2WSSV

The structure of the membrane extrinsic region of bovine atp synthase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
b'LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
molecule tags Hydrolase
source organism Bos taurus
publication title The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
pubmed doi rcsb
total genus 5
structure length 66
sequence length 66
chains with identical sequence Z
ec nomenclature
pdb deposition date 2009-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wssV01
2WSSV 2CLYC
chains in the Genus database with same CATH superfamily
4J2CA 3HKCE 3JC6C 4JI2T 5LOVE 3AVRA 2BG9E 2BS3A 2H7OA 5L3CB 2UU9T 4A97A 4DR1T 3ONXA 4IT4A 2XAGB 1YQ3A 4UXNB 4YTMA 3EABA 1MIVA 3UTKA 3GA8A 2J62A 3B5MA 3TLSA 4ZS2A 4TX5A 3PUYF 3TLWA 1O3XA 1ZEEA 3I0QA 2EHOD 2HH7A 3AAEB 2CWYA 1W09A 3QB5K 4WYVA 2GK9A 2WU2A 1T98A 2VURA 3F31A 4QX8B 4EYUA 5EK2A 2FJDA 3OKQA 2WCAA 3I0OA 2DI4A 1E7PA 2J47A 4H63V 5LHGB 2XPKA 2W63A 4JI3T 2CWOA 5LP6E 3CIRA 4KMCA 3RIFA 4ZEYA 2BKNA 1J5WA 3SFDA 5A1LA 5JRCB 2BG9C 3AA6B 2AXDS 3HI2A 2CPTA 4BA9A 2W00A 3RYIE 3KBTA 3DTOA 2NWBA 4LMLA 4O4LE 4YXDA 4AKGA 1FJGT 3CMLA 1J5ET 4BJNA 2CXDA 4DV7T 3P7IA 4XAXB 2KINB 2V7KA 3PUWF 3EDUA 3RIAA 3TLVA 5JRCA 4HFBA 2LRLA 4CXYA 2BZBA 2RP4A 3MXZA 2MAWA 4PK6A 4Q25A 4Z91A 4F8HA 3ZT6A 3FB2A 2XQ4A 1MNDA 4TZ4C 1YD8G 4AQGA 3RH3A 3LJCA 3ZMZB 1BR4A 2CBJA 1Y64B 1UX4A 4X62T 3RI5A 5AQNB 4UVAB 3TKLB 4DBRA 1NENA 1XZYA 2XAQB 3RKGA 1XNQT 3N9MA 4DR4T 4DR6T 2MBGA 2IIUA 4QXBB 4TNWA 4YY3T 2UXDT 4I50E 5AQVB 3EDVA 3PTRB 5CA1E 4ZXLA 2YK0A 5ABFB 4AI6A 2HN2A 4U2ZA 1D1CA 5LBQB 2IHR1 2WB5A 4H9NC 1IBMT 3ZJ1A 2Y8DA 4JBWF 2JQ9A 5AFUL 2NTXA 2IUBA 5DQWA 1ZP0A 2MPKA 4ZS3A 5ABEA 2ACXA 3H3AA 2H88A 2PG8A 2XHEB 5L47A 5JDGA 5ABFA 4HFVA 4ZI7E 1KNPA 4CXXA 1JNRA 2E9XA 2JMKA 2V6XA 1VOMA 4O4HE 4QXCB 4UF0B 1CHUA 3T1YT 4LF9T 4QKNA 4GKKT 3M65A 1KEYA 3ETVA 3L8RA 3P50A 4DV6T 4DO0A 4NXNT 3NRYA 1S35A 3K3OA 5KX5E 1E2AA 1M7KA 2YINA 3ABVA 4H9PC 4LF6T 2LM2A 4XBFB 4DR3T 4COFA 2E5LT 1MMDA 1HX8A 2Q9QA 2LHNA 2W67A 3HR0A 1Y01A 3P4PA 4O4IE 4A56A 2ZM2A 4H9SE 3VHLA 3ZYMA 2X0LB 5AQGB 4CI2B 3AE9A 4MBQA 4GYSA 2KZ7B 4DIDB 4YSYA 1CUNA 2XAJB 4U7IA 3PUVF 3ZEFB 2D0UA 2CHOA 2DWGA 1LKXA 3GMIA 3N9PA 3I1AA 5FKYA 1U5PA 3UULA 4JI6T 1IJ5A 2LSYA 2Y48B 2Q9QB 2ZLYA 3ZC0A 2XQ9A 1UUSA 2VWAA 2KLQA 2VQFT 4PJJA 2JQKA 4LF8T 3Q9DA 1HFAA 1YXRA 1NAFA 4K0KT 3O1IA 4PK5A 1E1HB 2VKHA 3UU6A 2Z6EA 5GONE 3A7MA 2EHOA 3TLTA 2QVAA 2JQHA 2X9YA 4U33A 3AE8A 2A9UA 4CXWA 3OYXA 5M4YA 2MOZA 3C98B 4H9RC 4X66T 2X0HA 2ODUA 3JAEA 4QH5A 5DABA 2LRKA 3RHWA 2IMLA 1XWMA 5HXCA 4ILCA 4HFIA 2XQ5A 5IYZE 2CBIA 3C4WA 5LG3A 2UXNB 5LGUB 1HNXT 2C5KT 3LSVA 1XDOA 2LE8A 2DCFA 2WY2A 2XUEA 3CKDA 2LSJA 3H3MA 4HFCA 4L0RA 3QK6A 3RYCE 3W15B 4F6RC 5JQGE 5IWAT 4DV0T 4JV5T 2FJEA 2W66A 2L8KA 4LF7T 1MMNA 2D5UA 4IIJE 4HWCA 4N78D 2P9BA 3N9NA 1YQ4A 3BK9A 2J4GA 2X67A 5J2UE 2ZM0A 2WSSV 1SA0E 5FYMA 2YDQA 4UV9B 4HE8A 4ERRA 2XY8B 3AEAA 3PU8A 1OXZA 1VCSA 1V9DA 3FBLA 4L9IA 3PUAA 5LNKA 4QWNB 4ISTA 3PDYA 3UU5A 3QB5A 2A2FX 3ZLIA 4ZI3D 4MLKA 3IA3A 4X1YE 3WAJA 3R84B 2CLYB 3AE7A 3O4XE 3Q5WA 4NUVA 4NXMT 3KDSE 3AVSA 4ISSA 4KHPT 2KWHA 5AQPB 4FI5A 2EHOC 2KWIB 4UV8B 3SOLA 5AQFB 2VB6A 5IUXA 1HR0T 4DMWA 2A72A 3OJAA 1KNZA 4JI8T 2YEVC 1QSDA 4NIQA 1IZNB 2I0MA 4PJLA 2X0YA 3I9YA 1XNRT 2N9DA 2JMHA 1FMVA 3FZKB 5JVDE 2WZHA 3KINB 5CGMA 1G8XA 3AE2A 2BVMA 2CE7A 3H37A 3MK7C 4O4JE 3ZSSA 3LK2B 3O1JA 3WAKA 4TWHA 4KBMB 4DVDA 1YKEB 5AQUB 4IE0A 4DV2T 3EUHA 2XQAA 3N2KE 3GWHA 5KMGP 2JIWA 2PFVA 2YDSA 4IREA 4UELA 4WZXA 4Z90A 3EVYA 1D1AA 4O2BE 3VR9A 3ESLA 5BMVE 3X1DA 5HXHA 4DNDA 2XQ3A 5HEUA 3AA1B 4YTNA 1B7TA 2XM2A 3SS1A 5JH7E 2HN1A 2BG9A 4H9QC 3FXEB 5LJMA 4DV1T 1UX5A 2DHRA 2H7VC 3LBXB 2SPCA 2LHRA 4B3ST 4WNKA 4WBNE 2NTYA 4TN7B 1BR2A 5FY0A 3RF1A 4HWFA 2H3RA 3FXDB 2V26A 2UXCT 3EI0A 3KVAA 3OYZA 3VRAA 2QYWA 4FJOA 1Z8UA 2BG9B 3IHRA 1FMWA 1ZKEA 4PJNA 2OLTA 4ANJA 4LF5T 3LBXA 1WRDA 1WYBA 2W4XA 3A5XA 4EIWA 4H9OC 3BQKA 2W62A 5AQKB 3Q5DA 4ZI2C 4GOUA 3PUQA 4B6XA 4YJ2E 1LVFA 2MTQA 3P8CD 4AKLA 4UVBB 2IC9A 2JQQA 2ES0A 2YDRA 3FZMB 5AQTB 2CXLA 2WM9A 3UUMA 5L3DB 3N5LA 4LFBT 4X5TA 4MALA 2V7LA 1G73A 2KMFA 5C3JA 1WCRA 5FXZA 1KNRA 5LJNA 4IE7A 4U72A 3UU4A 4JLEA 3AB3B 3GN5A 4JYAT 1I6ZA 1MMAA 1HF8A 3PJAA 1JNZA 1MIYA 3UUBA 1HS7A 2XAHB 1BR0A 4LMJA 5JR9C 3HL6A 4OYKA 2JJ9A 3ZYKA 4DV3T 3C50A 3PURA 4NPPA 1T8BA 2LKGA 2I59A 3ANWB 2UUCT 2VK9A 4Z8XA 4QXHB 4V1Av 5ABGA 4YSXA 3DP7A 3L09A 2IC6A 4KHZF 5FNVE 5C8YE 2OV9A 1GQEA 1U4QA 2BVLA 1IAPA 3ZCIA 4AXPA 4TWDA 5LXTE 2WMOA 4X65T 4P09A 2B1EA 2V5DA 2M6BA 4KX6A 3PV0F 5L2LA 4YHJA 1NWMX 3M3ZB 4ASKA 5HAXA 3P4QA 4ZZBA 1FEWA 5F3JA 2WP9A 3T1HT 2CA5A 3ETUA 3UUNA 4DV5T 5JR9A 4G2AA 2BS4A 2IW5B 1KF6A 3CQCB 3HKEE 4ILAA 4PNIA 4UEMA 3QNUA 4ILBA 4C90A 3IEEA 5ABHA 5L3BB 2X66A 5JDHA 3N9OA 2HHHT 2A3DA 4AISA 3PUZF 2H89A 2CMRA 1L0VA 2WU5A 3FZFB 4CQIA 2CRBA 3AE6A 5JR9B 2D9DA 2J1DG 1X9BA 4PAGA 2DL1A 3UFEA 1BR1A 4UVCB 3NKZA 3NVOA 4EYYR 5L4EA 4IDNA 2VVSA 3ZKRA 1T7SA 2W61A 1T72A 3AXJB 2Q9QD 2FJBA 3MA9A 3RQUA 3T8OA 5HEJA 3L3PA 5L3GB 3OTOT 1YKHB 2PTFA 1H7CA 4TWFA 5LBMA 5HEOA 2QRXA 4A5XA 1HG2A 4O8SA 2V5CA 3V5SA 2HPLA 3LK42 3RC3A 4NUUA 2LOSA 5AQLB 5CFBA 1HNZT 2BS2A 5TAOA 3AXJA 4P0BA 3UQ4A 4YT0A 1VCTA 3RRWA 4PW8A 2Y6XA 2NOXA 3KV9A 4BAYB 3RLFF 4IE4A 2DWKA 4YFSA 1Z0PA 1XMQT 2BKOA 2I6HA 3ZT5A 4OK0A 5HWYA 5AQOB 1WYCA 3E0ZA 4HWHA 1SUMB 4YHHT 3QUJA 2WS3A 4IDOA 3QC9A 3AECA 3CPZA 4AQFC 3P4WA 5AQSB 3RIUC 1S94A 2XQ7A 4H63H 3OVUA 4YTPA 4E7SA 4TV8E 2FUPA 4U3CA 4OX9T 4DMVA 2G0UA 2XASB 1R8IA 2M6IA 3AA7B 2CLYC 2K24A 2YU1A 3ONLC 3SFEA 5JDQA 5LYJE 4HTEA 4GKJT 2XAFB 1MIWA 3AEEA 3AEBA 4JI7T 3AE5A 5HCJA 4HWDA 1HX1B 3P4SA 3NRXA 4QH4A 2IDOB 1W9RA 2FBWA 5FL0A 4E7ZA 5H6QB 2VL0A 3ZSTA 5JTGA 2UUAT 1LVKA 4HFHA 4XZCA 5HXRA 3J7Yq 1XMOT 3HKBE 5AQJB 1WFDA 2X9HA 3QOFA 3B57A 4I55E 3CQXC 5HYAA 2PBIA 3AE1A 2XTLA 2VL8A 4QHOA 4WW0A 2XQYA 2CHNA 5C2TA 5DJQC 2V6YA 2V7MA 3Q2MA 2K9AA 3MZKB 2XSAA 1HTJF 1M62A 4I0UA 3RKOA 4I43B 1UGOA 3MJXA 2VKDA 1AJ3A 2QA7A 2E9XB 2YU2A 3KV5A 3G06A 3K8PC 1OEDC 3C4ZA 4UF0A 4DR5T 3HKDE 4QH1A 4PJMA 2V1DB 5E0OA 5FP3A 3ZT7A 4CZZB 2UXBT 3NZPA 3VR8A 4K0UA 4YLHA 1QUUA 2V6YB 2WQYA 1D0YA 2L9QA 3WI3A 5JDMA 5LMNT 4U74A 4B3MT 3C64A 4YJ3E 2EHOB 2LSGA 5BR8T 5JDFA 2RA1A 1UCUA 3KVBA 5LHHB 4CN4A 5JDLA 1N36T 4UR9A 1ZV4X 3K3QC 1HG5A 3CX8B 2E9XD 1DU2A 3CK6A 4G63A 3VKGA 3LFMA 4HGAA 3EAMA 1IJ6A 4JI5T 1VRBA 2NR4A 2VKOA 2XM1A 2UXXB 3O1HA 3RX6A 2WMNA 3I9WA 4AIUA 2CM0A 4GIWA 3RQWA 4CN1A 4JUYA 4ILUA 2VKJA 3Q5XA 3K3NA 4MFRA 3UU8A 3UU3A 5J2TE 2VQET 2L3LA 2KT9A 2BBJA 2WWUA 3N2OA 3Q5EA 4IDQA 5AQMB 1W0BA 3VRBA 3ONJA 4M1PA 4DBQA 2WDVA 2F4VT 5H6RB 3E08A 3FBZA 3N2GE 4HFDA 4HWIB 5EK3A 4LMKA 4X64T 3LK3B 2LM9A 4ZI3C 1SE7A 1ZOYA 2C5JA 2M67A 1US7B 2FJAA 2W2UA 3SRZA 4P1NA 1UURA 4TNVA 3RIUA 1W0AA 4ADZA 4EV6A 4WBOA 3ZPOA 3DJBA 5FMNA 3SWHA 1HNWT 3ZMUB 4CN6A 2X51A 2HPJA 1OEDA 4IGUA 5FXXA 3AEGA 5AQIB 1IBLT 3D0TA 5L3EB 1D1BA 1WR0A 3ZMSB 2BKPA 2K5BB 3KBUA 1N34T 2QGSA 4X20E 2R6GF 4ZI2D 4OHFA 4QX7B 3UFGA 5J0ZA 2E2AA 1YW0A 2VASA 2X9XA 2OA5A 3A8YC 4CI3B 1D0XA 2Q9QC 2JPFA 3UUXB 2YOEA 1LRZA 1OEDB 3BQLA 5F5WA 5LHIB 4I4TE 1XDPA 2XJ7A 3OPCA 4DUYT 2ZMAA 2KNDA 4OYJA 5EZYE 2V7JA 2WBLA 2MYSA 4KP3C 2CXFA 1N33T 4PK4A 3BQIA 5KDMC 5LG4A 3B13A 3IF8B 3RPUA 2NW7A 5FY7A 3ZMTB 2ACZA 3C4XA 2RPAA 4PFOA 5HWXA 1QLBA 4IDZA 2XZEA 5LA6E 3U78A 2KXPB 4EZ4A 3FZHB 4EAHA 4JEUB 2ZM8A 3LDQB 4L5GA 4AKIA 3PE0A 4AQYT 5FVLA 4DR2T 3CVRA 2UUBT 3S4UA 4A98A 5JREA 5ADXL 3AAIA 3AEFA 4EEBA 4U31A 3RRCA 4EEDA 4ZZCA 2LKHA 4DV4T 3AE3A 3PJAJ 2X9WA 4LF4T 3OBVE 2LJLA 2BDEA 2E9XC 2PJQA 2X68A 4PFPA 2KSRA 3UQ7A 4LFCT 3F57A 3UT5E 4C91A 2WWVA 4GYRA 1ZHCA 2N2NA 2YN6A 1EZ3A 3F2EA 3RYFE 4JI0T 3PUGA 1N32T 1MMGA 3AAAB 2LOPA 5FY1A 4ZOLE 4O2AE 2D2SA 4U2YA 3RYHE 1OWAA 5DQVA 3AEDA 3VU7H 3MKDA 3JC6D 3IBPA 4EXTA 3FZLB 4ZHQE 1KK7A 2C0SA 2LT3A 3ZN0B 1X79A 5HEHA 2LEHA 1MNEA 2B76A 4DR7T 1D0ZA 5IHYA 3N9QA 4MHCA 3LG7A 4X1KE 1NEKA 3J9X1 5LGTB 4IL9A 3CWZB 5FVKA 3JAFA 3MACA 2AE9A 3EHZA 2XSBA 5FXWA 3ZYLA 2LLYA 2VVNA 1I94T 5LMUT 4JI1T 5CA0E 4EB6E 4X1IE 3CQGB 3PUXF 3NBXX 3E22E 4JI4T 2JRKA 3HA4A 3RC8A 2W0GA 5CJ5A 4KI0F 3GN5B 4TV9E 1FIOA 2CCQA 3CX7B 4UIGA 5EK4A 5HXEA 4IDPA 5L4HA 2WAUA 4HFEA 4B3TT 1SHZC 2E8IA 4HEAA 2LSKA 3AA0B 3P4RA 4JEHB 5HCMA 4CI1B 4OFZA 2C5IT 2NP9A 2V7IA 2E5VA 2NW9A 3U3IA 2ZM6T 3ZCJA 5F8PA 2K48A 2CEAA 2WDRA 3N9LA 3KFWX 2NW8A 2XQ6A 5FL1A 3R6NA 1KFYA 2WZIA 3PUSA 5AQQB 2ODVA 2XQ8A 5LCYA 4AKHA 4IE6A 2K3WA 5CB4E 2IAKA 1IBKT 3V5UA 5AQHB 4DUZT 3RGLA 3NWIA 5HEGA 5L3FB 3CX6B 3C51A 4GK0E 3VKHA 1J1JA 3KV6A 4HKAA 1WLXA 1HCIA 2LSIA 3NZQA 3FHNA 3ZJ2A 1OEDE 4U7YA 3ZN1B 4IE5A 5AQRB 4EZHA 3L39A 3PU3A 4AQFA 4EGWA 4LFAT 4YSZA 3O9XA 3ANWA 3JCFA 5LB7B 5KXJA 5LGNB 4TUYE 4EOZB 1UK5A 3TLUA 3AE4A 4HN9A 4B3RT 4KUMB 2D0TA 4P0AA 4BJMA 4AKRB 3JADA 4IL4A 4IHJE 3KV4A 5J1GA 5ETWA 5JDNA 2DNXA 2YKSA 1WR6A 2N1GA 2WDQA 3K1SA 4GK5E 2BBHA 2V8SV 5FXVA 2DLRA 5HXSA 3ZC1A 3ZMVB
chains in the Genus database with same CATH topology
4J2CA 3HKCE 3JC6C 5LOVE 3AVRA 2H7OA 5L3CB 3ONXA 2XAGB 4UXNB 1MIVA 3UTKA 3GA8A 4ZS2A 4TX5A 1O3XA 1ZEEA 3I0QA 2EHOD 2HH7A 3AAEB 2CWYA 4BJMA 3J7Yq 4EYUA 2GK9A 5EK2A 1T98A 3F31A 4QX8B 3OKQA 3I0OA 2DI4A 4H63V 5LHGB 2W63A 2CWOA 5LP6E 4KMCA 5A1LA 5JRCB 3AA6B 3HI2A 4BA9A 2W00A 3RYIE 3KBTA 3DTOA 2NWBA 4O4LE 4AKGA 3CMLA 4BJNA 2CXDA 3P7IA 4XAXB 2KINB 2V7KA 3EDUA 5JRCA 4CXYA 2BZBA 2RP4A 3MXZA 4PK6A 3FB2A 1MNDA 4TZ4C 1YD8G 4AQGA 3RH3A 3LJCA 3ZMZB 1BR4A 1Y64B 1UX4A 4UVAB 3TKLB 4DBRA 2XAQB 3N9MA 2MBGA 4QXBB 4I50E 3EDVA 3PTRB 5CA1E 2YK0A 4AI6A 1D1CA 5LBQB 4H9NC 3ZJ1A 2Y8DA 5AFUL 2NTXA 5DQWA 4ZS3A 2ACXA 3H3AA 2PG8A 2XHEB 5JDGA 4HFVA 4ZI7E 4CXXA 2E9XA 4QXCB 2JMKA 1VOMA 4O4HE 4UF0B 4QKNA 3M65A 3ETVA 4DO0A 3NRYA 1S35A 3K3OA 5KX5E 2YINA 4XBFB 4H9PC 1MMDA 1HX8A 2Q9QA 2LHNA 3HR0A 4O4IE 4A56A 2ZM2A 4H9SE 3VHLA 3ZYMA 2X0LB 4CI2B 4MBQA 4GYSA 2KZ7B 1CUNA 2XAJB 3ZEFB 2D0UA 2DWGA 3GMIA 1LKXA 3N9PA 3UULA 3I1AA 5JDNA 1U5PA 3ZC0A 1IJ5A 2LSYA 2Y48B 2Q9QB 2ZLYA 2VWAA 2KLQA 4PJJA 3Q9DA 1HFAA 1NAFA 3O1IA 4PK5A 1E1HB 2VKHA 2Z6EA 5GONE 2EHOA 2X9YA 4CXWA 3OYXA 5M4YA 2MOZA 3C98B 4H9RC 2ODUA 5DABA 5HXCA 5LGUB 5IYZE 3C4WA 2UXNB 2C5KT 5FMNA 2LE8A 2XUEA 2DCFA 3CKDA 2LSJA 3RYCE 4L0RA 3W15B 3QK6A 4F6RC 5JQGE 2L8KA 1MMNA 2D5UA 4IIJE 4N78D 2P9BA 3N9NA 3BK9A 2X67A 5J2UE 2ZM0A 2WSSV 1SA0E 5FYMA 4UV9B 4HE8A 4ERRA 3PU8A 1OXZA 3FBLA 1V9DA 4L9IA 3PUAA 5LNKA 4QWNB 4ISTA 3PDYA 2A2FX 3ZLIA 4ZI3D 4MLKA 4X1YE 3WAJA 3R84B 2CLYB 3O4XE 3Q5WA 4NUVA 3KDSE 3AVSA 4ISSA 2KWHA 4FI5A 2EHOC 2KWIB 4UV8B 3SOLA 2VB6A 4DMWA 2A72A 3OJAA 1KNZA 2YEVC 1QSDA 1IZNB 4PJLA 3I9YA 2N9DA 2JMHA 1FMVA 5JVDE 3KINB 1G8XA 3MK7C 2BVMA 2CE7A 3H37A 4O4JE 3LK2B 3O1JA 3WAKA 4KBMB 4DVDA 1YKEB 4IE0A 3EUHA 3N2KE 3GWHA 5KMGP 2PFVA 4UELA 3EVYA 1D1AA 4O2BE 5BMVE 3ESLA 5HXHA 4DNDA 3AA1B 1B7TA 3SS1A 5JH7E 4H9QC 3FXEB 5LJMA 1UX5A 2DHRA 2H7VC 3LBXB 2SPCA 2LHRA 4WNKA 4WBNE 2NTYA 4TN7B 1BR2A 5FY0A 2H3RA 3FXDB 2V26A 3KVAA 3OYZA 4FJOA 3IHRA 1FMWA 1ZKEA 4PJNA 4ANJA 3LBXA 1WRDA 1WYBA 3A5XA 4EIWA 4H9OC 3BQKA 2W62A 4ZI2C 4GOUA 3PUQA 4B6XA 4YJ2E 1LVFA 2MTQA 3P8CD 4AKLA 4UVBB 2IC9A 2JQQA 2ES0A 5LHHB 2CXLA 2WM9A 3UUMA 5L3DB 3N5LA 4MALA 2V7LA 1G73A 2KMFA 5FXZA 5LJNA 4IE7A 4U72A 4JLEA 3AB3B 3GN5A 1MMAA 1HF8A 1MIYA 2XAHB 1BR0A 5JR9C 3HL6A 4OYKA 2JJ9A 3ZYKA 3C50A 3PURA 2I59A 3ANWB 2VK9A 4Z8XA 4QXHB 4V1Av 3DP7A 3L09A 2IC6A 5FNVE 5C8YE 1U4QA 2BVLA 1IAPA 3ZCIA 4AXPA 5LXTE 2WMOA 4P09A 2B1EA 5L2LA 4YHJA 1NWMX 4ASKA 5HAXA 1FEWA 5F3JA 3ETUA 2CA5A 3UUNA 5JR9A 4G2AA 2IW5B 3CQCB 3HKEE 4PNIA 4UEMA 4C90A 3IEEA 5L3BB 2X66A 5JDHA 3N9OA 2A3DA 2CMRA 4CQIA 5JR9B 2J1DG 3UFEA 4PAGA 1BR1A 4UVCB 4EYYR 2W61A 3MA9A 2Q9QD 3T8OA 3L3PA 1YKHB 5LBMA 1H7CA 1HG2A 4O8SA 3V5SA 2HPLA 3LK42 3RC3A 4NUUA 2LOSA 5TAOA 4P0BA 3RRWA 4PW8A 2Y6XA 2NOXA 3KV9A 4BAYB 4IE4A 2DWKA 4YFSA 1Z0PA 4OK0A 5HWYA 1WYCA 3E0ZA 3QUJA 3QC9A 3CPZA 4AQFC 1S94A 4H63H 4E7SA 4TV8E 4DMVA 2G0UA 2XASB 3AA7B 2CLYC 2K24A 2YU1A 5JDQA 5LYJE 4HTEA 2XAFB 1MIWA 3NRXA 4E7ZA 5H6QB 1LVKA 4XZCA 5HXRA 3HKBE 2X9HA 3B57A 4I55E 3CQXC 5HYAA 2PBIA 2XTLA 2VL8A 4QHOA 4WW0A 2XQYA 5DJQC 2V7MA 3Q2MA 2K9AA 3MZKB 3WI3A 1HTJF 3RKOA 4I43B 3MJXA 2VKDA 1AJ3A 2QA7A 2E9XB 2YU2A 3KV5A 4UF0A 3K8PC 3C4ZA 3HKDE 4PJMA 5E0OA 2V1DB 5FP3A 4CZZB 3NZPA 4K0UA 4YLHA 1QUUA 1D0YA 2L9QA 5JDMA 4U74A 3C64A 4YJ3E 2EHOB 2LSGA 5JDFA 2RA1A 1UCUA 3KVBA 5JDLA 1ZV4X 3K3QC 1HG5A 3CX8B 2E9XD 4G63A 3VKGA 3LFMA 4HGAA 3RX6A 1IJ6A 1VRBA 2VKOA 2UXXB 3O1HA 2WMNA 3I9WA 2CM0A 4GIWA 4JUYA 4ILUA 2VKJA 3Q5XA 3K3NA 4MFRA 5J2TE 2L3LA 2KT9A 2WWUA 3N2OA 4DBQA 4M1PA 5H6RB 3E08A 3FBZA 3N2GE 5EK3A 3LK3B 2LM9A 4ZI3C 2M67A 2C5JA 1US7B 3SRZA 1HS7A 4ADZA 4WBOA 3ZPOA 3DJBA 3SWHA 3ZMUB 2X51A 2HPJA 4IGUA 5FXXA 3D0TA 5L3EB 1D1BA 3ZMSB 2K5BB 3KBUA 2QGSA 4X20E 4ZI2D 4OHFA 4QX7B 2VASA 1YW0A 2X9XA 5L3GB 2OA5A 4CI3B 1D0XA 2JPFA 2Q9QC 3UUXB 5LHIB 1LRZA 3BQLA 4I4TE 2ZMAA 2KNDA 4OYJA 5EZYE 2V7JA 2WBLA 2MYSA 4KP3C 2CXFA 4PK4A 3BQIA 5KDMC 5LG4A 3B13A 3IF8B 3RPUA 2NW7A 5FY7A 3ZMTB 3C4XA 4PFOA 5HWXA 4IDZA 3U78A 5LA6E 2KXPB 4EZ4A 4EAHA 4JEUB 2ZM8A 4L5GA 4AKIA 3PE0A 3CVRA 3S4UA 5JREA 5ADXL 3AAIA 3RRCA 2X9WA 3OBVE 2LJLA 2BDEA 2E9XC 2PJQA 2X68A 4PFPA 3F57A 3UT5E 4C91A 4GYRA 1ZHCA 2N2NA 3F2EA 1EZ3A 3RYFE 3PUGA 1MMGA 3AAAB 2LOPA 5FY1A 4ZOLE 4O2AE 2D2SA 3RYHE 1OWAA 5DQVA 3VU7H 3MKDA 3JC6D 3IBPA 4EXTA 4ZHQE 1KK7A 2C0SA 2LT3A 3ZN0B 1X79A 2LEHA 1MNEA 1D0ZA 5IHYA 3N9QA 4MHCA 3LG7A 4X1KE 3J9X1 5LGTB 3CWZB 3MACA 5FXWA 3ZYLA 5CA0E 4EB6E 4X1IE 3CQGB 3NBXX 3E22E 2JRKA 3HA4A 3RC8A 2W0GA 3GN5B 4TV9E 1FIOA 2CCQA 3CX7B 4UIGA 5EK4A 5HXEA 2WAUA 1SHZC 2E8IA 4HEAA 2LSKA 3AA0B 4JEHB 4CI1B 4OFZA 2C5IT 2NP9A 2V7IA 3U3IA 2NW9A 3ZCJA 5F8PA 2K48A 2CEAA 3N9LA 3KFWX 2NW8A 3R6NA 3PUSA 5LCYA 2ODVA 4AKHA 4IE6A 5CB4E 2IAKA 3V5UA 5L3FB 3CX6B 3C51A 4GK0E 3VKHA 3KV6A 4HKAA 1WLXA 1HCIA 2LSIA 3NZQA 3FHNA 3ZJ2A 3ZN1B 4IE5A 4EZHA 4AQFA 3PU3A 3O9XA 3ANWA 5LGNB 4TUYE 4EOZB 4HN9A 4KUMB 2D0TA 4P0AA 4AKRB 5J1GA 4IHJE 3KV4A 5ETWA 2DNXA 4GK5E 1WR6A 2N1GA 5FXVA 2DLRA 5HXSA 3ZC1A 3ZMVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS V;  2CLY C; 
#chains in the Genus database with same CATH topology
 4J2C A;  3HKC E;  3JC6 C;  4JI2 T;  5LOV E;  3AVR A;  2BG9 E;  2BS3 A;  2H7O A;  5L3C B;  2UU9 T;  4A97 A;  4DR1 T;  3ONX A;  4IT4 A;  2XAG B;  1YQ3 A;  4UXN B;  4YTM A;  3EAB A;  1MIV A;  3UTK A;  3GA8 A;  2J62 A;  3B5M A;  3TLS A;  4ZS2 A;  4TX5 A;  3PUY F;  3TLW A;  1O3X A;  1ZEE A;  3I0Q A;  2EHO D;  2HH7 A;  3AAE B;  2CWY A;  1W09 A;  3QB5 K;  4WYV A;  2GK9 A;  2WU2 A;  1T98 A;  2VUR A;  3F31 A;  4QX8 B;  4EYU A;  5EK2 A;  2FJD A;  3OKQ A;  2WCA A;  3I0O A;  2DI4 A;  1E7P A;  2J47 A;  4H63 V;  5LHG B;  2XPK A;  2W63 A;  4JI3 T;  2CWO A;  5LP6 E;  3CIR A;  4KMC A;  3RIF A;  4ZEY A;  2BKN A;  1J5W A;  3SFD A;  5A1L A;  5JRC B;  2BG9 C;  3AA6 B;  2AXD S;  3HI2 A;  2CPT A;  4BA9 A;  2W00 A;  3RYI E;  3KBT A;  3DTO A;  2NWB A;  4LML A;  4O4L E;  4YXD A;  4AKG A;  1FJG T;  3CML A;  1J5E T;  4BJN A;  2CXD A;  4DV7 T;  3P7I A;  4XAX B;  2KIN B;  2V7K A;  3PUW F;  3EDU A;  3RIA A;  3TLV A;  5JRC A;  4HFB A;  2LRL A;  4CXY A;  2BZB A;  2RP4 A;  3MXZ A;  2MAW A;  4PK6 A;  4Q25 A;  4Z91 A;  4F8H A;  3ZT6 A;  3FB2 A;  2XQ4 A;  1MND A;  4TZ4 C;  1YD8 G;  4AQG A;  3RH3 A;  3LJC A;  3ZMZ B;  1BR4 A;  2CBJ A;  1Y64 B;  1UX4 A;  4X62 T;  3RI5 A;  5AQN B;  4UVA B;  3TKL B;  4DBR A;  1NEN A;  1XZY A;  2XAQ B;  3RKG A;  1XNQ T;  3N9M A;  4DR4 T;  4DR6 T;  2MBG A;  2IIU A;  4QXB B;  4TNW A;  4YY3 T;  2UXD T;  4I50 E;  5AQV B;  3EDV A;  3PTR B;  5CA1 E;  4ZXL A;  2YK0 A;  5ABF B;  4AI6 A;  2HN2 A;  4U2Z A;  1D1C A;  5LBQ B;  2IHR 1;  2WB5 A;  4H9N C;  1IBM T;  3ZJ1 A;  2Y8D A;  4JBW F;  2JQ9 A;  5AFU L;  2NTX A;  2IUB A;  5DQW A;  1ZP0 A;  2MPK A;  4ZS3 A;  5ABE A;  2ACX A;  3H3A A;  2H88 A;  2PG8 A;  2XHE B;  5L47 A;  5JDG A;  5ABF A;  4HFV A;  4ZI7 E;  1KNP A;  4CXX A;  1JNR A;  2E9X A;  2JMK A;  2V6X A;  1VOM A;  4O4H E;  4QXC B;  4UF0 B;  1CHU A;  3T1Y T;  4LF9 T;  4QKN A;  4GKK T;  3M65 A;  1KEY A;  3ETV A;  3L8R A;  3P50 A;  4DV6 T;  4DO0 A;  4NXN T;  3NRY A;  1S35 A;  3K3O A;  5KX5 E;  1E2A A;  1M7K A;  2YIN A;  3ABV A;  4H9P C;  4LF6 T;  2LM2 A;  4XBF B;  4DR3 T;  4COF A;  2E5L T;  1MMD A;  1HX8 A;  2Q9Q A;  2LHN A;  2W67 A;  3HR0 A;  1Y01 A;  3P4P A;  4O4I E;  4A56 A;  2ZM2 A;  4H9S E;  3VHL A;  3ZYM A;  2X0L B;  5AQG B;  4CI2 B;  3AE9 A;  4MBQ A;  4GYS A;  2KZ7 B;  4DID B;  4YSY A;  1CUN A;  2XAJ B;  4U7I A;  3PUV F;  3ZEF B;  2D0U A;  2CHO A;  2DWG A;  1LKX A;  3GMI A;  3N9P A;  3I1A A;  5FKY A;  1U5P A;  3UUL A;  4JI6 T;  1IJ5 A;  2LSY A;  2Y48 B;  2Q9Q B;  2ZLY A;  3ZC0 A;  2XQ9 A;  1UUS A;  2VWA A;  2KLQ A;  2VQF T;  4PJJ A;  2JQK A;  4LF8 T;  3Q9D A;  1HFA A;  1YXR A;  1NAF A;  4K0K T;  3O1I A;  4PK5 A;  1E1H B;  2VKH A;  3UU6 A;  2Z6E A;  5GON E;  3A7M A;  2EHO A;  3TLT A;  2QVA A;  2JQH A;  2X9Y A;  4U33 A;  3AE8 A;  2A9U A;  4CXW A;  3OYX A;  5M4Y A;  2MOZ A;  3C98 B;  4H9R C;  4X66 T;  2X0H A;  2ODU A;  3JAE A;  4QH5 A;  5DAB A;  2LRK A;  3RHW A;  2IML A;  1XWM A;  5HXC A;  4ILC A;  4HFI A;  2XQ5 A;  5IYZ E;  2CBI A;  3C4W A;  5LG3 A;  2UXN B;  5LGU B;  1HNX T;  2C5K T;  3LSV A;  1XDO A;  2LE8 A;  2DCF A;  2WY2 A;  2XUE A;  3CKD A;  2LSJ A;  3H3M A;  4HFC A;  4L0R A;  3QK6 A;  3RYC E;  3W15 B;  4F6R C;  5JQG E;  5IWA T;  4DV0 T;  4JV5 T;  2FJE A;  2W66 A;  2L8K A;  4LF7 T;  1MMN A;  2D5U A;  4IIJ E;  4HWC A;  4N78 D;  2P9B A;  3N9N A;  1YQ4 A;  3BK9 A;  2J4G A;  2X67 A;  5J2U E;  2ZM0 A;  2WSS V;  1SA0 E;  5FYM A;  2YDQ A;  4UV9 B;  4HE8 A;  4ERR A;  2XY8 B;  3AEA A;  3PU8 A;  1OXZ A;  1VCS A;  1V9D A;  3FBL A;  4L9I A;  3PUA A;  5LNK A;  4QWN B;  4IST A;  3PDY A;  3UU5 A;  3QB5 A;  2A2F X;  3ZLI A;  4ZI3 D;  4MLK A;  3IA3 A;  4X1Y E;  3WAJ A;  3R84 B;  2CLY B;  3AE7 A;  3O4X E;  3Q5W A;  4NUV A;  4NXM T;  3KDS E;  3AVS A;  4ISS A;  4KHP T;  2KWH A;  5AQP B;  4FI5 A;  2EHO C;  2KWI B;  4UV8 B;  3SOL A;  5AQF B;  2VB6 A;  5IUX A;  1HR0 T;  4DMW A;  2A72 A;  3OJA A;  1KNZ A;  4JI8 T;  2YEV C;  1QSD A;  4NIQ A;  1IZN B;  2I0M A;  4PJL A;  2X0Y A;  3I9Y A;  1XNR T;  2N9D A;  2JMH A;  1FMV A;  3FZK B;  5JVD E;  2WZH A;  3KIN B;  5CGM A;  1G8X A;  3AE2 A;  2BVM A;  2CE7 A;  3H37 A;  3MK7 C;  4O4J E;  3ZSS A;  3LK2 B;  3O1J A;  3WAK A;  4TWH A;  4KBM B;  4DVD A;  1YKE B;  5AQU B;  4IE0 A;  4DV2 T;  3EUH A;  2XQA A;  3N2K E;  3GWH A;  5KMG P;  2JIW A;  2PFV A;  2YDS A;  4IRE A;  4UEL A;  4WZX A;  4Z90 A;  3EVY A;  1D1A A;  4O2B E;  3VR9 A;  3ESL A;  5BMV E;  3X1D A;  5HXH A;  4DND A;  2XQ3 A;  5HEU A;  3AA1 B;  4YTN A;  1B7T A;  2XM2 A;  3SS1 A;  5JH7 E;  2HN1 A;  2BG9 A;  4H9Q C;  3FXE B;  5LJM A;  4DV1 T;  1UX5 A;  2DHR A;  2H7V C;  3LBX B;  2SPC A;  2LHR A;  4B3S T;  4WNK A;  4WBN E;  2NTY A;  4TN7 B;  1BR2 A;  5FY0 A;  3RF1 A;  4HWF A;  2H3R A;  3FXD B;  2V26 A;  2UXC T;  3EI0 A;  3KVA A;  3OYZ A;  3VRA A;  2QYW A;  4FJO A;  1Z8U A;  2BG9 B;  3IHR A;  1FMW A;  1ZKE A;  4PJN A;  2OLT A;  4ANJ A;  4LF5 T;  3LBX A;  1WRD A;  1WYB A;  2W4X A;  3A5X A;  4EIW A;  4H9O C;  3BQK A;  2W62 A;  5AQK B;  3Q5D A;  4ZI2 C;  4GOU A;  3PUQ A;  4B6X A;  4YJ2 E;  1LVF A;  2MTQ A;  3P8C D;  4AKL A;  4UVB B;  2IC9 A;  2JQQ A;  2ES0 A;  2YDR A;  3FZM B;  5AQT B;  2CXL A;  2WM9 A;  3UUM A;  5L3D B;  3N5L A;  4LFB T;  4X5T A;  4MAL A;  2V7L A;  1G73 A;  2KMF A;  5C3J A;  1WCR A;  5FXZ A;  1KNR A;  5LJN A;  4IE7 A;  4U72 A;  3UU4 A;  4JLE A;  3AB3 B;  3GN5 A;  4JYA T;  1I6Z A;  1MMA A;  1HF8 A;  3PJA A;  1JNZ A;  1MIY A;  3UUB A;  1HS7 A;  2XAH B;  1BR0 A;  4LMJ A;  5JR9 C;  3HL6 A;  4OYK A;  2JJ9 A;  3ZYK A;  4DV3 T;  3C50 A;  3PUR A;  4NPP A;  1T8B A;  2LKG A;  2I59 A;  3ANW B;  2UUC T;  2VK9 A;  4Z8X A;  4QXH B;  4V1A v;  5ABG A;  4YSX A;  3DP7 A;  3L09 A;  2IC6 A;  4KHZ F;  5FNV E;  5C8Y E;  2OV9 A;  1GQE A;  1U4Q A;  2BVL A;  1IAP A;  3ZCI A;  4AXP A;  4TWD A;  5LXT E;  2WMO A;  4X65 T;  4P09 A;  2B1E A;  2V5D A;  2M6B A;  4KX6 A;  3PV0 F;  5L2L A;  4YHJ A;  1NWM X;  3M3Z B;  4ASK A;  5HAX A;  3P4Q A;  4ZZB A;  1FEW A;  5F3J A;  2WP9 A;  3T1H T;  2CA5 A;  3ETU A;  3UUN A;  4DV5 T;  5JR9 A;  4G2A A;  2BS4 A;  2IW5 B;  1KF6 A;  3CQC B;  3HKE E;  4ILA A;  4PNI A;  4UEM A;  3QNU A;  4ILB A;  4C90 A;  3IEE A;  5ABH A;  5L3B B;  2X66 A;  5JDH A;  3N9O A;  2HHH T;  2A3D A;  4AIS A;  3PUZ F;  2H89 A;  2CMR A;  1L0V A;  2WU5 A;  3FZF B;  4CQI A;  2CRB A;  3AE6 A;  5JR9 B;  2D9D A;  2J1D G;  1X9B A;  4PAG A;  2DL1 A;  3UFE A;  1BR1 A;  4UVC B;  3NKZ A;  3NVO A;  4EYY R;  5L4E A;  4IDN A;  2VVS A;  3ZKR A;  1T7S A;  2W61 A;  1T72 A;  3AXJ B;  2Q9Q D;  2FJB A;  3MA9 A;  3RQU A;  3T8O A;  5HEJ A;  3L3P A;  5L3G B;  3OTO T;  1YKH B;  2PTF A;  1H7C A;  4TWF A;  5LBM A;  5HEO A;  2QRX A;  4A5X A;  1HG2 A;  4O8S A;  2V5C A;  3V5S A;  2HPL A;  3LK4 2;  3RC3 A;  4NUU A;  2LOS A;  5AQL B;  5CFB A;  1HNZ T;  2BS2 A;  5TAO A;  3AXJ A;  4P0B A;  3UQ4 A;  4YT0 A;  1VCT A;  3RRW A;  4PW8 A;  2Y6X A;  2NOX A;  3KV9 A;  4BAY B;  3RLF F;  4IE4 A;  2DWK A;  4YFS A;  1Z0P A;  1XMQ T;  2BKO A;  2I6H A;  3ZT5 A;  4OK0 A;  5HWY A;  5AQO B;  1WYC A;  3E0Z A;  4HWH A;  1SUM B;  4YHH T;  3QUJ A;  2WS3 A;  4IDO A;  3QC9 A;  3AEC A;  3CPZ A;  4AQF C;  3P4W A;  5AQS B;  3RIU C;  1S94 A;  2XQ7 A;  4H63 H;  3OVU A;  4YTP A;  4E7S A;  4TV8 E;  2FUP A;  4U3C A;  4OX9 T;  4DMV A;  2G0U A;  2XAS B;  1R8I A;  2M6I A;  3AA7 B;  2CLY C;  2K24 A;  2YU1 A;  3ONL C;  3SFE A;  5JDQ A;  5LYJ E;  4HTE A;  4GKJ T;  2XAF B;  1MIW A;  3AEE A;  3AEB A;  4JI7 T;  3AE5 A;  5HCJ A;  4HWD A;  1HX1 B;  3P4S A;  3NRX A;  4QH4 A;  2IDO B;  1W9R A;  2FBW A;  5FL0 A;  4E7Z A;  5H6Q B;  2VL0 A;  3ZST A;  5JTG A;  2UUA T;  1LVK A;  4HFH A;  4XZC A;  5HXR A;  3J7Y q;  1XMO T;  3HKB E;  5AQJ B;  1WFD A;  2X9H A;  3QOF A;  3B57 A;  4I55 E;  3CQX C;  5HYA A;  2PBI A;  3AE1 A;  2XTL A;  2VL8 A;  4QHO A;  4WW0 A;  2XQY A;  2CHN A;  5C2T A;  5DJQ C;  2V6Y A;  2V7M A;  3Q2M A;  2K9A A;  3MZK B;  2XSA A;  1HTJ F;  1M62 A;  4I0U A;  3RKO A;  4I43 B;  1UGO A;  3MJX A;  2VKD A;  1AJ3 A;  2QA7 A;  2E9X B;  2YU2 A;  3KV5 A;  3G06 A;  3K8P C;  1OED C;  3C4Z A;  4UF0 A;  4DR5 T;  3HKD E;  4QH1 A;  4PJM A;  2V1D B;  5E0O A;  5FP3 A;  3ZT7 A;  4CZZ B;  2UXB T;  3NZP A;  3VR8 A;  4K0U A;  4YLH A;  1QUU A;  2V6Y B;  2WQY A;  1D0Y A;  2L9Q A;  3WI3 A;  5JDM A;  5LMN T;  4U74 A;  4B3M T;  3C64 A;  4YJ3 E;  2EHO B;  2LSG A;  5BR8 T;  5JDF A;  2RA1 A;  1UCU A;  3KVB A;  5LHH B;  4CN4 A;  5JDL A;  1N36 T;  4UR9 A;  1ZV4 X;  3K3Q C;  1HG5 A;  3CX8 B;  2E9X D;  1DU2 A;  3CK6 A;  4G63 A;  3VKG A;  3LFM A;  4HGA A;  3EAM A;  1IJ6 A;  4JI5 T;  1VRB A;  2NR4 A;  2VKO A;  2XM1 A;  2UXX B;  3O1H A;  3RX6 A;  2WMN A;  3I9W A;  4AIU A;  2CM0 A;  4GIW A;  3RQW A;  4CN1 A;  4JUY A;  4ILU A;  2VKJ A;  3Q5X A;  3K3N A;  4MFR A;  3UU8 A;  3UU3 A;  5J2T E;  2VQE T;  2L3L A;  2KT9 A;  2BBJ A;  2WWU A;  3N2O A;  3Q5E A;  4IDQ A;  5AQM B;  1W0B A;  3VRB A;  3ONJ A;  4M1P A;  4DBQ A;  2WDV A;  2F4V T;  5H6R B;  3E08 A;  3FBZ A;  3N2G E;  4HFD A;  4HWI B;  5EK3 A;  4LMK A;  4X64 T;  3LK3 B;  2LM9 A;  4ZI3 C;  1SE7 A;  1ZOY A;  2C5J A;  2M67 A;  1US7 B;  2FJA A;  2W2U A;  3SRZ A;  4P1N A;  1UUR A;  4TNV A;  3RIU A;  1W0A A;  4ADZ A;  4EV6 A;  4WBO A;  3ZPO A;  3DJB A;  5FMN A;  3SWH A;  1HNW T;  3ZMU B;  4CN6 A;  2X51 A;  2HPJ A;  1OED A;  4IGU A;  5FXX A;  3AEG A;  5AQI B;  1IBL T;  3D0T A;  5L3E B;  1D1B A;  1WR0 A;  3ZMS B;  2BKP A;  2K5B B;  3KBU A;  1N34 T;  2QGS A;  4X20 E;  2R6G F;  4ZI2 D;  4OHF A;  4QX7 B;  3UFG A;  5J0Z A;  2E2A A;  1YW0 A;  2VAS A;  2X9X A;  2OA5 A;  3A8Y C;  4CI3 B;  1D0X A;  2Q9Q C;  2JPF A;  3UUX B;  2YOE A;  1LRZ A;  1OED B;  3BQL A;  5F5W A;  5LHI B;  4I4T E;  1XDP A;  2XJ7 A;  3OPC A;  4DUY T;  2ZMA A;  2KND A;  4OYJ A;  5EZY E;  2V7J A;  2WBL A;  2MYS A;  4KP3 C;  2CXF A;  1N33 T;  4PK4 A;  3BQI A;  5KDM C;  5LG4 A;  3B13 A;  3IF8 B;  3RPU A;  2NW7 A;  5FY7 A;  3ZMT B;  2ACZ A;  3C4X A;  2RPA A;  4PFO A;  5HWX A;  1QLB A;  4IDZ A;  2XZE A;  5LA6 E;  3U78 A;  2KXP B;  4EZ4 A;  3FZH B;  4EAH A;  4JEU B;  2ZM8 A;  3LDQ B;  4L5G A;  4AKI A;  3PE0 A;  4AQY T;  5FVL A;  4DR2 T;  3CVR A;  2UUB T;  3S4U A;  4A98 A;  5JRE A;  5ADX L;  3AAI A;  3AEF A;  4EEB A;  4U31 A;  3RRC A;  4EED A;  4ZZC A;  2LKH A;  4DV4 T;  3AE3 A;  3PJA J;  2X9W A;  4LF4 T;  3OBV E;  2LJL A;  2BDE A;  2E9X C;  2PJQ A;  2X68 A;  4PFP A;  2KSR A;  3UQ7 A;  4LFC T;  3F57 A;  3UT5 E;  4C91 A;  2WWV A;  4GYR A;  1ZHC A;  2N2N A;  2YN6 A;  1EZ3 A;  3F2E A;  3RYF E;  4JI0 T;  3PUG A;  1N32 T;  1MMG A;  3AAA B;  2LOP A;  5FY1 A;  4ZOL E;  4O2A E;  2D2S A;  4U2Y A;  3RYH E;  1OWA A;  5DQV A;  3AED A;  3VU7 H;  3MKD A;  3JC6 D;  3IBP A;  4EXT A;  3FZL B;  4ZHQ E;  1KK7 A;  2C0S A;  2LT3 A;  3ZN0 B;  1X79 A;  5HEH A;  2LEH A;  1MNE A;  2B76 A;  4DR7 T;  1D0Z A;  5IHY A;  3N9Q A;  4MHC A;  3LG7 A;  4X1K E;  1NEK A;  3J9X 1;  5LGT B;  4IL9 A;  3CWZ B;  5FVK A;  3JAF A;  3MAC A;  2AE9 A;  3EHZ A;  2XSB A;  5FXW A;  3ZYL A;  2LLY A;  2VVN A;  1I94 T;  5LMU T;  4JI1 T;  5CA0 E;  4EB6 E;  4X1I E;  3CQG B;  3PUX F;  3NBX X;  3E22 E;  4JI4 T;  2JRK A;  3HA4 A;  3RC8 A;  2W0G A;  5CJ5 A;  4KI0 F;  3GN5 B;  4TV9 E;  1FIO A;  2CCQ A;  3CX7 B;  4UIG A;  5EK4 A;  5HXE A;  4IDP A;  5L4H A;  2WAU A;  4HFE A;  4B3T T;  1SHZ C;  2E8I A;  4HEA A;  2LSK A;  3AA0 B;  3P4R A;  4JEH B;  5HCM A;  4CI1 B;  4OFZ A;  2C5I T;  2NP9 A;  2V7I A;  2E5V A;  2NW9 A;  3U3I A;  2ZM6 T;  3ZCJ A;  5F8P A;  2K48 A;  2CEA A;  2WDR A;  3N9L A;  3KFW X;  2NW8 A;  2XQ6 A;  5FL1 A;  3R6N A;  1KFY A;  2WZI A;  3PUS A;  5AQQ B;  2ODV A;  2XQ8 A;  5LCY A;  4AKH A;  4IE6 A;  2K3W A;  5CB4 E;  2IAK A;  1IBK T;  3V5U A;  5AQH B;  4DUZ T;  3RGL A;  3NWI A;  5HEG A;  5L3F B;  3CX6 B;  3C51 A;  4GK0 E;  3VKH A;  1J1J A;  3KV6 A;  4HKA A;  1WLX A;  1HCI A;  2LSI A;  3NZQ A;  3FHN A;  3ZJ2 A;  1OED E;  4U7Y A;  3ZN1 B;  4IE5 A;  5AQR B;  4EZH A;  3L39 A;  3PU3 A;  4AQF A;  4EGW A;  4LFA T;  4YSZ A;  3O9X A;  3ANW A;  3JCF A;  5LB7 B;  5KXJ A;  5LGN B;  4TUY E;  4EOZ B;  1UK5 A;  3TLU A;  3AE4 A;  4HN9 A;  4B3R T;  4KUM B;  2D0T A;  4P0A A;  4BJM A;  4AKR B;  3JAD A;  4IL4 A;  4IHJ E;  3KV4 A;  5J1G A;  5ETW A;  5JDN A;  2DNX A;  2YKS A;  1WR6 A;  2N1G A;  2WDQ A;  3K1S A;  4GK5 E;  2BBH A;  2V8S V;  5FXV A;  2DLR A;  5HXS A;  3ZC1 A;  3ZMV B; 
#chains in the Genus database with same CATH homology
 4J2C A;  3HKC E;  3JC6 C;  5LOV E;  3AVR A;  2H7O A;  5L3C B;  3ONX A;  2XAG B;  4UXN B;  1MIV A;  3UTK A;  3GA8 A;  4ZS2 A;  4TX5 A;  1O3X A;  1ZEE A;  3I0Q A;  2EHO D;  2HH7 A;  3AAE B;  2CWY A;  4BJM A;  3J7Y q;  4EYU A;  2GK9 A;  5EK2 A;  1T98 A;  3F31 A;  4QX8 B;  3OKQ A;  3I0O A;  2DI4 A;  4H63 V;  5LHG B;  2W63 A;  2CWO A;  5LP6 E;  4KMC A;  5A1L A;  5JRC B;  3AA6 B;  3HI2 A;  4BA9 A;  2W00 A;  3RYI E;  3KBT A;  3DTO A;  2NWB A;  4O4L E;  4AKG A;  3CML A;  4BJN A;  2CXD A;  3P7I A;  4XAX B;  2KIN B;  2V7K A;  3EDU A;  5JRC A;  4CXY A;  2BZB A;  2RP4 A;  3MXZ A;  4PK6 A;  3FB2 A;  1MND A;  4TZ4 C;  1YD8 G;  4AQG A;  3RH3 A;  3LJC A;  3ZMZ B;  1BR4 A;  1Y64 B;  1UX4 A;  4UVA B;  3TKL B;  4DBR A;  2XAQ B;  3N9M A;  2MBG A;  4QXB B;  4I50 E;  3EDV A;  3PTR B;  5CA1 E;  2YK0 A;  4AI6 A;  1D1C A;  5LBQ B;  4H9N C;  3ZJ1 A;  2Y8D A;  5AFU L;  2NTX A;  5DQW A;  4ZS3 A;  2ACX A;  3H3A A;  2PG8 A;  2XHE B;  5JDG A;  4HFV A;  4ZI7 E;  4CXX A;  2E9X A;  4QXC B;  2JMK A;  1VOM A;  4O4H E;  4UF0 B;  4QKN A;  3M65 A;  3ETV A;  4DO0 A;  3NRY A;  1S35 A;  3K3O A;  5KX5 E;  2YIN A;  4XBF B;  4H9P C;  1MMD A;  1HX8 A;  2Q9Q A;  2LHN A;  3HR0 A;  4O4I E;  4A56 A;  2ZM2 A;  4H9S E;  3VHL A;  3ZYM A;  2X0L B;  4CI2 B;  4MBQ A;  4GYS A;  2KZ7 B;  1CUN A;  2XAJ B;  3ZEF B;  2D0U A;  2DWG A;  3GMI A;  1LKX A;  3N9P A;  3UUL A;  3I1A A;  5JDN A;  1U5P A;  3ZC0 A;  1IJ5 A;  2LSY A;  2Y48 B;  2Q9Q B;  2ZLY A;  2VWA A;  2KLQ A;  4PJJ A;  3Q9D A;  1HFA A;  1NAF A;  3O1I A;  4PK5 A;  1E1H B;  2VKH A;  2Z6E A;  5GON E;  2EHO A;  2X9Y A;  4CXW A;  3OYX A;  5M4Y A;  2MOZ A;  3C98 B;  4H9R C;  2ODU A;  5DAB A;  5HXC A;  5LGU B;  5IYZ E;  3C4W A;  2UXN B;  2C5K T;  5FMN A;  2LE8 A;  2XUE A;  2DCF A;  3CKD A;  2LSJ A;  3RYC E;  4L0R A;  3W15 B;  3QK6 A;  4F6R C;  5JQG E;  2L8K A;  1MMN A;  2D5U A;  4IIJ E;  4N78 D;  2P9B A;  3N9N A;  3BK9 A;  2X67 A;  5J2U E;  2ZM0 A;  2WSS V;  1SA0 E;  5FYM A;  4UV9 B;  4HE8 A;  4ERR A;  3PU8 A;  1OXZ A;  3FBL A;  1V9D A;  4L9I A;  3PUA A;  5LNK A;  4QWN B;  4IST A;  3PDY A;  2A2F X;  3ZLI A;  4ZI3 D;  4MLK A;  4X1Y E;  3WAJ A;  3R84 B;  2CLY B;  3O4X E;  3Q5W A;  4NUV A;  3KDS E;  3AVS A;  4ISS A;  2KWH A;  4FI5 A;  2EHO C;  2KWI B;  4UV8 B;  3SOL A;  2VB6 A;  4DMW A;  2A72 A;  3OJA A;  1KNZ A;  2YEV C;  1QSD A;  1IZN B;  4PJL A;  3I9Y A;  2N9D A;  2JMH A;  1FMV A;  5JVD E;  3KIN B;  1G8X A;  3MK7 C;  2BVM A;  2CE7 A;  3H37 A;  4O4J E;  3LK2 B;  3O1J A;  3WAK A;  4KBM B;  4DVD A;  1YKE B;  4IE0 A;  3EUH A;  3N2K E;  3GWH A;  5KMG P;  2PFV A;  4UEL A;  3EVY A;  1D1A A;  4O2B E;  5BMV E;  3ESL A;  5HXH A;  4DND A;  3AA1 B;  1B7T A;  3SS1 A;  5JH7 E;  4H9Q C;  3FXE B;  5LJM A;  1UX5 A;  2DHR A;  2H7V C;  3LBX B;  2SPC A;  2LHR A;  4WNK A;  4WBN E;  2NTY A;  4TN7 B;  1BR2 A;  5FY0 A;  2H3R A;  3FXD B;  2V26 A;  3KVA A;  3OYZ A;  4FJO A;  3IHR A;  1FMW A;  1ZKE A;  4PJN A;  4ANJ A;  3LBX A;  1WRD A;  1WYB A;  3A5X A;  4EIW A;  4H9O C;  3BQK A;  2W62 A;  4ZI2 C;  4GOU A;  3PUQ A;  4B6X A;  4YJ2 E;  1LVF A;  2MTQ A;  3P8C D;  4AKL A;  4UVB B;  2IC9 A;  2JQQ A;  2ES0 A;  5LHH B;  2CXL A;  2WM9 A;  3UUM A;  5L3D B;  3N5L A;  4MAL A;  2V7L A;  1G73 A;  2KMF A;  5FXZ A;  5LJN A;  4IE7 A;  4U72 A;  4JLE A;  3AB3 B;  3GN5 A;  1MMA A;  1HF8 A;  1MIY A;  2XAH B;  1BR0 A;  5JR9 C;  3HL6 A;  4OYK A;  2JJ9 A;  3ZYK A;  3C50 A;  3PUR A;  2I59 A;  3ANW B;  2VK9 A;  4Z8X A;  4QXH B;  4V1A v;  3DP7 A;  3L09 A;  2IC6 A;  5FNV E;  5C8Y E;  1U4Q A;  2BVL A;  1IAP A;  3ZCI A;  4AXP A;  5LXT E;  2WMO A;  4P09 A;  2B1E A;  5L2L A;  4YHJ A;  1NWM X;  4ASK A;  5HAX A;  1FEW A;  5F3J A;  3ETU A;  2CA5 A;  3UUN A;  5JR9 A;  4G2A A;  2IW5 B;  3CQC B;  3HKE E;  4PNI A;  4UEM A;  4C90 A;  3IEE A;  5L3B B;  2X66 A;  5JDH A;  3N9O A;  2A3D A;  2CMR A;  4CQI A;  5JR9 B;  2J1D G;  3UFE A;  4PAG A;  1BR1 A;  4UVC B;  4EYY R;  2W61 A;  3MA9 A;  2Q9Q D;  3T8O A;  3L3P A;  1YKH B;  5LBM A;  1H7C A;  1HG2 A;  4O8S A;  3V5S A;  2HPL A;  3LK4 2;  3RC3 A;  4NUU A;  2LOS A;  5TAO A;  4P0B A;  3RRW A;  4PW8 A;  2Y6X A;  2NOX A;  3KV9 A;  4BAY B;  4IE4 A;  2DWK A;  4YFS A;  1Z0P A;  4OK0 A;  5HWY A;  1WYC A;  3E0Z A;  3QUJ A;  3QC9 A;  3CPZ A;  4AQF C;  1S94 A;  4H63 H;  4E7S A;  4TV8 E;  4DMV A;  2G0U A;  2XAS B;  3AA7 B;  2CLY C;  2K24 A;  2YU1 A;  5JDQ A;  5LYJ E;  4HTE A;  2XAF B;  1MIW A;  3NRX A;  4E7Z A;  5H6Q B;  1LVK A;  4XZC A;  5HXR A;  3HKB E;  2X9H A;  3B57 A;  4I55 E;  3CQX C;  5HYA A;  2PBI A;  2XTL A;  2VL8 A;  4QHO A;  4WW0 A;  2XQY A;  5DJQ C;  2V7M A;  3Q2M A;  2K9A A;  3MZK B;  3WI3 A;  1HTJ F;  3RKO A;  4I43 B;  3MJX A;  2VKD A;  1AJ3 A;  2QA7 A;  2E9X B;  2YU2 A;  3KV5 A;  4UF0 A;  3K8P C;  3C4Z A;  3HKD E;  4PJM A;  5E0O A;  2V1D B;  5FP3 A;  4CZZ B;  3NZP A;  4K0U A;  4YLH A;  1QUU A;  1D0Y A;  2L9Q A;  5JDM A;  4U74 A;  3C64 A;  4YJ3 E;  2EHO B;  2LSG A;  5JDF A;  2RA1 A;  1UCU A;  3KVB A;  5JDL A;  1ZV4 X;  3K3Q C;  1HG5 A;  3CX8 B;  2E9X D;  4G63 A;  3VKG A;  3LFM A;  4HGA A;  3RX6 A;  1IJ6 A;  1VRB A;  2VKO A;  2UXX B;  3O1H A;  2WMN A;  3I9W A;  2CM0 A;  4GIW A;  4JUY A;  4ILU A;  2VKJ A;  3Q5X A;  3K3N A;  4MFR A;  5J2T E;  2L3L A;  2KT9 A;  2WWU A;  3N2O A;  4DBQ A;  4M1P A;  5H6R B;  3E08 A;  3FBZ A;  3N2G E;  5EK3 A;  3LK3 B;  2LM9 A;  4ZI3 C;  2M67 A;  2C5J A;  1US7 B;  3SRZ A;  1HS7 A;  4ADZ A;  4WBO A;  3ZPO A;  3DJB A;  3SWH A;  3ZMU B;  2X51 A;  2HPJ A;  4IGU A;  5FXX A;  3D0T A;  5L3E B;  1D1B A;  3ZMS B;  2K5B B;  3KBU A;  2QGS A;  4X20 E;  4ZI2 D;  4OHF A;  4QX7 B;  2VAS A;  1YW0 A;  2X9X A;  5L3G B;  2OA5 A;  4CI3 B;  1D0X A;  2JPF A;  2Q9Q C;  3UUX B;  5LHI B;  1LRZ A;  3BQL A;  4I4T E;  2ZMA A;  2KND A;  4OYJ A;  5EZY E;  2V7J A;  2WBL A;  2MYS A;  4KP3 C;  2CXF A;  4PK4 A;  3BQI A;  5KDM C;  5LG4 A;  3B13 A;  3IF8 B;  3RPU A;  2NW7 A;  5FY7 A;  3ZMT B;  3C4X A;  4PFO A;  5HWX A;  4IDZ A;  3U78 A;  5LA6 E;  2KXP B;  4EZ4 A;  4EAH A;  4JEU B;  2ZM8 A;  4L5G A;  4AKI A;  3PE0 A;  3CVR A;  3S4U A;  5JRE A;  5ADX L;  3AAI A;  3RRC A;  2X9W A;  3OBV E;  2LJL A;  2BDE A;  2E9X C;  2PJQ A;  2X68 A;  4PFP A;  3F57 A;  3UT5 E;  4C91 A;  4GYR A;  1ZHC A;  2N2N A;  3F2E A;  1EZ3 A;  3RYF E;  3PUG A;  1MMG A;  3AAA B;  2LOP A;  5FY1 A;  4ZOL E;  4O2A E;  2D2S A;  3RYH E;  1OWA A;  5DQV A;  3VU7 H;  3MKD A;  3JC6 D;  3IBP A;  4EXT A;  4ZHQ E;  1KK7 A;  2C0S A;  2LT3 A;  3ZN0 B;  1X79 A;  2LEH A;  1MNE A;  1D0Z A;  5IHY A;  3N9Q A;  4MHC A;  3LG7 A;  4X1K E;  3J9X 1;  5LGT B;  3CWZ B;  3MAC A;  5FXW A;  3ZYL A;  5CA0 E;  4EB6 E;  4X1I E;  3CQG B;  3NBX X;  3E22 E;  2JRK A;  3HA4 A;  3RC8 A;  2W0G A;  3GN5 B;  4TV9 E;  1FIO A;  2CCQ A;  3CX7 B;  4UIG A;  5EK4 A;  5HXE A;  2WAU A;  1SHZ C;  2E8I A;  4HEA A;  2LSK A;  3AA0 B;  4JEH B;  4CI1 B;  4OFZ A;  2C5I T;  2NP9 A;  2V7I A;  3U3I A;  2NW9 A;  3ZCJ A;  5F8P A;  2K48 A;  2CEA A;  3N9L A;  3KFW X;  2NW8 A;  3R6N A;  3PUS A;  5LCY A;  2ODV A;  4AKH A;  4IE6 A;  5CB4 E;  2IAK A;  3V5U A;  5L3F B;  3CX6 B;  3C51 A;  4GK0 E;  3VKH A;  3KV6 A;  4HKA A;  1WLX A;  1HCI A;  2LSI A;  3NZQ A;  3FHN A;  3ZJ2 A;  3ZN1 B;  4IE5 A;  4EZH A;  4AQF A;  3PU3 A;  3O9X A;  3ANW A;  5LGN B;  4TUY E;  4EOZ B;  4HN9 A;  4KUM B;  2D0T A;  4P0A A;  4AKR B;  5J1G A;  4IHJ E;  3KV4 A;  5ETW A;  2DNX A;  4GK5 E;  1WR6 A;  2N1G A;  5FXV A;  2DLR A;  5HXS A;  3ZC1 A;  3ZMV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...