2WTBA

Arabidopsis thaliana multifuctional protein, mfp2
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
713
structure length
676
Chain Sequence
GKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGRFSGGFDIEPKAGYISIDIITDLLEAARKPSVAAIDGLALGGGLELAMACHARISAPAAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVKAEEGHSLGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLGEAREILTFAKAQTLKRAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKGLIHVFFSQRGTAKVPGVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQSRVRSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQVIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRAISKFGMPMGPFRLCDLVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKDPELKKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIMGMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLAERGSKGVLLSAPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Multi-Functional Protein in Peroxisomal Beta-Oxidation. Structure and Substrate Specificity of the Arabidopsis Thaliana Protein, Mfp2
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords FATTY ACID MULTIFUNCTIONAL PROTEIN (ATMFP2)
total genus 226
structure length 676
sequence length 713
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2wtbA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wtbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2wtbA01
2NQ8A 3GVPA 4E2WA 2O2SA 4ASIA 1U28A 1PWXA 5J23A 4W7IA 3CZMA 3F47A 2ZATA 3JQBC 1GCOA 1G6KA 3DONA 4PLFA 2A81A 2FBMA 3NX4A 5A9TA 4WCDA 5KJ1A 5ICSA 4E5YA 5AQ1A 3T88A 2PZKA 1R4MB 3AY7A 3VPHA 2FN7A 2ZB7A 3PHGA 4RLHA 5IDWA 2Q45A 3GFBA 1DAOA 3WYBA 4Z9FA 4FN7A 3OIFA 5DNAA 3KYCB 1UZMA 2DTEA 5DT9A 4RO0A 2VUSA 1WP4A 4JQCA 4K6CA 4RF3A 3B20A 3FPCA 4TQGA 1KVTA 3T4EA 2XPCA 4Z3KA 2Y1DA 3GVHA 3ZZNA 5GMOA 3L07A 2OL4A 2O3RA 3DDNA 3MJVA 4NH4A 3OA2A 4ZRMA 3COSA 4A2CA 4L8KA 5DZKH 1YJ8A 4JBIA 4ND5A 2QRKA 5IG2A 1ML3A 3FBTA 5C5IA 3DMYA 1NBOA 3D3WB 4CLEA 2UDPA 2C54A 1TA4A 1K0UA 2Q99A 4WNCA 1DB3A 1GFSA 4QXMA 4NFSA 1I3NA 5I9MA 5T8KA 3V8BA 4K26A 2GRAA 3FNEA 1E1MA 4BGEA 4YAGA 2QRJA 3B1KA 1T25A 3WGTA 1B3RA 4M54A 2VYVA 2A7SA 3C7DB 4N54A 1VE9A 1JLLA 1XQ6A 3WB9A 4B3JA 3L6DA 5KCZA 1TEHA 2C82A 3FNGA 3PEFA 4UVHA 4GLLA 3HLN1 3WLFA 3ON5A 2GD1O 4CQMB 3GA0A 4EBFA 3VPGA 2QRLA 3IKVA 3KSDO 4B4WA 2FZSA 5CAEA 1C1DB 4PLWA 1ZJZA 1KC3A 4IM7A 4DLAA 3QVXA 4Y6PA 1OD4A 1HLPA 1OAAA 1HNUA 5IF3A 4JK3A 3DTTA 2NP9A 4XIJA 3TRRA 1IUKA 1ZW1A 3D1LA 1PZEA 2HRBA 3FBGA 4BO4A 1PEDA 1PR3A 4RJTA 2QQ3A 2PPYA 2I5PO 1EMDA 1ZFNA 4JCOA 1GTMA 1WWKA 2YY7A 2WDZA 4OHUA 2AQ8A 3ZW9A 5CEEA 4CUJA 3CMMA 3U4IA 4CQLB 1H93A 2X0IA 1S6YA 1FJHA 2O3UA 3IDSA 1GY8A 2UV8A 3WSVA 5FWNA 1Z6ZA 3ST9A 3QWAA 3VPSA 3UVEA 2VTEA 4F3YA 3RROA 3SJ7A 1C0IA 1I3KA 1SPXA 1LQTA 1EEHA 3IUSA 4GWGA 2DBVO 4MVJG 3O26A 3TL3A 1N5DA 1NAHA 5I8ZA 3VOSA 3ZV5A 3Q11A 5H82A 3TRIA 3I4CA 1DHTA 2EJVA 2RH8A 3WGQA 3FCOA 5C90A 4R9RA 4RPGA 1ZBQA 2R6JA 4A03A 4BNHA 5A9SA 3SLLA 4MVJE 4XB1A 3L4BA 4IXWA 4CMKA 2DBZA 1O95A 4JSBA 2HQ1A 3IS3A 2P4HX 4FFPA 4MOUA 2NTNA 2PH3A 1LEHA 1HDCA 4ALNA 4CLXA 2DUBA 2W2LD 2PY6A 5IZCC 3NUGA 2VNAA 4I5FA 4L8VA 4RPKA 2NVBA 3M6NA 3BXXA 4M86A 1VSUA 4BO9A 2CVZA 3OJOA 3K8XA 4TSKA 4NQZA 5C37A 1XX4A 3VAZA 1QORA 2AA3A 3LKEA 1DIRA 1W8DA 1HT0A 4LSWA 3DXFA 3NTQA 4XA8A 4DYDA 1NFFA 2BMAA 2GGSA 4JGBA 1E5QA 2EGGA 4R4JA 4CR8A 1U9JA 3HFSA 3QW2A 1KEWA 1LRLA 2VT2A 3AU8A 3GNTA 4GLOA 2B4QA 3MJ4A 1NASA 3OQ1A 3D4NA 4NG5A 2B5VA 2X0NA 1WAMA 2NVWA 3ZHXA 4Z3DA 2FRDA 3BTOA 3K2EA 4OIMA 4TRJA 1EZ4A 4AJNA 2E4AA 2HJRA 1ISHA 2HLPA 4NNQA 4U0HA 3ZWBA 1XKQA 1W0CA 1NFQA 3U5TA 1A7AA 1EF8A 5C9GA 3H5NA 2EKQA 5G1SA 2AHRA 1YDEA 2AG8A 4KUHA 1QV7A 1RYEA 3T7CA 2FPGA 2QYTA 4U6QA 2RHCA 4W99A 1P9LA 2IZ1A 2UAGA 4Z0MA 3L4SO 2X24A 4RLSA 3GOHA 3DWFA 3WGIA 2BHLA 3H7AA 4BNIA 2E82A 4TRNA 3RC7A 4H7PA 2DVMA 3HINA 2JHFA 3EC7A 1NAIA 2JAHA 2FHSA 2UUPA 1ON9A 4FN8A 4CM5A 4MVJM 3WS7A 2DEOA 2Y1CA 2VN8A 5I9NA 1NX6A 2D3TA 1Q7CA 1D7OA 1ZNQO 2GO1A 3BMOB 3CINA 3RBXA 3TZHA 4DL9A 2AE2A 5LC1A 5CDSA 5CPFA 4CV1A 2B36A 3S1LA 2Z1MA 4R16A 1ZK1A 4RVSA 3MTGA 1YL5A 1XSEA 1E6WA 4I9UA 3VVBA 3F5QA 3PJDA 1W2XA 3DHEA 2DPGA 4URFA 4D3SA 1E7WA 3DMTC 3KYDB 3KV3O 5A04A 4E4YA 3L6OO 3W6UA 3Q1TA 5BR7A 3JU1A 5K6AC 4NBWA 1E0DA 2Q1UA 3C1AA 3DHNA 1OOEA 4KUGA 1FC9A 4BKUA 5TGDA 4GWKA 5FIFA 2EERA 3NAQA 5ENDA 1N6FA 3VIVA 3DAPA 3Q0EA 3ZWYA 1QYDA 1VSVA 1A9YA 5T5QA 3MT6A 3KVOA 1I3MA 1IHYA 1N7HA 1C14A 3BMNA 4GVLA 2FPIA 1HDXA 4ZU3A 3BIOA 1SB8A 5DTWA 1M67A 3GEMA 4LMRA 5IDQA 2NU6A 2ZB3A 3FNFA 1T1SA 3JSAA 2Q2VA 1C3VA 2PA3A 1J4AA 1UUFA 2VSSA 1UR5A 3JQFC 1CF2O 1PZGA 3IJRA 1VPDA 1IULA 4OKIA 3K6JA 1B3BA 2F1KA 3GHHA 1R12A 3DZKA 4CLOA 8LDHA 3H0JA 4JWVA 3IP3A 2F9YA 4QFCA 5F21A 4D79A 5CG1A 3DBHA 5A02A 3DBLA 2WM3A 4U8GA 3EDMA 4YT5A 1YS4A 3WICA 5IN4A 3BTSA 2GN6A 3A06A 1LBEA 1R6DA 3HQ4O 4GSLA 4MKRA 1ENPA 2H63A 2A35A 3EY4A 1J49A 1OC4A 4BNVA 3G79A 5KDRB 1GZ6A 2Q1TA 1X7GA 4PFJA 5ES3A 1L7DA 5C7LO 1A4UA 3DOJA 4WEQA 4CMIA 3HP0A 1I36A 4WK6A 3JYNA 4PZEA 4A26A 2H1SA 4QECA 3BYZA 3QXIA 4JN6B 3WFJA 5HRUA 3D5QA 2PR2A 3JD3A 3N74A 1LLCA 5CP8A 4RDIA 3JQGB 4H15A 4QEDA 1I2ZA 5G4KB 2ZJ0A 1UYVA 1DFHA 1HE4A 3RIHA 3D7LA 2C0CA 3AJRA 3PI7A 2G17A 4Y8VA 1UXKA 4FFOA 2Y0DA 4J90A 1P74A 1E92A 2X4GA 1IYZA 1XO6A 1F17A 2V6BA 5DU8A 1T4DA 4QO8A 1QP8A 1WNTA 3C3XA 4XKJA 2AMFA 3STAA 1KY5A 3P2OA 5FYDA 4BHTA 3GNQA 5AXCA 1ULSA 2D1YA 2VSSF 1N2SA 2BFMA 4NI5A 3PLNA 3WWZA 3ZCXA 3H6KA 3AY3A 3HDQA 1R16A 4EUHA 2DFVA 3P7MA 3WJ7A 4CLRB 2FOIA 3ANMA 3G17A 5JCXA 1IHXA 3FHLA 3EVNA 4OKNA 1EFLA 1J7XA 4XQ9A 4ZQHA 3QYRA 4YRBA 2JHGA 2DT5A 4BNWA 1SNYA 3GDGA 5A03A 4OJNA 4R5HA 2PNFA 3HADA 3GRPA 4JBHA 4MP8A 3QJ5A 5T6BA 2YV2A 3L9WA 2LDBA 4B8WA 4RVDA 1MV8A 3H0QA 2YQ5A 4YPOA 4K2NA 1I2BA 2X9NA 4PZCA 1SB9A 2H5LA 3H0SA 3H3JA 4RPHA 4XRGA 4EI2A 3AFMA 3QWFA 1BGVA 3QWDA 3DHYA 3JD4A 4Y6SA 4WCFA 1BXZA 2DAPA 5B4TA 1GUFA 3GLQA 1GZ4A 4E6PA 3GPIA 9LDTA 3DOOA 4TZTA 2FSVA 4R68A 2F6QA 1XA0A 1R66A 4MDHA 4U0GH 5JFOA 4PRKA 1N92A 1ZSNA 5COAA 1DBVO 2IYPA 3PEAA 1CDOA 1E7MA 3K2BA 4XD2A 2F9IA 1NZYA 1R4NB 1DAPA 2H6EA 1UDAA 3H5RA 2BGMA 3PWZA 1QYVA 5FEUA 4FSHA 3ROMA 2Z1NA 3KTHA 3H65A 3RBVA 1XQ1A 1YJQA 4JXKA 4LCEA 4U7WA 4I8XA 3ZU4A 1K5HA 3MCVA 2NTJA 1YOVA 3GY0A 4WECA 3TDCA 3SLKA 1BG6A 3ORFA 3CH6A 2NV6A 4IZCA 1PJLA 5HBRA 4NK5A 2A7KA 2VWGA 1H6CA 2Y0CA 2FP4A 3PK0A 4GSKA 4NPCA 4UVIA 3S2IA 2G76A 1YG6A 4FJWD 3JQ9A 4R5MA 4DI1A 4ALIA 2P2SA 4FOOA 3RKRA 5EQDA 3VDQA 2GYYA 5INGA 3M6MA 1NHWA 1RM0A 4KWBA 3ONFA 1G0NA 1Y7TA 4W82A 3A4VA 1I2CA 4J9VA 2IDZA 3HB5X 4WPGA 4DQUA 4L6WA 3RKUA 1E3EA 1LDBA 4IS2A 5IN5A 5C3MA 4CJXA 3DZFA 5A3JA 4CMEC 1HSOA 4WLFA 2FR1A 4HXYA 5BNFA 2CUKA 2F9YB 1EDOA 5A4DA 4FB8A 1CEQA 4XGIA 4E3ZA 3V2GA 1NPYA 5EINA 4YJHA 2XAAA 1U5AA 4OXNA 3W6ZA 4QSMA 4R1TA 1ISIA 3QIVA 4ZA2A 4BNXA 2C2XA 2ZTMA 4ZD6A 4CM4A 1IE3A 3RU7A 3ENNA 4D0RA 2ZQQA 1H0KA 3GR6A 1ONNA 5AXBA 3PHJA 2CZCA 1E3WB 4IZHA 4L76A 4DC0A 2NM0A 2EKLA 3MWEB 1P1IA 1B16A 4P4LA 4DA9A 3RSTA 2GF2A 4C7JA 5MGBA 3OEWA 3RSHA 3KETA 3GF3A 4KUEA 3EHEA 4Z9YA 2QZ9A 3RUDA 1Y6JA 3EAGA 3PZRA 3WQQA 4BMNA 1E3SA 5DCUA 2CE3A 4I4ZA 3VZQA 1AN9A 4RF4A 4Z0HO 4UUNA 3AFNA 3CE6A 5TRTA 2P4QA 3JYQA 4A73A 3UFXA 4BB6A 1LQUA 3OIGA 3TVWA 4I5GA 1LSOA 5L9AA 3JQEA 2GN4A 3PHLA 2HMWA 4UUPA 5IZ4A 4Q3NA 1RJMA 1MJ3A 4XIYA 5G0WA 1OFGA 2HAEA 2WTBA 1YO6A 2FSSA 1DPGA 1LNQA 3AI1A 4U0GA 2ZL3A 4MP3A 4ZJUA 3E5RA 5AOVA 2I76A 3LC1O 4I52A 4TROA 1MG0A 3T3WA 2V65A 1UYRA 3GMDA 4YT4A 1ISGA 4NJMA 4Q1IA 2OMEA 4ZQBA 4D46A 2DTXA 3KEQA 2Y1EA 3OA0A 1YQXA 2NU7A 4O0LA 5TQVA 4BNTA 4CPDA 2I99A 2W8ZA 2DTDA 5BSFA 1ZK4A 4EJ6A 3ITKA 1DC3A 1F06A 2FW2A 5FI5A 4DIBA 1I10A 5IDYA 5T67A 4FIZA 3KYDA 3GGOA 2E48A 2NUAA 2IYOA 3HN7A 3PZBA 5JDCA 2YW9A 2Z5LA 2VZ9A 3WGHA 3C85A 4BO1A 3I3OA 2HU2A 3JD0A 2WYUA 3DL2A 4RYFH 3ZWXA 3STHA 5DZSA 4GX2A 4XDZA 3MJSA 1SOWA 3A14A 2B35A 1BRMA 2A92A 1NFRA 4GH5A 3NV9A 3EK2A 3U4CA 5DF1A 4L73A 1TG6A 3HDYA 1A71A 4J6FA 3JQAB 2GTRA 4MVJF 3H9QA 2SCUA 4Q39A 3BMCB 4OOEA 4EUEA 1NM5A 3QVTA 3K92A 4F6CA 1P45A 4KQXA 4CR6A 2VSUF 3GVCA 3GPDG 3CXRA 1GR0A 3AUSA 4PG4A 4J4BA 2O7QA 4MINA 4NHEA 4X54A 3GQVA 4DPKA 2ZCUA 1RJNA 2VHZA 1NQTA 1BWSA 3DZJA 1Y8QA 1EVIA 2D2IA 5TX7A 3E1KA 4DMMA 3JD2A 5KJPA 1DIGA 2YYYA 1V3VA 1SEVA 3FWNA 2W98A 3LT0A 4J1SA 2EP5A 1Z75A 3G0OA 4FJ1A 1JAYA 4RORA 4JFCA 3AUUA 4TRMA 4ZHSA 3DFUA 3VTFA 1MB4A 4PRLA 3Q2IA 1YE3A 2IRWA 5GZ3A 1O5IA 1NPDA 4ELSA 3F9IA 5EIOA 4AVYA 5DU4A 4YTEA 1C0PA 1B15A 2O3SA 5DP2A 3WIEA 3K9QO 4FGSA 2B4RO 1L7EA 4WCFC 5HA5A 4R1SA 2PZMA 2DC1A 3FPLA 5B4VA 1PJBA 4E2YA 5FUSA 5H81A 1HTBA 1PGOA 5DU6A 2I3GA 5JLAA 3WSWA 2JCYA 5BSGA 4Z0TA 1QLHA 2NSDA 3PPIA 4CQMA 1UXJA 3GF4A 4I9NA 1JU9A 5F5LA 1C0KA 1QXSA 1U3UA 3TFOA 1KYQA 3BMQB 3PLRA 1R4MA 1VI2A 4YCAA 1NXQA 4WE3A 3PIIA 3RUIA 4MVJH 1DIHA 4OO3A 5G4KA 2VREA 3R3JA 1C1DA 5TSDA 1PSDA 4CL3A 4XQCA 2H9IA 1NQ5A 1PZFA 3PQEA 4M55A 4RQTA 3C1TA 3MTJA 1EUDA 1V8BA 1XEAA 4CUZA 5A3VA 1MFPA 2WD7A 3OMEA 4U19A 4D43A 4HC8A 4FQ8A 1SBYA 4GX0A 1IZ9A 1HDYA 3D64A 3UCXA 2JFHA 1JN0A 1Y5MA 1V6AA 3OT6A 2CF5A 1HDOA 3C1OA 3TF5A 1E6UA 1UJMA 3F5SA 4CM9A 1CETA 4FB5A 4NBVA 4TZKA 4QFDA 4KPKA 2VYNA 4BV9A 2ZL4A 4JCSA 1GAEO 4RVHA 3RUCA 3W4IA 3NJ8A 1KETA 1PJ4A 4CV3A 5JC1A 1LX6A 3EW7A 4XZ3A 2ZL0A 4IIUA 4I5DA 2Y1FA 3AM3A 3RASA 3GK3A 2A4KA 2X8LA 1SG4A 2BI8A 2X6TA 4FJ2A 4DQVA 2VWPA 3Q9NA 3PDUA 2VSUE 4CV2A 4HKTA 4NFHA 4XQEA 1G0OA 2QQ5A 4DIOA 1L1FA 5KOIA 2WMDA 3DR3A 2Y99A 1PJSA 2VTDA 1EQUA 2C5EA 4ALLA 3I9NA 4L4RA 3CEAA 2WE7A 3ROQA 4D3DA 1BXKA 3K30A 3VZRA 2X0RA 5CDGA 1K6IA 3H02A 4KD6A 1Z73A 2W2LA 3DQPA 3TDKA 2JFFA 4HFNA 3AK4A 3FDUA 3T4XA 1EE9A 3ZH2A 1B2LA 1O6ZA 4J4HA 4BO8A 4J43A 3TT7A 4JCRA 4BNYA 4RZIA 2YDYA 4I42A 4BNMA 2AE1A 4BO3A 4IQ0A 4R3NA 2VUUA 3WYCA 1E3IA 4L0QA 1D8AA 3W1VA 5F1PA 3TZ3A 1T2DA 2FZEA 4CQLA 1AHIA 3KZVA 4NK4A 1GCUA 3JYOA 1UAYA 1SC6A 3MEQA 5KWEA 1MC4A 1WMBA 1N6DA 3WLEA 2VHVA 4LVUA 1DDOA 5GZ1A 3L0DA 5ITWA 2XXJA 3JD1A 3B6ZA 4Z9XA 5TC4A 4ELWA 4L75A 4DC1A 4RQUA 3GAZA 3I9LA 4AJLA 3HB4X 3U9SB 4EDFA 1PJQA 1T24A 3DMTA 3FNHA 3I6IA 4CLHA 4EMMA 1MXHA 4D45A 2GPTA 3NTRA 3RUEA 3GVIA 3PJEA 1X1EA 4MIEA 1K32A 4ZDEA 1H9AA 3KLPX 4CM4B 2J3JA 2VNSA 4YT8A 2GZ2A 4YJGA 3TNLA 3NT5A 4ITUA 1LSSA 3CZRA 5EPOA 3NT4A 3WJAA 4WKGA 4DREA 4K3WA 1LXCA 1MUUA 3ZHZA 4IINA 3TOZA 5A5FA 1UDBA 4IDFA 2O3QA 2F00A 1E1LA 1N1GA 2CSUA 5DBIA 1A9ZA 3KO8A 4QO7A 2VHYA 3WMXA 3BZUA 1BSVA 2J8ZA 1ZVMA 4JNKA 3QV1A 4EMLA 4OSPA 4ALJA 1PJCA 5JSFA 4N5NA 2UVDA 4PLVA 4KP7A 1HZDA 1FDTA 3O8QA 4IDBA 5EQFA 3RD5A 1DCIA 1U4OA 5JXWA 1P1HA 1HE5A 2LDXA 5L53A 1GQ2A 1ENYA 5ER9A 4BO7A 1ZXLA 3GZNA 3PE8A 1DOHA 4RF5A 2A9FA 2VYVD 1X0UA 1GUYA 2WJPA 1H9BA 1LDMA 3ZWPA 5KNLA 1SZJG 3ZDFA 4MI2A 1GQQA 1DFIA 3L9XA 3KTDA 4NR0A 1WZ8A 4DPMA 3P2LA 3WNQA 5A05A 3VDRA 2HCTA 4LMPA 1NVMB 1Z7BA 2YZ7A 4AJPA 3H9GA 3Q1LA 1XELA 2EGHA 3ANLA 1HYGA 2WE8A 1ZSVA 3AOGA 3JQDA 4XQGA 5T57A 1E7YA 5L95A 1VM6A 4WUVA 4PGFA 4YAKA 3AW9A 2Q49A 5DBGA 3H2ZA 3ONDA 2DU8A 1DHRA 5KIAA 1WDMA 3DZGA 4CLOB 5G0UA 3CKYA 1ADGA 3ETDA 3QE3A 3GDFA 1U7HA 3G64A 3KQFA 1U2DA 1FC6A 5DCYA 3NDIA 2DQ4A 3LK7A 4K28A 4MP6A 2ZYGA 1FDUA 3TZCA 1GYQA 2AEJA 1ZK0A 3VPFA 1LDGA 4MVJD 2EG9A 1JAXA 5JYDA 2IEDA 3L4BC 1PIWA 3MFMA 3WIDA 3EYWA 1Z74A 2VZ0A 5JDIC 1P1FA 4GKBA 3X2FA 1Q7GA 3ICPA 4YA6A 4RL6A 1P1KA 2PKQP 4WLUA 4C7KA 3IKTA 2Q1WA 3FN4A 3MOIA 1EFKA 4NU5A 3ZNOA 3GEGA 4BIIA 1DIAA 4HFRA 1H5QA 4NU6A 3N7UA 3TOXA 1U1IA 3V5NA 2X5JO 3L3SA 1IL0A 1UYSA 1P31A 1ZK2A 5JMPA 1I0ZA 4B7XA 5TNXA 3TLFA 1LDYA 4H16A 4CMHA 4ZDBA 2EP7A 1NP3A 2PFGA 1F14A 1KS9A 3EZYA 4EEZA 3JQ9C 2O3TA 5JCJD 3IAVA 3OP4A 4RVFA 3QY9A 4NMHA 1XLTA 2Q1SA 4UEKA 5G0TA 4B3HA 1I8TA 1QYCA 4J3FA 3GZ4A 3U9LA 4JCTA 1Q52A 1GZ3A 1MA0A 1CQJA 2VHXA 4UVGA 4JBGA 2PKRA 2X86A 4ROSA 1FDWA 3ZU5A 4II3A 3FF6A 3S55A 2PBPA 2B69A 3IUPA 5AVOA 3I4FA 2O23A 4CM8B 5U4QA 2J3KA 1KEVA 1ZUD1 2HK8A 2OHXA 4DUPA 1EBFA 4EEXA 3IOYA 2E49A 4GKVA 4J9UE 3A28A 3R9SA 4YDRA 2Q46A 2Y93A 4W9NC 4BNLA 2ZKLA 4EJMA 3HE3A 3ZWVA 4BNZA 1F12A 3EUWA 5DTPA 2V7PA 2VUTA 2NTVA 4DMLA 3K8ZA 3TWOA 5K9ZA 3R0OA 1AXGA 3E03A 3KUXA 1X14A 3LC2O 4YVFA 5ER6A 3W4KA 1VRGA 2J5IB 2OO5A 5ICMA 3OQBA 5L7TA 3AM5A 5F3RA 3ZHYA 2PTGA 3P19A 2ZTUA 3QVWA 2F9IB 3D4OA 3ZV4A 4OXKA 4HNGA 3I47A 1T2AA 2YV3A 3KSUA 2NU9A 4UVDA 1T2EA 2JL1A 3D5TA 3JYPA 3NTOA 1EF9A 5JO9A 3HG7A 1KC1A 3RJ5A 3WFIA 4RZHA 4YAJA 1EK6A 1LC3A 1N9GA 1QLJA 2IE0A 3PHHA 4CM6A 3NGXA 3ZGYA 4UEOA 1WZIA 4FPXA 1W73A 4E30A 3LDHA 4AJIA 1V0JA 3E9QA 2WD8A 3PTZA 4Y67A 2TMGA 3DZHA 4HUJA 4RCVA 2NNLD 1RYDA 3ZV3A 4JLWA 4CR7A 4HADA 2Y05A 4HX5A 4J7XA 1YQDA 2PKQO 1ID1A 3LF1A 3WTCA 2EKPA 2HMSA 4YXFA 2QIOA 3NYWA 4CMJA 3DFZA 4R69A 1ADCA 2V6GA 1A5ZA 2FR8A 5CPBA 1U8XX 3BHIA 3EGOA 3LLVA 1PGQA 2PGDA 4DVJA 3H2SA 1NNUA 4FN4A 3DO5A 1XHLA 1PQWA 2QZZA 1GDHA 1K89A 2AQKA 4QUKA 3D3EA 5DULA 5TLSA 4MKZA 4E2ZA 3WYEA 1VJTA 1ZKMA 3JQBA 2D59A 3U9RB 2ZTVA 1C1XB 4PLCA 3UXYA 4TKLA 3IQDB 4RYFA 4D42A 2PD3A 2JAPA 4FZWA 3GT0A 4HBGA 5F1OA 3I5MA 1KVQA 3PZKA 4RDHA 4L4SA 1Y81A 3OSUA 4ID9A 1Y7OA 3F4LA 2VSSE 4M8SA 4YRDA 3U49A 1LRKA 1NZYB 3PJGA 4YYZA 4Y9DA 2W2KB 4IBOA 3QWBA 4BNFA 3LT2A 3NJDA 1DUBA 1EE2A 2OFPA 2WSBA 2NVUB 5JAIA 2VSUC 4F45A 3VH2A 4YWJA 3GMSA 5KVVA 3AOEA 4M1QA 4QT0A 1E3JA 1E3WA 1KVRA 5TJ9A 3JQAA 3PWSA 1XCBA 5JY1A 4WEOA 5I7SA 5JYEA 4NIMA 2X58A 1UP7A 4M89A 4MIYA 3GN1A 3UOGA 3VTZA 4J1NA 1QG6A 3JQ8B 3IB9A 4FC6A 4RPLA 1K39A 3WGGA 2AG5A 5DOVA 2PV7A 1LJ8A 5GY7A 1PS9A 3GC6A 4OYRA 5H83A 1M6HA 4IUYA 3R1IA 4BO2A 5DL1A 2X0JA 4RVUA 1JKIA 4CL8A 4BMVA 2G1UA 1W6UA 4QTZA 1AXEA 1UXIA 5JE8A 1O89A 1Z82A 2OXIA 3UUWA 4CLRA 1B0AA 3ZWMA 1I24A 3HSKA 4YEDA 4FFNA 4J91A 4HP8A 1PU2A 1Q51A 1JKJA 3WGOA 4WNIA 5E0SH 1O94A 2Q34A 3ZU2A 3U9TB 3WQRA 2C7GA 2CFCA 3KOUA 3UF0A 4ALMA 4PZDA 5AYVA 1DLJA 2YQ4A 1E1NA 5C7OO 1HYEA 4KMSA 1DEHA 4Q3AA 1UP4A 1XR3A 4TVOA 1V3UA 2B0JA 3WXBA 4INAA 4E5PA 3WTBA 2D0IA 3I83A 1JA9A 4GM2A 4EZBA 4YR9A 4HFMA 3MWDB 1TT7A 2VWHA 2ZIZA 5L40A 3KXDA 4XGKA 1GYPA 2CDCA 4W7HA 1E1KA 2J5II 4KNPA 4E5MA 4M49A 1N7GA 4KDFA 3DBRA 2GERA 4IY1A 1KBZA 1XU7A 1LTHR 3E82A 3H4VA 4WCZA 1KVUA 1SO8A 2NLOA 5THKA 4JJFA 1CIVA 3RVDA 4BGUA 1B8PA 5CHEA 2R00A 1DJQA 3WGYA 1ZIDA 3VH3A 4XR4A 4PLTA 3H9JA 3LVFO 4ND3A 1HL3A 2VRCA 3ENKA 2POQX 2HO5A 3ROPA 4NDNE 4CM9D 4ZICA 4GL4A 4NBRA 1V9LA 2ZQRA 3QVSA 1PS8A 2O7SA 3FSRA 2DUUA 4IJWA 4QFEA 1MFZA 4F6LA 4Y6RA 4IJUA 7ADHA 2YDXA 3DBHB 3I1JA 3TZKA 4BQRA 2I6TA 1PQPA 5L7WA 3ZNQA 2J5KA 4GBJA 3JQ7A 4W6ZA 1UXGA 1VLLA 4ALKA 1GQYA 5L45A 3HZZA 5KVSA 1YB1A 4ZVVA 4OQZA 1TI7A 3MZ0A 1ZO8A 3RC2A 4E5KA 4L4XA 3I9MA 1DLIA 2JCVA 3EVTA 4E5NA 2J6IA 3TV5A 4WOKA 4JYJA 3KEOA 3PJFA 2OBYA 4JJGA 3U0BA 2DLDA 4S3MA 1ONOA 4I5EA 1VL0A 2BFOA 1VL6A 2VRBA 5B37A 5TT0A 3FD8A 1BMDA 3P85A 5ILGA 3ONEA 4DBZA 3JQGA 3E5MA 1HE2A 5EN4A 5KJFA 1ENZA 5DUCA 3Q7HA 2BGKA 4DWVA 4R51A 1ONPA 3L6EA 5CDUA 1LDEA 4AJ2A 3RU9A 2HMTA 3C7AA 1K3TA 1KOLA 4NBTA 3U3XA 1PGPA 4C4OA 3ZWNA 2JD1A 3TZ6A 3RCBA 3V2UA 4RCNA 3RQSA 3JV7A 3PYXA 4TWRA 4WASA 3A1NA 4P8RA 1ADFA 4K29A 1JW9B 3N6RB 4J1QA 4FBGA 1X7HA 2ZK7A 1WDLA 2OP0A 2D8AA 5DUFA 3H9UA 3VPXA 3TVUA 2PGLA 4U18A 4N18A 2V6MA 1O0SA 2NU8A 3FTPA 3OIDA 4B4UA 4XYEA 2CNBA 4OQYA 2X5KO 4ZGWA 4E21A 4XDYA 3WNVA 4ND1A 2J3HA 1EUZA 3MJCA 1TT5A 5GZ6A 2O50A 4DIFA 5TIIA 1UIYA 5COQA 3VKUA 1DO8A 1WDKA 5A06A 1XNVA 3BHJA 2Q2WA 3QP9A 3GH3A 5LDGA 1FDSA 4RF2A 1YBVA 3Q9UA 3GFGA 4OAQA 3KYBA 1M6WA 4R54A 4YJGB 4L9RA 5DDIP 3BF0A 5JPIA 3RWBA 1ISJA 1HDRA 2BI7A 2BLLA 2EW2A 3ETGA 4RGBA 3GLMA 4K9DA 4K6FA 4MVJI 1FCFA 2EV9A 1M66A 3VKVA 1I32A 4A7PA 3HDHA 2JKVA 4H3VA 2O4CA 2P5UA 4IZIA 1OBFO 4RPJA 2VQ3A 4NEKA 1Z45A 2ZB4A 4XYBA 2HK7A 1Q0LA 1GEGA 5BT9A 4BO6A 4K1LA 4B79A 5IZCA 1UZNA 1SMKA 2IZZA 3W8DA 3MOYA 4JP3A 4BNGA 5JCJA 2I67A 4W9NA 4BVAA 3GF7A 3TJRA 1XWFA 2NACA 3ASUA 3BAZA 3LF2A 3OJLA 3S2FA 3ZWCA 4BKPA 2EJ5A 3HUDA 1JQBA 3KRTA 5AXAA 1TLTA 4IDGA 3HFGA 3ZI0A 3WMWA 3PIDA 4PVCA 4EYEA 4U1AA 5L4NA 1DC5A 4FJ0A 4GVXA 2DBQA 4M87A 3KSZO 1YKFA 2VWQA 1DC6A 3GDOA 4ESOA 1ZXBA 3HN2A 2BF7A 4CMEA 4IGFA 4LGVA 1BW9A 5TS3A 3OM9A 2CY0A 1YGYA 4OL9A 3CSDA 2B5WA 2D5AA 2O48X 3NEPX 4G65A 4PVDA 4UULA 2ZQZA 4O5OA 2FPPA 4CMCA 3QVOA 1VRWA 1YDWA 1HETA 1OZAA 4HNKA 1YXMA 3VC7A 1RM3A 1HRDA 4ZQGA 1O8CA 5I7EA 2J5QA 3GHYA 4PLGA 1ZMTA 1R0LA 1LI4A 2UZFA 5JNLA 4XYMA 5FI3A 1YB5A 4BB5A 3C7CB 4U0JA 2TMDA 1C1XA 3Q6IA 3U4DA 3T7EA 1BVUA 1PR9A 1QV6A 2D4AA 3P2YA 4FGWA 5L3ZA 5INFA 3G1UA 3H0UA 4ZQFA 5JY6A 1HNOA 1GADO 3JQ7B 1X1TA 5THQA 4OG1A 3UCFA 4XCVA 4ZU2A 4HNHA 5BNTA 1NR7A 4WJZA 1HYHA 1N1EA 3PGQA 5JDCC 1M2WA 4BKRA 4KTVE 4OLQA 3QA9A 4WLNA 3CIFA 3V1TC 4JVTA 3ICCA 2GSDA 4JX8A 3A9WA 4YRAA 1J5PA 4OMRA 5FFFA 1GPDG 3WQSB 3PGJA 4O6VA 1JDJA 2C20A 3RUFA 4E0BA 3B1FA 1A7KA 1P1JA 2AW5A 1GL3A 1ZJYA 2GN9A 3ADOA 1B14A 3D4PA 2B37A 2GN8A 3LT4A 2I65A 2BFAA 5CEFA 3V5EA 4JIGA 3E6AA 1QKIA 3CPSA 3ZU3A 3ZN2A 1N6EA 5T8KC 3PFWO 2W90A 4XEHA 5IAAA 5DKPA 4J2OA 5JC8A 4O59O 5BSEA 3BMQA 1LUAA 1EBUA 2JJYA 3MOGA 1I3LA 1HZJA 4MJLA 5T64A 3UAGA 4JYLA 2PGJA 2Y68A 3GN2A 4IDAA 1BVRA 3PDJA 1VL8A 4D3FA 4IPTA 1NWHA 2FZWA 2AXQA 3GAFA 1EQ2A 4Q3DA 2RIRA 3GVXA 4PLYA 4IJVA 4KWIA 1YVEI 3B70A 4QX6A 4XX0A 3HJAA 5CDYA 3UKOA 3UCEA 4FFMA 2P91A 6ADHA 3ROKA 3U62A 3K96A 1NQAO 1T2CA 1UXHA 4GGOA 1FC7A 1QYXA 2V6FA 2X9GA 1PJHA 3IMFA 4YLHA 3RBZA 5CTCA 1K6JA 2Q2XA 1B7GO 2CDAA 4E2XA 1TB4A 2G82A 2W4QA 3OJFA 1YRLA 5CG2A 1XNYA 5TF4A 1E6EA 2XF8A 5KDRA 1G1AA 4W4TA 3GUCA 3SLGA 3Q0GA 1HKUA 3GUYA 4LRSB 3NT2A 2QYSA 3ULKA 2J5GA 2R2GA 4CV0A 4PG5A 1XIVA 2HMUA 4TVBA 2X5OA 5IXYA 4E12A 5BSHA 1M76A 5ILOA 3ETEA 2RAFA 4OXYA 1U3WA 2Q50A 4LN1A 4LVCA 4DLLA 2OZPA 1N9GB 1X15A 1R0SA 4J7CA 1BDBA 1P33A 1IOLA 2DPHA 5A9RA 2ZL2A 5G1RA 4R1NA 3GKBA 5HM8A 4J4TA 1KEPA 3GEDA 1YBAA 4IGEA 4A0SA 4FNDA 3PWKA 4UAGA 4I08A 3RI3A 4XB2A 4J16A 3PP8A 3C24A 5HS6A 3AY6A 1YWGO 4BNKA 4AG3A 1DRWA 4IZDA 3H8VA 3GGPA 1PJ2A 2AEMA 3JQFA 2I9PA 1H6AA 1ZEJA 3TSCA 3QWIA 4E33A 9LDBA 1NTOA 3TFQA 3AUTA 2GZ3A 5L51A 1RKXA 3UGKA 5BQFA 2HW5A 1NPTO 3PXXA 4IMRA 4D7AA 5IDXA 2C8TA 4DQXA 4A10A 5DP1A 4CMBA 5KTKA 1PZHA 2VCYA 5G0SA 1PS0A 1DFGA 3L77A 5CEJA 2CBYA 3TZQA 4MVJA 2YV1A 3IIEA 1XDWA 5JAQA 5A9SB 1PL8A 5K6AA 5K0ZA 4GMGA 4EUFA 3R9QA 4R3WA 3ZV6A 1WVGA 4WLEA 4BGVA 1AHHA 3FF4A 4XWYA 1GV0A 3G3EA 2G0TA 6LDHA 3OJEA 3HHPA 2VX2A 4GX1A 4BOYA 2EEZA 3IAHA 1O8UA 2VZ8A 5DBFA 4BO5A 1PGNA 2BRUA 2D5CA 4IJKA 2O4UX 2VT3A 3OFSA 4IDCA 2P9GA 4LRTB 1E7SA 1ZZEA 4YQYA 1WLYA 2Y0EA 4AJOA 4CM7A 2P9EA 3H5AA 2AQHA 1Y8RB 1AGNA 3ZWOA 3VZSA 4BUCA 4UUMA 5G0VA 4WZ8B 3K73O 3QLJA 5EMHA 4J7UA 3QQPA 4BQPA 2RBEA 1NVTA 4XYLA 3WG9A 3K50A 1PJ3A 3PGXA 3DEYX 1J6UA 4LW8A 3SC4A 1UZLA 4AJ4A 4CODB 1PWZA 4XR9A 1F8FA 2ZYAA 3DB2A 2PG8A 1IPEA 1MXFA 3UICA 4DTIA 4EJ0A 3TQHA 3KTJA 3D3WA 4KQWA 3I52A 2BZRA 2O2YA 2GZ1A 3LQFA 3QRWA 3WG5A 4WLVA 2J3IA 4CUKA 1D1TA 1UH5A 4XJSA 5LCXA 5A1TA 2ZCVA 3H9EO 3KM0A 4P4NA 3DBLB 3RFVA 3KTKA 4CM8A 3OQ6A 2HUNA 1EVZA 3OETA 1GD1O 4FC7A 2J5RA 2RHRA 3BHMA 4P22A 4PLHA 3WBBA 5CDTA 5EL0A 4I9HA 4ZDDA 1LA2A 1ISMA 3FI9A 4RVGA 5I9LA 3UHAA 3IC5A 2P5YA 1ZH8A 2A94A 1OMOA 2X1HA 1U4SA 3VHRA 2G5CA 4FFRA 3O9ZA 3N58A 4YJFA 1JTVA 3I9OA 2X9VA 2WEKA 2EJWA 1QYWA 4KWHA 4TKMA 1Q0HA 2GNAA 1ISFA 1HDGO 4BNNA 1P1RA 2J5IA 2DM6A 3Q0JA 1JVSA 3D0OA 4DXHA 2J5GD 4IDDA 2CVQA 1I5RA 1X0VA 5JAZA 2IXBA 3DC2A 1DIBA 2WWRA 3SJUA 1A27A 4PLZA 3PHIA 4FS3A 4JJIA 3SBOA 1CYDA 1MG5A 4PLPA 2EF1A 1F8GA 4OGWA 4B7UA 2GASA 3HRXA 1EK5A 1TXGA 3IJPA 1HZZA 3WDSA 3OMLA 1E3LA 3JQAD 5B1YA 1LC0A 1AUPA 3O8QB 3VVCA 1AE1A 3PYMA 4LCJA 1VKNA 4IZBA 1IY8A 1NQOA 3CMCO 3RAJA 5EESA 4HY3A 2PZJA 3GZNB 3INRA 1RJWA 1H6BA 1ZEMA 1GU7A 1U7TA 1JXZA 2HDHA 5L4LA 4Q0GA 4EMPA 1X7DA 2DUWA 2HMVA 2GUGA 1VKOA 1Q2XA 1YQGA 2CD9A 2QW8A 3JYLA 3KYCA 5IXSA 4GHNA 4D41A 2GLXA 3JTMA 3M6IA 4ND4A 3DAGA 3ZWWA 1K2WA 3F46A 3G1TA 3E9MA 3AUAA 3TL2A 4AJKA 1K6XA 3W8FA 4Z0PA 4NFYA 4PG7A 3SEFA 2Q4BA 5KVQA 2HK9A 2WYVA 4JCQA 1PJTA 3UW3A 1WXDA 1B26A 5F1KA 5G4LA 3IBBA 2CF6A 2QG4A 1U3VA 2OUIA 5INIA 3ZWAA 3M2TA 4WYOB 3WWYA 3KLMX 4FNBA 1YONA 2Q2QA 3JQ6A 1QMGA 1GEEA 3FR8A 2E37A 4G5HA 4MOWA 1PL7A 3CUKA 1FF9A 3DBVO 3F4BA 4GPD1 2Y1GA 4L74A 4BKOA 4R41A 4CMGA 5I7VA 2XOXA 1Y9EA 2FWMX 3PFFA 4N5MA 3V1YA 4S1VA 4DPLA 3Q2KA 4B3IA 3OBBA 4YBZA 4BNJA 2IEXA 1U2GA 1EUCA 1SOVA 3BTUA 3GGGA 4PIVA 1YOVB 5B12A 4J1TA 3GG2A 3DBRB 3UN1A 4CM3A 1B8UA 4F46A 3WOHA 4KDEA 3S2GA 1T2FA 3QWHA 2CVOA 3PVZA 4J0FA 3P5MA 1JKFA 5E0NX 5KJCA 1RWBA 1MGOA 1PX0A 2BKAA 1D3AA 3LT1A 3I23A 3FTNA 1WZEA 3BEZA 4CLDA 1NYTA 4UVEA 1F0YA 2J5SA 2AQIA 1PIXA 3ABIA 4R1UA 3LZ6A 1JWBB 2HSDA 4CMAA 1R37A 1A4IA 1FMCA 5DN9A 2JD2A 3OHSX 4FCCA 4PN3A 1EY3A 1XNWA 4CQMD 3AU9A 4OH1A 5JMWA 2EIHA 3BTVA 3W8EA 5EJ2A 1TVEA 4ZDFA 1XYGA 5HS4A 5JAMA 5EERA 2GCGA 4BNUA 4U0KA 4WLOA 2VHWA 3H3FA 2ZYDA 1LRJA 2C29D 2PWZA 5I8WA 3R9TA 1PTJA 3VH1A 4WCFB 2UUOA 3QSGA 1YBMA 4Q3BA 2NQTA 3BMOA 4FFLA 4O1MA 1B8VA 2JCXA 3S8MA 3KHUA 1XG5A 3PQFA 4YAEA 4ZRNA 2GR9A 2AEFA 1DRVA 3M1AA 3V1UA 1P0FA 4DGSA 2O3JA 4JJTA 1M75A 4KZPA 4O63O 4KTTE 5TJHA 2IEBA 4GAEA 4NBUA 5ENVA 1V35A 4YB8A 3WGZA 1N8KA 5G2OA 3F6YA 3P5SA 1GV1A 1Y8RA 1I01A 1E5LA 1T4BA 4EITA 3ASVA 2YHUA 1Z7EA 1J0XO 1YL6A 1KERA 1ULUA 5JBXA 3F1LA 4E31A 5KVCA 1RPNA 3DJAA 3ZHBA 2EWMA 1IPFA 2DFDA 4QQRA 3EZLA 4WGGA 2WD7B 1BW9B 2UYYA 5HWSA 1BDMA 1VJ0A 4BO0A 1IZ0A 1QSGA 3DORA 4MKXA 1Q1NA 2EXXA 2ZB8A 4A5OA 4IXTA 4CM1A 4LSMA 4II2A 3PYLA 3ITDA 1HLDA 5DZKA 1SEPA 4G81A 4MIOA 4A27A 1ARZA 1QRRA 1ZSYA 3NDRA 4GQAA 4P38A 1BTOA 3OF2A 1V3TA 3JQ8A 3MJTA 3ZNNA 4B8ZA 4JOTA 4BS9A 1UYTA 3KTIA 2W3PA 1BXGA 1MLDA 4J49A 1GUZA 4F47A 2JD0A 2IZ0A 2CDBA 1DRUA 2BGLA 1XU9A 1NWCA 4NJMB 4HFJA 1Y8QB 1H6DA 4MO2A 5COBA 4IMPA 1LDNA 3LLSA 4QIJA 1LLDA 1WPQA 4YJFB 4AJJA 1HSZA 4MXIA 3DTYA 1YL7A 2VRCD 2YUTA 3IL2A 5KKCA 1C0LA 2EW8A 3FR7A 5FF9A 4ELXA 3PQDA 3ZNPA 1CJCA 4NJOA 4UEJA 3I9JA 5I7FA 1ZCJA 1HF3A 4XJTA 3LSYA 1I30A 1FDVA 4Z6KA 5ITVA 1HEUA 3RFTA 3SWXA 1LLQA 1EVJA 1CWUA 3AM4A 1X0XA 3OECA 3F1KA 2PZLA 1QR6A 4LK5A 2VYND 1OC2A 4XYGA 4BGIA 4IQ8A 2W2KA 1I33A 2EHDA 4IQGA 3BA1A 3DAFA 4LISA 3SC6A 3HWRA 3QKAA 2ILTA 2C5AA 1OI7A 3AI2A 1A72A 3LYLA 3BMCA 3BPPA 3ISAA 3RJ9A 2YHIA 4PG8A 4J0EA 4OSOA 1DJNA 4BMSA 1IB6A 4B4VA 2BH9A 2FR0A 2OORA 4Q9NA 3O38A 3OC7A 4YAIA 2JFGA 2Q35A 1O9BA 3AI3A 1NHGA 3VH4A 2Q4EA 2PD6A 2C7VA 1BXGB 2XXBA 3Q3CA 4U5QA 4XGNA 5G1QA 5JBWA 1H2HA 4ZQEA 5LDHA 1D4FA 4PCVA 4TMFA 4BKQA 3GMAA 5CFZA 2F6IA 4NZ9A 4OOFA 4ILKA 1Q7BA 1Y1PA 5BNIA 5HTOA 2FMUA 3R3SA 3QMJA 1RM5A 3NKLA 2C59A 1SZOA 3QK8A 3R6DA 3CTMA 3HDJA 3KBOA 4RV9A 1E77A 4B4OA 2IXAA 1SCUA 5AXDA 3T89A 5B4UA 3NGLA 5C7IO 1LSJA 4ZDCA 4D44A 5IJZA 1PQUA 2VSUA 3PRJA 1KEUA 3RUHA 1DSSG 1ADBA 4U6SA 1ZK3A 1LSUA 2E6UX 2GDZA 4HWKA 1R4NA 5DOZA 1ON3A 4R01A 2PLAA 1PGJA 3WBFA 1VJ1A 4DRYA 1R0KA 1JWAB 3NJ4A 4CMIB 1LU9A 4AICA 2ZJ1A 1P77A 3NJBA 5CTBA 4E32A 4AJ1A 1OD2A 4ONEA 2P68A 3LC7O 4LK3A 1U8FO 4IDEA 3F3SA 4R9SA 1EVYA 3V2HA 1P44A 1T1RA 4AJEA 1YG8A 3OEYA 2BELA 4IS3A 5JBIA 1MP0A 5KJ6A 5E0SA 2OGUA 3R0IA 1GYRA 3OJ0A 4G2NA 1R15A 2YHIB 1VC2A 1MX3A 3MJEA 1NVGA 3ZW8A 4MVJP 1EDZA 1SAYA 5JS6A 3QREA 3WX0A 2Y66A 2CMDA 3HE2A 1HDZA 1YB4A 1S7CA 8ADHA 1T26A 5MDHA 3I6QA 4ND2A 3SX2A 4OMUA 3TN7A 3W4JA 3NDJA 2YJZA 3AWDA 1E7RA 1W4ZA 2NWQA 4KOAA 5KKAA 1Q0QA 5L4SA 4GMFA 4BV8A 3LU1A 3HNPA 1UDCA 3NRCA 4YJDA 3QXZA 7MDHA 3O03A 1TT5B 4UUOA 1BHSA 2ET6A 4AFNA 1H2BA 3RUAA 2B4TO 1YH3A 2R00C 3K5PA 2DBRA 2X7HA 2QX7A 4YACA 4YJHB 1CERA 3E9NA 3JCZA 4J2HA 3SXPA 2Q3EA 4WOJA 2IODA 1Y5RA 4YQZA 3S2EA 1H94A 4P4GA 4AL4A 3DZIA 4QIIA 1KVSA 1GPJA 2PK3A 1WMAA 3M2PA 2PD4A 3RSIA 1MC5A 2X22A 4XRRA 2B83A 3RC1A 4G2RA 3U09A 4E13A 1HWYA 2YFQA 4FZWC 3X2EA 2ZTLA 1RM4A 4IIVA 3M1LA 4FDAA 2C07A 2VOJA 3SVTA 1E7QA 2RH4A 4I1IA 1Y9AA 2BD0A 3K31A 1UP6A 2BFPA 3R6HA 2Y67A 2OOSA 4MPDA 5L7YA 3KB6A 3TPCA 3T8BA 1U3TA 4Y98A 3TT6A 5IFLA 2NVUA 5ADHA 3DZBA 1P0CA 1DC4A 3GG9A 4PG6A 3ST7A 4GGPA 4N7RA 5JW6A 2WYWA 4YT2A 1ORRA 1WW8A 1DXYA 3GRKA 3G49A 4DLBA 1KIFA 5U1PA 3H81A 1ZMOA 4DBVO 3FRJA 3IP1A 5DCWA 3C8MA 4EGFA 3RRVA 4TRRA 3GNSA 3RC9A 4OM8A 3V5IA 2ZQYA 3O4RA 4FD3A 3E48A 2YFHA 2RCYA 4JROA 2P9CA 4N5LA 2FY8A 4NNJA 3BMNB 4FR5A 2DKNA 4BL5A 3JQCA 3FWZA 2Z95A 2QHXA 4FW8A 1ENOA 4Q3EA 3U4HA 3ANNA 1HXHA 2Y1OA 1LLUA 2PH5A 3OH8A 1XGKA 4D0SA 1U5CA 3DOCA 1CRWG 1CQIA 1D1SA 1PL6A 3E18A 3AOEC 4B7CA 4JP2A 5IKLB 4GX5A 4DYVA 5A5EA 2I66A 2OBNA 1P3DA 5TT1A 4AJHA 3QHAA 2HKIA 3LAOA 1UAGA 3OICA 5U9CA 2VOEA 3ADPA 3E8XA 4EW6A 1HE3A 2HJSA 2HRZA 2X23A 1FK8A 4Q3CA 1TYFA 3B1JA 3EMKA 3MYBA 4UREA 1FXSA 5KJEA 3INGA 4HV4A 3KTGA 5JO0A 4ZN6A 2C2YA 1JVBA 2OP1A 5JDIA 4FOSA 2NADA 3VZPA 5F5NA 3INTA 3T8AA 3WR5A 1X13A 1NR1A 3RFXA 1KY4A 4GI2A 2I3AA 3I9KA 3UH1A
chains in the Genus database with same CATH superfamily
2R8OA 2WNHA 4A8PA 3GVPA 3I2FA 2BEWB 4ASIA 3COPA 2WMNB 5EOVA 3CZMA 3F47A 3JQBC 3OFND 5CCXA 1SKAA 1G6KA 1XN1A 3PX2A 4RDXA 2Z98A 1BU5A 3VNBA 2ZBDA 1SJ9A 2CXTA 3NX4A 4G1EB 4TLCA 1OXXK 2QZ4A 4ER0A 1ZD5A 1DBSA 1M6YA 2JHPA 1SVUA 4TTPA 1RI4A 4E5YA 4EY6A 2QX9A 5TE9A 2FPUA 3F7OA 3HU2A 3T88A 2YZNA 1WY5A 3TZEA 2ZB7A 4B7AA 5IKEA 3K9NA 4DLUA 5TMDA 4Z9FA 3ONNA 4RAOA 4FN7A 1SUEA 7ABPA 4N7JA 1CUCA 1BWPA 1JVNA 4RO0A 5AI4A 5FYQA 4PO3X 2B98A 1WRBA 4OHWA 3B20A 2XPCA 3W3AH 4Z3KA 1YE5A 2HLNA 2VO1A 2Y1DA 2Z2XA 3SSOA 5CLHA 5GMOA 1E2DA 2OL4A 3NONA 2PT9A 1J25A 3DDNA 4NH4A 4ZRMA 3K71B 1RU3A 2N1BA 2XE4A 3KOXA 3SHFA 5JATA 2A3NA 3AFOA 2OV6A 4GE3A 4JBIA 4KJZA 1ZUWA 2H4XA 4OHKA 1ML3A 1NX9A 3FBTA 5CLJA 4H0NA 2A30A 3H4TA 5IG2A 4UU7A 3ECCA 2EZ4A 2YN4A 3G13A 4FXPA 5ALRA 4DA8A 1ZJWA 2K5UA 2R7MA 1DB3A 2P1DA 4ACAA 5KMGB 4QXMA 6ABPA 1N1MA 3LIPA 3IAS1 5T8KA 1JEQB 4IMJB 1WU7A 4K26A 4KFTA 1P17A 3CA8A 3KT0A 4RC9A 2Y6UA 4IIFA 5C1IA 4YAGA 1FS5A 2NZVG 4LNAA 5TDHA 2PRIA 2WU3A 3CRQA 3SIWA 2A7SA 1J20A 4N54A 2PRYA 3OZAA 5E38A 1L7VC 5HCIA 4EY8A 1BWQA 1UQRA 4UNQA 3R3WA 4KPYA 1NOJA 3L6DA 1R9NA 2J3EA 3JXEA 4TMXA 3PEFA 4UVHA 1C9MA 2B8JA 4GLLA 1G8AA 1ZL0A 3EG9A 3KC2A 1AS3A 3WLFA 2XMSA 2GD1O 5EJIA 1V5IA 2XT9A 4EBFA 9ATCA 4WN3A 3KSDO 1SZCA 3B7GA 4WMLA 1T2VA 3ZHCA 3H3XA 2A57A 1ISSA 2CKMA 2BGRA 4DLAA 2BTEA 4N65A 3U80A 3EEIA 3QVXA 1YR7A 3I5AA 4C7OB 1KZ4A 2DFTA 4N3CA 5JNSA 1Q1BA 5IF3A 3SIRA 1N6PA 2PBZA 1OXSC 2IITA 4QNRA 1EFUA 2AS0A 4XIJA 3TRRA 2M6SA 5EZSA 2VXBA 1PZEA 1DAMA 3FFBA 3WAKA 3GLGE 1FRQA 3M5WA 2QQ3A 3IOMA 5C8VA 2I5PO 2M6KA 2PPYA 1EMDA 4DB4A 1ZFNA 4OLJA 5ADVA 5EZYF 4G5FA 2ZRQA 3FNQA 3HXQA 4OHUA 3O4JA 3P9QA 2QTCA 2C2OA 3QVVA 3ZW9A 4KXQA 2YJ4A 4RYLA 1Z3CA 4PGGA 4D9EA 3FMFA 3GJ6A 3OM0A 3ADCA 1CKEA 3HKBB 1CJUC 2X0EA 4DQKA 1TQ2A 4EJSA 3ST9A 4DIKA 2V96A 4CF4A 2VTEA 3LT5A 3RROA 2EW1A 4KSBA 1C0IA 4AX8A 1EP9A 1T4MA 3HYNA 3O26A 1CJKC 4B46A 1Y1RA 1QS0B 1EXWA 3CWQA 3EFBA 3PC8A 5I8ZA 4QBTA 2I4OA 1Q1AA 1GOTA 2JKZA 3Q11A 2YJTD 4YMLA 1ZJ4A 3FSJX 2ISCA 4HDNB 1T91A 4X1YA 1DHTA 2WYHA 2EJVA 3OQVA 3WGQA 3T52A 3KSAC 1PD0A 2RD2A 3IVCA 3C98A 4YRMA 4RPGA 2VK1A 4IIBA 1KTIA 4BNHA 5JISA 1LF5A 2X2FA 1E4YA 5TF0A 2XOKA 4JSBA 2HQ1A 4Q1AA 2IH5A 3FMOB 3L5OA 2LCIA 3D7NA 1LB1B 3UUGA 4C0LA 2IEZA 3P0IA 4NBKA 5M04A 4P4UA 4CLXA 2CHEA 1D0IA 1GPKA 2ZIUB 1ZRSA 2W2LD 3L8YA 4UXJA 3CJTA 5DNDA 3T0IA 3THOA 1LTKA 4OQLA 4Z51A 5C46F 2ZYVX 4KWCA 4ON9A 4JI1B 1LWOA 1VSUA 3VU9B 5K3AA 3EIWA 1F0NA 5C37A 4G0WA 4HN9A 2PUCA 2HHHB 2A5FA 4BVFA 3UUEA 2AA3A 4HVAA 4RPIA 5CLFA 1CFJA 1XZBA 4IRXA 5F73A 4ZVKA 4JYZA 1QO9A 3BM5A 1JI3A 3A1TA 4DYDA 1HFEL 2GFIA 2R25B 3FJ1A 3KZMA 3WFZA 4EOGA 5ALVA 5B6JA 4OMFG 1U9JA 1RRPA 3QW2A 1KEWA 3PIRA 3ESYA 2FLWA 2Y77A 3MJ4A 4K2AA 4PHCA 3ECAA 2JIQA 4PZZA 4XX0B 1FDIA 5KQSA 4WFJA 3ICEA 5B55A 4EGQA 2OV4A 4NG5A 4DZRA 1VA4A 2I2FA 1AKMA 3RGGA 4Z3DA 3BTOA 3K2EA 1RLTA 2BOVA 4KFSA 1EZ4A 2GKGA 4TRJA 4AJNA 4POAA 4JH0A 2E4AA 3VQTA 4BMCA 2PUFA 3THRA 2HLPA 5K99A 2ZKIA 3ZWBA 2DPMA 2FWIA 1VCHA 4XASA 5HX7A 3ILHA 5J4YA 1USGA 3E81A 2PUBA 2BYTA 2W22A 4DEYA 1M8PA 2O8FA 4KUHA 5CA1B 3DEFA 3NALA 2IZ1A 1P9LA 3A37A 2IHZA 2PS9A 3I5YA 4Z0MA 2X24A 5DHQA 2VSXA 5AKHA 4D74A 5JUWA 5KQLA 2B82A 4DILA 2EATA 3H7AA 3LS2A 4NNPA 4BNIA 4TRNA 3MERA 3RC7A 3KNZA 1KIMA 2DVMA 5KBYA 1O96B 1JNXX 4GPTA 2A5LA 1WEKA 1NAIA 4OK6A 2FHSA 2G8LA 4CZ2A 2ACWA 1Y0BA 2BR3A 3AMVA 2VXOA 4IF6A 4V3CA 4YJKA 3B8EA 1YOBA 1OTYA 1WKBA 1NX6A 1Q7CA 1RWXA 1D7OA 2HEGA 2VN8A 3CINA 5HCNA 3RBXA 3TZHA 3W8RA 2AE2A 4G0UA 1AKVA 1U11A 2QL6A 2B36A 2P62A 1YHZA 3H2IA 5F7ZA 2I7VA 4R16A 1ZK1A 2XNHA 3Q6NA 4RVSA 4EHFA 3FCYA 1YL5A 3OPXA 4LS3A 2I4NA 4QNMA 2ZUUA 4IW3B 5AJZA 5K3CA 1UPAA 3V4OA 3EJ6A 3DHEA 2DPGA 4FCTA 4URFA 10MHA 4E4YA 1O94C 3Q1TA 5BR7A 2C83A 4CFZA 3JU1A 2CCKA 5K6AC 4NBWA 1IOWA 2V7BA 3DHNA 4DWWA 1UJ5A 1PJRA 4KAJA 5C35A 3VIVA 5IS2A 3S40A 3B36A 3LX8A 1SIOA 4EF5A 5LOVA 3MT6A 3KJGA 3KVOA 3UGQA 1IHYA 1K1EA 3GV0A 3QK7A 2FPIA 2YR0A 4GVLA 5DYWA 5H59A 3GLGA 3ZLVA 2P27A 4PXSA 1SB8A 2GZDA 5DTWA 2FLKA 5KOYA 3OTOB 4MI1A 2YWEA 2NU6A 4X6LA 2PPLA 5DXJA 4F4JA 2IEIA 1T1SA 3FDZB 4MWEA 4TM7A 2PA3A 4S0XA 2ACVA 1UUFA 1VSTA 1JMYA 1I5EA 1MOQA 1F2TB 5TPWA 2QXTA 4WDQA 1ZJJA 2HNBA 3KJIA 2I4MA 4PTZA 2F1KA 5KMGA 3DZKA 3PXCX 1UFQA 8LDHA 1H4SA 1OU0A 1FW6A 2QZJA 1DQZA 4ZCQA 4D79A 1QGZA 1M7HA 2WAYA 4NMXB 1EHYA 3WIUA 1NVFA 2QN3A 5A02A 2FOLA 3U48A 4N47A 2RGNA 4HG2A 2UVQA 4XPIA 3WICA 2R6R1 3FFAA 1EHCA 3BTSA 5E2BA 4F2WA 3HQ4O 2YYSA 5LQAA 2CLIB 2J3LA 2YYAA 3CU5A 4JYBA 4RHYA 4IGAA 1HEIA 2HSZA 1Y9ZA 3REFA 5BVGB 1SXQA 4GT1A 1L3CA 2NXNA 5DU2A 1GZ6A 3QHQA 3RTBA 5AKLA 1CS0A 1UMBA 3EOBI 5C7LO 4EJ2A 4PYIA 4YMWA 4CMIA 4DLWA 5EE3A 4PZEA 3JYNA 4A26A 1KJ8A 2H1SA 5KVAA 3DVLA 3NRBA 5JI3E 5CIYA 2O05A 1KYTA 3WFJA 3ACCA 4IR7A 4M36A 4AY5A 2FUCA 5FAKA 2PR2A 3N74A 3OFVA 2NT3A 5K3BA 4BEBA 2GXSA 4UBJA 3IRUA 2HHAA 4M0MA 1I2ZA 1SUCA 3UK0A 2SHKA 1OQAA 3L6RA 1GGHA 4AROA 4NH0A 3D7LA 1KMHA 2C0CA 5J2TB 1RLJA 1E4EB 4FFOA 1QIHA 2Y0DA 4RAQA 1P74A 5K1ZA 3SZLA 4ESEA 3DSRA 5I4IA 2OV3A 2X9QA 1WBDA 1L8XA 1OYYA 2XA9A 3ROTA 2HRCA 5DU8A 1T4DA 3G8CA 4QO8A 1WNTA 3TZLA 1CY6A 4TWBA 2AMFA 3QFTA 3STAA 2ZDQA 3P2OA 1SURA 2HEIA 1Z83A 4MA5A 4KR2A 3EF1A 1NUTA 1AU9A 3JAKB 1N2SA 1U7OA 2NVOA 1QFJA 4NI5A 3AF4A 3EXFB 3P4UA 4OUDA 5BVHA 4Q1EA 3H13A 1KO1A 1IN5A 1RKQA 4XD7D 1QTQA 3IEXA 3WJ7A 4JLKA 5KU7A 3ANMA 3Q8LA 3PGLA 3G17A 5JCXA 4EA9A 3HB7A 3FHLA 3I92A 4OKNA 3TQIA 3THXB 1JSRA 1NDHA 4EHNA 4XQ9A 3W3AA 3L7AA 1O3YA 1U5BA 3R20A 1GPH1 3A9RA 1CE8A 1M34A 2OV1A 4MTLA 1S2GA 3VV3A 4DBLC 2L19A 3ND6A 1NURA 3D4LA 2GYUA 4DT1B 3D1VA 2I6SA 2GK6A 3SM9A 1Z34A 4HLCA 1I6WA 4ENRA 4EFNA 3HBJA 4EX6A 1I2BA 2X9NA 3X43A 5JXJA 1VE7A 1RPZA 5IUKC 5ALKA 5LD2B 3H0SA 4X66B 4EI2A 4QZVA 4YHBA 3RJZA 1PT6A 1KBOA 2OCXA 1C9KA 2OM6A 3DHYA 3PC4A 3TG2A 1W34A 2HQRA 2GS9A 2NO9A 4D9IA 2D6FA 5DWQA 2KJQA 1GUFA 2JIZA 2N9UA 2GBFA 3GLQA 3L0YA 3VPDA 5JPDA 3DOOA 2JF0A 4GZ5A 2YJGA 4NYIR 5D3KA 4MDHA 3ISJA 1G38A 3UOAB 3AINA 3OG9A 4O4JB 2XQVA 5HFJA 3DGEC 1FDRA 1DBVO 2VXCA 1OY1A 3MVEA 3PEAA 1CDOA 3KSMA 1NZYA 2QVXX 1R4NB 3DT8A 1W0KD 2O5RA 2Z83A 3H8JA 3LBNA 1DAPA 1T6NA 5DVZA 3PNVA 3T12A 1NE7A 4ZC8A 1L7XA 3ROMA 3KTHA 2QZPA 2XE7A 5DYNA 4OHOA 1ZR2A 3HVJA 4I8XA 2OQRA 4WUTA 4S1OA 2YICA 2X76A 3GY0A 1AF7A 3M6XA 2Q8QA 4HNQA 1BG6A 5BWLA 4IZCA 3CH6A 3VDNB 3G9TA 4Q7MB 5CMLA 4ZVNA 1B74A 2X1MA 1NXWA 2A7KA 2Y0CA 2ECFA 6REQB 3EXEB 5EGSA 2QMYA 4DA6A 3ER8A 2WSYB 3CF4G 3GCDA 4KEAA 1QR2A 1YG6A 4FJWD 1NSFA 4DI1A 5PNTA 2P2SA 3L8FA 3VDQA 2XLCA 1GL6A 4AECA 4EELA 1YI8A 2F4VB 2P35A 2G7ZA 1RM0A 1G0NA 1IUPA 1U2QA 1Y7TA 1I2CA 3IDQA 3SQDA 2WI8A 1W30A 2A88A 2QB5A 2WJ3A 4L6WA 4ZDWA 1MDBA 1USVA 5IN5A 3DZFA 3L8MA 4HXEB 3VMFA 1HSOA 1F8YA 4DLVA 2FR1A 1XTJA 2QUZA 5ECGC 2CUKA 2F9YB 1EX6A 2JH8A 4JOBA 3UA4A 2XGSA 4E3ZA 5E3JA 2A7QA 1ZYUA 3KTFA 3H97A 3RRFA 1XLWA 1Z4PX 4X1OA 1AGRA 2JCSA 4P33A 1W7AA 2JGAA 3QHPA 5EWMA 4YI3A 1XO1A 5EIAA 4BX9A 3QNMA 4R1TA 1ISIA 2B4AA 1KORA 5J1SB 3K1AB 5JIBA 3I45A 2RI1A 1RW4A 4GC9A 5GOTA 2CXPA 4GMDA 4PF1A 4HJRA 3HU5A 5DX8A 3QE9Y 1MPXA 4PPFA 1VHWA 2AFHA 4XTCS 3D4BA 3RPEA 4DHWA 4L76A 4DC0A 4W1SA 2WMYA 1THTA 3LXXA 1P9NA 4DA9A 3RSTA 4LE0A 2P2ZA 3D59A 2H7YA 2WF8A 3PC6A 4KN5A 4WFIA 4ZT3A 3AXTA 4Q4CA 1MHTA 3IILA 2FN3A 3H6HA 2WWWA 3WJ2A 3KETA 4LQLA 4GLBA 3PJRA 1V8PA 3S68A 2ZTSA 5ALTA 4Q5IA 4XSGA 3BDIA 4HEA1 1EAYA 1Y5IA 3NHPA 4I4ZA 1QFZA 3B8HA 3SYRA 3F73A 4OK3A 1VSQA 3E9CA 2P4QA 3JYQA 3QITA 3RVQA 4ZVRA 4BB6A 3AH8A 2FUNB 3K0SA 2WJ6A 4I5GA 2PO5A 5SY6A 2H4FA 5L9AA 2AMVA 4AUKA 2GEJA 2GN4A 4V38A 1R00A 4BJ1A 3EPLA 4Q3NA 1CR2A 3BD7A 2MIIA 4ZMBA 2XA1A 2OOKA 4V39A 3T15A 3W90A 3WLLA 1OFGA 1DWUA 1SQFA 1K7SN 3QXSA 4K86A 1KAMA 4F3RA 1RXVA 1GNRA 2XMCA 3C5WP 5GJWC 2W6PA 4Q6WA 1DPGA 1Z7YA 3B5IA 2Z5GA 1WD5A 3V32A 1ZA1A 1OBOA 3OZGA 2FW9A 4KREA 2ECPA 2O1XA 2AD5A 3O4VA 5J2UB 5BY2A 1YQUA 1WZNA 3AHEA 3LQKA 4I52A 1GPAA 2WYIA 1GSHA 3IVAA 2WIBA 3GLFB 3HO1A 1UYRA 2XUGA 3A4LA 3N0WA 5LZ4A 5CUQA 5BSUA 4Q1IA 3OD5A 5A3RA 2QU8A 2G08A 4H3HB 4D46A 3KPVA 4TV8F 2DY1A 2QG9A 1YQXA 4NBLA 5TQVA 4CPDA 2I99A 1E1RD 1Q3HA 2DTDA 4QL3A 5BSFA 4NYJQ 4G5OA 3ITKA 1DC3A 1F06A 4P7GA 4Y2UA 5IKMA 2AV6A 2RAUA 4QDXA 4DIBA 3D0RA 4NNOA 1AC5A 2ZJ4A 4RS4A 4RZQA 2IYOA 2J85A 1ZD8A 3DV0B 1OJLA 3WV4A 2Z5LA 5JS1A 1US8B 4KAFA 4A8JC 1E59A 2O2ZA 3C85A 3SGLA 1YBHA 2HU2A 3BK2A 1UCFA 3R8XA 5KYKA 1Y42X 4GO1A 3ZTWA 3A6JA 5KYUB 3A6PC 4GX2A 4XDZA 4B5KA 4P4SA 3LUPA 1SR8A 3RNOA 5CDFA 1NFRA 2EGUA 2ECQA 2Q1YA 3NV9A 3MN1A 3U4CA 4L73A 421PA 4E15A 1YQTA 4H35A 4AS2A 1QK5A 3FBWA 3LAWA 3Q85A 5E7IA 3AI7A 4TMTA 1TZCA 3OT4A 1G16A 1NM5A 1H1TA 3COZA 3QVTA 4ZI7F 3OU2A 5CH5A 2X42A 1UK8A 1U8UA 3C3JA 3MIIA 4K8OA 4BFTA 2WHYA 4CR6A 1KKMA 1Z2NX 4C4PA 1OWNA 3FUVA 3GVCA 3A7DA 2IGTA 3CXRA 3GPDG 1WMSA 3LLUA 3OEHA 1MCZA 5DK4A 3BE8A 5T4EA 1C9DB 2CLKB 1H2AS 3HBNA 1ECJA 4EG6A 1NQTA 1BWSA 3V8MA 1EVIA 2D2IA 3TUIC 1R10A 4LTMA 1OT3A 3MGAA 4J1SA 2FJUA 2EP5A 5EUBA 5J5VA 4JA0A 3G0OA 1YS6A 4FJ1A 1Y82A 4L2IB 4HRXA 4JFCA 4G1UC 6GPBA 3DFUA 2R87A 4YAWA 4MI6A 1P2SA 7AT1A 3PNQA 5K0CA 1J56A 3REOA 3CB4A 3QVUA 3U6BA 1FMTA 1CJSA 4ZKEA 5DBEX 3T95A 5LIPA 3U19A 4EG3A 2AZDA 5AI0A 3T34A 3VGJA 2O07A 3F9IA 5DSTA 5EIOA 4EFDA 1FLVA 1WSBA 1C0PA 1W29A 2Z3VA 3G7SA 4M22A 1E62A 1YZUA 2O3SA 4JYCA 2JGJA 3V7NA 1L7AA 2H0RA 4DV7B 1YHNA 2WIAA 1EB9A 3R0QA 4FGSA 4H27A 4WCFC 1GRVA 4I50B 4MR7B 3SX0A 1AKNA 4OG2A 4M9XA 3FPLA 3T94A 5B4VA 3L0CA 4LE1A 1CB0A 1N75A 4E2YA 3PUJA 5CFOA 1QRTA 2B2NA 2I8AA 1HTBA 1VTKA 2XADA 3N75A 2I3GA 2OCIA 4ZOAA 5BSGA 4ZOLB 2NSDA 2ATEA 4CQMA 3OQNA 3GF4A 2PSSA 3FG9A 2ZJBA 2EDAA 2QQGA 1TUBA 3LFHA 4UD6A 1I4TD 1U3UA 3Q0TA 3ZGVA 5BNZA 1B0UA 1R4MA 4YCAA 1NXQA 1XMVA 3Q9SA 4W9MC 4OO3A 4XAQA 5CA0A 3FYSA 3M3DA 2VREA 1BEZA 1LKZA 3RVBA 4F85A 3K0HA 4L5AA 1A88A 5E2AA 3PQEA 1HH4A 3TM4A 1E2JA 4JJ6A 3LPLA 4X65B 3OOHA 1PT7A 4D43A 2GZAA 4CF5A 3QBJA 1SBYA 4GX0A 4X61A 3MMZA 5LXTB 1G60A 1HDYA 1TA9A 3ZXIA 3HLKA 1YVPA 2BTQB 5CX1A 4KCGA 1AQYA 1Y5MA 3BCUA 1GILA 4G1CA 3ABRB 4U39A 3W77A 2F9FA 1G21A 3F5SA 4CEIA 2FLVA 4KPKA 1QWSA 4BV9A 1YZFA 1RWOA 1T5DX 5BN3B 1JEYA 1N2BA 1U8EA 4AMYA 1N36B 1N2HA 4QU9A 3AVVA 2JZCA 1PJ4A 2ZSEA 3HGQA 3R4CA 4O5AA 1ACMA 3H2YA 4CV3A 1LX6A 5BWCA 2XCUA 2PVPA 5SZIA 4XZ3A 4BXOA 3RYCB 3C3KA 1K5DA 2R5FA 1TEVA 2RC6A 3AM3A 3DCJA 3RASA 4B6FA 1VLJA 1SG4A 2BI8A 5KREA 3N8GA 1YD7A 3R4VA 4PW0A 5UKDA 3PDUA 1PF7E 4GPBA 5GJBA 2GBLA 2QP9X 3K9CA 4GR9A 5KOIA 3HPQA 4HDMA 5JAOA 1N5IA 1PJSA 2C5EA 2QE6A 2VPYA 3BL8A 4YJ3B 3WA6A 4NFLA 2WE7A 3ROQA 4ZV7A 5HQTA 2NGRA 3K30A 5D84A 3H02A 2PCLA 2W2LA 3DQPA 4KU4A 1DG1G 1WOYA 4HQ0A 3W7BA 3DOUA 8OHMA 4F4HA 4LYGA 5MGNA 5HKOA 3EPJA 4UARA 1Q3TA 1X86B 3SSAA 4RH0A 4EGSA 4DDKA 1O6ZA 2J3DA 4JC0A 2QRUA 4BO8A 4J43A 3AEYA 2QN2A 1FU8A 4OSEA 4DBLE 1PR4A 4FFDA 3VX4A 3G0DA 2PX2A 2NZJA 2I55A 2FPPB 1ECGA 4ZU1X 4K88A 4S24A 4KRXA 2OVBA 4AXBA 4G8DA 2B5OA 1E3IA 3BWDD 4IOLA 4L0QA 3W1VA 2D0OB 3UO8B 1I7PA 3O1HB 3Q72A 2WVHA 3M6MD 1U8TA 3F5FA 3OTHA 5E1DA 2X8JB 1RMTA 3SDSA 3EIHA 3MEQA 5KWEA 1MC4A 1N6DA 4RMNA 2PX3A 2VHVA 3CUYA 4XLLA 3H5IA 4DS3A 4XM0A 1R0RE 2IUEA 2CT8A 2Z6AA 8AT1A 4M1EA 4JSRA 2WWTA 1VQ1A 5BRJA 1XZIA 1I3OA 3JYHA 4L75A 5EJ7A 1L5GB 1KI1A 4RQUA 3I9LA 4AJLA 3U9SB 2ZI7A 2X4IA 3ZCPA 4EDFA 2FFBA 2HMYB 4P2BA 4AYWA 5K45A 2FZ4A 2W6QA 1NNI1 1T6ZA 4N0QA 4M0EA 3NTRA 5L8VA 3FTEA 3EB9A 2HWXA 4WGFA 4GOND 2QV0A 2ZSDA 1I13A 3QU5A 4J3JA 4D56A 4DM4A 1W9HA 4YT8A 1YIAA 4S2UA 3WJAA 1LSSA 1O7JA 2OGTA 2H1HA 3NT4A 5AP9A 4B6QA 2ZUDA 5B3JC 3PFNA 1Q0RA 4PTLA 5KQMA 1YR3A 4IINA 1L5LA 5GTDA 4JT2A 1X39A 5J1TB 4IFTA 2QLTA 2O2CA 1QGAA 3LUFA 1E1LA 4V1CI 2O0HA 4MULA 1A9ZA 1W25A 2H2WA 1P8JA 4QO7A 5G1NA 2IGBA 5JQWA 3RS4A 1JLMA 3AEKA 3GQBB 1GPNA 2J8ZA 3FFTA 1ZVMA 4EMLA 3QV1A 3PA6A 1BHQ1 4OSPA 4E46A 4H1WA 4TXNA 4ALJA 3I73A 3IERA 2I1VB 5JSFA 4PSAA 3TJZA 1YASA 3MWDA 5BQXA 3GD7A 4ZTBA 1U90A 2DJIA 3LPDA 3O8QA 4FONA 2H9AA 4IDBA 4L15A 4RJIA 5EQFA 4GDFA 3PR1A 2XBMA 1UAAA 1E1QD 1E5DA 1SUPA 4EG5A 5L53A 3CTVA 1KO8A 3C43A 1NR5A 1ZONA 1DOHA 2I33A 4K3VA 4DV3B 3V4RA 2A9FA 3AIKA 1F6DA 1X0UA 3FYUA 1H9BA 1SZJG 3ZDFA 3DMRA 4O4HF 3U4MA 1OXMA 3VKWA 1XHEA 5HRAA 2WP0A 2FRDC 2GEBA 3QPDA 2VDNB 3PF8A 4GM0A 4PYRA 4DPMA 3P2LA 4QYSA 4CKCA 1DXOA 3I1YA 2HCTA 1GNVA 4A2QA 3FE2A 3KVVA 4D9CA 1XELA 4HAWA 4N1AA 2F1OA 1JECA 4JQOA 4EHIA 1J2RA 4RA9B 1KARA 3QUAA 3OCCA 3JQDA 3RVRA 4XQGA 5T57A 3LK6A 1PUXA 4PYKA 4ZGBA 3DZ8A 4FR2A 2ZITA 4NE7A 4KQEA 3LW7A 1IK4A 1ITZA 1UQUA 2XXAA 2OKGA 1TC2A 4KIFA 5DB4A 1KPIA 3UMVA 1QNLA 3H2ZA 1U2TA 2DU8A 1DHRA 4N3NA 2NYUA 2GTIA 5M34A 4M46A 1NF3A 1RAIA 4PU0A 2OLJA 4K5QA 4LY9A 5BW8A 1WXQA 1MEOA 5G0UA 1RFLA 1YMQA 1ADGA 3QE3A 4YO7A 3G64A 4GOJA 5SZJA 2HY7A 1PP4A 1PV2A 5DCYA 1UOOA 2WM9B 3NDIA 2DQ4A 4PGHA 4ZEWA 2HIGA 2Z1DA 2VA8A 3M1IA 5EWLB 5JZOA 1UBMS 2AEJA 4MUBA 4HH1A 1GTRA 1M6VB 3T5MA 4H9GA 2XB4A 4XPZA 5JYDA 2IEDA 4GXTA 4OA8A 1GCGA 5H3LA 4CKYA 5GV7A 1Z74A 1OWOA 3HP1A 5JDIC 1P1FA 2I6UA 5JSZA 3DO8A 3HYSA 3K70D 4MVXA 2D1FA 1Q7GA 1E8MA 5DTRA 4WLUA 1E32A 4ENSA 5JBQA 3ROXA 5IAKA 3FN4A 3MOIA 2WAMA 3RYHA 3BWMA 3GEGA 3ZW7A 3PLAE 3AF6A 5LIRA 1E98A 3U40A 5CJPA 3ZIDA 1T9KA 1U1IA 3WRWA 1JSLA 2IELA 4EY5A 2JCGA 1IL0A 3FUXA 2FP4B 1PV4A 3TTUA 2HBQA 1PTJC 2FR8C 4L6CA 1D03A 1Z47A 4B7XA 4BWFB 3CEJA 2A1UB 1H3FA 3BDVA 2F1HA 3AETA 4EJSC 4TMKA 1NP3A 2QG6A 2QVZX 2PFGA 3IMGA 1F14A 4RK1A 3TSOA 2HBYA 2WAOA 2ZRMA 2O3TA 3HLYA 3U4AA 3WWOA 5BRAA 5JCJD 2F8TA 3CKKA 3SJBA 3W3ZB 1XLTA 1EXMA 3I39X 3F3KA 3EIQA 4C1BA 1JT9A 5DCLA 4CF6A 3U9LA 2CFSA 1MA0A 4BKPA 3LFTA 3N2ZB 4XVUA 1CNEA 3D0QA 1OPRA 4LJLA 1FDWA 1JU4A 4URZR 2B69A 2VHCA 3SR3A 4EVQA 3SQWA 4G1FA 5U4QA 4RW0A 3LECA 4DUPA 3GU3A 4I6EA 4A92A 1S8OA 3DMHA 3E2PA 4EEXA 3WHPA 3CPEA 4BTVA 3OC6A 2E49A 1KL7A 4GKVA 1CF4A 3HJHA 5JTTA 4HNSA 3A28A 4URHA 3R9SA 3OESA 3A8TA 3R3YA 2C31A 5DASA 4W9NC 5A6SB 2X9LA 3UYKA 3RDPA 3W2GA 2YFKA 3VX3A 2GBPA 2IH2A 1TO2E 1HE8B 1GVNB 1Y3CE 2XDQB 1NKVA 3FF1A 4OCZA 1VB5A 1IQ0A 1G7TA 3OE4A 2XODA 3IT3A 3PENA 3LC2O 4NENB 3KEGA 4YVFA 4QU8A 3W0LB 2OO5A 4WFQA 3TOCA 1U31A 2YCLA 3CCBA 3AM5A 1NVUQ 1FNSA 3F2IA 4V0MA 4DR5B 2XGOA 5D87A 4ZKDA 5JASA 5ELXA 5JZMA 2XR1A 3D4OA 3I47A 1T2AA 2NU9A 1EF9A 3IE1A 1ZJ6A 1WCXA 4JJEA 1UDXA 4BN4A 1WTAA 1NU6A 1QVZA 3PHHA 3QFCA 2IHBA 3SQMA 1P5ZB 3LDHA 3JQRA 3I0MA 2VZEA 3AEXA 4P0TA 5LZ2A 1QGUA 3G2OA 1W19A 4QVIA 2JLWA 4O4JF 4INJA 1AY0A 3GCGA 4A0RA 4N4AA 4IEIA 3A3OA 4DF3A 6PFKA 2H1LA 4H2DA 1F7VA 4ZO6A 2Y05A 1LWNA 1TZBA 2I1WA 1ZVVA 3TLYA 2A84A 4TMYA 2PKQO 3WTCA 1A5AB 2QIOA 3IPYA 3KOWA 1CZKA 3DFZA 4HMQA 1ADCA 1WULS 1YC5A 1N5KA 2XMBA 5LMCA 2JLAA 1X74A 2H65A 1SZPA 1VDZA 2IP2A 2PT5A 5AM3A 4PZPA 3KJHA 2PL3A 4F9FA 1LV8A 4WIAA 1GDHA 1U0SY 2AQKA 1WUTA 3DL7A 3AVQA 1LJUA 4LC1A 1CEEA 3P26A 3HM2A 4ECEA 4C2AA 1NW9B 2IVFA 1J7KA 4PLCA 4GXRA 1JA0A 4ZANA 3UXYA 4CKBA 1HTTA 3GZTB 5JJIA 3PNMA 3DYIA 1PVVA 3M6WA 3T7DA 2XNDD 4IRUB 2BUCA 3I5MA 1KVQA 3PZKA 1M8FA 4RDHA 4L4SA 2C1ZA 4F7DA 3OSUA 5A5DA 2JC3A 4B9EA 1Y7OA 1WHTA 4LKOA 4YRDA 3U3OA 2REXB 1OZGA 3HWWA 4TLAA 3NKVA 3OMXA 4YYZA 2WT8A 3QPUA 3VO9A 2Q5IA 3VR1A 2G0NA 4TTSA 1W0JD 4A0FA 2OFPA 4MARA 4Z4EA 4JAVC 1W36C 4F45A 1YJBA 1P2GA 1T3ZA 3GMSA 1KYXA 1S2LA 3AOEA 2VHTA 1V16B 2XMRA 2BHSA 4KV9A 1SC3A 4M1QA 1KOGA 2WIDA 1Z8HA 3J7AC 1HT2E 1Z5WA 3JQAA 1X1AA 1XCBA 5IU6A 4WEOA 1CZOA 5I7SA 1IMJA 4XGRA 1GKUB 3UK6A 4K9RA 4NIMA 4KGDA 4M89A 4MIYA 5EJMA 4D8UA 1A7UA 2EC5A 2ZJOA 3GFVA 1RKBA 2VHQA 4WKBA 5JALA 4FC6A 3KP1A 3IP9A 4FSXA 4IAOA 4K6KA 4RPLA 5DOVA 2JLSA 2AKEA 1K39A 1N0IA 3ISTA 3SE0A 1EFPA 4EFMA 4GMKA 5H83A 5JMOA 4IUYA 3G7UA 4R9NA 3LQQA 3EISA 2VBIA 1FX0B 3PBKA 1BOOA 2IXEA 3ZDQA 2AZ4A 5IEJA 3O84A 2JFUA 1P4RA 3BJMA 1HUQA 3HGMA 4IUBS 3AHFA 1SOAA 1VJRA 4E09A 1A8SA 3BCSA 3DDZX 2BBSA 3ZJVA 3HSKA 4MKHA 1A5SB 2GM4A 2ACKA 1O94A 1G291 4O4LF 4FINA 4RJLA 2BCGY 4HWGA 2CFCA 3WJ1A 4MPJA 1RE1A 1APBA 1JJBA 4PZDA 2YX1A 5AYVA 1QDEA 2GVNA 2VJQA 5DN6A 3T9DA 1O0BA 3FYDA 1TF5A 4C22A 4KMSA 1G20B 4Q3AA 4DM3A 3AEKB 2QN7A 3GQBA 4E07A 2ICAA 3I83A 1N2CB 2B25A 3PCXA 3GRZA 3UWSA 1C8KA 1HE1C 4MB6A 4ZIRA 3S81A 2GAAA 4ISBA 4MV7A 1V7CA 1YQ9A 4JJZA 4XGKA 4XOIA 2HFJA 5B64A 3MTIA 4UCWA 4BV3A 3VTAA 1JQEA 3N7TA 5IAOA 4LPKA 4KNPA 4H0CA 4YRLA 4YXWA 4DB2A 4FKMA 1N7GA 1ZCAA 4FZ3A 4MQ4A 4EPRA 2CCJA 1ELOA 3MGBA 4LVNA 1Q44A 4IY1A 4Z9AA 5ICGA 5AKYA 4EHHA 1NJGA 1AOXA 2F9LA 1FUUA 3H4VA 2HC9A 3UMCA 3A2NA 3OX3A 1KVUA 1SO8A 4O4LB 2HXSA 2NLOA 5J40A 2XDYA 1WDWB 3N8IA 5THKA 3VKFA 5D5QA 1J1UA 1KI3A 4TSFD 5CHEA 2R00A 1XL1A 3WGYA 1ZIDA 3JVDA 5HVNA 3U5ZB 4XR4A 1N7JA 3IAAA 2WJHA 3ETNA 4BRWA 2VRCA 3ENKA 2FXIA 4EI7A 2YIMA 4R0VA 3EXAA 3RLFA 1YU9A 5LU9A 4NDNE 3V9AA 2FA9A 3D6VA 3P20A 4GL4A 1S0UA 1V1MA 2VAMA 3HZHA 4QGAA 4QYWA 3MQ4A 3FSRA 1QH1B 2FYTA 4IJWA 3KG2A 1R0XA 1Z6GA 5DW3A 3TRHA 1MO2A 3ET4A 4Y6RA 4ER5A 1SVSA 4TYQA 7ADHA 3I4LA 2WHRA 1CY1A 4EVSA 4HDOB 1VKZA 3AUFA 1GGVA 1E1YA 2J4CA 2JIZD 4GPZA 4EPVA 3I1JA 4F11A 3D6JA 1PQPA 2C5LA 5B1IA 1K8XB 2R79A 5ERGB 1WP9A 4D98A 5L7WA 1ZM7A 3TNJA 1OLSA 3E4CA 3JQ7A 4W6ZA 1ZM3A 1IBLB 4TXJA 4F8JA 3I8SA 1GQYA 5L45A 3CVYA 3HZZA 1NKTA 4L8FA 4X24A 3AX6A 4L1KA 5KVSA 1O0CA 3MZ0A 2BN4A 3ESXA 1HDEA 1XVVA 4E5KA 2BEUA 1DLIA 1OBCA 2JCVA 3EVTA 3I9MA 4TYPA 4ZYTA 3TBKA 2DHDA 2OBYA 2NXWA 2DERA 3I9V1 2NZ2A 1ONOA 2CFIA 4IOMA 5EIHA 3S2UA 3IR5A 3GP5A 2PJDA 1I2DA 1WF3A 2BFOA 2EHJA 2X13A 4OBWA 1GGJA 5TT0A 1T0JB 1PVDA 4X5OA 3OCWA 3RRMA 1K75A 5DI9A 3NCHA 5EKXA 5CVVA