2WSSV

The structure of the membrane extrinsic region of bovine atp synthase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 5
structure length 66
sequence length 66
chains with identical sequence Z
ec nomenclature
pdb deposition date 2009-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wssV01
2WSSV 2CLYC
chains in the Genus database with same CATH superfamily
4TUYE 2BS4A 4OYJA 3AA6B 2XASB 4H63V 4LF5T 1T7SA 3FZHB 4Z8XA 4JI7T 5AQQB 1IBMT 4JI6T 3I0OA 4L0RA 4BJNA 1NWMX 3BQKA 2EHOD 5LA6E 1VCTA 5JRCA 2V5CA 1ZEEA 3VRBA 3AE6A 1KNZA 3GMIA 2ZMAA 3N9OA 3ANWA 3SOLA 3CVRA 3L09A 3RC3A 1MIWA 5KXJA 2AXDS 3OBVE 5AQTB 2VL0A 2HPLA 5IYZE 3C64A 3LBXB 5AQNB 1BR1A 5HAXA 3UULA 4OYKA 4UELA 2H89A 4I55E 2CWOA 1W9RA 2NR4A 2UXNB 3HKEE 5FY7A 4CXYA 4P0BA 2NTYA 1MNDA 1JNZA 2X0LB 4HE8A 3RIUA 2V8SV 1S94A 2CA5A 2E5VA 1G8XA 4WNKA 3RRWA 3EDVA 3AA7B 5LMUT 4B3ST 3PUAA 4DR7T 4FJOA 3UU8A 2XQ6A 5CJ5A 3QUJA 2LM2A 3KV6A 3O1JA 4KX6A 2ZM6T 4ZXLA 4JI0T 5LHGB 2FJEA 2OA5A 2ZM8A 5LB7B 4DUYT 3ZT7A 1SA0E 4GOUA 2EHOA 5L47A 3TLUA 4HTEA 5AQSB 1HS7A 3LG7A 2UXXB 2DWKA 2KWHA 4EOZB 1T8BA 2LSGA 3SFEA 3JC6D 4TZ4C 2YK0A 4AISA 3N9MA 3AEGA 1WR0A 2Y8DA 4ISTA 1IBKT 4EZHA 4YHJA 3ZYMA 2RPAA 4IDPA 4GIWA 4DBQA 4TNWA 3L3PA 5H6QB 4X66T 1J5WA 1CHUA 2JIWA 3UU5A 3GWHA 2X67A 3X1DA 1MIVA 4PJMA 3E0ZA 4HWIB 4QXBB 4OHFA 3NBXX 2W4XA 3EUHA 2Q9QA 4O4JE 4EEBA 5JR9B 4P1NA 1L0VA 2W66A 3AE7A 1WFDA 1XZYA 3OYZA 4Q25A 2ES0A 3LK42 2Y48B 3HKDE 5HXCA 2N1GA 2CRBA 2JQ9A 2NW7A 2WDQA 5F8PA 3DTOA 5ABGA 2ACZA 3JAFA 5L3DB 2J4GA 2WDVA 1NENA 4EYUA 4UF0B 4B3MT 1VRBA 2KWIB 2IIUA 3AVSA 5IUXA 4OFZA 1N34T 2VWAA 2JQHA 3K3QC 5FL1A 3JCFA 2MAWA 2BKNA 2LSIA 4O4IE 2LHNA 5E0OA 4GK0E 3RKGA 5JDLA 5LXTE 4PK6A 4LFBT 2VKJA 2BG9C 1NEKA 2LHRA 4JUYA 4HFHA 4YT0A 3PUWF 3CIRA 4GYSA 4EZ4A 5FY0A 5FNVE 2VKHA 3RYFE 4YTPA 2KNDA 4ZI7E 1LKXA 3HKBE 5KX5E 1IZNB 4IREA 2V7LA 4K0KT 2YU1A 2H7VC 3CMLA 1HNZT 3UT5E 5JH7E 2W2UA 2VURA 4PJLA 2BS2A 1XNRT 2LSYA 3CPZA 3KVAA 1WRDA 2XQ3A 5FXWA 4ILBA 1N32T 5FP3A 5AQIB 4GKJT 3QK6A 2E2AA 4DV7T 3AXJB 4QKNA 2V26A 4O4HE 2DLRA 5IWAT 2WU5A 2DI4A 2XQYA 4CN4A 4EAHA 4AKHA 3F31A 4QXCB 2HHHT 1Y64B 3L39A 4HKAA 5LGTB 2M6IA 3CX8B 3NRYA 3N2OA 5ABEA 4DV0T 4XAXB 2HH7A 5J1GA 2YU2A 4F6RC 4YTMA 4O2BE 3WI3A 4IHJE 2X66A 5HWXA 3ETVA 1OEDE 1V9DA 1S35A 3OTOT 2V6YA 1HNXT 1D1CA 2V7MA 3FXDB 5LYJE 2PBIA 3IF8B 2KXPB 4DIDB 4ZI3D 5HWYA 4K0UA 4ERRA 2IUBA 3TLSA 4DV5T 2WB5A 4QX8B 3J9X1 2FJDA 2XSBA 4IDNA 5J2TE 3RKOA 3QC9A 2LSKA 5ETWA 1OEDA 2CM0A 1OXZA 3ZN1B 4IE7A 2VVNA 3CX6B 4H63H 4ADZA 1VOMA 4O2AE 5FYMA 5HXRA 4AQYT 3CK6A 4UXNB 2QGSA 3M3ZB 4H9OC 4ZZBA 3O1IA 3P4RA 3H3AA 2MBGA 3RGLA 3K8PC 4E7ZA 4OX9T 2NP9A 1MMAA 4UR9A 4PJNA 2E5LT 2LOSA 3N9NA 3CQGB 3ONXA 4HWFA 4PW8A 1US7B 5AQLB 2A72A 4HEAA 4UIGA 3AEAA 2A9UA 2YEVC 3B57A 3GN5B 3B5MA 5LNKA 2BVLA 4YHHT 4FI5A 2E9XA 1IJ5A 3BQLA 4KI0F 3NWIA 1KFYA 2LRKA 3W15B 4WBNE 3A8YC 2LE8A 3ZSTA 3VU7H 3U78A 2XAGB 2B1EA 3OKQA 4MLKA 3N9PA 4JI1T 5JDHA 4AKGA 2DHRA 2OV9A 1M62A 1I94T 2ODUA 4TX5A 4HWHA 2DWGA 4HGAA 4YFSA 3M65A 4QX7B 2UUCT 3MKDA 4A56A 4EV6A 5ADXL 3ZT5A 4JBWF 4U33A 3AB3B 1YKEB 1E2AA 5AQPB 3KFWX 1YW0A 5JR9C 4A97A 4HFDA 3S4UA 2ZM2A 2PG8A 2J1DG 3UU4A 4KHZF 1HG5A 2KZ7B 2W61A 3PUVF 1E7PA 3KINB 2JRKA 2D0UA 3MXZA 3FHNA 5CA0E 4TN7B 4DR4T 3HR0A 4ANJA 5JDMA 4BJMA 4ZI2C 3OJAA 5H6RB 1WYBA 2VKOA 1T72A 1FJGT 2UXDT 4AKIA 1YQ3A 3T8OA 2NTXA 3QNUA 3GA8A 2K3WA 5EK4A 2MOZA 5LHIB 2WMNA 3P4SA 2CEAA 2CXFA 2VVSA 5AQHB 4CQIA 1JNRA 3IA3A 2IMLA 2LT3A 2W00A 3AEDA 4QH1A 4YJ2E 1FEWA 4KP3C 4LF9T 2IAKA 2N2NA 3LJCA 4DV4T 4U31A 4X1YE 3ZMVB 2Z6EA 5L3GB 2CCQA 3C51A 4J2CA 3A5XA 2RP4A 4NUVA 5HXEA 4A98A 5DQWA 2XHEB 5M4YA 1HFAA 2L9QA 4CXXA 3RQWA 4JV5T 3VKGA 1HF8A 5JTGA 4HWCA 2CHOA 4DMVA 4IE6A 2WWVA 3Q5EA 2IW5B 2CXDA 1ZOYA 2I59A 4MBQA 2BBJA 2LEHA 4JI4T 4YSZA 1LVFA 3NVOA 3UUBA 4I43B 5JQGE 4IIJE 4JYAT 4A5XA 2VB6A 2LRLA 3EHZA 4GK5E 1XMQT 3FZMB 3CKDA 4KHPT 3AEFA 1YKHB 3O1HA 3FZLB 1HNWT 2KINB 2WMOA 4IE5A 2BKPA 3ZN0B 5KMGP 3AEEA 2VQET 4ILCA 4TWFA 2X9XA 4N78D 1KF6A 2CE7A 2XPKA 2W63A 2PJQA 4U7YA 3RIAA 5ABFB 2YKSA 4CZZB 1U4QA 4AQFA 4KMCA 4EXTA 5L3EB 3AAIA 2X9HA 3K3OA 2WP9A 5A1LA 3P4QA 2QVAA 4DR5T 4EGWA 3FB2A 3FBZA 2D2SA 2W62A 2YOEA 3LK3B 3CQXC 4X1KE 3PJAJ 4DV2T 4PJJA 3HA4A 5DQVA 3P4PA 5JRCB 3PUSA 1YQ4A 2WWUA 3I1AA 3N9QA 2HN1A 5L4HA 5EK2A 1HX8A 2XJ7A 5AFUL 1XMOT 3RF1A 4WYVA 5FY1A 3ANWB 2CMRA 4IDOA 4TWDA 5J0ZA 2ODVA 2JJ9A 4DR2T 4IDQA 2M67A 2J62A 4ISSA 3FZFB 5J2UE 3N2KE 2WAUA 3AE8A 4H9SE 4UVBB 3FZKB 3T1HT 5HEUA 3C50A 3I9YA 3NZPA 3RHWA 3J7Yq 1W0AA 5LJNA 1UX5A 2YDSA 2BG9A 2QYWA 4YJ3E 2XTLA 4JEUB 2IC9A 1QLBA 2XQ4A 2XUEA 3IBPA 4DV1T 3LSVA 4ZZCA 4CN1A 5LCYA 5AQUB 3ZJ2A 3ZLIA 1AJ3A 3U3IA 3AE1A 3KBUA 5FXZA 3DJBA 3T1YT 2V7KA 5AQMB 4X65T 2D0TA 4LF6T 4CI3B 1M7KA 3ONLC 4EIWA 3NKZA 3UU3A 4TNVA 3DP7A 5FXXA 3EAMA 2J47A 2EHOB 3ZMZB 3RC8A 2XY8B 2XQAA 3EDUA 4DV3T 2FBWA 3JADA 3RIFA 3N5LA 4DR3T 4DV6T 1X79A 4DO0A 2X9WA 3ZPOA 1ZHCA 2MPKA 3UQ7A 2VKDA 2R6GF 4NXMT 2K9AA 2DL1A 4V1Av 5HXHA 3B13A 3UUMA 1D0XA 3TLWA 2PFVA 4NUUA 4WW0A 1YXRA 2V7JA 4IE0A 4GKKT 4O4LE 2Q9QB 2K5BB 5AQKB 2FJBA 1GQEA 4PFPA 3KDSE 1W09A 2NWBA 3LBXA 2X0HA 2QRXA 3LDQB 5HEOA 4HFCA 4PAGA 5LG4A 4UVCB 2D5UA 2E8IA 4ZS2A 4YSYA 5HEJA 4IDZA 3VRAA 5FVKA 3K1SA 5KDMC 4IL4A 3KVBA 3VR9A 3MK7C 5FXVA 3VR8A 3K3NA 4YLHA 4UV9B 1BR0A 1KK7A 1J5ET 2WCAA 4DR1T 2CLYB 2A2FX 2WQYA 2KT9A 5CB4E 3AE9A 2BVMA 3AA0B 4ZI2D 2WBLA 2MTQA 4NPPA 4TWHA 2BDEA 1UX4A 2G0UA 3E22E 5L3FB 3RH3A 3PUGA 4B3RT 3OVUA 3KV9A 4YSXA 5IHYA 3KV4A 4PNIA 2XAHB 5HCMA 3C4ZA 4MFRA 3G06A 1NAFA 2WZIA 2LOPA 4C91A 5LGUB 3AE5A 1MMGA 4B6XA 2IHR1 2WSSV 2KSRA 2HN2A 4DR6T 3H3MA 3IEEA 1HX1B 2ZM0A 3UFEA 2JPFA 4I0UA 1N36T 2FUPA 3N9LA 4UVAB 2LLYA 3VHLA 2IDOB 3ZKRA 2DCFA 3A7MA 2UUBT 5DJQC 3RYHE 2UUAT 2XM2A 4OK0A 2V5DA 3HL6A 4Z90A 5ABFA 2NW8A 4WBOA 2CWYA 3SRZA 3V5UA 1UCUA 2V6XA 2I6HA 1FIOA 2XM1A 3AECA 4X62T 5L2LA 3C98B 5L4EA 3UU6A 5JR9A 1B7TA 4IE4A 1UUSA 4MHCA 1LVKA 1HTJF 5JDNA 2YINA 2F4VT 1D1BA 2FJAA 5F3JA 5C8YE 3RYCE 2VASA 4H9QC 3VKHA 2XAJB 5HCJA 1ZP0A 4EYYR 5BMVE 3PV0F 2LKGA 4JI5T 1Z0PA 3HI2A 5JVDE 4UF0A 2RA1A 4AXPA 2BZBA 2V6YB 4X20E 3IHRA 2VL8A 4O8SA 3AE2A 4HFIA 4DUZT 3OPCA 3PUQA 4JEHB 5CFBA 2CXLA 3E08A 4XBFB 3PU8A 5LMNT 1SHZC 4DNDA 5LBQB 3ZCJA 3ONJA 4ZS3A 3L8RA 2WDRA 4COFA 3R6NA 4P09A 2Q9QD 3NZQA 4AQGA 1BR2A 1FMWA 1E1HB 1X9BA 3RIUC 1OEDB 1IJ6A 2K24A 3R84B 2CBIA 1CUNA 4LMLA 3C4WA 4H9RC 4CI2B 3UTKA 3SS1A 3ZMSB 2V1DB 2XZEA 4UV8B 4DVDA 2XSAA 1UK5A 2BKOA 3CWZB 3ZJ1A 4IL9A 4EB6E 2XQ9A 3PE0A 2LSJA 2BS3A 3BK9A 3EI0A 4YXDA 2YDRA 4X5TA 3AE4A 1IAPA 1SUMB 2YN6A 3F57A 4G2AA 1EZ3A 3P4WA 3UQ4A 3V5SA 2DNXA 1WCRA 3ZT6A 2EHOC 4C90A 3RI5A 5LG3A 2E9XB 4DBRA 1D0YA 3EABA 3WAJA 1QUUA 1BR4A 3AXJA 3ZMTB 5HEHA 4GYRA 1D1AA 4CN6A 3PTRB 1U5PA 2KLQA 4AI6A 3AAEB 4H9NC 5HEGA 3ZEFB 4H9PC 4TV8E 2XAQB 4G63A 4U72A 4AIUA 3QOFA 3AA1B 1Y01A 4M1PA 4U3CA 3RX6A 2D9DA 2ZLYA 5AQFB 2H3RA 3TLVA 4JI3T 4AQFC 2LKHA 1D0ZA 3ETUA 2Q9QC 3LK2B 2C5KT 2NOXA 1UGOA 2X9YA 3CQCB 2VK9A 3P7IA 1YD8G 5C2TA 2Y6XA 4HN9A 3SFDA 4ZEYA 5JDQA 4ZHQE 1O3XA 3OYXA 3O4XE 1IBLT 4QH4A 4PFOA 2C5JA 4XZCA 3AVRA 1MMDA 2X51A 3RLFF 3NRXA 2M6BA 3QB5K 2CHNA 1KEYA 5FVLA 2B76A 2BG9E 5AQGB 5FMNA 4ASKA 5AQOB 3MACA 1KNRA 2CLYC 5CGMA 2IC6A 5ABHA 3EVYA 3Q5XA 5HXSA 2K48A 1MIYA 2I0MA 3RYIE 4I4TE 1G73A 3CX7B 4HFVA 3UFGA 3Q9DA 2MYSA 4Z91A 1XNQT 1N33T 3ZYKA 3D0TA 4E7SA 2JQKA 2UU9T 2LJLA 4X64T 4LF7T 2V7IA 3ZYLA 4IT4A 3RQUA 1SE7A 3JC6C 2L8KA 5BR8T 2QA7A 3GN5A 3KBTA 2JQQA 3Q5DA 2WU2A 4TV9E 3PUXF 4LFCT 2AE9A 3ZMUB 3PUYF 5JREA 4CI1B 4L5GA 2CBJA 5CA1E 5JDGA 3ESLA 3F2EA 4YTNA 4LMJA 5EK3A 3TKLB 4WZXA 4NIQA 3AE3A 2JMHA 4UEMA 3MA9A 1HCIA 2P9BA 5F5WA 1KNPA 5HYAA 3KV5A 5LHHB 1ZV4X 3PURA 3ZC1A 4U2YA 2BBHA 5EZYE 2W0GA 3ABVA 3C4XA 4YY3T 2JMKA 4AKLA 4LFAT 5LBMA 4MALA 4LMKA 3TLTA 1OWAA 4U74A 5DABA 3HKCE 1FMVA 1XDOA 2X0YA 4X1IE 4ZOLE 2E9XD 4HWDA 4ILAA 5LP6E 1R8IA 1J1JA 3I0QA 3Q5WA 3WAKA 3MJXA 2XQ8A 3I9WA 3P50A 3BQIA 3JAEA 4QHOA 2CPTA 2C5IT 5AQJB 2N9DA 3LFMA 4JI8T 3FXEB 3UUNA 5FKYA 1LRZA 1HR0T 2NW9A 4QXHB 2L3LA 2UXCT 2YDQA 1DU2A 1WLXA 3RRCA 3AAAB 2HPJA 4PK5A 3H37A 5GONE 1OEDC 1W0BA 4I50E 1I6ZA 2W67A 1XWMA 4QWNB 5LOVE 5LGNB 2WY2A 4JLEA 4P0AA 4LF8T 3N2GE 1WYCA 3UUXB 4KUMB 2GK9A 4HFBA 2UXBT 4PK4A 1Z8UA 4L9IA 3ZC0A 1UURA 4IGUA 2C0SA 1T98A 2XAFB 3RPUA 3FBLA 1QSDA 2LM9A 3PJAA 4U2ZA 4BAYB 4QH5A 2OLTA 2BG9B 2H88A 3Q2MA 2WM9A 5AQRB 4BA9A 4U7IA 2ACXA 2VQFT 2E9XC 4AKRB 4EEDA 2WZHA 3ZCIA 4JI2T 3PUZF 5C3JA 3SWHA 3P8CD 5L3CB 2XQ5A 4F8HA 2SPCA 1H7CA 1HG2A 5TAOA 4CXWA 3MZKB 4ILUA 2PTFA 4B3TT 4HFEA 3QB5A 1VCSA 3PU3A 2WS3A 5AQVB 2X68A 2H7OA 4DMWA 5L3BB 1ZKEA 3ZSSA 3AEBA 5LJMA 4ZI3C 2KMFA 4LF4T 4KBMB 2XQ7A 1XDPA 2A3DA 3PDYA 1WR6A 3O9XA 1MMNA 5FL0A 5JDFA 1MNEA 4NXNT
chains in the Genus database with same CATH topology
3C50A 4TUYE 1EZ3A 3I9YA 5HWYA 3V5SA 4OYJA 2DNXA 3AA6B 3NZPA 2XASB 4K0UA 4H63V 3J7Yq 4ERRA 2EHOC 4C90A 4Z8XA 5LJNA 1UX5A 3I0OA 2E9XB 4L0RA 4BJNA 4DBRA 1D0YA 1NWMX 3BQKA 3WAJA 1QUUA 2EHOD 1BR4A 4QX8B 3J9X1 4YJ3E 2XTLA 4JEUB 2IC9A 5J2TE 3ZMTB 3RKOA 5LA6E 3QC9A 2LSKA 4GYRA 1D1AA 5JRCA 5ETWA 2CM0A 1ZEEA 3PTRB 1OXZA 2XUEA 3IBPA 1U5PA 3ZN1B 2KLQA 4AI6A 1KNZA 4IE7A 3CX6B 4H63H 4ADZA 3AAEB 4H9NC 3GMIA 1VOMA 4O2AE 5FYMA 3ZEFB 5LCYA 5HXRA 3ZJ2A 4H9PC 3ZLIA 2ZMAA 4TV8E 1AJ3A 4UXNB 3U3IA 2XAQB 3ANWA 3N9OA 4G63A 3CVRA 4U72A 3KBUA 2QGSA 3SOLA 5FXZA 3DJBA 3AA1B 3L09A 4H9OC 2V7KA 1MIWA 3O1IA 3RC3A 4M1PA 3OBVE 3H3AA 2MBGA 3K8PC 3RX6A 2HPLA 5IYZE 2ZLYA 4E7ZA 2D0TA 2H3RA 2NP9A 1MMAA 4AQFC 4CI3B 3C64A 3LBXB 4PJNA 1BR1A 5HAXA 2LOSA 4EIWA 1D0ZA 3ETUA 3CQGB 3N9NA 3UULA 4OYKA 2Q9QC 3ONXA 3LK2B 4UELA 2C5KT 4I55E 2NOXA 4PW8A 1US7B 3DP7A 5FXXA 2X9YA 3CQCB 2A72A 4HEAA 2EHOB 2VK9A 4UIGA 3ZMZB 3P7IA 1YD8G 3RC8A 2CWOA 2UXNB 2Y6XA 4HN9A 2YEVC 3B57A 5JDQA 4ZHQE 3EDUA 3HKEE 5FY7A 4CXYA 1O3XA 3GN5B 4P0BA 2NTYA 3OYXA 3O4XE 1MNDA 5LNKA 2BVLA 4FI5A 2E9XA 3N5LA 1IJ5A 2X0LB 3BQLA 4HE8A 1S94A 4PFOA 2C5JA 2CA5A 4XZCA 3AVRA 1X79A 1MMDA 3W15B 4WBNE 2X51A 4DO0A 2LE8A 3NRXA 2X9WA 1G8XA 3VU7H 1ZHCA 3ZPOA 2VKDA 2XAGB 3U78A 2B1EA 3OKQA 4MLKA 2K9AA 4V1Av 4WNKA 3RRWA 3N9PA 3EDVA 5FMNA 5HXHA 5JDHA 3B13A 2DHRA 4ASKA 4AKGA 3AA7B 3MACA 3UUMA 1D0XA 3PUAA 2ODUA 2CLYC 4TX5A 2IC6A 4FJOA 2DWGA 4HGAA 2PFVA 3EVYA 3Q5XA 5HXSA 4YFSA 3M65A 3QUJA 4NUUA 4QX7B 2K48A 4WW0A 2V7JA 3MKDA 1MIYA 3RYIE 4A56A 4IE0A 3KV6A 5ADXL 3O1JA 4I4TE 1G73A 3CX7B 4HFVA 4O4LE 2Q9QB 3Q9DA 2MYSA 2K5BB 5LHGB 3ZYKA 4PFPA 2OA5A 3KDSE 2NWBA 3AB3B 2ZM8A 3LBXA 3D0TA 1YKEB 4E7SA 3KFWX 2LJLA 1YW0A 2V7IA 4PAGA 3ZYLA 1SA0E 5JR9C 4GOUA 2EHOA 5LG4A 4UVCB 2D5UA 3S4UA 2E8IA 4HTEA 4ZS2A 2ZM2A 3JC6C 2L8KA 2PG8A 2J1DG 3LG7A 4IDZA 1HS7A 2UXXB 1HG5A 2DWKA 2KWHA 2KZ7B 2QA7A 5KDMC 3GN5A 3KVBA 4EOZB 3KBTA 2JQQA 2W61A 4TV9E 3MK7C 2LSGA 5FXVA 3K3NA 3JC6D 4YLHA 4UV9B 4TZ4C 3KINB 1BR0A 2YK0A 2JRKA 2D0UA 3ZMUB 3MXZA 3N9MA 5F3JA 1KK7A 5JREA 4CI1B 3FHNA 4ISTA 2Y8DA 4TN7B 5CA0E 4L5GA 4EZHA 3HR0A 2CLYB 4ANJA 5CA1E 2A2FX 5JDGA 4YHJA 3ZYMA 3ESLA 3F2EA 5JDMA 4BJMA 4ZI2C 5EK3A 2KT9A 3TKLB 3OJAA 5H6RB 4GIWA 5CB4E 4DBQA 2BVMA 1WYBA 2VKOA 3L3PA 3AA0B 5H6QB 4ZI2D 2WBLA 2MTQA 4AKIA 3GWHA 2JMHA 4UEMA 3T8OA 2X67A 2NTXA 1MIVA 2BDEA 3MA9A 4PJMA 3E0ZA 1UX4A 3GA8A 4QXBB 2G0UA 4OHFA 1HCIA 3E22E 5EK4A 2P9BA 2MOZA 3NBXX 5LHIB 5L3FB 2WMNA 3EUHA 3RH3A 2CEAA 2CXFA 2Q9QA 3PUGA 4CQIA 4O4JE 5HYAA 3KV5A 5LHHB 2LT3A 1ZV4X 3PURA 3ZC1A 5JR9B 2W00A 5EZYE 3KV9A 2W0GA 3C4XA 5IHYA 3KV4A 2JMKA 3OYZA 4AKLA 4PNIA 2XAHB 3C4ZA 4MFRA 4YJ2E 1FEWA 2ES0A 4KP3C 5LBMA 2IAKA 3LK42 2N2NA 4MALA 3LJCA 2Y48B 3HKDE 1NAFA 5HXCA 1OWAA 4U74A 2N1GA 2LOPA 5DABA 4C91A 5LGUB 3HKCE 4X1YE 1FMVA 1MMGA 2Z6EA 3ZMVB 5L3GB 2CCQA 3C51A 2NW7A 4B6XA 4J2CA 5F8PA 4X1IE 3A5XA 3DTOA 4ZOLE 2RP4A 2WSSV 2E9XD 4NUVA 5L3DB 5HXEA 5LP6E 5DQWA 2XHEB 5M4YA 1HFAA 4EYUA 3I0QA 4UF0B 1VRBA 3IEEA 2L9QA 4CXXA 3Q5WA 2KWIB 2ZM0A 3UFEA 2JPFA 3N9LA 4UVAB 3WAKA 3VHLA 3MJXA 3AVSA 3I9WA 2DCFA 3VKGA 4OFZA 3BQIA 5DJQC 3RYHE 1HF8A 4QHOA 2VWAA 4OK0A 2C5IT 3HL6A 3K3QC 2N9DA 2NW8A 3LFMA 4WBOA 4DMVA 2LSIA 2CWYA 4IE6A 2IW5B 3SRZA 2CXDA 3V5UA 1UCUA 3FXEB 3UUNA 4O4IE 2I59A 2LHNA 4MBQA 1LRZA 2LEHA 5E0OA 2NW9A 1LVFA 4GK0E 2L3LA 4QXHB 1FIOA 5JDLA 5LXTE 4PK6A 5L2LA 3C98B 4I43B 5JQGE 4IIJE 1B7TA 2VKJA 5JR9A 4IE4A 1WLXA 2VB6A 4GK5E 4MHCA 2LHRA 1LVKA 4JUYA 3RRCA 3CKDA 3AAAB 2HPJA 4PK5A 1YKHB 1HTJF 3O1HA 5JDNA 3H37A 4GYSA 5GONE 2YINA 2KINB 4I50E 1D1BA 5FY0A 2WMOA 5FNVE 4EZ4A 4QWNB 2VKHA 3RYFE 5C8YE 2KNDA 3RYCE 2VASA 4IE5A 5LOVE 4H9QC 3VKHA 5LGNB 3ZN0B 4ZI7E 1LKXA 3HKBE 2XAJB 5KMGP 5KX5E 4JLEA 4EYYR 5BMVE 4P0AA 3N2GE 1IZNB 1WYCA 2X9XA 4N78D 1Z0PA 2CE7A 2V7LA 3HI2A 2YU1A 5JVDE 2H7VC 2W63A 2PJQA 4UF0A 2RA1A 4AXPA 2BZBA 3CMLA 3UUXB 4KUMB 2GK9A 3UT5E 4X20E 3IHRA 2VL8A 4CZZB 4O8SA 4PK4A 1U4QA 4AQFA 4KMCA 4EXTA 5JH7E 3AAIA 5L3EB 2X9HA 3K3OA 4L9IA 3ZC0A 4PJLA 3PUQA 4JEHB 5A1LA 4IGUA 2CXLA 2C0SA 3E08A 1T98A 2XAFB 4XBFB 3RPUA 3FBLA 1QSDA 3FB2A 3FBZA 3PU8A 2D2SA 2LM9A 1SHZC 4DNDA 2LSYA 5LBQB 2W62A 3CPZA 3KVAA 3ZCJA 1WRDA 4BAYB 3LK3B 3CQXC 4ZS3A 4X1KE 3R6NA 4PJJA 5FXWA 3HA4A 5FP3A 4P09A 3Q2MA 2WM9A 5DQVA 2Q9QD 4BA9A 3QK6A 3NZQA 4AQGA 2ACXA 1BR2A 1FMWA 2E9XC 4QKNA 2V26A 4AKRB 1E1HB 4O4HE 3ZCIA 2DLRA 5JRCB 2DI4A 2XQYA 3SWHA 3P8CD 4EAHA 5L3CB 3PUSA 1IJ6A 2K24A 3R84B 4AKHA 1CUNA 2WWUA 2SPCA 3F31A 1H7CA 4QXCB 1HG2A 3I1AA 1Y64B 3MZKB 4ILUA 5TAOA 3N9QA 4CXWA 4HKAA 5EK2A 1HX8A 3C4WA 5LGTB 3CX8B 4H9RC 3NRYA 5AFUL 4CI2B 3PU3A 5FY1A 3UTKA 3ANWB 3SS1A 3ZMSB 2CMRA 3N2OA 2V1DB 4XAXB 2X68A 2HH7A 5J1GA 2YU2A 4UV8B 4DVDA 4F6RC 2H7OA 3CWZB 2ODVA 4O2BE 3ZJ1A 2JJ9A 3WI3A 4IHJE 2X66A 5HWXA 4DMWA 4EB6E 5L3BB 3PE0A 1ZKEA 3ETVA 2LSJA 2M67A 1V9DA 1S35A 5LJMA 4ISSA 4ZI3C 2KMFA 5J2UE 3BK9A 3N2KE 2WAUA 4KBMB 1D1CA 2V7MA 4H9SE 4UVBB 3FXDB 1IAPA 2A3DA 5LYJE 2PBIA 3IF8B 3PDYA 1WR6A 2KXPB 3O9XA 3F57A 1MMNA 5JDFA 4ZI3D 4G2AA 1MNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSS V;  2CLY C; 
#chains in the Genus database with same CATH topology
 4TUY E;  2BS4 A;  4OYJ A;  3AA6 B;  2XAS B;  4H63 V;  4LF5 T;  1T7S A;  3FZH B;  4Z8X A;  4JI7 T;  5AQQ B;  1IBM T;  4JI6 T;  3I0O A;  4L0R A;  4BJN A;  1NWM X;  3BQK A;  2EHO D;  5LA6 E;  1VCT A;  5JRC A;  2V5C A;  1ZEE A;  3VRB A;  3AE6 A;  1KNZ A;  3GMI A;  2ZMA A;  3N9O A;  3ANW A;  3SOL A;  3CVR A;  3L09 A;  3RC3 A;  1MIW A;  5KXJ A;  2AXD S;  3OBV E;  5AQT B;  2VL0 A;  2HPL A;  5IYZ E;  3C64 A;  3LBX B;  5AQN B;  1BR1 A;  5HAX A;  3UUL A;  4OYK A;  4UEL A;  2H89 A;  4I55 E;  2CWO A;  1W9R A;  2NR4 A;  2UXN B;  3HKE E;  5FY7 A;  4CXY A;  4P0B A;  2NTY A;  1MND A;  1JNZ A;  2X0L B;  4HE8 A;  3RIU A;  2V8S V;  1S94 A;  2CA5 A;  2E5V A;  1G8X A;  4WNK A;  3RRW A;  3EDV A;  3AA7 B;  5LMU T;  4B3S T;  3PUA A;  4DR7 T;  4FJO A;  3UU8 A;  2XQ6 A;  5CJ5 A;  3QUJ A;  2LM2 A;  3KV6 A;  3O1J A;  4KX6 A;  2ZM6 T;  4ZXL A;  4JI0 T;  5LHG B;  2FJE A;  2OA5 A;  2ZM8 A;  5LB7 B;  4DUY T;  3ZT7 A;  1SA0 E;  4GOU A;  2EHO A;  5L47 A;  3TLU A;  4HTE A;  5AQS B;  1HS7 A;  3LG7 A;  2UXX B;  2DWK A;  2KWH A;  4EOZ B;  1T8B A;  2LSG A;  3SFE A;  3JC6 D;  4TZ4 C;  2YK0 A;  4AIS A;  3N9M A;  3AEG A;  1WR0 A;  2Y8D A;  4IST A;  1IBK T;  4EZH A;  4YHJ A;  3ZYM A;  2RPA A;  4IDP A;  4GIW A;  4DBQ A;  4TNW A;  3L3P A;  5H6Q B;  4X66 T;  1J5W A;  1CHU A;  2JIW A;  3UU5 A;  3GWH A;  2X67 A;  3X1D A;  1MIV A;  4PJM A;  3E0Z A;  4HWI B;  4QXB B;  4OHF A;  3NBX X;  2W4X A;  3EUH A;  2Q9Q A;  4O4J E;  4EEB A;  5JR9 B;  4P1N A;  1L0V A;  2W66 A;  3AE7 A;  1WFD A;  1XZY A;  3OYZ A;  4Q25 A;  2ES0 A;  3LK4 2;  2Y48 B;  3HKD E;  5HXC A;  2N1G A;  2CRB A;  2JQ9 A;  2NW7 A;  2WDQ A;  5F8P A;  3DTO A;  5ABG A;  2ACZ A;  3JAF A;  5L3D B;  2J4G A;  2WDV A;  1NEN A;  4EYU A;  4UF0 B;  4B3M T;  1VRB A;  2KWI B;  2IIU A;  3AVS A;  5IUX A;  4OFZ A;  1N34 T;  2VWA A;  2JQH A;  3K3Q C;  5FL1 A;  3JCF A;  2MAW A;  2BKN A;  2LSI A;  4O4I E;  2LHN A;  5E0O A;  4GK0 E;  3RKG A;  5JDL A;  5LXT E;  4PK6 A;  4LFB T;  2VKJ A;  2BG9 C;  1NEK A;  2LHR A;  4JUY A;  4HFH A;  4YT0 A;  3PUW F;  3CIR A;  4GYS A;  4EZ4 A;  5FY0 A;  5FNV E;  2VKH A;  3RYF E;  4YTP A;  2KND A;  4ZI7 E;  1LKX A;  3HKB E;  5KX5 E;  1IZN B;  4IRE A;  2V7L A;  4K0K T;  2YU1 A;  2H7V C;  3CML A;  1HNZ T;  3UT5 E;  5JH7 E;  2W2U A;  2VUR A;  4PJL A;  2BS2 A;  1XNR T;  2LSY A;  3CPZ A;  3KVA A;  1WRD A;  2XQ3 A;  5FXW A;  4ILB A;  1N32 T;  5FP3 A;  5AQI B;  4GKJ T;  3QK6 A;  2E2A A;  4DV7 T;  3AXJ B;  4QKN A;  2V26 A;  4O4H E;  2DLR A;  5IWA T;  2WU5 A;  2DI4 A;  2XQY A;  4CN4 A;  4EAH A;  4AKH A;  3F31 A;  4QXC B;  2HHH T;  1Y64 B;  3L39 A;  4HKA A;  5LGT B;  2M6I A;  3CX8 B;  3NRY A;  3N2O A;  5ABE A;  4DV0 T;  4XAX B;  2HH7 A;  5J1G A;  2YU2 A;  4F6R C;  4YTM A;  4O2B E;  3WI3 A;  4IHJ E;  2X66 A;  5HWX A;  3ETV A;  1OED E;  1V9D A;  1S35 A;  3OTO T;  2V6Y A;  1HNX T;  1D1C A;  2V7M A;  3FXD B;  5LYJ E;  2PBI A;  3IF8 B;  2KXP B;  4DID B;  4ZI3 D;  5HWY A;  4K0U A;  4ERR A;  2IUB A;  3TLS A;  4DV5 T;  2WB5 A;  4QX8 B;  3J9X 1;  2FJD A;  2XSB A;  4IDN A;  5J2T E;  3RKO A;  3QC9 A;  2LSK A;  5ETW A;  1OED A;  2CM0 A;  1OXZ A;  3ZN1 B;  4IE7 A;  2VVN A;  3CX6 B;  4H63 H;  4ADZ A;  1VOM A;  4O2A E;  5FYM A;  5HXR A;  4AQY T;  3CK6 A;  4UXN B;  2QGS A;  3M3Z B;  4H9O C;  4ZZB A;  3O1I A;  3P4R A;  3H3A A;  2MBG A;  3RGL A;  3K8P C;  4E7Z A;  4OX9 T;  2NP9 A;  1MMA A;  4UR9 A;  4PJN A;  2E5L T;  2LOS A;  3N9N A;  3CQG B;  3ONX A;  4HWF A;  4PW8 A;  1US7 B;  5AQL B;  2A72 A;  4HEA A;  4UIG A;  3AEA A;  2A9U A;  2YEV C;  3B57 A;  3GN5 B;  3B5M A;  5LNK A;  2BVL A;  4YHH T;  4FI5 A;  2E9X A;  1IJ5 A;  3BQL A;  4KI0 F;  3NWI A;  1KFY A;  2LRK A;  3W15 B;  4WBN E;  3A8Y C;  2LE8 A;  3ZST A;  3VU7 H;  3U78 A;  2XAG B;  2B1E A;  3OKQ A;  4MLK A;  3N9P A;  4JI1 T;  5JDH A;  4AKG A;  2DHR A;  2OV9 A;  1M62 A;  1I94 T;  2ODU A;  4TX5 A;  4HWH A;  2DWG A;  4HGA A;  4YFS A;  3M65 A;  4QX7 B;  2UUC T;  3MKD A;  4A56 A;  4EV6 A;  5ADX L;  3ZT5 A;  4JBW F;  4U33 A;  3AB3 B;  1YKE B;  1E2A A;  5AQP B;  3KFW X;  1YW0 A;  5JR9 C;  4A97 A;  4HFD A;  3S4U A;  2ZM2 A;  2PG8 A;  2J1D G;  3UU4 A;  4KHZ F;  1HG5 A;  2KZ7 B;  2W61 A;  3PUV F;  1E7P A;  3KIN B;  2JRK A;  2D0U A;  3MXZ A;  3FHN A;  5CA0 E;  4TN7 B;  4DR4 T;  3HR0 A;  4ANJ A;  5JDM A;  4BJM A;  4ZI2 C;  3OJA A;  5H6R B;  1WYB A;  2VKO A;  1T72 A;  1FJG T;  2UXD T;  4AKI A;  1YQ3 A;  3T8O A;  2NTX A;  3QNU A;  3GA8 A;  2K3W A;  5EK4 A;  2MOZ A;  5LHI B;  2WMN A;  3P4S A;  2CEA A;  2CXF A;  2VVS A;  5AQH B;  4CQI A;  1JNR A;  3IA3 A;  2IML A;  2LT3 A;  2W00 A;  3AED A;  4QH1 A;  4YJ2 E;  1FEW A;  4KP3 C;  4LF9 T;  2IAK A;  2N2N A;  3LJC A;  4DV4 T;  4U31 A;  4X1Y E;  3ZMV B;  2Z6E A;  5L3G B;  2CCQ A;  3C51 A;  4J2C A;  3A5X A;  2RP4 A;  4NUV A;  5HXE A;  4A98 A;  5DQW A;  2XHE B;  5M4Y A;  1HFA A;  2L9Q A;  4CXX A;  3RQW A;  4JV5 T;  3VKG A;  1HF8 A;  5JTG A;  4HWC A;  2CHO A;  4DMV A;  4IE6 A;  2WWV A;  3Q5E A;  2IW5 B;  2CXD A;  1ZOY A;  2I59 A;  4MBQ A;  2BBJ A;  2LEH A;  4JI4 T;  4YSZ A;  1LVF A;  3NVO A;  3UUB A;  4I43 B;  5JQG E;  4IIJ E;  4JYA T;  4A5X A;  2VB6 A;  2LRL A;  3EHZ A;  4GK5 E;  1XMQ T;  3FZM B;  3CKD A;  4KHP T;  3AEF A;  1YKH B;  3O1H A;  3FZL B;  1HNW T;  2KIN B;  2WMO A;  4IE5 A;  2BKP A;  3ZN0 B;  5KMG P;  3AEE A;  2VQE T;  4ILC A;  4TWF A;  2X9X A;  4N78 D;  1KF6 A;  2CE7 A;  2XPK A;  2W63 A;  2PJQ A;  4U7Y A;  3RIA A;  5ABF B;  2YKS A;  4CZZ B;  1U4Q A;  4AQF A;  4KMC A;  4EXT A;  5L3E B;  3AAI A;  2X9H A;  3K3O A;  2WP9 A;  5A1L A;  3P4Q A;  2QVA A;  4DR5 T;  4EGW A;  3FB2 A;  3FBZ A;  2D2S A;  2W62 A;  2YOE A;  3LK3 B;  3CQX C;  4X1K E;  3PJA J;  4DV2 T;  4PJJ A;  3HA4 A;  5DQV A;  3P4P A;  5JRC B;  3PUS A;  1YQ4 A;  2WWU A;  3I1A A;  3N9Q A;  2HN1 A;  5L4H A;  5EK2 A;  1HX8 A;  2XJ7 A;  5AFU L;  1XMO T;  3RF1 A;  4WYV A;  5FY1 A;  3ANW B;  2CMR A;  4IDO A;  4TWD A;  5J0Z A;  2ODV A;  2JJ9 A;  4DR2 T;  4IDQ A;  2M67 A;  2J62 A;  4ISS A;  3FZF B;  5J2U E;  3N2K E;  2WAU A;  3AE8 A;  4H9S E;  4UVB B;  3FZK B;  3T1H T;  5HEU A;  3C50 A;  3I9Y A;  3NZP A;  3RHW A;  3J7Y q;  1W0A A;  5LJN A;  1UX5 A;  2YDS A;  2BG9 A;  2QYW A;  4YJ3 E;  2XTL A;  4JEU B;  2IC9 A;  1QLB A;  2XQ4 A;  2XUE A;  3IBP A;  4DV1 T;  3LSV A;  4ZZC A;  4CN1 A;  5LCY A;  5AQU B;  3ZJ2 A;  3ZLI A;  1AJ3 A;  3U3I A;  3AE1 A;  3KBU A;  5FXZ A;  3DJB A;  3T1Y T;  2V7K A;  5AQM B;  4X65 T;  2D0T A;  4LF6 T;  4CI3 B;  1M7K A;  3ONL C;  4EIW A;  3NKZ A;  3UU3 A;  4TNV A;  3DP7 A;  5FXX A;  3EAM A;  2J47 A;  2EHO B;  3ZMZ B;  3RC8 A;  2XY8 B;  2XQA A;  3EDU A;  4DV3 T;  2FBW A;  3JAD A;  3RIF A;  3N5L A;  4DR3 T;  4DV6 T;  1X79 A;  4DO0 A;  2X9W A;  3ZPO A;  1ZHC A;  2MPK A;  3UQ7 A;  2VKD A;  2R6G F;  4NXM T;  2K9A A;  2DL1 A;  4V1A v;  5HXH A;  3B13 A;  3UUM A;  1D0X A;  3TLW A;  2PFV A;  4NUU A;  4WW0 A;  1YXR A;  2V7J A;  4IE0 A;  4GKK T;  4O4L E;  2Q9Q B;  2K5B B;  5AQK B;  2FJB A;  1GQE A;  4PFP A;  3KDS E;  1W09 A;  2NWB A;  3LBX A;  2X0H A;  2QRX A;  3LDQ B;  5HEO A;  4HFC A;  4PAG A;  5LG4 A;  4UVC B;  2D5U A;  2E8I A;  4ZS2 A;  4YSY A;  5HEJ A;  4IDZ A;  3VRA A;  5FVK A;  3K1S A;  5KDM C;  4IL4 A;  3KVB A;  3VR9 A;  3MK7 C;  5FXV A;  3VR8 A;  3K3N A;  4YLH A;  4UV9 B;  1BR0 A;  1KK7 A;  1J5E T;  2WCA A;  4DR1 T;  2CLY B;  2A2F X;  2WQY A;  2KT9 A;  5CB4 E;  3AE9 A;  2BVM A;  3AA0 B;  4ZI2 D;  2WBL A;  2MTQ A;  4NPP A;  4TWH A;  2BDE A;  1UX4 A;  2G0U A;  3E22 E;  5L3F B;  3RH3 A;  3PUG A;  4B3R T;  3OVU A;  3KV9 A;  4YSX A;  5IHY A;  3KV4 A;  4PNI A;  2XAH B;  5HCM A;  3C4Z A;  4MFR A;  3G06 A;  1NAF A;  2WZI A;  2LOP A;  4C91 A;  5LGU B;  3AE5 A;  1MMG A;  4B6X A;  2IHR 1;  2WSS V;  2KSR A;  2HN2 A;  4DR6 T;  3H3M A;  3IEE A;  1HX1 B;  2ZM0 A;  3UFE A;  2JPF A;  4I0U A;  1N36 T;  2FUP A;  3N9L A;  4UVA B;  2LLY A;  3VHL A;  2IDO B;  3ZKR A;  2DCF A;  3A7M A;  2UUB T;  5DJQ C;  3RYH E;  2UUA T;  2XM2 A;  4OK0 A;  2V5D A;  3HL6 A;  4Z90 A;  5ABF A;  2NW8 A;  4WBO A;  2CWY A;  3SRZ A;  3V5U A;  1UCU A;  2V6X A;  2I6H A;  1FIO A;  2XM1 A;  3AEC A;  4X62 T;  5L2L A;  3C98 B;  5L4E A;  3UU6 A;  5JR9 A;  1B7T A;  4IE4 A;  1UUS A;  4MHC A;  1LVK A;  1HTJ F;  5JDN A;  2YIN A;  2F4V T;  1D1B A;  2FJA A;  5F3J A;  5C8Y E;  3RYC E;  2VAS A;  4H9Q C;  3VKH A;  2XAJ B;  5HCJ A;  1ZP0 A;  4EYY R;  5BMV E;  3PV0 F;  2LKG A;  4JI5 T;  1Z0P A;  3HI2 A;  5JVD E;  4UF0 A;  2RA1 A;  4AXP A;  2BZB A;  2V6Y B;  4X20 E;  3IHR A;  2VL8 A;  4O8S A;  3AE2 A;  4HFI A;  4DUZ T;  3OPC A;  3PUQ A;  4JEH B;  5CFB A;  2CXL A;  3E08 A;  4XBF B;  3PU8 A;  5LMN T;  1SHZ C;  4DND A;  5LBQ B;  3ZCJ A;  3ONJ A;  4ZS3 A;  3L8R A;  2WDR A;  4COF A;  3R6N A;  4P09 A;  2Q9Q D;  3NZQ A;  4AQG A;  1BR2 A;  1FMW A;  1E1H B;  1X9B A;  3RIU C;  1OED B;  1IJ6 A;  2K24 A;  3R84 B;  2CBI A;  1CUN A;  4LML A;  3C4W A;  4H9R C;  4CI2 B;  3UTK A;  3SS1 A;  3ZMS B;  2V1D B;  2XZE A;  4UV8 B;  4DVD A;  2XSA A;  1UK5 A;  2BKO A;  3CWZ B;  3ZJ1 A;  4IL9 A;  4EB6 E;  2XQ9 A;  3PE0 A;  2LSJ A;  2BS3 A;  3BK9 A;  3EI0 A;  4YXD A;  2YDR A;  4X5T A;  3AE4 A;  1IAP A;  1SUM B;  2YN6 A;  3F57 A;  4G2A A;  1EZ3 A;  3P4W A;  3UQ4 A;  3V5S A;  2DNX A;  1WCR A;  3ZT6 A;  2EHO C;  4C90 A;  3RI5 A;  5LG3 A;  2E9X B;  4DBR A;  1D0Y A;  3EAB A;  3WAJ A;  1QUU A;  1BR4 A;  3AXJ A;  3ZMT B;  5HEH A;  4GYR A;  1D1A A;  4CN6 A;  3PTR B;  1U5P A;  2KLQ A;  4AI6 A;  3AAE B;  4H9N C;  5HEG A;  3ZEF B;  4H9P C;  4TV8 E;  2XAQ B;  4G63 A;  4U72 A;  4AIU A;  3QOF A;  3AA1 B;  1Y01 A;  4M1P A;  4U3C A;  3RX6 A;  2D9D A;  2ZLY A;  5AQF B;  2H3R A;  3TLV A;  4JI3 T;  4AQF C;  2LKH A;  1D0Z A;  3ETU A;  2Q9Q C;  3LK2 B;  2C5K T;  2NOX A;  1UGO A;  2X9Y A;  3CQC B;  2VK9 A;  3P7I A;  1YD8 G;  5C2T A;  2Y6X A;  4HN9 A;  3SFD A;  4ZEY A;  5JDQ A;  4ZHQ E;  1O3X A;  3OYX A;  3O4X E;  1IBL T;  4QH4 A;  4PFO A;  2C5J A;  4XZC A;  3AVR A;  1MMD A;  2X51 A;  3RLF F;  3NRX A;  2M6B A;  3QB5 K;  2CHN A;  1KEY A;  5FVL A;  2B76 A;  2BG9 E;  5AQG B;  5FMN A;  4ASK A;  5AQO B;  3MAC A;  1KNR A;  2CLY C;  5CGM A;  2IC6 A;  5ABH A;  3EVY A;  3Q5X A;  5HXS A;  2K48 A;  1MIY A;  2I0M A;  3RYI E;  4I4T E;  1G73 A;  3CX7 B;  4HFV A;  3UFG A;  3Q9D A;  2MYS A;  4Z91 A;  1XNQ T;  1N33 T;  3ZYK A;  3D0T A;  4E7S A;  2JQK A;  2UU9 T;  2LJL A;  4X64 T;  4LF7 T;  2V7I A;  3ZYL A;  4IT4 A;  3RQU A;  1SE7 A;  3JC6 C;  2L8K A;  5BR8 T;  2QA7 A;  3GN5 A;  3KBT A;  2JQQ A;  3Q5D A;  2WU2 A;  4TV9 E;  3PUX F;  4LFC T;  2AE9 A;  3ZMU B;  3PUY F;  5JRE A;  4CI1 B;  4L5G A;  2CBJ A;  5CA1 E;  5JDG A;  3ESL A;  3F2E A;  4YTN A;  4LMJ A;  5EK3 A;  3TKL B;  4WZX A;  4NIQ A;  3AE3 A;  2JMH A;  4UEM A;  3MA9 A;  1HCI A;  2P9B A;  5F5W A;  1KNP A;  5HYA A;  3KV5 A;  5LHH B;  1ZV4 X;  3PUR A;  3ZC1 A;  4U2Y A;  2BBH A;  5EZY E;  2W0G A;  3ABV A;  3C4X A;  4YY3 T;  2JMK A;  4AKL A;  4LFA T;  5LBM A;  4MAL A;  4LMK A;  3TLT A;  1OWA A;  4U74 A;  5DAB A;  3HKC E;  1FMV A;  1XDO A;  2X0Y A;  4X1I E;  4ZOL E;  2E9X D;  4HWD A;  4ILA A;  5LP6 E;  1R8I A;  1J1J A;  3I0Q A;  3Q5W A;  3WAK A;  3MJX A;  2XQ8 A;  3I9W A;  3P50 A;  3BQI A;  3JAE A;  4QHO A;  2CPT A;  2C5I T;  5AQJ B;  2N9D A;  3LFM A;  4JI8 T;  3FXE B;  3UUN A;  5FKY A;  1LRZ A;  1HR0 T;  2NW9 A;  4QXH B;  2L3L A;  2UXC T;  2YDQ A;  1DU2 A;  1WLX A;  3RRC A;  3AAA B;  2HPJ A;  4PK5 A;  3H37 A;  5GON E;  1OED C;  1W0B A;  4I50 E;  1I6Z A;  2W67 A;  1XWM A;  4QWN B;  5LOV E;  5LGN B;  2WY2 A;  4JLE A;  4P0A A;  4LF8 T;  3N2G E;  1WYC A;  3UUX B;  4KUM B;  2GK9 A;  4HFB A;  2UXB T;  4PK4 A;  1Z8U A;  4L9I A;  3ZC0 A;  1UUR A;  4IGU A;  2C0S A;  1T98 A;  2XAF B;  3RPU A;  3FBL A;  1QSD A;  2LM9 A;  3PJA A;  4U2Z A;  4BAY B;  4QH5 A;  2OLT A;  2BG9 B;  2H88 A;  3Q2M A;  2WM9 A;  5AQR B;  4BA9 A;  4U7I A;  2ACX A;  2VQF T;  2E9X C;  4AKR B;  4EED A;  2WZH A;  3ZCI A;  4JI2 T;  3PUZ F;  5C3J A;  3SWH A;  3P8C D;  5L3C B;  2XQ5 A;  4F8H A;  2SPC A;  1H7C A;  1HG2 A;  5TAO A;  4CXW A;  3MZK B;  4ILU A;  2PTF A;  4B3T T;  4HFE A;  3QB5 A;  1VCS A;  3PU3 A;  2WS3 A;  5AQV B;  2X68 A;  2H7O A;  4DMW A;  5L3B B;  1ZKE A;  3ZSS A;  3AEB A;  5LJM A;  4ZI3 C;  2KMF A;  4LF4 T;  4KBM B;  2XQ7 A;  1XDP A;  2A3D A;  3PDY A;  1WR6 A;  3O9X A;  1MMN A;  5FL0 A;  5JDF A;  1MNE A;  4NXN T; 
#chains in the Genus database with same CATH homology
 3C50 A;  4TUY E;  1EZ3 A;  3I9Y A;  5HWY A;  3V5S A;  4OYJ A;  2DNX A;  3AA6 B;  3NZP A;  2XAS B;  4K0U A;  4H63 V;  3J7Y q;  4ERR A;  2EHO C;  4C90 A;  4Z8X A;  5LJN A;  1UX5 A;  3I0O A;  2E9X B;  4L0R A;  4BJN A;  4DBR A;  1D0Y A;  1NWM X;  3BQK A;  3WAJ A;  1QUU A;  2EHO D;  1BR4 A;  4QX8 B;  3J9X 1;  4YJ3 E;  2XTL A;  4JEU B;  2IC9 A;  5J2T E;  3ZMT B;  3RKO A;  5LA6 E;  3QC9 A;  2LSK A;  4GYR A;  1D1A A;  5JRC A;  5ETW A;  2CM0 A;  1ZEE A;  3PTR B;  1OXZ A;  2XUE A;  3IBP A;  1U5P A;  3ZN1 B;  2KLQ A;  4AI6 A;  1KNZ A;  4IE7 A;  3CX6 B;  4H63 H;  4ADZ A;  3AAE B;  4H9N C;  3GMI A;  1VOM A;  4O2A E;  5FYM A;  3ZEF B;  5LCY A;  5HXR A;  3ZJ2 A;  4H9P C;  3ZLI A;  2ZMA A;  4TV8 E;  1AJ3 A;  4UXN B;  3U3I A;  2XAQ B;  3ANW A;  3N9O A;  4G63 A;  3CVR A;  4U72 A;  3KBU A;  2QGS A;  3SOL A;  5FXZ A;  3DJB A;  3AA1 B;  3L09 A;  4H9O C;  2V7K A;  1MIW A;  3O1I A;  3RC3 A;  4M1P A;  3OBV E;  3H3A A;  2MBG A;  3K8P C;  3RX6 A;  2HPL A;  5IYZ E;  2ZLY A;  4E7Z A;  2D0T A;  2H3R A;  2NP9 A;  1MMA A;  4AQF C;  4CI3 B;  3C64 A;  3LBX B;  4PJN A;  1BR1 A;  5HAX A;  2LOS A;  4EIW A;  1D0Z A;  3ETU A;  3CQG B;  3N9N A;  3UUL A;  4OYK A;  2Q9Q C;  3ONX A;  3LK2 B;  4UEL A;  2C5K T;  4I55 E;  2NOX A;  4PW8 A;  1US7 B;  3DP7 A;  5FXX A;  2X9Y A;  3CQC B;  2A72 A;  4HEA A;  2EHO B;  2VK9 A;  4UIG A;  3ZMZ B;  3P7I A;  1YD8 G;  3RC8 A;  2CWO A;  2UXN B;  2Y6X A;  4HN9 A;  2YEV C;  3B57 A;  5JDQ A;  4ZHQ E;  3EDU A;  3HKE E;  5FY7 A;  4CXY A;  1O3X A;  3GN5 B;  4P0B A;  2NTY A;  3OYX A;  3O4X E;  1MND A;  5LNK A;  2BVL A;  4FI5 A;  2E9X A;  3N5L A;  1IJ5 A;  2X0L B;  3BQL A;  4HE8 A;  1S94 A;  4PFO A;  2C5J A;  2CA5 A;  4XZC A;  3AVR A;  1X79 A;  1MMD A;  3W15 B;  4WBN E;  2X51 A;  4DO0 A;  2LE8 A;  3NRX A;  2X9W A;  1G8X A;  3VU7 H;  1ZHC A;  3ZPO A;  2VKD A;  2XAG B;  3U78 A;  2B1E A;  3OKQ A;  4MLK A;  2K9A A;  4V1A v;  4WNK A;  3RRW A;  3N9P A;  3EDV A;  5FMN A;  5HXH A;  5JDH A;  3B13 A;  2DHR A;  4ASK A;  4AKG A;  3AA7 B;  3MAC A;  3UUM A;  1D0X A;  3PUA A;  2ODU A;  2CLY C;  4TX5 A;  2IC6 A;  4FJO A;  2DWG A;  4HGA A;  2PFV A;  3EVY A;  3Q5X A;  5HXS A;  4YFS A;  3M65 A;  3QUJ A;  4NUU A;  4QX7 B;  2K48 A;  4WW0 A;  2V7J A;  3MKD A;  1MIY A;  3RYI E;  4A56 A;  4IE0 A;  3KV6 A;  5ADX L;  3O1J A;  4I4T E;  1G73 A;  3CX7 B;  4HFV A;  4O4L E;  2Q9Q B;  3Q9D A;  2MYS A;  2K5B B;  5LHG B;  3ZYK A;  4PFP A;  2OA5 A;  3KDS E;  2NWB A;  3AB3 B;  2ZM8 A;  3LBX A;  3D0T A;  1YKE B;  4E7S A;  3KFW X;  2LJL A;  1YW0 A;  2V7I A;  4PAG A;  3ZYL A;  1SA0 E;  5JR9 C;  4GOU A;  2EHO A;  5LG4 A;  4UVC B;  2D5U A;  3S4U A;  2E8I A;  4HTE A;  4ZS2 A;  2ZM2 A;  3JC6 C;  2L8K A;  2PG8 A;  2J1D G;  3LG7 A;  4IDZ A;  1HS7 A;  2UXX B;  1HG5 A;  2DWK A;  2KWH A;  2KZ7 B;  2QA7 A;  5KDM C;  3GN5 A;  3KVB A;  4EOZ B;  3KBT A;  2JQQ A;  2W61 A;  4TV9 E;  3MK7 C;  2LSG A;  5FXV A;  3K3N A;  3JC6 D;  4YLH A;  4UV9 B;  4TZ4 C;  3KIN B;  1BR0 A;  2YK0 A;  2JRK A;  2D0U A;  3ZMU B;  3MXZ A;  3N9M A;  5F3J A;  1KK7 A;  5JRE A;  4CI1 B;  3FHN A;  4IST A;  2Y8D A;  4TN7 B;  5CA0 E;  4L5G A;  4EZH A;  3HR0 A;  2CLY B;  4ANJ A;  5CA1 E;  2A2F X;  5JDG A;  4YHJ A;  3ZYM A;  3ESL A;  3F2E A;  5JDM A;  4BJM A;  4ZI2 C;  5EK3 A;  2KT9 A;  3TKL B;  3OJA A;  5H6R B;  4GIW A;  5CB4 E;  4DBQ A;  2BVM A;  1WYB A;  2VKO A;  3L3P A;  3AA0 B;  5H6Q B;  4ZI2 D;  2WBL A;  2MTQ A;  4AKI A;  3GWH A;  2JMH A;  4UEM A;  3T8O A;  2X67 A;  2NTX A;  1MIV A;  2BDE A;  3MA9 A;  4PJM A;  3E0Z A;  1UX4 A;  3GA8 A;  4QXB B;  2G0U A;  4OHF A;  1HCI A;  3E22 E;  5EK4 A;  2P9B A;  2MOZ A;  3NBX X;  5LHI B;  5L3F B;  2WMN A;  3EUH A;  3RH3 A;  2CEA A;  2CXF A;  2Q9Q A;  3PUG A;  4CQI A;  4O4J E;  5HYA A;  3KV5 A;  5LHH B;  2LT3 A;  1ZV4 X;  3PUR A;  3ZC1 A;  5JR9 B;  2W00 A;  5EZY E;  3KV9 A;  2W0G A;  3C4X A;  5IHY A;  3KV4 A;  2JMK A;  3OYZ A;  4AKL A;  4PNI A;  2XAH B;  3C4Z A;  4MFR A;  4YJ2 E;  1FEW A;  2ES0 A;  4KP3 C;  5LBM A;  2IAK A;  3LK4 2;  2N2N A;  4MAL A;  3LJC A;  2Y48 B;  3HKD E;  1NAF A;  5HXC A;  1OWA A;  4U74 A;  2N1G A;  2LOP A;  5DAB A;  4C91 A;  5LGU B;  3HKC E;  4X1Y E;  1FMV A;  1MMG A;  2Z6E A;  3ZMV B;  5L3G B;  2CCQ A;  3C51 A;  2NW7 A;  4B6X A;  4J2C A;  5F8P A;  4X1I E;  3A5X A;  3DTO A;  4ZOL E;  2RP4 A;  2WSS V;  2E9X D;  4NUV A;  5L3D B;  5HXE A;  5LP6 E;  5DQW A;  2XHE B;  5M4Y A;  1HFA A;  4EYU A;  3I0Q A;  4UF0 B;  1VRB A;  3IEE A;  2L9Q A;  4CXX A;  3Q5W A;  2KWI B;  2ZM0 A;  3UFE A;  2JPF A;  3N9L A;  4UVA B;  3WAK A;  3VHL A;  3MJX A;  3AVS A;  3I9W A;  2DCF A;  3VKG A;  4OFZ A;  3BQI A;  5DJQ C;  3RYH E;  1HF8 A;  4QHO A;  2VWA A;  4OK0 A;  2C5I T;  3HL6 A;  3K3Q C;  2N9D A;  2NW8 A;  3LFM A;  4WBO A;  4DMV A;  2LSI A;  2CWY A;  4IE6 A;  2IW5 B;  3SRZ A;  2CXD A;  3V5U A;  1UCU A;  3FXE B;  3UUN A;  4O4I E;  2I59 A;  2LHN A;  4MBQ A;  1LRZ A;  2LEH A;  5E0O A;  2NW9 A;  1LVF A;  4GK0 E;  2L3L A;  4QXH B;  1FIO A;  5JDL A;  5LXT E;  4PK6 A;  5L2L A;  3C98 B;  4I43 B;  5JQG E;  4IIJ E;  1B7T A;  2VKJ A;  5JR9 A;  4IE4 A;  1WLX A;  2VB6 A;  4GK5 E;  4MHC A;  2LHR A;  1LVK A;  4JUY A;  3RRC A;  3CKD A;  3AAA B;  2HPJ A;  4PK5 A;  1YKH B;  1HTJ F;  3O1H A;  5JDN A;  3H37 A;  4GYS A;  5GON E;  2YIN A;  2KIN B;  4I50 E;  1D1B A;  5FY0 A;  2WMO A;  5FNV E;  4EZ4 A;  4QWN B;  2VKH A;  3RYF E;  5C8Y E;  2KND A;  3RYC E;  2VAS A;  4IE5 A;  5LOV E;  4H9Q C;  3VKH A;  5LGN B;  3ZN0 B;  4ZI7 E;  1LKX A;  3HKB E;  2XAJ B;  5KMG P;  5KX5 E;  4JLE A;  4EYY R;  5BMV E;  4P0A A;  3N2G E;  1IZN B;  1WYC A;  2X9X A;  4N78 D;  1Z0P A;  2CE7 A;  2V7L A;  3HI2 A;  2YU1 A;  5JVD E;  2H7V C;  2W63 A;  2PJQ A;  4UF0 A;  2RA1 A;  4AXP A;  2BZB A;  3CML A;  3UUX B;  4KUM B;  2GK9 A;  3UT5 E;  4X20 E;  3IHR A;  2VL8 A;  4CZZ B;  4O8S A;  4PK4 A;  1U4Q A;  4AQF A;  4KMC A;  4EXT A;  5JH7 E;  3AAI A;  5L3E B;  2X9H A;  3K3O A;  4L9I A;  3ZC0 A;  4PJL A;  3PUQ A;  4JEH B;  5A1L A;  4IGU A;  2CXL A;  2C0S A;  3E08 A;  1T98 A;  2XAF B;  4XBF B;  3RPU A;  3FBL A;  1QSD A;  3FB2 A;  3FBZ A;  3PU8 A;  2D2S A;  2LM9 A;  1SHZ C;  4DND A;  2LSY A;  5LBQ B;  2W62 A;  3CPZ A;  3KVA A;  3ZCJ A;  1WRD A;  4BAY B;  3LK3 B;  3CQX C;  4ZS3 A;  4X1K E;  3R6N A;  4PJJ A;  5FXW A;  3HA4 A;  5FP3 A;  4P09 A;  3Q2M A;  2WM9 A;  5DQV A;  2Q9Q D;  4BA9 A;  3QK6 A;  3NZQ A;  4AQG A;  2ACX A;  1BR2 A;  1FMW A;  2E9X C;  4QKN A;  2V26 A;  4AKR B;  1E1H B;  4O4H E;  3ZCI A;  2DLR A;  5JRC B;  2DI4 A;  2XQY A;  3SWH A;  3P8C D;  4EAH A;  5L3C B;  3PUS A;  1IJ6 A;  2K24 A;  3R84 B;  4AKH A;  1CUN A;  2WWU A;  2SPC A;  3F31 A;  1H7C A;  4QXC B;  1HG2 A;  3I1A A;  1Y64 B;  3MZK B;  4ILU A;  5TAO A;  3N9Q A;  4CXW A;  4HKA A;  5EK2 A;  1HX8 A;  3C4W A;  5LGT B;  3CX8 B;  4H9R C;  3NRY A;  5AFU L;  4CI2 B;  3PU3 A;  5FY1 A;  3UTK A;  3ANW B;  3SS1 A;  3ZMS B;  2CMR A;  3N2O A;  2V1D B;  4XAX B;  2X68 A;  2HH7 A;  5J1G A;  2YU2 A;  4UV8 B;  4DVD A;  4F6R C;  2H7O A;  3CWZ B;  2ODV A;  4O2B E;  3ZJ1 A;  2JJ9 A;  3WI3 A;  4IHJ E;  2X66 A;  5HWX A;  4DMW A;  4EB6 E;  5L3B B;  3PE0 A;  1ZKE A;  3ETV A;  2LSJ A;  2M67 A;  1V9D A;  1S35 A;  5LJM A;  4ISS A;  4ZI3 C;  2KMF A;  5J2U E;  3BK9 A;  3N2K E;  2WAU A;  4KBM B;  1D1C A;  2V7M A;  4H9S E;  4UVB B;  3FXD B;  1IAP A;  2A3D A;  5LYJ E;  2PBI A;  3IF8 B;  3PDY A;  1WR6 A;  2KXP B;  3O9X A;  3F57 A;  1MMN A;  5JDF A;  4ZI3 D;  4G2A A;  1MNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...