2WSSV

The structure of the membrane extrinsic region of bovine atp synthase
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
66
structure length
66
Chain Sequence
b'LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL
publication title The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 5
structure length 66
sequence length 66
chains with identical sequence Z
ec nomenclature
pdb deposition date 2009-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wssV01
2CLYC 2WSSV
chains in the Genus database with same CATH superfamily
3UU4A 4KP3C 5AQKB 2V7LA 2W2UA 4XBFB 2EHOA 4U33A 4MLKA 3RC3A 3ANWB 5TAOA 1S94A 5HWYA 4ZI7E 5JRCB 1FMVA 3ZMVB 2Q9QA 5LNKA 3RC8A 3ESLA 3UU8A 5M4YA 5LJNA 3RGLA 3BQLA 2XQ8A 2WBLA 1IBMT 5IWAT 2X0HA 3PUSA 4YJ2E 2X9WA 2UXNB 4I43B 3UUMA 3DP7A 4AKHA 4ZI2D 4EGWA 5LGTB 4AI6A 4AKRB 4YJ3E 4PJLA 3CQGB 2WSSV 5JR9A 4K0UA 5LGNB 4O4JE 2DI4A 3SOLA 5AQLB 2VQET 3O1HA 4Z91A 2EHOC 4NPPA 4TNWA 3B57A 3LK2B 3UQ4A 4EYUA 2CHOA 5J2UE 3I9YA 5LJMA 5JREA 3QB5K 4ZHQE 5L3BB 1Y01A 3AEAA 2Q9QC 4UXNB 1YKHB 2E5VA 3PUGA 4K0KT 4X64T 3AE1A 4P0AA 4JEHB 2FJDA 2XQAA 3TLWA 3CPZA 1MMAA 4PJJA 2XSBA 3EABA 3N9MA 3O4XE 4DMVA 3AA6B 5JR9C 3UU5A 4NXMT 4WNKA 2UXCT 3Q5EA 3JAEA 3M65A 2DLRA 4KMCA 4DIDB 1QUUA 5IHYA 3WAJA 1AJ3A 1UK5A 2MYSA 4AQFA 1NENA 3FZHB 5KX5E 4ILUA 5HEJA 1WFDA 2J1DG 2YU1A 3C4WA 4HFDA 3MK7C 4UF0A 4GKKT 3KV5A 4EEDA 2XM1A 4U31A 3D0TA 2J47A 4EEBA 2JPFA 5ETWA 2XQYA 3I0OA 2M67A 3CQXC 2ES0A 3MA9A 5LOVE 2MAWA 1HS7A 4CZZB 2KNDA 5FXXA 3PUQA 2RA1A 2CBJA 3NKZA 3QC9A 3ZMUB 5FL1A 2HHHT 3ZKRA 2VKHA 2LKGA 1FEWA 4KHPT 3AXJA 3UU3A 2VWAA 3MJXA 2ODVA 5ABGA 4IE4A 4A98A 1IZNB 4DV7T 5FYMA 3SS1A 2H89A 1YQ4A 3I0QA 4AQFC 3OPCA 4A5XA 4DVDA 4QHOA 4U74A 5LYJE 4F8HA 3K8PC 1M7KA 2NTYA 3ETUA 2E5LT 5HXSA 4WYVA 4O8SA 2HPJA 2V1DB 5JRCA 2CRBA 3H3MA 1IBKT 1YQ3A 4EZHA 4O4LE 3EAMA 2DL1A 5JDQA 3P4WA 2V6XA 4TV8E 5DJQC 2CM0A 3J9X1 4HWDA 2DCFA 3AB3B 2V6YB 2XTLA 3M3ZB 4CI1B 3LFMA 4X5TA 4JBWF 2CHNA 4P1NA 1UURA 3T1YT 2WU2A 4LF7T 3ZT6A 4QXCB 3ZN0B 3RKGA 3CWZB 2OLTA 1HR0T 2BKPA 3AE3A 5AQSB 1X9BA 4TWFA 3A7MA 2KLQA 5HXEA 2K9AA 5FP3A 1GQEA 5IYZE 3V5UA 2E2AA 2EHOB 3KDSE 1Z8UA 1SHZC 2D2SA 4EIWA 4EZ4A 3PUVF 2ZLYA 4EOZB 4PFOA 3EVYA 2HN1A 5LP6E 4LF4T 4ZZCA 4LF5T 2UU9T 2PBIA 2Q9QB 5FY7A 2M6BA 3Q5WA 2LM2A 3JC6D 2JQKA 1YXRA 2V7MA 2W00A 4BJMA 4U7YA 4IDQA 3JAFA 2H3RA 4PJNA 3NRYA 4ILAA 4NUVA 4JLEA 3P4QA 2JJ9A 3UU6A 3AEFA 5JDNA 4U7IA 4AKLA 4H9QC 4QWNB 4HFHA 1T98A 5HEUA 4EXTA 3RPUA 5JH7E 2NW9A 1BR1A 2I0MA 4DV5T 3ZLIA 3VRBA 2OA5A 1KNPA 3B13A 5E0OA 2YEVC 4B3MT 4IDZA 4XZCA 4YHHT 4AKIA 2JMHA 1LVKA 2D9DA 4EYYR 3IEEA 4U3CA 2VB6A 4DUZT 3FXDB 3ABVA 4I4TE 2XSAA 4YTMA 2IUBA 2NR4A 3K3OA 5FXZA 4WZXA 3LBXA 3KV9A 3C50A 3RKOA 5LBQB 4DV6T 4IDPA 5EK4A 5KXJA 2YINA 1HG5A 1US7B 4Q25A 2D5UA 4ASKA 3E0ZA 4G2AA 4IHJE 4B3TT 4IREA 3UULA 1G73A 2NOXA 5HCJA 3N9PA 1KF6A 2X68A 2L9QA 5HXHA 1WYBA 2WP9A 2Y8DA 3PJAA 5AQOB 3RRWA 2E9XD 3C98B 4DV1T 2KWIB 2CE7A 4HWCA 3N9LA 2VKOA 3HKEE 5EK3A 4N78D 2IC6A 1J5WA 2XQ3A 4OHFA 1XNQT 4TZ4C 5AQPB 3AVRA 2VVNA 2G0UA 3O1IA 3PV0F 3N9OA 2KWHA 4KHZF 4COFA 2LLYA 4JI6T 2BBHA 2LJLA 4A97A 2X9HA 4UV9B 5CA1E 4QH1A 4FI5A 3AAAB 3AA1B 5L3CB 3HI2A 3NRXA 5J0ZA 1MIYA 3AXJB 4YFSA 4KUMB 4OFZA 1ZOYA 3IHRA 5FL0A 5HEHA 3ONJA 1D1AA 2I59A 3PUXF 1UX5A 2WZHA 3VKHA 2KMFA 4ZEYA 2CPTA 4PFPA 3BQIA 4DV4T 3PUYF 1M62A 1DU2A 3MACA 1IJ5A 3WAKA 3UQ7A 3SFDA 2WCAA 1HNZT 4B3ST 2WWUA 4HE8A 4HWFA 3UT5E 3S4UA 5LMUT 3PUZF 3SFEA 2LEHA 3N9NA 2A2FX 3AEBA 3L8RA 4X66T 1I94T 4DR3T 2XAHB 3AE5A 4YXDA 3GMIA 5FMNA 5L3GB 5LGUB 4YSZA 2JQQA 1FIOA 3FHNA 3H3AA 2C5IT 3PJAJ 1MMNA 2VURA 5JVDE 3VHLA 1NEKA 3F2EA 4CQIA 1MIWA 2VL8A 3AA7B 2QVAA 2JIWA 2ZM0A 1D1BA 1KNZA 5LMNT 3HA4A 3T1HT 1XMQT 1FMWA 5HAXA 1QLBA 3K3QC 2W67A 2YDQA 4HGAA 4IE6A 4CN1A 3U78A 5CGMA 5AQGB 5HYAA 2K24A 5AQRB 1E7PA 2V8SV 3LJCA 3AEEA 4PJMA 3AEDA 1ZHCA 4ZI3D 4MHCA 1D1CA 4CXXA 3OBVE 3R84B 3QK6A 5FVKA 3NBXX 2W61A 5J2TE 3ZSTA 4DV3T 4UEMA 1MMDA 2XY8B 1E2AA 4IE0A 3GA8A 2NW8A 2MPKA 4DBQA 3SRZA 3CQCB 4C90A 2BS4A 5LB7B 1XZYA 4GK0E 4JYAT 1QSDA 3HL6A 5L3EB 2XQ6A 1O3XA 1HCIA 3UFGA 4CXYA 4V1Av 2XQ4A 2NWBA 1OEDE 3BK9A 5LCYA 2YDSA 2CCQA 2DHRA 3AAEB 3ZMZB 1YD8G 4AQGA 2X51A 3PUWF 3IBPA 4TWHA 2RP4A 4B6XA 4EAHA 1HNWT 4O2AE 4BJNA 3LBXB 3FXEB 4LFAT 3MKDA 5HEGA 4ZZBA 1YKEB 4OX9T 5KMGP 4NUUA 4IL9A 3P4RA 2BG9C 2LSJA 3L39A 4ILCA 1HNXT 4IE5A 4GKJT 2WMOA 4ZI2C 1W0BA 2HN2A 2NTXA 2ODUA 5L3DB 1WYCA 4CI2B 3CIRA 2C5JA 5BMVE 4IDNA 4PAGA 3RX6A 2LOSA 3HKBE 3ETVA 1U5PA 1ZEEA 1T72A 2LSYA 2RPAA 5JDGA 2D0UA 5CB4E 2UUAT 3RYCE 1W0AA 2JMKA 3QOFA 2PJQA 4QX8B 4DMWA 3N2GE 4IIJE 3ZJ2A 1MIVA 3RQUA 4H9PC 1HG2A 3FB2A 1WR0A 5AQJB 3E22E 4JI0T 3OTOT 3KVAA 2LHNA 1T8BA 5LBMA 4UVBB 1KK7A 2W63A 3OVUA 2WMNA 5LG3A 2C5KT 2XQ7A 3C51A 3UUBA 1VCSA 2FUPA 1U4QA 4EB6E 3UFEA 4AKGA 3AE9A 2BG9E 2IIUA 4H9SE 2X67A 1IBLT 3A8YC 4QX7B 3EDUA 3RYIE 2H7VC 4UVCB 4DR7T 5GONE 4LMLA 2VL0A 3PUAA 3AECA 4UVAB 4MBQA 5C8YE 4QH4A 3I1AA 1ZV4X 4TX5A 4LMJA 2CEAA 2JQHA 3FZFB 3LK3B 4HKAA 4B3RT 5ABFA 2UUCT 2N9DA 3PU3A 3EDVA 2X9XA 1IAPA 2OV9A 3J7Yq 5FXVA 3NVOA 4ISSA 4JI3T 3GN5A 1KNRA 4C91A 4LMKA 4LF8T 4ADZA 4IGUA 5FY1A 5AQQB 3QUJA 1NAFA 1W9RA 4DR5T 4QXBB 2XHEB 3ZPOA 3EUHA 3P4PA 2YOEA 1JNZA 4ILBA 3LG7A 3ZC0A 4HN9A 4LF6T 2LSGA 3AE7A 2N1GA 2CWOA 2V7KA 2LM9A 2WDVA 4JV5T 2N2NA 3MZKB 4U72A 4DBRA 1VOMA 5LXTE 2WU5A 3RYFE 3VU7H 2YU2A 3GWHA 3Q9DA 4ZS3A 4Z90A 5L2LA 3TLSA 5DABA 4TN7B 5HXRA 3AAIA 3SWHA 1SE7A 2VASA 2FJEA 4UR9A 2NP9A 1R8IA 3P4SA 2QA7A 2ACXA 2BBJA 4I0UA 5BR8T 3KFWX 1XNRT 2WDQA 2VKJA 5HWXA 4OK0A 4JI2T 2LSKA 2K5BB 4YY3T 5HEOA 4ZS2A 2WDRA 3OYXA 2CLYC 4AIUA 2MTQA 2UXBT 5JDFA 2CXLA 3OKQA 3P7IA 2WWVA 3RIFA 4HTEA 4KBMB 5DQVA 1WCRA 5A1LA 5AQIB 3RHWA 4X1YE 4YTPA 3LK42 3ZYKA 2B76A 1XMOT 2BG9B 3FZKB 3C4XA 3RRCA 1ZKEA 4H9OC 3ZYLA 4CI3B 2EHOD 2YDRA 1HF8A 3AEGA 3VR9A 4YSYA 3E08A 4IDOA 2Q9QD 1T7SA 3G06A 2WY2A 3ZCJA 3FBZA 2PG8A 4KI0F 2UUBT 1BR0A 3IA3A 2CXDA 2DWGA 4BA9A 4HWHA 2WB5A 2HPLA 4CN4A 2IHR1 1HX8A 2SPCA 4H63V 2IC9A 1UCUA 5CA0E 1LKXA 1WRDA 3JC6C 4L9IA 2KZ7B 4MFRA 1J1JA 5AQMB 4GK5E 3RIUA 3R6NA 2XQ5A 2VQFT 4BAYB 2BDEA 3RYHE 2YKSA 4O4IE 2I6HA 3L09A 3OJAA 4TWDA 3AA0B 5LHHB 3UTKA 5AQHB 3FZLB 2LRKA 4YTNA 3VKGA 3OYZA 5AQTB 2IMLA 2XAFB 1L0VA 2B1EA 2E9XA 5AQNB 2A9UA 2QGSA 5J1GA 5JDHA 2V5CA 2BZBA 3ZMSB 5AQUB 1OEDA 2WM9A 3CK6A 3ONLC 3TLVA 1XWMA 4F6RC 3RIUC 3K1SA 4IT4A 2DNXA 1KEYA 1LVFA 3C64A 4OYJA 4IL4A 2Y6XA 2BKOA 1MNDA 2VK9A 3N2OA 3H37A 3CX8B 4GIWA 3KBUA 3ZYMA 1VCTA 3TLTA 1H7CA 4X20E 2V7JA 3ZCIA 4TUYE 4PK5A 4QXHB 3LDQB 2BS3A 3CX6B 3JCFA 1UGOA 2ZM8A 2WZIA 2A3DA 2BVMA 1N33T 5FKYA 2E9XC 1ZP0A 2XAGB 3TLUA 2L8KA 4JI4T 1CUNA 5ABFB 3UUNA 2VKDA 2V5DA 2HH7A 1BR2A 4X1KE 1OEDC 4QH5A 4YT0A 1XDPA 3AE6A 5H6RB 3WI3A 3N5LA 3GN5B 4Z8XA 2FJBA 3LSVA 3AE2A 1UX4A 4JEUB 5ABEA 4AQYT 2QRXA 3O9XA 3VR8A 4U2ZA 2XQ9A 2BG9A 3Q5XA 5L47A 4YLHA 2XUEA 2CLYB 2YN6A 2VVSA 2CXFA 1N32T 4J2CA 2ACZA 4AXPA 2FBWA 1SUMB 3ONXA 4DR4T 1X79A 3HKCE 2W66A 4X65T 4PW8A 3NZPA 5EZYE 4JI8T 3PURA 3NZQA 1Y64B 4PNIA 2WS3A 2XASB 4UV8B 3V5SA 3FZMB 4GOUA 2W4XA 5F8PA 2P9BA 1N34T 2W62A 1XDOA 3ZT5A 3KINB 2AE9A 1SA0E 1KFYA 1E1HB 4E7SA 3ZEFB 1J5ET 4UIGA 2NW7A 3ZN1B 4WBNE 4JI1T 2ZM2A 4WBOA 1OXZA 2V26A 5C3JA 2CMRA 2KT9A 4G63A 1YW0A 5HCMA 4U2YA 3QB5A 1I6ZA 3F57A 2H88A 5FXWA 4JI5T 3RLFF 1W09A 3P8CD 3HR0A 1BR4A 5LHGB 4A56A 4YHJA 4NXNT 2F4VT 2JQ9A 1OWAA 3DJBA 1Z0PA 5ABHA 4CXWA 1JNRA 3ANWA 4GYRA 2K3WA 2IAKA 3KVBA 4JUYA 4PK4A 2BVLA 2IDOB 3O1JA 2W0GA 2GK9A 4X1IE 4P09A 2MOZA 5H6QB 3F31A 3TKLB 3ZC1A 4O2BE 3KV4A 2K48A 2XAJB 4HFEA 4NIQA 4L0RA 5JDMA 3KV6A 2LT3A 2ZMAA 1HX1B 1HFAA 2CBIA 4ZI3C 3AE8A 4MALA 5EK2A 4DR2T 5FY0A 2Y48B 5AQFB 1EZ3A 4GYSA 2KXPB 4DUYT 3UUXB 3C4ZA 1FJGT 4LFCT 3N9QA 3RH3A 4HFCA 4TNVA 3VRAA 3ZSSA 3B5MA 4PK6A 2E9XB 2AXDS 2UXDT 3JADA 3N2KE 4KX6A 2PFVA 2QYWA 2DWKA 4LF9T 1OEDB 5LA6E 3EHZA 2CWYA 2WQYA 1HTJF 2LKHA 2PTFA 4DR1T 4H63H 3W15B 2YK0A 1WR6A 5CJ5A 2R6GF 3CKDA 3QNUA 3RQWA 3PE0A 4EV6A 3AE4A 5DQWA 2M6IA 3ZMTB 2KINB 4DR6T 1IJ6A 1LRZA 3KBTA 5L4HA 4ZOLE 3CX7B 4ANJA 5JR9B 2CA5A 5FVLA 3RIAA 3MXZA 2LOPA 2LE8A 2FJAA 4TV9E 2L3LA 4DNDA 5F3JA 2XZEA 1VRBA 4E7ZA 3CMLA 2X0YA 3X1DA 4JI7T 2ZM6T 3Q5DA 1B7TA 2BS2A 4P0BA 1N36T 3AVSA 5CFBA 5LHIB 1NWMX 1D0YA 5KDMC 2X66A 5F5WA 4FJOA 4L5GA 4I55E 4HEAA 5JTGA 3RF1A 1WLXA 2WAUA 3ZT7A 3RI5A 3U3IA 4HFVA 5L3FB 3FBLA 4DO0A 4H9NC 3PDYA 2MBGA 4LFBT 4O4HE 4CN6A 5LG4A 5ADXL 2A72A 3EI0A 5JDLA 3T8OA 3I9WA 1CHUA 1D0ZA 2JRKA 3Q2MA 2Z6EA 3IF8B 2V7IA 2KSRA 2D0TA 1G8XA 2X9YA 2LSIA 5AFUL 4HWIB 2LHRA 4AISA 2J4GA 4ISTA 2XPKA 2H7OA 1D0XA 3HKDE 3A5XA 3ZJ1A 4DV2T 4DV0T 1UUSA 5FNVE 1S35A 4ERRA 5C2TA 4HFBA 3BQKA 3K3NA 4M1PA 1MNEA 4UF0B 5L4EA 2V6YA 3DTOA 3PTRB 4I50E 2BKNA 2XM2A 3PU8A 2J62A 2LRLA 2X0LB 5AQVB 2XJ7A 5JQGE 4IE7A 2UXXB 3NWIA 5HXCA 4YSXA 2E8IA 4WW0A 4UELA 3L3PA 4HFIA 5IUXA 4OYKA 4QKNA 4X62T 4ZXLA 1V9DA 1MMGA 4XAXB 3CVRA 2XAQB 4H9RC 3P50A 2C0SA 2IW5B
chains in the Genus database with same CATH topology
2C5KT 1LVKA 2CLYB 4EYYR 3IEEA 3C51A 2CXFA 1U4QA 2VB6A 4KP3C 4EB6E 3UFEA 4AKGA 3FXDB 2V7LA 4I4TE 4XBFB 2EHOA 4J2CA 4AXPA 4MLKA 3K3OA 4H9SE 2X67A 5FXZA 3RC3A 3ANWB 5TAOA 3ONXA 3LBXA 3KV9A 1S94A 3C50A 3RKOA 4QX7B 1X79A 3EDUA 3RYIE 3HKCE 5HWYA 5LBQB 2H7VC 4UVCB 5GONE 4ZI7E 4PW8A 5JRCB 3NZPA 5EZYE 3PUAA 1FMVA 4UVAB 3ZMVB 2Q9QA 5EK4A 5LNKA 4MBQA 3ESLA 2YINA 5C8YE 3RC8A 1HG5A 1US7B 3PURA 3I1AA 1ZV4X 3NZQA 5M4YA 5LJNA 4TX5A 2D5UA 3BQLA 2CEAA 2WBLA 1Y64B 4PNIA 3LK3B 3PUSA 4HKAA 4ASKA 2X9WA 4YJ2E 2XASB 3E0ZA 4G2AA 4UV8B 3V5SA 2UXNB 4IHJE 4GOUA 5F8PA 3UULA 2P9BA 4I43B 3UUMA 1G73A 2W62A 2N9DA 3DP7A 2NOXA 4AKHA 3N9PA 3KINB 2X68A 3PU3A 1SA0E 3EDVA 2X9XA 1IAPA 4ZI2D 1E1HB 2L9QA 4E7SA 3ZEFB 5HXHA 1WYBA 5LGTB 4AI6A 2Y8DA 3J7Yq 5FXVA 4UIGA 2NW7A 3ZN1B 4ISSA 3RRWA 4AKRB 2E9XD 3GN5A 4WBNE 4YJ3E 4PJLA 3CQGB 2WSSV 5JR9A 2ZM2A 4K0UA 4WBOA 4C91A 1OXZA 4ADZA 2V26A 5LGNB 4O4JE 3C98B 4IGUA 2DI4A 5FY1A 3SOLA 2CMRA 2KT9A 3QUJA 1NAFA 4G63A 2KWIB 1YW0A 3O1HA 4QXBB 2XHEB 2CE7A 3N9LA 2VKOA 2EHOC 3HKEE 5EK3A 3ZPOA 3F57A 3EUHA 3B57A 3LK2B 4N78D 5FXWA 2IC6A 4EYUA 4OHFA 3LG7A 4TZ4C 3AVRA 3P8CD 2G0UA 3O1IA 3I9YA 5J2UE 3ZC0A 3N9OA 5LJMA 3HR0A 5JREA 4HN9A 2KWHA 1BR4A 2LSGA 5LHGB 2N1GA 4A56A 2CWOA 4ZHQE 5L3BB 2V7KA 4YHJA 2LM9A 2Q9QC 1OWAA 4UXNB 3DJBA 2N2NA 1YKHB 3MZKB 1Z0PA 4CXWA 2LJLA 3ANWA 4GYRA 4U72A 1VOMA 4DBRA 2X9HA 4UV9B 2IAKA 3PUGA 5LXTE 3KVBA 4JUYA 4PK4A 3RYFE 3VU7H 2YU2A 5CA1E 3GWHA 4P0AA 3Q9DA 2BVLA 4FI5A 4ZS3A 3AAAB 3AA1B 5L3CB 5L2LA 3HI2A 3NRXA 4JEHB 3O1JA 2W0GA 1MIYA 2GK9A 4X1IE 5DABA 3CPZA 4YFSA 4KUMB 4OFZA 1MMAA 4P09A 2MOZA 3IHRA 4PJJA 4TN7B 5H6QB 5HXRA 3F31A 3N9MA 3TKLB 3AAIA 3O4XE 3ZC1A 4O2BE 4DMVA 3AA6B 3SWHA 5JR9C 2VASA 2NP9A 1D1AA 2I59A 3KV4A 2K48A 2QA7A 1UX5A 2XAJB 3VKHA 2KMFA 2ACXA 4WNKA 4L0RA 5JDMA 3KFWX 3KV6A 3M65A 2VKJA 2DLRA 5HWXA 4KMCA 4PFPA 4OK0A 2LT3A 2ZMAA 3BQIA 1QUUA 5IHYA 2LSKA 3WAJA 1HFAA 2K5BB 4ZI3C 3MACA 1IJ5A 4ZS2A 1AJ3A 3WAKA 4MALA 2MYSA 3OYXA 2CLYC 4AQFA 2WWUA 2MTQA 5KX5E 4HE8A 5JDFA 5EK2A 2CXLA 3OKQA 3UT5E 3S4UA 5FY0A 2Y48B 3P7IA 1EZ3A 4GYSA 4HTEA 4ILUA 4KBMB 5DQVA 2KXPB 3UUXB 3C4ZA 5A1LA 3N9QA 2J1DG 2YU1A 3C4WA 2LEHA 3N9NA 4X1YE 3MK7C 2A2FX 4UF0A 3LK42 3RH3A 3ZYKA 3KV5A 3C4XA 3D0TA 3RRCA 1ZKEA 4H9OC 3ZYLA 4PK6A 4CI3B 2EHOD 2JPFA 5ETWA 2XAHB 2E9XB 2XQYA 3GMIA 5FMNA 3I0OA 2M67A 3CQXC 2ES0A 3MA9A 1HF8A 5LOVE 1HS7A 4CZZB 5L3GB 2KNDA 5FXXA 5LGUB 3PUQA 3N2KE 2RA1A 3QC9A 3ZMUB 2PFVA 2JQQA 3E08A 2VKHA 1FEWA 4AKIA 2DWKA 1FIOA 5LA6E 2Q9QD 3FHNA 2CWYA 1HTJF 2VWAA 3H3AA 3MJXA 3ZCJA 2ODVA 3FBZA 2C5IT 2PG8A 1MMNA 4H63H 4IE4A 5JVDE 3W15B 1BR0A 2CXDA 2DWGA 2YK0A 3VHLA 1WR6A 1IZNB 5FYMA 4BA9A 3F2EA 3CKDA 3SS1A 4CQIA 3I0QA 1MIWA 2HPLA 2VL8A 4AQFC 1HX8A 2SPCA 4H63V 3AA7B 2IC9A 4QHOA 4DVDA 4U74A 3PE0A 1UCUA 5CA0E 1LKXA 1WRDA 5LYJE 5DQWA 2ZM0A 3K8PC 3JC6C 4L9IA 2KZ7B 1D1BA 4MFRA 1KNZA 4GK5E 2NTYA 3ETUA 3ZMTB 5HXSA 2KINB 3HA4A 4O8SA 2HPJA 2V1DB 3R6NA 1IJ6A 1LRZA 3KBTA 5JRCA 1FMWA 2BDEA 4BAYB 5HAXA 4ZOLE 3CX7B 4ANJA 3K3QC 5JR9B 3RYHE 2CA5A 4HGAA 3MXZA 4O4IE 4IE6A 2LOPA 3U78A 2LE8A 4EZHA 5HYAA 2K24A 4O4LE 3L09A 3OJAA 3AA0B 5JDQA 4TV9E 3LJCA 2L3LA 5LHHB 4PJMA 3UTKA 4TV8E 4DNDA 5DJQC 1ZHCA 4ZI3D 5F3JA 2CM0A 4MHCA 1VRBA 1D1CA 3J9X1 4CXXA 4E7ZA 2DCFA 3AB3B 3OBVE 3R84B 3CMLA 3VKGA 2XTLA 3QK6A 3NBXX 3OYZA 2W61A 4CI1B 3LFMA 1B7TA 2XAFB 5J2TE 2B1EA 2E9XA 4UEMA 4P0BA 3AVSA 1MMDA 2QGSA 5J1GA 5LHIB 4IE0A 1NWMX 3GA8A 1D0YA 5KDMC 2NW8A 5JDHA 4DBQA 4QXCB 3SRZA 2X66A 2BZBA 4FJOA 3CQCB 3ZMSB 4C90A 3ZN0B 2WM9A 4L5GA 4I55E 4GK0E 3CWZB 1QSDA 4HEAA 3HL6A 5L3EB 1O3XA 1HCIA 4F6RC 1WLXA 2WAUA 4V1Av 4CXYA 3U3IA 2DNXA 2NWBA 4HFVA 5L3FB 3BK9A 3FBLA 5LCYA 1LVFA 3C64A 4DO0A 4H9NC 2CCQA 2DHRA 3AAEB 4OYJA 3ZMZB 3PDYA 1YD8G 2KLQA 2Y6XA 5HXEA 4AQGA 2K9AA 2MBGA 4O4HE 5FP3A 1MNDA 5IYZE 5LG4A 2VK9A 5ADXL 2A72A 3N2OA 3V5UA 2X51A 2EHOB 3H37A 3KDSE 3CX8B 3IBPA 1SHZC 2RP4A 4B6XA 4GIWA 4EAHA 2D2SA 4EIWA 4O2AE 3KBUA 4EZ4A 3ZYMA 5JDLA 4BJNA 3LBXB 2ZLYA 4EOZB 4PFOA 3I9WA 3T8OA 3FXEB 1D0ZA 3MKDA 2JRKA 1H7CA 3Q2MA 2Z6EA 3EVYA 3IF8B 2V7IA 4X20E 2V7JA 1YKEB 3ZCIA 5KMGP 2D0TA 5LP6E 1G8XA 2X9YA 4NUUA 4TUYE 2LSIA 2PBIA 4PK5A 5AFUL 4QXHB 2LHRA 2Q9QB 2LSJA 4ISTA 3CX6B 4IE5A 5FY7A 2WMOA 4ZI2C 2ZM8A 3Q5WA 2H7OA 2NTXA 2ODUA 3JC6D 5L3DB 1D0XA 3HKDE 1WYCA 2A3DA 2BVMA 3A5XA 4CI2B 3ZJ1A 2C5JA 5BMVE 2E9XC 2V7MA 2XAGB 4PAGA 2W00A 4BJMA 3RX6A 2L8KA 2LOSA 5FNVE 3HKBE 1S35A 1CUNA 3ETVA 3UUNA 4ERRA 2VKDA 1U5PA 2H3RA 1ZEEA 4PJNA 3BQKA 2LSYA 2HH7A 3NRYA 3K3NA 5JDGA 2D0UA 4M1PA 1MNEA 4UF0B 4NUVA 4JLEA 1BR2A 4X1KE 5CB4E 3PTRB 3DTOA 2JJ9A 5JDNA 3RYCE 4AKLA 4H9QC 4I50E 5H6RB 4QWNB 3WI3A 2JMKA 3N5LA 1T98A 3PU8A 2X0LB 2PJQA 3GN5B 3RPUA 4EXTA 4QX8B 5JH7E 4DMWA 2NW9A 3N2GE 4IIJE 3ZJ2A 1MIVA 1BR1A 4Z8XA 4H9PC 5JQGE 1HG2A 4IE7A 2UXXB 3FB2A 5HXCA 1UX4A 2E8IA 4JEUB 4WW0A 4UELA 3E22E 3L3PA 3ZLIA 2XUEA 4OYKA 4QKNA 3O9XA 2OA5A 3KVAA 3B13A 2LHNA 5E0OA 1V9DA 2YEVC 1MMGA 4XAXB 5LBMA 4IDZA 3CVRA 2XAQB 1KK7A 4H9RC 4UVBB 4XZCA 2C0SA 2W63A 2IW5B 3Q5XA 2WMNA 4YLHA 2JMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLY C;  2WSS V; 
#chains in the Genus database with same CATH topology
 3UU4 A;  4KP3 C;  5AQK B;  2V7L A;  2W2U A;  4XBF B;  2EHO A;  4U33 A;  4MLK A;  3RC3 A;  3ANW B;  5TAO A;  1S94 A;  5HWY A;  4ZI7 E;  5JRC B;  1FMV A;  3ZMV B;  2Q9Q A;  5LNK A;  3RC8 A;  3ESL A;  3UU8 A;  5M4Y A;  5LJN A;  3RGL A;  3BQL A;  2XQ8 A;  2WBL A;  1IBM T;  5IWA T;  2X0H A;  3PUS A;  4YJ2 E;  2X9W A;  2UXN B;  4I43 B;  3UUM A;  3DP7 A;  4AKH A;  4ZI2 D;  4EGW A;  5LGT B;  4AI6 A;  4AKR B;  4YJ3 E;  4PJL A;  3CQG B;  2WSS V;  5JR9 A;  4K0U A;  5LGN B;  4O4J E;  2DI4 A;  3SOL A;  5AQL B;  2VQE T;  3O1H A;  4Z91 A;  2EHO C;  4NPP A;  4TNW A;  3B57 A;  3LK2 B;  3UQ4 A;  4EYU A;  2CHO A;  5J2U E;  3I9Y A;  5LJM A;  5JRE A;  3QB5 K;  4ZHQ E;  5L3B B;  1Y01 A;  3AEA A;  2Q9Q C;  4UXN B;  1YKH B;  2E5V A;  3PUG A;  4K0K T;  4X64 T;  3AE1 A;  4P0A A;  4JEH B;  2FJD A;  2XQA A;  3TLW A;  3CPZ A;  1MMA A;  4PJJ A;  2XSB A;  3EAB A;  3N9M A;  3O4X E;  4DMV A;  3AA6 B;  5JR9 C;  3UU5 A;  4NXM T;  4WNK A;  2UXC T;  3Q5E A;  3JAE A;  3M65 A;  2DLR A;  4KMC A;  4DID B;  1QUU A;  5IHY A;  3WAJ A;  1AJ3 A;  1UK5 A;  2MYS A;  4AQF A;  1NEN A;  3FZH B;  5KX5 E;  4ILU A;  5HEJ A;  1WFD A;  2J1D G;  2YU1 A;  3C4W A;  4HFD A;  3MK7 C;  4UF0 A;  4GKK T;  3KV5 A;  4EED A;  2XM1 A;  4U31 A;  3D0T A;  2J47 A;  4EEB A;  2JPF A;  5ETW A;  2XQY A;  3I0O A;  2M67 A;  3CQX C;  2ES0 A;  3MA9 A;  5LOV E;  2MAW A;  1HS7 A;  4CZZ B;  2KND A;  5FXX A;  3PUQ A;  2RA1 A;  2CBJ A;  3NKZ A;  3QC9 A;  3ZMU B;  5FL1 A;  2HHH T;  3ZKR A;  2VKH A;  2LKG A;  1FEW A;  4KHP T;  3AXJ A;  3UU3 A;  2VWA A;  3MJX A;  2ODV A;  5ABG A;  4IE4 A;  4A98 A;  1IZN B;  4DV7 T;  5FYM A;  3SS1 A;  2H89 A;  1YQ4 A;  3I0Q A;  4AQF C;  3OPC A;  4A5X A;  4DVD A;  4QHO A;  4U74 A;  5LYJ E;  4F8H A;  3K8P C;  1M7K A;  2NTY A;  3ETU A;  2E5L T;  5HXS A;  4WYV A;  4O8S A;  2HPJ A;  2V1D B;  5JRC A;  2CRB A;  3H3M A;  1IBK T;  1YQ3 A;  4EZH A;  4O4L E;  3EAM A;  2DL1 A;  5JDQ A;  3P4W A;  2V6X A;  4TV8 E;  5DJQ C;  2CM0 A;  3J9X 1;  4HWD A;  2DCF A;  3AB3 B;  2V6Y B;  2XTL A;  3M3Z B;  4CI1 B;  3LFM A;  4X5T A;  4JBW F;  2CHN A;  4P1N A;  1UUR A;  3T1Y T;  2WU2 A;  4LF7 T;  3ZT6 A;  4QXC B;  3ZN0 B;  3RKG A;  3CWZ B;  2OLT A;  1HR0 T;  2BKP A;  3AE3 A;  5AQS B;  1X9B A;  4TWF A;  3A7M A;  2KLQ A;  5HXE A;  2K9A A;  5FP3 A;  1GQE A;  5IYZ E;  3V5U A;  2E2A A;  2EHO B;  3KDS E;  1Z8U A;  1SHZ C;  2D2S A;  4EIW A;  4EZ4 A;  3PUV F;  2ZLY A;  4EOZ B;  4PFO A;  3EVY A;  2HN1 A;  5LP6 E;  4LF4 T;  4ZZC A;  4LF5 T;  2UU9 T;  2PBI A;  2Q9Q B;  5FY7 A;  2M6B A;  3Q5W A;  2LM2 A;  3JC6 D;  2JQK A;  1YXR A;  2V7M A;  2W00 A;  4BJM A;  4U7Y A;  4IDQ A;  3JAF A;  2H3R A;  4PJN A;  3NRY A;  4ILA A;  4NUV A;  4JLE A;  3P4Q A;  2JJ9 A;  3UU6 A;  3AEF A;  5JDN A;  4U7I A;  4AKL A;  4H9Q C;  4QWN B;  4HFH A;  1T98 A;  5HEU A;  4EXT A;  3RPU A;  5JH7 E;  2NW9 A;  1BR1 A;  2I0M A;  4DV5 T;  3ZLI A;  3VRB A;  2OA5 A;  1KNP A;  3B13 A;  5E0O A;  2YEV C;  4B3M T;  4IDZ A;  4XZC A;  4YHH T;  4AKI A;  2JMH A;  1LVK A;  2D9D A;  4EYY R;  3IEE A;  4U3C A;  2VB6 A;  4DUZ T;  3FXD B;  3ABV A;  4I4T E;  2XSA A;  4YTM A;  2IUB A;  2NR4 A;  3K3O A;  5FXZ A;  4WZX A;  3LBX A;  3KV9 A;  3C50 A;  3RKO A;  5LBQ B;  4DV6 T;  4IDP A;  5EK4 A;  5KXJ A;  2YIN A;  1HG5 A;  1US7 B;  4Q25 A;  2D5U A;  4ASK A;  3E0Z A;  4G2A A;  4IHJ E;  4B3T T;  4IRE A;  3UUL A;  1G73 A;  2NOX A;  5HCJ A;  3N9P A;  1KF6 A;  2X68 A;  2L9Q A;  5HXH A;  1WYB A;  2WP9 A;  2Y8D A;  3PJA A;  5AQO B;  3RRW A;  2E9X D;  3C98 B;  4DV1 T;  2KWI B;  2CE7 A;  4HWC A;  3N9L A;  2VKO A;  3HKE E;  5EK3 A;  4N78 D;  2IC6 A;  1J5W A;  2XQ3 A;  4OHF A;  1XNQ T;  4TZ4 C;  5AQP B;  3AVR A;  2VVN A;  2G0U A;  3O1I A;  3PV0 F;  3N9O A;  2KWH A;  4KHZ F;  4COF A;  2LLY A;  4JI6 T;  2BBH A;  2LJL A;  4A97 A;  2X9H A;  4UV9 B;  5CA1 E;  4QH1 A;  4FI5 A;  3AAA B;  3AA1 B;  5L3C B;  3HI2 A;  3NRX A;  5J0Z A;  1MIY A;  3AXJ B;  4YFS A;  4KUM B;  4OFZ A;  1ZOY A;  3IHR A;  5FL0 A;  5HEH A;  3ONJ A;  1D1A A;  2I59 A;  3PUX F;  1UX5 A;  2WZH A;  3VKH A;  2KMF A;  4ZEY A;  2CPT A;  4PFP A;  3BQI A;  4DV4 T;  3PUY F;  1M62 A;  1DU2 A;  3MAC A;  1IJ5 A;  3WAK A;  3UQ7 A;  3SFD A;  2WCA A;  1HNZ T;  4B3S T;  2WWU A;  4HE8 A;  4HWF A;  3UT5 E;  3S4U A;  5LMU T;  3PUZ F;  3SFE A;  2LEH A;  3N9N A;  2A2F X;  3AEB A;  3L8R A;  4X66 T;  1I94 T;  4DR3 T;  2XAH B;  3AE5 A;  4YXD A;  3GMI A;  5FMN A;  5L3G B;  5LGU B;  4YSZ A;  2JQQ A;  1FIO A;  3FHN A;  3H3A A;  2C5I T;  3PJA J;  1MMN A;  2VUR A;  5JVD E;  3VHL A;  1NEK A;  3F2E A;  4CQI A;  1MIW A;  2VL8 A;  3AA7 B;  2QVA A;  2JIW A;  2ZM0 A;  1D1B A;  1KNZ A;  5LMN T;  3HA4 A;  3T1H T;  1XMQ T;  1FMW A;  5HAX A;  1QLB A;  3K3Q C;  2W67 A;  2YDQ A;  4HGA A;  4IE6 A;  4CN1 A;  3U78 A;  5CGM A;  5AQG B;  5HYA A;  2K24 A;  5AQR B;  1E7P A;  2V8S V;  3LJC A;  3AEE A;  4PJM A;  3AED A;  1ZHC A;  4ZI3 D;  4MHC A;  1D1C A;  4CXX A;  3OBV E;  3R84 B;  3QK6 A;  5FVK A;  3NBX X;  2W61 A;  5J2T E;  3ZST A;  4DV3 T;  4UEM A;  1MMD A;  2XY8 B;  1E2A A;  4IE0 A;  3GA8 A;  2NW8 A;  2MPK A;  4DBQ A;  3SRZ A;  3CQC B;  4C90 A;  2BS4 A;  5LB7 B;  1XZY A;  4GK0 E;  4JYA T;  1QSD A;  3HL6 A;  5L3E B;  2XQ6 A;  1O3X A;  1HCI A;  3UFG A;  4CXY A;  4V1A v;  2XQ4 A;  2NWB A;  1OED E;  3BK9 A;  5LCY A;  2YDS A;  2CCQ A;  2DHR A;  3AAE B;  3ZMZ B;  1YD8 G;  4AQG A;  2X51 A;  3PUW F;  3IBP A;  4TWH A;  2RP4 A;  4B6X A;  4EAH A;  1HNW T;  4O2A E;  4BJN A;  3LBX B;  3FXE B;  4LFA T;  3MKD A;  5HEG A;  4ZZB A;  1YKE B;  4OX9 T;  5KMG P;  4NUU A;  4IL9 A;  3P4R A;  2BG9 C;  2LSJ A;  3L39 A;  4ILC A;  1HNX T;  4IE5 A;  4GKJ T;  2WMO A;  4ZI2 C;  1W0B A;  2HN2 A;  2NTX A;  2ODU A;  5L3D B;  1WYC A;  4CI2 B;  3CIR A;  2C5J A;  5BMV E;  4IDN A;  4PAG A;  3RX6 A;  2LOS A;  3HKB E;  3ETV A;  1U5P A;  1ZEE A;  1T72 A;  2LSY A;  2RPA A;  5JDG A;  2D0U A;  5CB4 E;  2UUA T;  3RYC E;  1W0A A;  2JMK A;  3QOF A;  2PJQ A;  4QX8 B;  4DMW A;  3N2G E;  4IIJ E;  3ZJ2 A;  1MIV A;  3RQU A;  4H9P C;  1HG2 A;  3FB2 A;  1WR0 A;  5AQJ B;  3E22 E;  4JI0 T;  3OTO T;  3KVA A;  2LHN A;  1T8B A;  5LBM A;  4UVB B;  1KK7 A;  2W63 A;  3OVU A;  2WMN A;  5LG3 A;  2C5K T;  2XQ7 A;  3C51 A;  3UUB A;  1VCS A;  2FUP A;  1U4Q A;  4EB6 E;  3UFE A;  4AKG A;  3AE9 A;  2BG9 E;  2IIU A;  4H9S E;  2X67 A;  1IBL T;  3A8Y C;  4QX7 B;  3EDU A;  3RYI E;  2H7V C;  4UVC B;  4DR7 T;  5GON E;  4LML A;  2VL0 A;  3PUA A;  3AEC A;  4UVA B;  4MBQ A;  5C8Y E;  4QH4 A;  3I1A A;  1ZV4 X;  4TX5 A;  4LMJ A;  2CEA A;  2JQH A;  3FZF B;  3LK3 B;  4HKA A;  4B3R T;  5ABF A;  2UUC T;  2N9D A;  3PU3 A;  3EDV A;  2X9X A;  1IAP A;  2OV9 A;  3J7Y q;  5FXV A;  3NVO A;  4ISS A;  4JI3 T;  3GN5 A;  1KNR A;  4C91 A;  4LMK A;  4LF8 T;  4ADZ A;  4IGU A;  5FY1 A;  5AQQ B;  3QUJ A;  1NAF A;  1W9R A;  4DR5 T;  4QXB B;  2XHE B;  3ZPO A;  3EUH A;  3P4P A;  2YOE A;  1JNZ A;  4ILB A;  3LG7 A;  3ZC0 A;  4HN9 A;  4LF6 T;  2LSG A;  3AE7 A;  2N1G A;  2CWO A;  2V7K A;  2LM9 A;  2WDV A;  4JV5 T;  2N2N A;  3MZK B;  4U72 A;  4DBR A;  1VOM A;  5LXT E;  2WU5 A;  3RYF E;  3VU7 H;  2YU2 A;  3GWH A;  3Q9D A;  4ZS3 A;  4Z90 A;  5L2L A;  3TLS A;  5DAB A;  4TN7 B;  5HXR A;  3AAI A;  3SWH A;  1SE7 A;  2VAS A;  2FJE A;  4UR9 A;  2NP9 A;  1R8I A;  3P4S A;  2QA7 A;  2ACX A;  2BBJ A;  4I0U A;  5BR8 T;  3KFW X;  1XNR T;  2WDQ A;  2VKJ A;  5HWX A;  4OK0 A;  4JI2 T;  2LSK A;  2K5B B;  4YY3 T;  5HEO A;  4ZS2 A;  2WDR A;  3OYX A;  2CLY C;  4AIU A;  2MTQ A;  2UXB T;  5JDF A;  2CXL A;  3OKQ A;  3P7I A;  2WWV A;  3RIF A;  4HTE A;  4KBM B;  5DQV A;  1WCR A;  5A1L A;  5AQI B;  3RHW A;  4X1Y E;  4YTP A;  3LK4 2;  3ZYK A;  2B76 A;  1XMO T;  2BG9 B;  3FZK B;  3C4X A;  3RRC A;  1ZKE A;  4H9O C;  3ZYL A;  4CI3 B;  2EHO D;  2YDR A;  1HF8 A;  3AEG A;  3VR9 A;  4YSY A;  3E08 A;  4IDO A;  2Q9Q D;  1T7S A;  3G06 A;  2WY2 A;  3ZCJ A;  3FBZ A;  2PG8 A;  4KI0 F;  2UUB T;  1BR0 A;  3IA3 A;  2CXD A;  2DWG A;  4BA9 A;  4HWH A;  2WB5 A;  2HPL A;  4CN4 A;  2IHR 1;  1HX8 A;  2SPC A;  4H63 V;  2IC9 A;  1UCU A;  5CA0 E;  1LKX A;  1WRD A;  3JC6 C;  4L9I A;  2KZ7 B;  4MFR A;  1J1J A;  5AQM B;  4GK5 E;  3RIU A;  3R6N A;  2XQ5 A;  2VQF T;  4BAY B;  2BDE A;  3RYH E;  2YKS A;  4O4I E;  2I6H A;  3L09 A;  3OJA A;  4TWD A;  3AA0 B;  5LHH B;  3UTK A;  5AQH B;  3FZL B;  2LRK A;  4YTN A;  3VKG A;  3OYZ A;  5AQT B;  2IML A;  2XAF B;  1L0V A;  2B1E A;  2E9X A;  5AQN B;  2A9U A;  2QGS A;  5J1G A;  5JDH A;  2V5C A;  2BZB A;  3ZMS B;  5AQU B;  1OED A;  2WM9 A;  3CK6 A;  3ONL C;  3TLV A;  1XWM A;  4F6R C;  3RIU C;  3K1S A;  4IT4 A;  2DNX A;  1KEY A;  1LVF A;  3C64 A;  4OYJ A;  4IL4 A;  2Y6X A;  2BKO A;  1MND A;  2VK9 A;  3N2O A;  3H37 A;  3CX8 B;  4GIW A;  3KBU A;  3ZYM A;  1VCT A;  3TLT A;  1H7C A;  4X20 E;  2V7J A;  3ZCI A;  4TUY E;  4PK5 A;  4QXH B;  3LDQ B;  2BS3 A;  3CX6 B;  3JCF A;  1UGO A;  2ZM8 A;  2WZI A;  2A3D A;  2BVM A;  1N33 T;  5FKY A;  2E9X C;  1ZP0 A;  2XAG B;  3TLU A;  2L8K A;  4JI4 T;  1CUN A;  5ABF B;  3UUN A;  2VKD A;  2V5D A;  2HH7 A;  1BR2 A;  4X1K E;  1OED C;  4QH5 A;  4YT0 A;  1XDP A;  3AE6 A;  5H6R B;  3WI3 A;  3N5L A;  3GN5 B;  4Z8X A;  2FJB A;  3LSV A;  3AE2 A;  1UX4 A;  4JEU B;  5ABE A;  4AQY T;  2QRX A;  3O9X A;  3VR8 A;  4U2Z A;  2XQ9 A;  2BG9 A;  3Q5X A;  5L47 A;  4YLH A;  2XUE A;  2CLY B;  2YN6 A;  2VVS A;  2CXF A;  1N32 T;  4J2C A;  2ACZ A;  4AXP A;  2FBW A;  1SUM B;  3ONX A;  4DR4 T;  1X79 A;  3HKC E;  2W66 A;  4X65 T;  4PW8 A;  3NZP A;  5EZY E;  4JI8 T;  3PUR A;  3NZQ A;  1Y64 B;  4PNI A;  2WS3 A;  2XAS B;  4UV8 B;  3V5S A;  3FZM B;  4GOU A;  2W4X A;  5F8P A;  2P9B A;  1N34 T;  2W62 A;  1XDO A;  3ZT5 A;  3KIN B;  2AE9 A;  1SA0 E;  1KFY A;  1E1H B;  4E7S A;  3ZEF B;  1J5E T;  4UIG A;  2NW7 A;  3ZN1 B;  4WBN E;  4JI1 T;  2ZM2 A;  4WBO A;  1OXZ A;  2V26 A;  5C3J A;  2CMR A;  2KT9 A;  4G63 A;  1YW0 A;  5HCM A;  4U2Y A;  3QB5 A;  1I6Z A;  3F57 A;  2H88 A;  5FXW A;  4JI5 T;  3RLF F;  1W09 A;  3P8C D;  3HR0 A;  1BR4 A;  5LHG B;  4A56 A;  4YHJ A;  4NXN T;  2F4V T;  2JQ9 A;  1OWA A;  3DJB A;  1Z0P A;  5ABH A;  4CXW A;  1JNR A;  3ANW A;  4GYR A;  2K3W A;  2IAK A;  3KVB A;  4JUY A;  4PK4 A;  2BVL A;  2IDO B;  3O1J A;  2W0G A;  2GK9 A;  4X1I E;  4P09 A;  2MOZ A;  5H6Q B;  3F31 A;  3TKL B;  3ZC1 A;  4O2B E;  3KV4 A;  2K48 A;  2XAJ B;  4HFE A;  4NIQ A;  4L0R A;  5JDM A;  3KV6 A;  2LT3 A;  2ZMA A;  1HX1 B;  1HFA A;  2CBI A;  4ZI3 C;  3AE8 A;  4MAL A;  5EK2 A;  4DR2 T;  5FY0 A;  2Y48 B;  5AQF B;  1EZ3 A;  4GYS A;  2KXP B;  4DUY T;  3UUX B;  3C4Z A;  1FJG T;  4LFC T;  3N9Q A;  3RH3 A;  4HFC A;  4TNV A;  3VRA A;  3ZSS A;  3B5M A;  4PK6 A;  2E9X B;  2AXD S;  2UXD T;  3JAD A;  3N2K E;  4KX6 A;  2PFV A;  2QYW A;  2DWK A;  4LF9 T;  1OED B;  5LA6 E;  3EHZ A;  2CWY A;  2WQY A;  1HTJ F;  2LKH A;  2PTF A;  4DR1 T;  4H63 H;  3W15 B;  2YK0 A;  1WR6 A;  5CJ5 A;  2R6G F;  3CKD A;  3QNU A;  3RQW A;  3PE0 A;  4EV6 A;  3AE4 A;  5DQW A;  2M6I A;  3ZMT B;  2KIN B;  4DR6 T;  1IJ6 A;  1LRZ A;  3KBT A;  5L4H A;  4ZOL E;  3CX7 B;  4ANJ A;  5JR9 B;  2CA5 A;  5FVL A;  3RIA A;  3MXZ A;  2LOP A;  2LE8 A;  2FJA A;  4TV9 E;  2L3L A;  4DND A;  5F3J A;  2XZE A;  1VRB A;  4E7Z A;  3CML A;  2X0Y A;  3X1D A;  4JI7 T;  2ZM6 T;  3Q5D A;  1B7T A;  2BS2 A;  4P0B A;  1N36 T;  3AVS A;  5CFB A;  5LHI B;  1NWM X;  1D0Y A;  5KDM C;  2X66 A;  5F5W A;  4FJO A;  4L5G A;  4I55 E;  4HEA A;  5JTG A;  3RF1 A;  1WLX A;  2WAU A;  3ZT7 A;  3RI5 A;  3U3I A;  4HFV A;  5L3F B;  3FBL A;  4DO0 A;  4H9N C;  3PDY A;  2MBG A;  4LFB T;  4O4H E;  4CN6 A;  5LG4 A;  5ADX L;  2A72 A;  3EI0 A;  5JDL A;  3T8O A;  3I9W A;  1CHU A;  1D0Z A;  2JRK A;  3Q2M A;  2Z6E A;  3IF8 B;  2V7I A;  2KSR A;  2D0T A;  1G8X A;  2X9Y A;  2LSI A;  5AFU L;  4HWI B;  2LHR A;  4AIS A;  2J4G A;  4IST A;  2XPK A;  2H7O A;  1D0X A;  3HKD E;  3A5X A;  3ZJ1 A;  4DV2 T;  4DV0 T;  1UUS A;  5FNV E;  1S35 A;  4ERR A;  5C2T A;  4HFB A;  3BQK A;  3K3N A;  4M1P A;  1MNE A;  4UF0 B;  5L4E A;  2V6Y A;  3DTO A;  3PTR B;  4I50 E;  2BKN A;  2XM2 A;  3PU8 A;  2J62 A;  2LRL A;  2X0L B;  5AQV B;  2XJ7 A;  5JQG E;  4IE7 A;  2UXX B;  3NWI A;  5HXC A;  4YSX A;  2E8I A;  4WW0 A;  4UEL A;  3L3P A;  4HFI A;  5IUX A;  4OYK A;  4QKN A;  4X62 T;  4ZXL A;  1V9D A;  1MMG A;  4XAX B;  3CVR A;  2XAQ B;  4H9R C;  3P50 A;  2C0S A;  2IW5 B; 
#chains in the Genus database with same CATH homology
 2C5K T;  1LVK A;  2CLY B;  4EYY R;  3IEE A;  3C51 A;  2CXF A;  1U4Q A;  2VB6 A;  4KP3 C;  4EB6 E;  3UFE A;  4AKG A;  3FXD B;  2V7L A;  4I4T E;  4XBF B;  2EHO A;  4J2C A;  4AXP A;  4MLK A;  3K3O A;  4H9S E;  2X67 A;  5FXZ A;  3RC3 A;  3ANW B;  5TAO A;  3ONX A;  3LBX A;  3KV9 A;  1S94 A;  3C50 A;  3RKO A;  4QX7 B;  1X79 A;  3EDU A;  3RYI E;  3HKC E;  5HWY A;  5LBQ B;  2H7V C;  4UVC B;  5GON E;  4ZI7 E;  4PW8 A;  5JRC B;  3NZP A;  5EZY E;  3PUA A;  1FMV A;  4UVA B;  3ZMV B;  2Q9Q A;  5EK4 A;  5LNK A;  4MBQ A;  3ESL A;  2YIN A;  5C8Y E;  3RC8 A;  1HG5 A;  1US7 B;  3PUR A;  3I1A A;  1ZV4 X;  3NZQ A;  5M4Y A;  5LJN A;  4TX5 A;  2D5U A;  3BQL A;  2CEA A;  2WBL A;  1Y64 B;  4PNI A;  3LK3 B;  3PUS A;  4HKA A;  4ASK A;  2X9W A;  4YJ2 E;  2XAS B;  3E0Z A;  4G2A A;  4UV8 B;  3V5S A;  2UXN B;  4IHJ E;  4GOU A;  5F8P A;  3UUL A;  2P9B A;  4I43 B;  3UUM A;  1G73 A;  2W62 A;  2N9D A;  3DP7 A;  2NOX A;  4AKH A;  3N9P A;  3KIN B;  2X68 A;  3PU3 A;  1SA0 E;  3EDV A;  2X9X A;  1IAP A;  4ZI2 D;  1E1H B;  2L9Q A;  4E7S A;  3ZEF B;  5HXH A;  1WYB A;  5LGT B;  4AI6 A;  2Y8D A;  3J7Y q;  5FXV A;  4UIG A;  2NW7 A;  3ZN1 B;  4ISS A;  3RRW A;  4AKR B;  2E9X D;  3GN5 A;  4WBN E;  4YJ3 E;  4PJL A;  3CQG B;  2WSS V;  5JR9 A;  2ZM2 A;  4K0U A;  4WBO A;  4C91 A;  1OXZ A;  4ADZ A;  2V26 A;  5LGN B;  4O4J E;  3C98 B;  4IGU A;  2DI4 A;  5FY1 A;  3SOL A;  2CMR A;  2KT9 A;  3QUJ A;  1NAF A;  4G63 A;  2KWI B;  1YW0 A;  3O1H A;  4QXB B;  2XHE B;  2CE7 A;  3N9L A;  2VKO A;  2EHO C;  3HKE E;  5EK3 A;  3ZPO A;  3F57 A;  3EUH A;  3B57 A;  3LK2 B;  4N78 D;  5FXW A;  2IC6 A;  4EYU A;  4OHF A;  3LG7 A;  4TZ4 C;  3AVR A;  3P8C D;  2G0U A;  3O1I A;  3I9Y A;  5J2U E;  3ZC0 A;  3N9O A;  5LJM A;  3HR0 A;  5JRE A;  4HN9 A;  2KWH A;  1BR4 A;  2LSG A;  5LHG B;  2N1G A;  4A56 A;  2CWO A;  4ZHQ E;  5L3B B;  2V7K A;  4YHJ A;  2LM9 A;  2Q9Q C;  1OWA A;  4UXN B;  3DJB A;  2N2N A;  1YKH B;  3MZK B;  1Z0P A;  4CXW A;  2LJL A;  3ANW A;  4GYR A;  4U72 A;  1VOM A;  4DBR A;  2X9H A;  4UV9 B;  2IAK A;  3PUG A;  5LXT E;  3KVB A;  4JUY A;  4PK4 A;  3RYF E;  3VU7 H;  2YU2 A;  5CA1 E;  3GWH A;  4P0A A;  3Q9D A;  2BVL A;  4FI5 A;  4ZS3 A;  3AAA B;  3AA1 B;  5L3C B;  5L2L A;  3HI2 A;  3NRX A;  4JEH B;  3O1J A;  2W0G A;  1MIY A;  2GK9 A;  4X1I E;  5DAB A;  3CPZ A;  4YFS A;  4KUM B;  4OFZ A;  1MMA A;  4P09 A;  2MOZ A;  3IHR A;  4PJJ A;  4TN7 B;  5H6Q B;  5HXR A;  3F31 A;  3N9M A;  3TKL B;  3AAI A;  3O4X E;  3ZC1 A;  4O2B E;  4DMV A;  3AA6 B;  3SWH A;  5JR9 C;  2VAS A;  2NP9 A;  1D1A A;  2I59 A;  3KV4 A;  2K48 A;  2QA7 A;  1UX5 A;  2XAJ B;  3VKH A;  2KMF A;  2ACX A;  4WNK A;  4L0R A;  5JDM A;  3KFW X;  3KV6 A;  3M65 A;  2VKJ A;  2DLR A;  5HWX A;  4KMC A;  4PFP A;  4OK0 A;  2LT3 A;  2ZMA A;  3BQI A;  1QUU A;  5IHY A;  2LSK A;  3WAJ A;  1HFA A;  2K5B B;  4ZI3 C;  3MAC A;  1IJ5 A;  4ZS2 A;  1AJ3 A;  3WAK A;  4MAL A;  2MYS A;  3OYX A;  2CLY C;  4AQF A;  2WWU A;  2MTQ A;  5KX5 E;  4HE8 A;  5JDF A;  5EK2 A;  2CXL A;  3OKQ A;  3UT5 E;  3S4U A;  5FY0 A;  2Y48 B;  3P7I A;  1EZ3 A;  4GYS A;  4HTE A;  4ILU A;  4KBM B;  5DQV A;  2KXP B;  3UUX B;  3C4Z A;  5A1L A;  3N9Q A;  2J1D G;  2YU1 A;  3C4W A;  2LEH A;  3N9N A;  4X1Y E;  3MK7 C;  2A2F X;  4UF0 A;  3LK4 2;  3RH3 A;  3ZYK A;  3KV5 A;  3C4X A;  3D0T A;  3RRC A;  1ZKE A;  4H9O C;  3ZYL A;  4PK6 A;  4CI3 B;  2EHO D;  2JPF A;  5ETW A;  2XAH B;  2E9X B;  2XQY A;  3GMI A;  5FMN A;  3I0O A;  2M67 A;  3CQX C;  2ES0 A;  3MA9 A;  1HF8 A;  5LOV E;  1HS7 A;  4CZZ B;  5L3G B;  2KND A;  5FXX A;  5LGU B;  3PUQ A;  3N2K E;  2RA1 A;  3QC9 A;  3ZMU B;  2PFV A;  2JQQ A;  3E08 A;  2VKH A;  1FEW A;  4AKI A;  2DWK A;  1FIO A;  5LA6 E;  2Q9Q D;  3FHN A;  2CWY A;  1HTJ F;  2VWA A;  3H3A A;  3MJX A;  3ZCJ A;  2ODV A;  3FBZ A;  2C5I T;  2PG8 A;  1MMN A;  4H63 H;  4IE4 A;  5JVD E;  3W15 B;  1BR0 A;  2CXD A;  2DWG A;  2YK0 A;  3VHL A;  1WR6 A;  1IZN B;  5FYM A;  4BA9 A;  3F2E A;  3CKD A;  3SS1 A;  4CQI A;  3I0Q A;  1MIW A;  2HPL A;  2VL8 A;  4AQF C;  1HX8 A;  2SPC A;  4H63 V;  3AA7 B;  2IC9 A;  4QHO A;  4DVD A;  4U74 A;  3PE0 A;  1UCU A;  5CA0 E;  1LKX A;  1WRD A;  5LYJ E;  5DQW A;  2ZM0 A;  3K8P C;  3JC6 C;  4L9I A;  2KZ7 B;  1D1B A;  4MFR A;  1KNZ A;  4GK5 E;  2NTY A;  3ETU A;  3ZMT B;  5HXS A;  2KIN B;  3HA4 A;  4O8S A;  2HPJ A;  2V1D B;  3R6N A;  1IJ6 A;  1LRZ A;  3KBT A;  5JRC A;  1FMW A;  2BDE A;  4BAY B;  5HAX A;  4ZOL E;  3CX7 B;  4ANJ A;  3K3Q C;  5JR9 B;  3RYH E;  2CA5 A;  4HGA A;  3MXZ A;  4O4I E;  4IE6 A;  2LOP A;  3U78 A;  2LE8 A;  4EZH A;  5HYA A;  2K24 A;  4O4L E;  3L09 A;  3OJA A;  3AA0 B;  5JDQ A;  4TV9 E;  3LJC A;  2L3L A;  5LHH B;  4PJM A;  3UTK A;  4TV8 E;  4DND A;  5DJQ C;  1ZHC A;  4ZI3 D;  5F3J A;  2CM0 A;  4MHC A;  1VRB A;  1D1C A;  3J9X 1;  4CXX A;  4E7Z A;  2DCF A;  3AB3 B;  3OBV E;  3R84 B;  3CML A;  3VKG A;  2XTL A;  3QK6 A;  3NBX X;  3OYZ A;  2W61 A;  4CI1 B;  3LFM A;  1B7T A;  2XAF B;  5J2T E;  2B1E A;  2E9X A;  4UEM A;  4P0B A;  3AVS A;  1MMD A;  2QGS A;  5J1G A;  5LHI B;  4IE0 A;  1NWM X;  3GA8 A;  1D0Y A;  5KDM C;  2NW8 A;  5JDH A;  4DBQ A;  4QXC B;  3SRZ A;  2X66 A;  2BZB A;  4FJO A;  3CQC B;  3ZMS B;  4C90 A;  3ZN0 B;  2WM9 A;  4L5G A;  4I55 E;  4GK0 E;  3CWZ B;  1QSD A;  4HEA A;  3HL6 A;  5L3E B;  1O3X A;  1HCI A;  4F6R C;  1WLX A;  2WAU A;  4V1A v;  4CXY A;  3U3I A;  2DNX A;  2NWB A;  4HFV A;  5L3F B;  3BK9 A;  3FBL A;  5LCY A;  1LVF A;  3C64 A;  4DO0 A;  4H9N C;  2CCQ A;  2DHR A;  3AAE B;  4OYJ A;  3ZMZ B;  3PDY A;  1YD8 G;  2KLQ A;  2Y6X A;  5HXE A;  4AQG A;  2K9A A;  2MBG A;  4O4H E;  5FP3 A;  1MND A;  5IYZ E;  5LG4 A;  2VK9 A;  5ADX L;  2A72 A;  3N2O A;  3V5U A;  2X51 A;  2EHO B;  3H37 A;  3KDS E;  3CX8 B;  3IBP A;  1SHZ C;  2RP4 A;  4B6X A;  4GIW A;  4EAH A;  2D2S A;  4EIW A;  4O2A E;  3KBU A;  4EZ4 A;  3ZYM A;  5JDL A;  4BJN A;  3LBX B;  2ZLY A;  4EOZ B;  4PFO A;  3I9W A;  3T8O A;  3FXE B;  1D0Z A;  3MKD A;  2JRK A;  1H7C A;  3Q2M A;  2Z6E A;  3EVY A;  3IF8 B;  2V7I A;  4X20 E;  2V7J A;  1YKE B;  3ZCI A;  5KMG P;  2D0T A;  5LP6 E;  1G8X A;  2X9Y A;  4NUU A;  4TUY E;  2LSI A;  2PBI A;  4PK5 A;  5AFU L;  4QXH B;  2LHR A;  2Q9Q B;  2LSJ A;  4IST A;  3CX6 B;  4IE5 A;  5FY7 A;  2WMO A;  4ZI2 C;  2ZM8 A;  3Q5W A;  2H7O A;  2NTX A;  2ODU A;  3JC6 D;  5L3D B;  1D0X A;  3HKD E;  1WYC A;  2A3D A;  2BVM A;  3A5X A;  4CI2 B;  3ZJ1 A;  2C5J A;  5BMV E;  2E9X C;  2V7M A;  2XAG B;  4PAG A;  2W00 A;  4BJM A;  3RX6 A;  2L8K A;  2LOS A;  5FNV E;  3HKB E;  1S35 A;  1CUN A;  3ETV A;  3UUN A;  4ERR A;  2VKD A;  1U5P A;  2H3R A;  1ZEE A;  4PJN A;  3BQK A;  2LSY A;  2HH7 A;  3NRY A;  3K3N A;  5JDG A;  2D0U A;  4M1P A;  1MNE A;  4UF0 B;  4NUV A;  4JLE A;  1BR2 A;  4X1K E;  5CB4 E;  3PTR B;  3DTO A;  2JJ9 A;  5JDN A;  3RYC E;  4AKL A;  4H9Q C;  4I50 E;  5H6R B;  4QWN B;  3WI3 A;  2JMK A;  3N5L A;  1T98 A;  3PU8 A;  2X0L B;  2PJQ A;  3GN5 B;  3RPU A;  4EXT A;  4QX8 B;  5JH7 E;  4DMW A;  2NW9 A;  3N2G E;  4IIJ E;  3ZJ2 A;  1MIV A;  1BR1 A;  4Z8X A;  4H9P C;  5JQG E;  1HG2 A;  4IE7 A;  2UXX B;  3FB2 A;  5HXC A;  1UX4 A;  2E8I A;  4JEU B;  4WW0 A;  4UEL A;  3E22 E;  3L3P A;  3ZLI A;  2XUE A;  4OYK A;  4QKN A;  3O9X A;  2OA5 A;  3KVA A;  3B13 A;  2LHN A;  5E0O A;  1V9D A;  2YEV C;  1MMG A;  4XAX B;  5LBM A;  4IDZ A;  3CVR A;  2XAQ B;  1KK7 A;  4H9R C;  4UVB B;  4XZC A;  2C0S A;  2W63 A;  2IW5 B;  3Q5X A;  2WMN A;  4YLH A;  2JMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...