ZI2 C;  3N9O A;  3FB2 A;  2CXL A;  2NWB A;  2CMR A;  2E9X B;  2XAH B;  3N2G E;  2Q9Q A;  4C91 A;  4QX8 B;  2RP4 A;  4KUM B;  2CWO A;  4L9I A;  2LSI A;  1ZV4 X;  3PUS A;  1FEW A;  3NBX X;  2PBI A;  4PK6 A;  2V7M A;  3C64 A;  2C0S A;  1V9D A;  3QC9 A;  4PAG A;  3LK2 B;  3RC8 A;  3K3Q C;  3O1H A;  1B7T A;  1HCI A;  3N9N A;  4GIW A;  5LGT B;  4CI2 B;  3R84 B;  2V7I A;  4M1P A;  1MMN A;  3MK7 C;  4E7S A;  3VKG A;  1X79 A;  2ZM2 A;  2V7J A;  4HE8 A;  4QKN A;  5JDQ A;  3CX8 B;  4ZOL E;  4YLH A;  3C4W A;  2HPL A;  4DO0 A;  5LA6 E;  4NUV A;  4F6R C;  4IE4 A;  3OJA A;  3VU7 H;  1D1A A;  4PNI A;  3KFW X;  5JDG A;  2W61 A;  4ADZ A;  1FMV A;  1UCU A;  3B57 A;  4OYK A;  3R6N A;  5L2L A;  3NRY A;  2C5J A;  3ZCI A;  2LHR A;  3CVR A;  2JMK A;  3Q2M A;  4EB6 E;  4UEL A;  2VKD A;  3J7Y q;  2X9Y A;  4KBM B;  3AA1 B;  5LYJ E;  5LBM A;  2LSJ A;  2QA7 A;  3PUQ A;  3CX7 B;  3C4Z A;  1HG5 A;  1D1C A;  2Y48 B;  1ZHC A;  5JDM A;  3LG7 A;  1WRD A;  2CXF A;  3EUH A;  3E0Z A;  4BJM A;  5HWY A;  5IHY A;  5FXV A;  1SA0 E;  4ERR A;  3OKQ A;  4O4H E;  3RPU A;  5L3E B;  3LJC A;  5HXR A;  4O2B E;  3QK6 A;  1D0Z A;  3JC6 C;  3AA0 B;  3UFE A;  3UUX B;  1WYC A;  1IJ5 A;  1YW0 A;  2LJL A;  4IDZ A;  4AQF C;  1Z0P A;  4QHO A;  3AAA B;  1QUU A;  3U3I A;  3Q9D A;  2XQY A;  3BQI A;  5FXX A;  3BQK A;  3IBP A;  4HFV A;  3V5S A;  4GK0 E;  2KMF A;  4DVD A;  2VWA A;  5BMV E;  2NW9 A;  4DBQ A;  4HKA A;  4TZ4 C;  1MMA A;  4QXC B;  2PG8 A;  1Y64 B;  1NWM X;  2XHE B;  3CML A;  3ZPO A;  3I9Y A;  2VL8 A;  4P09 A;  3ZC0 A;  1FIO A;  3CWZ B;  5J1G A;  2QGS A;  5HAX A;  1D0X A;  3F57 A;  1BR1 A;  4L5G A;  2N2N A;  1ZKE A;  3AVR A;  4OK0 A;  3M65 A;  4IST A;  5FY0 A;  1MND A;  3O1J A;  5LNK A;  2A2F X;  4ZI7 E;  1KK7 A;  4TV8 E;  3BK9 A;  2Z6E A;  4HEA A;  2SPC A;  3WAK A;  3GWH A;  3ZJ1 A;  2KLQ A;  2NOX A;  2Q9Q D;  1E1H B;  4AQG A;  4MAL A;  3UTK A;  4MBQ A;  4PW8 A;  5A1L A;  1QSD A;  2HPJ A;  3KDS E;  5KX5 E;  5FY1 A;  5TAO A;  3FBL A;  1EZ3 A;  2DHR A;  2YK0 A;  4G63 A;  5JR9 B;  1MIY A;  4GK5 E;  1UX5 A;  2B1E A;  2NW7 A;  2EHO C;  2ZMA A;  4EXT A;  2XAQ B;  4AKH A;  5HXS A;  3I0O A;  3OYX A;  2X0L B;  4AKL A;  2LSG A;  3C51 A;  3HKE E;  2E8I A;  1O3X A;  2NTX A;  4J2C A;  1H7C A;  3SS1 A;  3T8O A;  2BVL A;  4H9S E;  2W0G A;  3PTR B;  4Z8X A;  4CI3 B;  2ZM8 A;  4EZH A;  3LK4 2;  4ZHQ E;  4NUU A;  3AA6 B;  2E9X C;  2EHO D;  2PFV A;  2X66 A;  4AKG A;  4IGU A;  5EZY E;  1LRZ A;  4TN7 B;  4P0B A;  4UV9 B;  2XUE A;  3RRW A;  1LVK A;  4WBO A;  2XAS B;  4IE0 A;  5JRE A;  4E7Z A;  3O9X A;  1MIW A;  4YHJ A;  4UF0 A;  2CLY B;  2LEH A;  3MZK B;  4PJN A;  5EK4 A;  2YIN A;  4XAX B;  3KVB A;  2DWK A;  3ZEF B;  5FNV E;  4IHJ E;  3ONX A;  2E9X A;  1BR0 A;  2WMN A;  3N5L A;  3N9M A;  4ZS2 A;  2DI4 A;  4UEM A;  2VKH A;  4AQF A;  2N1G A;  2YU1 A;  5DAB A;  5E0O A;  3HI2 A;  5HXC A;  4I4T E;  5JVD E;  3CX6 B;  3NZQ A;  2EHO B;  4G2A A;  2KZ7 B;  2UXX B;  3RYI E;  5JDN A;  1CUN A;  5JR9 C;  3KVA A;  5LHG B;  3KV4 A;  3HKD E;  5J2T E;  3UUN A;  3ANW B;  4K0U A;  5LCY A;  4CZZ B;  3QUJ A;  4MHC A;  4V1A v;  4BJN A;  3NRX A;  1T98 A;  2LOP A;  4C90 A;  2K9A A;  2KWH A;  3FXD B;  4H9O C;  1AJ3 A;  2W00 A;  2L9Q A;  2CE7 A;  2ODV A;  5JR9 A;  2ACX A;  3ZCJ A;  2X68 A;  3FXE B;  2VKO A;  1IZN B;  4H9Q C;  2P9B A;  3C98 B;  3PUA A;  3HR0 A;  2WBL A;  4PJJ A;  4O4I E;  3VKH A;  1LVF A;  2MTQ A;  4H9R C;  4UVA B;  5M4Y A;  3ETU A;  4X1Y E;  2DLR A;  1OXZ A;  5JRC B;  3SRZ A;  4KP3 C;  1WYB A;  3Q5X A;  3HA4 A;  4CXW A;  2XAF B;  4YJ3 E;  3IEE A;  3J9X 1;  5HXE A;  3O1I A;  4GYR A;  1HF8 A;  1NAF A;  3AVS A;  3L3P A;  1U4Q A;  5JQG E;  2BVM A;  2CA5 A;  2PJQ A;  4ZI3 C;  2XTL A;  4EIW A;  4QWN B;  4H63 V;  4GOU A;  3AAI A;  5KMG P;  5H6Q B;  1IJ6 A;  1MMD A;  3BQL A;  3ZJ2 A;  1HX8 A;  3N9P A;  2VK9 A;  1MMG A;  2YU2 A;  2X9H A;  2A3D A;  3MA9 A;  3ZC1 A;  3PU3 A;  5LJM A;  2MBG A;  4XZC A;  4PJL A;  1D1B A;  4JEH B;  4IE6 A;  3N2K E;  3EVY A;  3KV9 A;  5HYA A;  2X67 A;  5L3B B;  4QXH B;  5L3D B;  4OYJ A;  1MNE A;  2D0U A;  2RA1 A;  3F2E A;  2I59 A;  4EYY R;  4ZI3 D;  2LOS A;  3RRC A;  5ADX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...