2WTBA

Arabidopsis thaliana multifuctional protein, mfp2
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
713
structure length
676
Chain Sequence
GKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGRFSGGFDIEPKAGYISIDIITDLLEAARKPSVAAIDGLALGGGLELAMACHARISAPAAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVKAEEGHSLGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLGEAREILTFAKAQTLKRAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKGLIHVFFSQRGTAKVPGVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQSRVRSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQVIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRAISKFGMPMGPFRLCDLVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKDPELKKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIMGMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLAERGSKGVLLSAPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Multi-Functional Protein in Peroxisomal Beta-Oxidation. Structure and Substrate Specificity of the Arabidopsis Thaliana Protein, Mfp2
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords FATTY ACID MULTIFUNCTIONAL PROTEIN (ATMFP2)
total genus 226
structure length 676
sequence length 713
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2wtbA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2wtbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2wtbA01
1FDWA 5FYDA 1HT0A 4BNKA 4CMBA 1EE2A 3SLGA 3E03A 1VLLA 4MP3A 3L6OO 4J3FA 1DJQA 2GUGA 4LVCA 4RQTA 5G4KB 1KVSA 1FK8A 1CETA 1WNTA 4W99A 4NNQA 3FNHA 3FHLA 1MC4A 1GUYA 3HNPA 2JKVA 4WUVA 4BNLA 3QVSA 5IZCC 5IXYA 4E5KA 2OHXA 3KYDB 1Q0LA 1N9GA 2F1KA 1JXZA 4CV2A 4N54A 5IFLA 3VKVA 2HSDA 2AG5A 1QKIA 2CF6A 1XU9A 2I99A 4B4VA 5JBIA 4EMMA 3LLSA 1ZK4A 1ZVMA 3I4FA 3ST9A 3UHAA 1ZIDA 3MWEB 1UZNA 1VE9A 2GZ1A 1I3MA 4IJUA 2CZCA 1YONA 4L73A 4CM6A 5JMWA 3BTSA 3WB9A 4LSWA 5CDTA 4YDRA 3JQAA 1HYEA 5CPBA 5KJCA 1VKNA 4PVCA 4MXIA 2EW2A 3KQFA 4WLVA 3ZI0A 3FR8A 2ZB7A 3ZWBA 2D4AA 2PGLA 1PJLA 2UV8A 1TT5A 3ANNA 3PXXA 4DRYA 2ZB3A 2O4UX 1LRKA 3T88A 3I6IA 4QFDA 4PLPA 3AI2A 5INIA 2OORA 3E5RA 4YQZA 1QYWA 3ZW9A 2P4HX 3H7AA 3I3OA 1IZ0A 4IBOA 1XX4A 1U2DA 3IAVA 2VWPA 4TWRA 4KTVE 2ILTA 4E13A 2NACA 1IPFA 3E1KA 2GZ2A 4JIGA 1QG6A 3ZV4A 3ZHXA 1MJ3A 3JQEA 4M87A 5JAIA 5B4TA 1BXGA 3K9QO 1JWAB 4OOFA 6ADHA 1MV8A 2JL1A 2EP7A 2FY8A 1B15A 4O1MA 5ICSA 3EVNA 1DJNA 4OKIA 4K29A 4JCSA 3TZ6A 5TIIA 2JAHA 1BXGB 2WMDA 3I1JA 3NTRA 3DJAA 2I76A 3TPCA 1NBOA 4IZIA 3ZWVA 4ZQHA 3BPPA 4NEKA 2BFAA 3GHYA 2I3AA 5I7EA 4OAQA 1YOVA 4A10A 1PL6A 2I65A 4XRGA 2CD9A 3FNEA 2Y0DA 1NZYA 5JS6A 2X58A 4QIIA 3KHUA 3O03A 3Q0EA 4E5MA 4I08A 4E21A 4JJTA 4R51A 4NH4A 2B4RO 1EVJA 4I5GA 2EJ5A 3M2PA 2VHVA 4UUOA 3WWZA 1M67A 4FQ8A 1R16A 1H93A 4R41A 3UICA 3VPSA 1B16A 4FPXA 4J1QA 2Z1MA 4IXWA 2VSUC 1I0ZA 1Y7TA 2CDBA 3SLLA 4F3YA 4CM9A 3V2UA 1WAMA 3HG7A 1PZGA 5IDQA 3KZVA 1NFQA 4E30A 5HTOA 3GFGA 4LVUA 4DXHA 2A7SA 4AJOA 5DU6A 3D64A 4Y98A 2YZ7A 3VAZA 3C24A 4BL5A 4BNMA 2O2YA 1LSOA 2J5RA 4J7UA 2PBPA 1HF3A 2O7QA 3RKUA 2D0IA 4RVDA 3NAQA 1KBZA 4ZDEA 1K39A 1BHSA 1NFRA 1R15A 4QFCA 3OMLA 3PVZA 4EUFA 4PG5A 2HCTA 3MWDB 2FPGA 3T7CA 4BMNA 1ENOA 4BV8A 3DDNA 3R9TA 1I10A 3RRVA 1E6WA 4EBFA 4NI5A 4WLOA 1F14A 2ZKLA 4RVHA 1QMGA 4HV4A 4ALLA 1W8DA 3L9XA 4FFOA 3OIFA 1LDBA 3QQPA 4K1LA 4FJWD 4EJ6A 3W6UA 3CMCO 2VUUA 3ENNA 4PG4A 3P85A 1SO8A 1VL0A 3ZWYA 2AQ8A 4CL8A 3N74A 3LU1A 2PNFA 2ZB4A 4AJKA 2ZYDA 2X0JA 3L6DA 4D79A 1NTOA 3PLNA 4JLWA 2HK7A 4QSMA 2JFFA 4GI2A 1AGNA 1MC5A 2HQ1A 5DUFA 1NPDA 1XU7A 3EMKA 1HDXA 3U4IA 1NYTA 4NU6A 1DLIA 2J3IA 2VTEA 5FI5A 3IAHA 5TQVA 4LMRA 5CDYA 2ZIZA 4TQGA 2VSUE 1GYRA 1A4UA 4PLGA 4CMEC 1WWKA 4GX0A 1F17A 4ILKA 4R3WA 3VZRA 4MDHA 1PEDA 3CSDA 5DBFA 1C1DA 5LC1A 3UAGA 1I2BA 4PIVA 2PK3A 4LRSB 2FN7A 3H65A 3MJVA 5ILGA 3ZNPA 1GQQA 4TRRA 1X15A 4TSKA 3K8XA 1KEUA 4U0GH 5E0NX 3DEYX 4HFRA 4A03A 3DZBA 3ZH2A 2DKNA 2D2IA 3L4BA 3UF0A 1KIFA 1PGQA 1Z82A 2JCYA 3Q0JA 4QFEA 1DIRA 1P77A 2IXBA 1U7TA 4LMPA 4MVJD 1GQYA 3RAJA 3KBOA 4I9UA 3TJRA 4GHNA 3HHPA 1DOHA 2YDYA 3EUWA 3I4CA 3O4RA 1FDVA 4MIEA 4P4LA 3ROQA 1XNWA 2VWHA 2Q99A 2Z1NA 4MVJF 4KMSA 3TQHA 4IINA 4J9UE 5HWSA 4U0KA 3ZWOA 4D3FA 4M55A 1TEHA 1QXSA 1DHTA 3P7MA 3SJUA 1TI7A 3H6KA 3DOJA 5JE8A 4RO0A 2RCYA 4IPTA 1SEVA 2NQ8A 3AY3A 4DWVA 4G81A 3KTGA 1MFZA 1EDZA 3BZUA 1AN9A 2CUKA 4B7XA 3WBFA 4E4YA 3I9OA 5H81A 4J1SA 5TLSA 3ZWWA 3Q7HA 3V5IA 1PJSA 4GQAA 4MOWA 4WCFA 4XDYA 4J9VA 4DL9A 1V3VA 5BNIA 3HFSA 4GKBA 4RCNA 3UVEA 4CODB 3IC5A 4YJHA 1EBUA 4J7CA 1GQ2A 3F5QA 4E2WA 1M2WA 4ALJA 5ICMA 3JV7A 1PQWA 4BO7A 5B4VA 3QXIA 1AXGA 3DONA 3QWIA 4JCQA 1ZK2A 3S55A 4YJHB 1N1EA 3HADA 5AXCA 2ZATA 3HINA 3X2FA 2X22A 4IXTA 3BMQA 2QRLA 2WYWA 4I5DA 1ZO8A 5KDRB 2YHIA 4W82A 4EGFA 1I3NA 3U5TA 5A04A 3WICA 2R2GA 1NPYA 3L4SO 3Q1TA 4HY3A 1Q7GA 1T4BA 4OYRA 5IN4A 5G0VA 3BTVA 3L07A 3ZHZA 5F21A 2C54A 1CEQA 2WD7B 1UYVA 1U3WA 3DOCA 2Q1SA 3DB2A 1DC3A 2EWMA 3DMTA 1XDWA 1Y8RB 3U9SB 3P19A 2VSUF 2BI7A 2E82A 2ZJ1A 1R0SA 3LZ6A 4ND2A 2PZMA 3S2GA 3AU8A 5FEUA 2JD0A 3MJEA 1T4DA 1WP4A 1W2XA 3F4BA 3ZWPA 4L74A 5A03A 5ITVA 3QY9A 3GG9A 3UKOA 3BTUA 4IZHA 5L7WA 1NVMB 4E33A 1R4NA 5G0TA 1ZW1A 3E9NA 2Y0CA 4L76A 4PLTA 4NK5A 1L7EA 2ZTMA 4JCTA 4W4TA 1PIWA 4DLLA 3AOEA 2HAEA 3WNQA 5L4LA 1H6DA 3JTMA 3CZRA 1P1KA 5A05A 4KUEA 1V8BA 2NADA 2O3JA 1TXGA 3ZNNA 2EHDA 4ALNA 2EV9A 1IULA 2D5AA 3JD1A 1V3TA 3NUGA 2HRBA 2D3TA 5DP1A 3HRXA 3EYWA 3QJ5A 2FMUA 2ZTVA 2JHFA 3ZGYA 4LK5A 4MINA 1LXCA 1GUFA 3DHNA 4NBTA 5KJ6A 3V5EA 4WLUA 1P1FA 3G0OA 4ALIA 4GGPA 4OXYA 3SC4A 3W4KA 3TRRA 3GUCA 2GNAA 1LRLA 3EAGA 3KSZO 3PGJA 4NZ9A 3UCXA 1E7QA 3MYBA 1DFIA 1PQUA 3U49A 5JCXA 4D0SA 4LGVA 5F1KA 2Y67A 4YRDA 1E5QA 3EZYA 1B8UA 4ALKA 3KLPX 5JAQA 4N7RA 3TZHA 5TJHA 1T2AA 4KQWA 1K5HA 2OOSA 3F1LA 3OQ6A 4JCRA 3RC2A 4N18A 1U1IA 2JAPA 1Y5RA 4OO3A 2O3QA 4KUGA 4Y6PA 2W4QA 4EDFA 1UH5A 5JDIA 4MVJH 4ZRNA 4BNYA 3GK3A 1E92A 5TSDA 1V3UA 1EY3A 1A5ZA 3NTOA 1GADO 3ORFA 4MVJE 1PU2A 2VSSE 3EVTA 1KVTA 4AJIA 2AEFA 1C0LA 4O0LA 3R3JA 3DORA 1T2CA 4FIZA 4BNUA 1ENZA 4HX5A 4NFYA 1KYQA 4CV0A 3Q3CA 2C5EA 2W3PA 2FR0A 3OQ1A 4BO9A 4MVJI 2Y66A 2JFGA 5EERA 1YOVB 3RBZA 1NXQA 1I24A 4CM4A 3BMCA 5JBWA 3ANLA 1HKUA 5DULA 5KJFA 3DZKA 2B0JA 4GSLA 1GR0A 3FNFA 3I9LA 3LLVA 3GPIA 8LDHA 4CPDA 4XGKA 4L8KA 1LLCA 1LQUA 4XYBA 1SNYA 1EF9A 1EQ2A 4DUPA 3BA1A 1H2BA 1PGOA 1CQIA 2R00C 4Z6KA 3SX2A 1HL3A 4EUEA 1ZKMA 1DCIA 3NTQA 2RAFA 4E31A 2DM6A 4EJMA 1T2EA 3AJRA 4LISA 4GX2A 4EITA 3OA0A 2BGKA 3PTZA 3WGYA 2H63A 3EK2A 3WTBA 1XWFA 1BMDA 3GEGA 1BVUA 3PHIA 3KSDO 4NBRA 1UZMA 3V1UA 2VRCD 3OHSX 3NT2A 4JP3A 3DQPA 3WYBA 4D45A 2Q34A 4ZDFA 2J5KA 2NU6A 2IEDA 4RPJA 5GZ3A 5TGDA 1UP6A 5CEEA 4DIFA 3D3EA 1R66A 1WXDA 3TDCA 3WYEA 4M8SA 1E3LA 3VH3A 2ZYGA 3GVCA 2XXJA 1DRVA 1EUCA 5G0SA 4XQ9A 5JSFA 5CDUA 3KOUA 2IZ0A 3VIVA 4UEJA 1B2LA 3RUAA 2PD4A 2EJVA 3CPSA 3GVPA 2A94A 2EGHA 2OFPA 4FJ0A 4PVDA 2Q1TA 5DCWA 4D43A 1EVYA 2WE7A 5G1SA 3K73O 1EFLA 1SZOA 1Z74A 5L4SA 1C14A 1KVRA 4YAGA 5EINA 3QVTA 3H2SA 2HO5A 4K6CA 2WWRA 1J4AA 2F00A 4PZEA 4RVGA 4YA6A 3DC2A 4L75A 1T2FA 3ZDFA 3G1UA 4ND4A 4BHTA 3AM3A 3UCFA 2GASA 3VC7A 1LTHR 2XAAA 3M2TA 3WGHA 3TZ3A 5DDIP 4OH1A 5KIAA 3V1YA 1EZ4A 2X9NA 3Q0GA 4PN3A 2HMWA 4BKQA 3DBLA 1IY8A 3TFQA 3JD2A 1GL3A 1NWHA 5A4DA 1GY8A 3FDUA 1BG6A 1O94A 1UDBA 2B5WA 3OT6A 4I42A 3KLMX 5I9MA 1D8AA 1OAAA 4NIMA 2Y93A 5ES3A 4BKRA 4BO8A 4GX5A 3F1KA 1YG8A 1N5DA 4CMGA 4FJ1A 1CWUA 1JWBB 4XCVA 1X1TA 3LQFA 4XJTA 3H3FA 5B12A 5HA5A 5EJ2A 5JYDA 2VYND 1UP7A 3JQ8A 4AFNA 3LF1A 3WFIA 4A27A 3ROMA 4I9HA 4R16A 3HFGA 2NTNA 3K5PA 1KY5A 4UVGA 1SCUA 3BAZA 2BMAA 4RVSA 3TZQA 2IEBA 1GZ3A 3RUIA 2Q4EA 2E49A 1NWCA 3EY4A 3ETEA 4JWVA 4DVJA 1M6WA 1U5AA 4U7WA 1XHLA 2IE0A 3PPIA 1C0PA 1HSOA 4ELWA 4BKUA 3RFVA 1HE2A 1DRWA 1M66A 1GZ4A 2PKQO 2DC1A 2DBVO 4P38A 3LDHA 1ML3A 1XEAA 4JBGA 1FF9A 1VM6A 1U4OA 4EI2A 4WCZA 4KDFA 3FBGA 1SG4A 3QYRA 1O5IA 2AQHA 2DUWA 1T2DA 2O3TA 1PJTA 1PZEA 3IJRA 3PLRA 2GSDA 3AUSA 4K2NA 1HYHA 2ZK7A 4YJFA 2UZFA 3JYPA 1JTVA 3I9MA 3FWNA 4NBVA 3VPXA 1K3TA 3R6DA 1E77A 3IP3A 3GOHA 3H9QA 1BXKA 2GN6A 1QYDA 3GH3A 5EPOA 5AYVA 3NJ4A 2ZB8A 1YH3A 1VC2A 2EF1A 1KY4A 3ZHYA 3PWKA 4C7KA 2I67A 3O8QA 2PR2A 1KEWA 1MUUA 2E48A 3JD0A 5KDRA 4PLZA 3OH8A 5G4KA 1Z73A 3WGQA 5ENDA 3JQ9C 2F9IB 4BGEA 1X0UA 3OC7A 3GMDA 2BFMA 3U0BA 3PHJA 4IUYA 3HN7A 1TA4A 4FD3A 5DF1A 1ISIA 1OI7A 3S2FA 1N9GB 3ULKA 3RUDA 3VDQA 3VKUA 1FC9A 4RVUA 5AVOA 1Q2XA 2FR8A 1HZDA 1PS8A 1WPQA 4LCJA 1IE3A 3M6MA 5F3RA 4GLLA 3UGKA 4ZU3A 2EEZA 4RZIA 3S2IA 2VYVA 4IDEA 4UVHA 1A72A 1E7YA 1PWZA 4RV9A 3LKEA 2BFPA 3AFNA 5AQ1A 3HZZA 4K6FA 2AEMA 5T8KC 1HXHA 1DC4A 5T5QA 4TVBA 4RZHA 3RIHA 5KKCA 4RPLA 3L9WA 2QRJA 3F9IA 5K9ZA 3KEOA 4KTTE 2Q4BA 4NG5A 1FDUA 5TRTA 3CMMA 8ADHA 3W8DA 2PKRA 2A81A 3DWFA 2X5KO 2PA3A 4GM2A 5B1YA 3WJ7A 5L95A 4UREA 1PGPA 5MDHA 3RUEA 4CMEA 3GKBA 1EDOA 1QLJA 2XF8A 4MVJP 3H0QA 1HLDA 5INFA 3U9TB 5IDXA 4BGVA 4EZBA 4XDZA 3GFBA 4R1NA 3GNQA 4WK6A 4B8WA 1F0YA 2X86A 2RIRA 3E6AA 4CLRB 2J5QA 2DEOA 1E6UA 3L4BC 4BGIA 1WMBA 3MT6A 4FZWC 4DLBA 3RI3A 2Q46A 3LT0A 2G76A 3QWHA 1WZIA 5DN9A 5T8KA 1SPXA 4K28A 3HDJA 2W2LA 3WFJA 4YT4A 3L6EA 5JNLA 4U18A 1ULSA 5KJPA 2NTJA 1X7HA 2DUUA 4YJGA 3LT4A 4DQXA 4U6QA 3Q11A 1E1KA 2YQ5A 4D44A 2NSDA 2OMEA 1KC1A 3ENKA 3SEFA 1BW9B 4WLFA 1SOWA 1DB3A 4LW8A 2CY0A 1LSSA 1DDOA 5AOVA 1VL8A 1SEPA 2C7GA 4W9NA 5DZKH 7ADHA 2AE1A 5TT1A 3WLFA 1L7DA 3WBBA 4CQMB 3I6QA 4MOUA 3T8AA 3NRCA 3O26A 2HJSA 1ZSVA 1ZK1A 4FFMA 4GKVA 3ZV3A 4OM8A 3C8MA 3WQRA 4W7IA 2B35A 3AI1A 5C7OO 2GRAA 1VSUA 3OP4A 2EP5A 3DAGA 4FN4A 4S3MA 3VH1A 3HLN1 5GY7A 4OMRA 4YYZA 2G1UA 4XQCA 4P4GA 3RBVA 2D59A 3BHMA 1AUPA 4RPKA 2QW8A 4J4TA 5IZCA 1ISJA 3WTCA 1U9JA 5B4UA 4FZWA 4Q3DA 2GD1O 2W98A 5DZSA 4IDFA 5JLAA 1GZ6A 2Y1FA 3D7LA 2VX2A 4Q3CA 3KYCB 2Q2VA 4BO2A 5MGBA 3WGIA 1XLTA 3C3XA 1ULUA 3I9NA 1DUBA 3GG2A 3DHYA 1J0XO 4YRAA 2YFHA 3WLEA 3ZV5A 4HWKA 3RUHA 2HMSA 4O6VA 4Z3DA 4OHUA 3ROKA 4IDAA 4W9NC 5A06A 3OJOA 5BR7A 5IXSA 2B4QA 3RBXA 1CRWG 3WXBA 5DU4A 1EF8A 1N92A 2UYYA 1LC3A 1A7KA 3PQEA 1HDRA 4H7PA 4KNPA 1EE9A 4F47A 4M49A 3A1NA 1GFSA 1F06A 1Y8QB 1EVIA 4D7AA 1RM3A 1MG0A 3EDMA 4I1IA 5A9SB 1ZCJA 3TZCA 4LCEA 1LX6A 4B4OA 4Z0PA 4CR6A 1X0XA 1ADGA 3MTGA 1G1AA 1NVGA 1K6XA 4R5HA 3OICA 4L4RA 2NU7A 4M86A 3HSKA 3KTKA 2IRWA 2J5II 1UIYA 4GMGA 1PQPA 3TDKA 1WMAA 1U7HA 2HKIA 3LVFO 4KP7A 1ZXLA 3OIGA 4KWIA 3GHHA 2DBQA 4XEHA 2A9FA 2Y68A 2W90A 3BXXA 3UXYA 2V65A 5CDGA 2BZRA 1M75A 3FBTA 3FSRA 2E37A 2Y0EA 2GPTA 3ONEA 3CINA 4GGOA 5KWEA 1DC5A 2X0NA 1Y6JA 4M89A 3S8MA 9LDTA 5K0ZA 3W4JA 4BO5A 1E3SA 4Z9YA 1LRJA 3PIIA 5B37A 6LDHA 1RPNA 1YB4A 1F8GA 3SVTA 2HU2A 2FHSA 4WEOA 2Z95A 4CLDA 1K32A 3TLFA 4QECA 4JFCA 1EQUA 3DO5A 4HNHA 5DTWA 3F46A 1YRLA 3DBVO 3ZZNA 4CM9D 1HSZA 5I7FA 4F45A 4B7CA 4WE3A 3B1KA 1NP3A 2FWMX 1DFHA 1WDKA 4YB8A 4E3ZA 4FN8A 4Z9XA 3HE2A 1X0VA 4BNXA 1XNVA 1N8KA 4HNGA 4AICA 3RFTA 3G79A 3ZU3A 4CUZA 3D3WB 5BSHA 1O8UA 1NHGA 4CM5A 4WNIA 1HZJA 4Z3KA 3NGLA 2EIHA 5G1RA 4FFLA 2C29D 1OOEA 4Q1IA 3QP9A 1LNQA 2GLXA 1IPEA 1UR5A 2WDZA 2QIOA 3ZWMA 4FB5A 1VJ0A 4B7UA 4O63O 4Z0MA 1BVRA 4NU5A 2OXIA 1LEHA 4PCVA 3LC1O 1H2HA 4XYGA 3C1TA 1U3VA 5JDIC 4NMHA 5FF9A 4EEZA 4J49A 3PQFA 2NVUA 3BHJA 3PYXA 1IZ9A 3ZWAA 2C0CA 2VQ3A 3F5SA 1B26A 2W8ZA 2AG8A 3U3XA 1WDLA 2POQX 4NBUA 2GDZA 2VUTA 1RYEA 4DC0A 2DLDA 3JQ6A 3NDJA 1JW9B 3I9KA 4GX1A 3OIDA 3BMNB 4ID9A 3RUFA 2E6UX 4DC1A 3EC7A 2V6GA 1B3BA 1NAHA 4CLOB 1ZMOA 2IYOA 2OP0A 1HDYA 1N2SA 3Q9UA 1IHXA 5T64A 2YUTA 1K2WA 5L9AA 1EFKA 3R0OA 4XR9A 4XKJA 4MP8A 1PJ2A 1JAYA 1YS4A 4WEQA 4Z9FA 4ZHSA 4OG1A 1B14A 4DPKA 4F6LA 4BNTA 5TJ9A 3GZNB 2CNBA 4YJDA 4ZRMA 4PLVA 1XA0A 5GZ1A 3RQSA 1GAEO 3GMSA 1UJMA 4DA9A 2VREA 3ABIA 4WPGA 3GQVA 4AJ2A 3GRKA 1GDHA 1IUKA 1OD4A 2C82A 3I5MA 3RJ9A 2V7PA 2RHCA 4EJ0A 1A27A 1KERA 1YBAA 1CERA 1ISFA 2FPPA 4FN7A 1PZFA 4FDAA 2I9PA 1N7HA 3CKYA 4AJPA 5EQFA 4U19A 5A5EA 1JKIA 3WGZA 4CV1A 5HS4A 3DTYA 2VHXA 3ZWNA 3HB4X 3JU1A 1LDEA 3NJ8A 1HDZA 3H0UA 3I47A 1YJ8A 1BDBA 4ZDBA 1X1EA 3KYDA 2NP9A 5JY1A 2X9VA 1P1RA 1LUAA 4PLHA 2HK8A 2VT2A 4XYMA 4Q3BA 2G0TA 3WIDA 2H9IA 1Z6ZA 2C07A 3PJGA 2CE3A 3TZKA 1QV6A 2J3HA 4NQZA 2FSVA 2X5JO 1IB6A 3BEZA 1F12A 1WVGA 2Q45A 3D4NA 2QRKA 3JQAD 2NWQA 3FD8A 5BSFA 3OQBA 3PWSA 4CMIB 1Y9EA 3QSGA 2F6QA 3INGA 3VZSA 5A9TA 2BGMA 4JXKA 4ZU2A 1PR9A 4X54A 2BLLA 3D5QA 3ICPA 2LDBA 2V6MA 4JX8A 4TRJA 2J3JA 2ZQRA 1A4IA 1P3DA 4A5OA 4IIVA 1TB4A 4UULA 4CMIA 1TT5B 1H94A 1L1FA 2VZ8A 2DTXA 3PJEA 1YQXA 2FR1A 3GA0A 1WDMA 3KVOA 1PJQA 4RL6A 1E7RA 1M76A 1UUFA 2B36A 4XYLA 3UOGA 1J5PA 3CE6A 5C90A 1MA0A 1V35A 4FOSA 4EMLA 3C7DB 1FDSA 2VT3A 1Z7BA 2Q35A 1O95A 3GLMA 3GR6A 3RUCA 2QQ5A 1Q7BA 4OGWA 3DMYA 4GL4A 4Y6RA 4J7XA 3IP1A 1LDYA 2OUIA 1VRGA 1YL7A 4IQGA 4NFHA 4TZKA 4DREA 2FRDA 4DLAA 3DL2A 1LDNA 4UUPA 2DFVA 1NM5A 3ST7A 1CIVA 4U0JA 4HFJA 4AJNA 2DVMA 2UVDA 2CDCA 4PLFA 3GDFA 1SOVA 3EHEA 2D5CA 1I2ZA 3H5AA 1U8XX 3TT6A 3OBBA 3RSHA 2W2LD 1B7GO 3PJDA 5T6BA 3TL2A 2FZSA 3GDOA 4XJSA 3ONFA 3E18A 4GMFA 1GTMA 1VI2A 4FBGA 4MO2A 1E5LA 1Z75A 1EUDA 3DBHA 4BKPA 3V5NA 4GLOA 4I9NA 2QZZA 4YCAA 2Q50A 3PZBA 4YQYA 3UUWA 4BIIA 2FZWA 4G65A 4UVEA 4E5NA 3BMCB 4R69A 1JAXA 3IKTA 3GF7A 2EKLA 1W6UA 4HC8A 4RYFH 1JKJA 5CG1A 2CVQA 3DZIA 1HZZA 2UUPA 3GEMA 3JD4A 4R9SA 5IF3A 5DP2A 2G5CA 2BRUA 1ZH8A 2HMUA 1ZSNA 3CEAA 3DFZA 5KVQA 4B8ZA 2IDZA 1X7DA 2QHXA 2P2SA 2Y1GA 1DXYA 5L45A 1NZYB 1HYGA 3H3JA 1YO6A 2V6BA 4IZCA 5DCYA 4DYVA 2O50A 3ZU2A 1E1MA 1DO8A 1GCUA 4IJWA 3Q1LA 3CZMA 3D3WA 3IOYA 4J0FA 4B4WA 1ISHA 3U4CA 4WLNA 2X8LA 4TMFA 1PR3A 2WSBA 3H5NA 3MCVA 3PEFA 4II3A 2C20A 3ONDA 5KVSA 1E3WB 1O0SA 4RF4A 1KVUA 1O6ZA 2NU9A 1FCFA 1ADCA 3V2GA 3RWBA 4J90A 3UW3A 1PJ4A 3U4DA 4PLYA 1YGYA 4XB1A 3L77A 2PH5A 2NVUB 3SLKA 3JYOA 1HETA 3VPFA 5U4QA 4RQUA 5FUSA 2P4QA 3H2ZA 2YHIB 4DQVA 2WEKA 4ONEA 2PLAA 2J5IA 4G2NA 1IYZA 5CDSA 2BKAA 1B0AA 1HDCA 3GN1A 3PDJA 4CL3A 3QLJA 1UDAA 2DAPA 3JQFA 1UXJA 3JQ7B 3Q2KA 5GZ6A 4BNHA 4BS9A 3TOXA 1PJCA 3QKAA 1N7GA 3O9ZA 3ZU5A 3ASUA 1EVZA 5U1PA 3R0IA 3G49A 4CJXA 3I23A 3OEWA 2P5YA 2V6FA 5JO0A 3K2BA 2I6TA 5E0SH 3GZNA 5I9LA 4YEDA 4FR5A 1C0IA 3PJFA 4XA8A 3STHA 4NR0A 1OC2A 1GYPA 3C85A 3PIDA 2A7KA 3NJDA 2WD8A 1ARZA 4CMCA 2PWZA 3DZGA 5H82A 1V0JA 4IDCA 3KV3O 3ZNOA 1RYDA 4JBHA 4EUHA 1I36A 1SAYA 3DMTC 1W73A 3O8QB 3Q9NA 3V2HA 4PG6A 4QO7A 1CDOA 1J6UA 4NJMA 3SWXA 2EJWA 4CR8A 3WWYA 5CAEA 1LSUA 2B83A 1MB4A 3QWFA 4J2OA 2X4GA 3JYNA 2VZ9A 1YJQA 2CSUA 3MOIA 3IL2A 3NYWA 3IDSA 3A14A 2GGSA 4GAEA 1P31A 3WIEA 5L53A 4NJMB 1MLDA 3FPCA 1QLHA 3JQFC 2J5GD 3GNSA 1QP8A 3CXRA 4E12A 4KUHA 3LT2A 3C1OA 2VN8A 4Q3AA 3QVWA 2F9YB 1ZK3A 4A7PA 4JJIA 2YQ4A 4EEXA 4UEOA 5CTCA 1UAYA 2Q3EA 3R9SA 3G17A 3D4OA 1PZHA 3DAFA 4GPD1 4IS2A 2J5SA 4XGNA 2ZL4A 3AOEC 5BT9A 5L3ZA 3MOGA 5ER9A 2F9YA 4L8VA 2D1YA 4Q3NA 5JDCA 1LU9A 3PHHA 1K89A 3GY0A 1Q0QA 5DNAA 4RF2A 1WZEA 4FJ2A 5CP8A 5HS6A 3ETDA 3AK4A 4RORA 1O8CA 5LDGA 3PFWO 1ID1A 2J8ZA 3GDGA 3W8EA 5C9GA 1U4SA 4IMPA 4IZDA 4XYEA 3VH4A 3E82A 4E5PA 3IBBA 5KCZA 3MJCA 1C1XB 5K6AC 4BB5A 4UVIA 4LK3A 5THKA 4E0BA 2P91A 2YFQA 1RM5A 2DBZA 2NVWA 3R3SA 4NPCA 4WCFB 4FS3A 1DIGA 3JQGA 4GSKA 4FW8A 4XRRA 5COQA 3V8BA 5I8WA 3P5SA 3NGXA 2OL4A 3ON5A 4KDEA 2XXBA 2CMDA 3OECA 1EUZA 2ZCVA 4ALMA 3GZ4A 4BNGA 1I2CA 3WJAA 1SBYA 2ZQQA 1GEGA 1YL5A 2GERA 1OD2A 1PJ3A 2O3UA 1T1SA 4RPHA 5I7VA 2IODA 3OJ0A 2A35A 2G82A 3IMFA 1BRMA 5DL1A 1HEUA 5JDCC 4YAEA 3AI3A 4R1TA 4CM4B 3NT5A 2OBNA 4R4JA 2Q49A 4MPDA 4D42A 4M1QA 4ROSA 2EG9A 4G5HA 4BMVA 2GYYA 4Y9DA 3AM4A 3AUAA 1JQBA 4R1UA 3A9WA 2NU8A 1U5CA 2O4CA 2I5PO 2AA3A 1CQJA 3FCOA 3AOGA 3RROA 5DKPA 5JAMA 3AY6A 1HE3A 4WZ8B 5F5NA 2ZCUA 3RD5A 2BELA 4P22A 3BIOA 5COBA 2RH4A 3G1TA 1ADBA 1QSGA 3ZN2A 1E7MA 5JO9A 4RLHA 1I01A 5JC8A 4ZDCA 1HRDA 3QWAA 1YWGO 4ZVVA 4CM3A 2BD0A 1TG6A 2AW5A 4LSMA 4R68A 4YVFA 3WG5A 4MIYA 3K92A 3K96A 4MVJG 5DZKA 2NQTA 2OO5A 2ZTUA 4QQRA 2YV1A 4ZQEA 2O2SA 5L4NA 2ZJ0A 3MJ4A 1UYRA 3COSA 4XQEA 1T1RA 4BNWA 4JNKA 1JDJA 3H5RA 1RKXA 3DHEA 5JXWA 1Y5MA 1HDOA 1NASA 5IDWA 3QRWA 1CJCA 3ZNQA 1TVEA 1YG6A 2X0IA 5ER6A 3AW9A 4XQGA 4EYEA 1JVBA 2NUAA 1AXEA 4N5NA 5JCJD 4OLQA 3AUTA 5EQDA 4DI1A 4OJNA 1H6AA 4AG3A 2J6IA 1U3TA 3HJAA 1ENYA 2PY6A 3GNTA 4B3HA 3N7UA 1I3KA 2NTVA 4WOJA 1VJTA 1LBEA 1V6AA 3RSTA 3E48A 2QZ9A 2QQ3A 3M6IA 5LDHA 4U8GA 1ZJYA 4E6PA 1WZ8A 3QV1A 4PRKA 3EW7A 3PDUA 4KQXA 4WECA 1RM4A 2OBYA 5KNLA 4KPKA 1H6BA 1LJ8A 4TKLA 4JJGA 1QYCA 1KVQA 4IIUA 2UDPA 1OBFO 1ONOA 4OL9A 1ON3A 2BI8A 2Y1CA 1YB1A 5THQA 1BWSA 5KVCA 4FNBA 3G64A 4L0QA 3H4VA 2Q2WA 4DMLA 4CQMA 3NJBA 3NEPX 1GU7A 1Q1NA 1HE5A 3E5MA 2BF7A 3PI7A 4CM8B 2PZJA 4RF3A 4WOKA 1VRWA 3KRTA 1MP0A 4PG7A 2CBYA 5DBIA 1KOLA 1Y9AA 3KTDA 5L51A 2UAGA 1Y81A 1RWBA 3HUDA 1D7OA 4N5MA 4IZBA 3IUSA 1NVTA 3OSUA 4E2XA 4GBJA 4FOOA 2YV2A 3JD3A 3EZLA 3QK8A 3B1JA 4BQRA 1S7CA 1UAGA 3F4LA 1TYFA 5F5LA 1ORRA 4ZGWA 2XPCA 1LDMA 4D3DA 4IGEA 2H1SA 4QXMA 1IOLA 1HTBA 4ZN6A 3FF4A 1H9BA 3LF2A 3MEQA 3RC1A 2PZKA 3HB5X 1UZLA 4QT0A 4IMRA 3ZU4A 2P68A 2YYYA 5CEFA 1H0KA 2BFOA 4O59O 5F1PA 2X0RA 1UXGA 1PGNA 4BUCA 3R9QA 1PTJA 5G0WA 5KTKA 3H9EO 2FPIA 1DHRA 5A9RA 1NAIA 2RH8A 3STAA 4YLHA 2GF2A 1ZSYA 4H3VA 4RDHA 5BSEA 3FI9A 1VKOA 2Y1OA 1P1JA 3MTJA 1HDGO 4OSOA 3MJSA 4TZTA 3B6ZA 4CUKA 4RYFA 3RCBA 3ICCA 3HP0A 2CVOA 4H16A 3ZHBA 2EERA 1GPDG 2QYSA 5DOZA 2Y05A 1O89A 2H6EA 1E3WA 1Q0HA 2JHGA 3GPDG 3QE3A 4KWHA 2O48X 3WGOA 1S6YA 3NKLA 1UXKA 4INAA 3VPHA 4A26A 2FW2A 1LI4A 4FSHA 5JCJA 3JQGB 4Q9NA 3MFMA 1IHYA 4DYDA 3BMNA 3FR7A 1Q7CA 3GAFA 4HNKA 1I30A 1F8FA 3U09A 3MJTA 4FFRA 3SJ7A 1NX6A 1J49A 4YRBA 1MFPA 5DBGA 2PKQP 2X9GA 4NFSA 5IKLB 2PG8A 1B3RA 1DIHA 1YDWA 2IZ1A 3WNVA 5I8ZA 3ZCXA 3W6ZA 5L40A 3UN1A 1P74A 1YQGA 1DIBA 5L7TA 1U28A 5J23A 1ON9A 5CTBA 3QWDA 1E3JA 4CMJA 2GN8A 3LSYA 1DFGA 2F6IA 5CPFA 3VVBA 2HLPA 5JW6A 4FFPA 3JQBA 4XIJA 3PFFA 5HM8A 1ZFNA 2WE8A 4E2YA 1P33A 3I9JA 4FCCA 4AJHA 3PE8A 1PJBA 3QHAA 4ND1A 4WASA 3T4EA 4JSBA 3TNLA 2BGLA 4JBIA 1FJHA 1R4NB 1A71A 3D5TA 3FTNA 3WQSB 4GVLA 4M54A 5ENVA 5HRUA 5CG2A 3C7CB 1K6IA 2DTEA 4N5LA 2VSUA 1NFFA 1DRUA 3K6JA 1OMOA 2VOEA 4WKGA 4BB6A 5TF4A 3SXPA 2CF5A 3L3SA 2GO1A 4CMAA 1XSEA 3JQDA 1ENPA 1YKFA 4IQ8A 1GYQA 1FC7A 3TWOA 2HMTA 3DOOA 1GPJA 4FGWA 5CFZA 5A3JA 5TC4A 3U4HA 1FDTA 3DZFA 2Z5LA 3AWDA 4CR7A 4UVDA 3PK0A 3ZWXA 3F3SA 2B4TO 4A73A 3DR3A 3GVIA 3KXDA 3D0OA 1NNUA 1JN0A 2PFGA 1ISGA 1E6EA 2XOXA 4AL4A 4Y8VA 4ELSA 3W8FA 2EXXA 2C59A 3IJPA 2DPGA 3IKVA 2OZPA 1HNOA 1SMKA 3OMEA 3TVUA 4KOAA 5FFFA 1UXIA 4IM7A 4I52A 4OSPA 3ITDA 5CHEA 1SB8A 3K31A 1PIXA 3QA9A 2Q2QA 1A7AA 1H6CA 3B1FA 2I66A 2Y1EA 3P2YA 4YJFB 1R4MA 4HP8A 3OFSA 5EESA 2NNLD 4IDDA 3ROPA 4HFMA 3RJ5A 4G2RA 1BTOA 3VTZA 4RLSA 4R01A 3NX4A 4JQCA 1C1XA 2TMDA 1NQ5A 2JCXA 3BTOA 4RCVA 3OEYA 4PLWA 1VJ1A 3VZPA 4UEKA 4IJVA 2VHZA 3QMJA 3RASA 3BMOA 4L9RA 4Y67A 3QREA 5H83A 1SZJG 1YVEI 4CM8A 3FPLA 1PJHA 4YWJA 2OP1A 5ADHA 3DBRB 4U1AA 2AQKA 2P9EA 2ZQZA 1UXHA 4WCDA 3PGXA 4J2HA 3GN2A 4I4ZA 4JOTA 4Q3EA 2AEJA 2YHUA 3BMQB 2VNAA 4XZ3A 5JYEA 5IAAA 3GC6A 3Q6IA 4OMUA 2BH9A 1GCOA 3S1LA 1N6FA 4ZD6A 1P45A 3TN7A 1X14A 2VYVD 4XD2A 3F47A 4HADA 5A3VA 3ISAA 2ZL3A 3KUXA 4CLHA 5EIOA 1JA9A 2AMFA 4U0GA 4JROA 2A92A 3D4PA 3TF5A 2YV3A 1GD1O 3MOYA 1AE1A 1E0DA 1H5QA 2FZEA 3FN4A 5KVVA 3H9UA 2FBMA 1I32A 5BQFA 2DU8A 4BVAA 5KKAA 3WGTA 3DTTA 4II2A 4O5OA 4I5EA 3PP8A 1ZZEA 2C2XA 3E9QA 4IDGA 2BHLA 4MVJA 4YXFA 3O38A 1XQ1A 3TRIA 3JCZA 3GRPA 3BHIA 1RJWA 4TKMA 1ZBQA 3PGQA 4FGSA 1XKQA 3H0JA 1KEPA 4WCFC 3CUKA 4XB2A 1U8FO 4BOYA 4DBVO 4J0EA 1FMCA 4MKXA 1I3LA 4RGBA 3RFXA 3KSUA 3R6HA 4XX0A 3RU9A 3FWZA 4OQZA 4J1TA 3ZW8A 1BGVA 1HNUA 5FIFA 2A4KA 4U0HA 5IDYA 4CM7A 4WGGA 2AXQA 2YY7A 1BSVA 2G17A 4BO4A 1PWXA 1PL8A 4J4BA 4I5FA 4R1SA 2Y1DA 5IG2A 2PH3A 1M6HA 3U9RB 1HWYA 3VTFA 4BNZA 2OGUA 4HUJA 1R0LA 4FNDA 3GVHA 3WX0A 4K3WA 2PPYA 4E5YA 3DBHB 2WJPA 2NM0A 5EMHA 4CV3A 4MIOA 1B8VA 3G3EA 4YACA 1RM0A 1I8TA 5ILOA 4BNJA 1A9ZA 4HXYA 5DTPA 3GGGA 4CQMD 4DTIA 1N6DA 2HRZA 1LDGA 1U2GA 1EK6A 5JAZA 3ETGA 3VPGA 1ZK0A 4YJGB 1HLPA 2YJZA 1ZMTA 4PG8A 2RBEA 1Y7OA 1QYXA 3HDQA 4WJZA 4UUNA 1EEHA 4MKZA 4YT2A 1P0FA 1LLDA 1YBVA 3DBLB 5INGA 3KEQA 4IQ0A 2JFHA 5A5FA 3H9GA 2J5GA 4W7HA 4URFA 4RVFA 3LT1A 3PQDA 1I33A 4BNIA 4YTEA 4NDNE 3T89A 1X7GA 3OM9A 4R3NA 3HDHA 1R0KA 3VDRA 1ZXBA 2JCVA 3VOSA 3H8VA 1GV1A 3JSAA 2O3SA 2LDXA 3A06A 4BV9A 1SB9A 1N1GA 3U62A 3VHRA 1ADFA 4BNNA 4J16A 4UUMA 3KYCA 1NPTO 4L6WA 5HBRA 5BNFA 3GVXA 4U6SA 3A4VA 3WMXA 1P1IA 3K50A 1E1LA 1XGKA 2JD2A 5A02A 3VH2A 2TMGA 3ZWCA 3TV5A 2IXAA 1DAOA 1AHIA 1GV0A 1NHWA 3JYLA 5EL0A 2YW9A 1KC3A 2CDAA 4ZICA 5IZ4A 3QW2A 4ESOA 5U9CA 4IY1A 4JN6B 3PZKA 1E1NA 4NNJA 2Y99A 1QV7A 2EW8A 3WS7A 2HMVA 1D1TA 4TROA 1YE3A 3LAOA 1K0UA 2X1HA 3JYQA 1NQTA 4MJLA 2HW5A 1R12A 3WR5A 1PGJA 2ZYAA 4F6CA 1K6JA 3DXFA 1ZNQO 4FC7A 4CUJA 3HQ4O 1RJMA 2GZ3A 3N58A 1P1HA 4IGFA 1MXFA 1VL6A 2O23A 1MGOA 4RF5A 4ASIA 4DMMA 2NVBA 4CM1A 2IEXA 2AE2A 4B4UA 1AHHA 2CVZA 4KD6A 3GF4A 4J4HA 5I9NA 4JYJA 2DTDA 3SC6A 3HDYA 4RDIA 4B3IA 4GWGA 2RHRA 1FC6A 4Q0GA 4UAGA 3K2EA 1XIVA 3QVOA 1KETA 4A0SA 4BO0A 1QYVA 4Q39A 1C1DB 3OJFA 1DC6A 4BQPA 3MZ0A 4AJ1A 5GMOA 4DGSA 4NBWA 2QX7A 2WD7A 2F9IA 1BDMA 1MXHA 3P2OA 3INTA 2J3KA 1KEVA 1T25A 1W4ZA 2W2KA 4AJLA 4CLXA 4NHEA 5KOIA 2GR9A 5ITWA 3SBOA 4RPGA 3C7AA 2DFDA 4ZJUA 2VOJA 1WLYA 2UUOA 1TLTA 1Y8RA 4OQYA 3JQAB 3M1AA 3PWZA 4GWKA 4OIMA 2ZL2A 2VNSA 1QRRA 1FXSA 2W2KB 3RVDA 3WYCA 4DQUA 1Q51A 3AFMA 3X2EA 3NT4A 4CMKA 2HUNA 3ZV6A 1ZEJA 4K26A 2R00A 1YBMA 4H15A 4J1NA 3IQDB 1UP4A 2VCYA 1PX0A 2ET6A 2WM3A 3V1TC 4BNFA 3S2EA 1XR3A 2FP4A 4TRMA 4Z0HO 4BO1A 1ZJZA 5JC1A 1Q52A 2GCGA 3PYMA 5C3MA 2GN4A 1DLJA 4CMHA 2P5UA 2PD6A 1PSDA 4HBGA 3QXZA 2FOIA 4QO8A 3FTPA 4AVYA 2PV7A 3I52A 4C4OA 2C5AA 4P8RA 1LLUA 3QWBA 4CLRA 1A9YA 2O7SA 3QIVA 5T67A 3K30A 3JQ8B 3KTJA 4R9RA 2P9GA 4JP2A 2B69A 1U3UA 2JD1A 2C2YA 3CTMA 4OOEA 4D46A 1UDCA 2HJRA 1P0CA 3RC7A 1V9LA 1IL0A 5IN5A 2DPHA 2VRCA 4TRNA 3TVWA 9LDBA 1BW9A 4PLCA 2EKPA 4PZCA 4YR9A 4JVTA 2VWQA 1NR7A 1MG5A 2EGGA 3NV9A 2QYTA 2B37A 3ADPA 2GTRA 4MP6A 2E4AA 3DAPA 2X6TA 3WQQA 1C0KA 3D1LA 4R54A 4BKOA 1NQOA 2X5OA 3B70A 4R5MA 4YT8A 5E0SA 4CLOA 1R4MB 1GEEA 4AJ4A 4JCOA 1VPDA 2VUSA 4ND5A 4BO6A 5COAA 4D41A 3DZJA 4QTZA 4XGIA 3VVCA 1NQAO 1DIAA 5AXAA 1E7SA 1OC4A 1YB5A 3B20A 3OJLA 4E32A 1XG5A 3T8BA 3LC7O 4XWYA 4QUKA 4C7JA 3HN2A 1PS9A 4W6ZA 3JQ9A 5EN4A 4FC6A 4B79A 1O9BA 2X24A 4PFJA 1ONPA 3BMOB 4JK3A 4PGFA 1JU9A 3AY7A 4U5QA 4MI2A 3PRJA 3GAZA 5KJEA 4J91A 1JLLA 3DBRA 1QORA 3W4IA 1HE4A 5TNXA 3CH6A 1XYGA 2PGJA 4JJFA 1T24A 2AHRA 4KZPA 1R6DA 5G2OA 3PEAA 4ZQGA 3T3WA 1R37A 2Q1UA 4JYLA 5TS3A 3IB9A 1QR6A 4KWBA 1JVSA 3JQCA 3LK7A 3E8XA 2D8AA 4DIBA 3OETA 4IJKA 3HE3A 4BMSA 2VYNA 5KJ1A 4J6FA 3WGGA 5TX7A 2VTDA 1EK5A 4AJEA 3DFUA 1DBVO 2HK9A 3BYZA 7MDHA 4BO3A 4IDBA 1D1SA 5IJZA 2J5IB 4BGUA 2DT5A 3VZQA 3WOHA 2PGDA 1WW8A 4YT5A 2WTBA 4CQLA 2AQIA 5T57A 2Q2XA 4WYOB 5AXBA 3KTHA 3DZHA 1JKFA 1P9LA 2IYPA 4ITUA 4F46A 3JQ7A 4FFNA 4DPLA 3T4XA 1T26A 2WYUA 5G4LA 1G0NA 4BNVA 3FRJA 3JQBC 3CIFA 1W0CA 2CFCA 4CQLB 4L4SA 3KYBA 5DU8A 4P4NA 5DCUA 5FI3A 5A1TA 3N6RB 5FWNA 4ZDDA 1NR1A 3WSWA 2PD3A 3M6NA 5TT0A 5AXDA 5JY6A 3OJEA 3FF6A 1ZEMA 2H5LA 3W1VA 5K6AA 1E3EA 2VWGA 5DOVA 1LSJA 3TFOA 4FB8A 1G6KA 2Q1WA 1OZAA 2DUBA 3AUUA 3E9MA 3OA2A 3QVXA 3BF0A 3EGOA 4DIOA 3A28A 1D4FA 5DT9A 4NJOA 4Z0TA 5I7SA 2VZ0A 4YAIA 2PZLA 4YAKA 4EMPA 1LLQA 1N6EA 4TVOA 2C8TA 2ZTLA 3PZRA 3GT0A 5C7IO 3Q2IA 4XIYA 4ND3A 3I83A 4IS3A 1XCBA 4WLEA 5JFOA 5G1QA 3IS3A 3RKRA 1UYSA 1DSSG 3PHGA 3HWRA 2X7HA 2VHWA 1YQDA 1KS9A 3WDSA 2PTGA 3P2LA 3H81A 3KETA 2JJYA 1EBFA 4L4XA 3UH1A 4MKRA 4QX6A 2YDXA 2IZZA 3ITKA 1ZUD1 3L0DA 1CYDA 5F1OA 4ZQFA 3UFXA 2O3RA 4OKNA 1B8PA 2ZL0A 1G0OA 1PS0A 4ZA2A 4YBZA 1ONNA 3GEDA 4WNCA 3F6YA 4YPOA 5C37A 5BNTA 1SC6A 3KTIA 2QG4A 3FNGA 3ADOA 4ZQBA 4NK4A 2GN9A 3TL3A 3WG9A 4OXKA 1YL6A 3KO8A 5CEJA 1TT7A 3GLQA 4ELXA 5JPIA 4MVJM 4YAJA 5BSGA 3GUYA 1XQ6A 4DPMA 5G0UA 4PZDA 3RC9A 1BXZA 3T7EA 4XR4A 2VRBA 2EKQA 1CF2O 4LRTB 3KB6A 1LA2A 2C7VA 4J43A 3GMAA 3INRA 2R6JA 5JMPA 1H9AA 3RU7A 4A2CA 1D3AA 5LCXA 4S1VA 2ZQYA 4HKTA 1C3VA 3K8ZA 3NDIA 4K9DA 3AU9A 3R1IA 3PHLA 4PRLA 2VSSA 5L7YA 4GVXA 1Y1PA 4E2ZA 3H02A 5DUCA 5C7LO 3LC2O 1XNYA 3OF2A 1UYTA 4D3SA 2P9CA 3M1LA 3KM0A 1ISMA 4QEDA 1XELA 1Z7EA 4OXNA 1LC0A 4JGBA 1VSVA 1X13A 1YDEA 3IUPA 1P44A 4LN1A 4CLEA 3TT7A 2FSSA 3TSCA 1DAPA 4I8XA 3C1AA 4DBZA 4QIJA 1XO6A 3WSVA 3U9LA 3GGPA 4Y6SA 2DQ4A 2VHYA 2HDHA 3TOZA 4EW6A 3GF3A 3RSIA 2X23A 3GGOA 3NDRA 4B3JA 1Z45A 3UCEA 1PL7A 3WMWA 4AJJA 1YXMA 2SCUA 3H9JA 1OFGA 3P5MA 3ANMA 1DPGA 1E7WA 3LYLA 1GUZA 5JBXA 3ASVA 2I3GA 1E3IA 1DEHA 1Y8QA 1I5RA 1RJNA 4HFNA 5C5IA 3PYLA 4RJTA 2B5VA 1J7XA 4GH5A 5A9SA 4D0RA 2NV6A 1EMDA 2DBRA 2WYVA 3H0SA 3AM5A 2VSSF 3IIEA 2NLOA 1MX3A 1LQTA
chains in the Genus database with same CATH superfamily
4PSKA 3NHSA 3LM8A 3DVQX 4WBNA 1FDWA 1ZYUA 2FWBA 3G2HA 4KACA 3TVTA 5FBZA 1EE2A 1IHOA 1Z56C 2KX7A 4LZLA 3E03A 1VLLA 3TVYA 4C14A 1NKTA 4BEVA 2OBBA 5ISMA 2A7QA 4UHKA 4I2VA 1G5TA 1A0OA 4W99A 4NNQA 4R1PA 4WUVA 3ZEIA 1GUYA 2GM9A 5IZCC 1UBRS 2OXFA 3OUZA 1CE8B 2Q3BA 2VJNA 4ENRA 5IXYA 5L3QB 4LYHA 4E5KA 5JQGB 5LQUA 2CDRA 3OKCA 1YB2A 2F1KA 3WQHA 4O5AA 5ARDA 2YS7A 2H1WA 2HSDA 4BRUA 4D9NA 4N76A 1XNRB 1NMXA 3UFBA 3VHQA 1HEYA 2OV2A 3BE4A 3KUCA 1ZVMA 3I4FA 4KO8A 3U39A 1A9SA 3STUA 3MWEB 1UZNA 1VE9A 2GZ1A 4NJEA 4IJUA 3WKAA 3BTSA 4O4IA 3W6OA 2E4VA 2FEXA 1CJMA 4YDRA 1WIWA 3WB9A 3CX4A 4AB1A 2Q5FA 3W8RA 4DDKA 5KJCA 1QVAA 3M1YA 2CLSA 5A4MS 3EZ2A 1TTPB 3QNUA 3OPXA 4CHGA 2ZBQA 1QHYA 2UV8A 1JG6A 1UC5B 3PXXA 2H1VA 5EXXA 1PZNA 5HIMA 3SIXA 1G5PA 5DISB 3FMOB 4NQRA 1LRKA 3SZMA 3RDPA 1E2NA 4Y2GA 5LYJB 1DEXA 3ZW9A 1ECLA 1R10A 2LP4Y 5HKLA 3H7AA 5B58T 3RVMA 4NTZA 2G40A 3KJEA 3I3OA 1XX4A 4HMQA 4KPEC 1RXYA 2F55A 4E13A 3T6KA 2ILTA 4HNSA 2ADOA 1CFZA 1FNBA 1UJ5A 2QGNA 3I8XA 3NHJA 3IEPA 4JIGA 5JEEA 5JAIA 1BXGA 3O4FA 3K9QO 4OOFA 3QJYA 3O47A 1CBUA 3TRDA 3FFXA 4HPWA 2EP7A 2H08A 2OAGA 4DF3A 3TFWA 4B3FX 1BEZA 2IHJA 4X9XA 2ZR0A 2X19A 1I80A 3TZ6A 4JCSA 2JAHA 5ALHA 3D2LA 3NTRA 5B3KA 4AYTA 4HLUA 4XCXA 2DR2A 2MYUA 4J0CA 3VDXA 2ECFA 5YASA 2O8EB 4DCVA 3PD0A 1KR5A 2H5EA 3BGDA 4HHEA 1OQAA 1OH7A 4X3CA 1P4SA 1U28C 3KALA 2GSWA 3EIOA 3DC7A 3PC8C 1WQ4A 2G28A 2OESA 1AKQA 4A10A 3S8YA 2QLNA 2R7MA 3TSWA 2VAWA 3FNEA 4NS1A 2G1PA 3OIUA 3FCUB 3ESDA 4HDMB 3ENZA 5IKXA 1EHYA 1UCFA 1UK9A 1H8ED 3HC7A 4NV3A 4PPFA 4QIIA 5KNBD 3B12A 3Q0EA 4I08A 4E21A 2Z9DA 2ZZNA 4EY7A 4R51A 1KO8A 2PGOA 2C77A 4AG6A 4EY8A 5BMVB 1F4PA 4NH4A 1EVJA 3W78A 1PR1A 2EJ5A 1TO1E 3MT9A 5CA1B 2VHVA 2WVJA 3FLEA 1MOSA 1M67A 2P4SA 2P2LA 1C8LA 1XZPA 1B16A 2BHSA 3J7AC 4J1QA 4EL5A 3WLTA 4AWAA 1D5WA 4EB8A 1KMCA 4XVCA 3GJXC 4JYAB 4ZI7F 3QI2A 3EXEB 4F3YA 2ZVPX 1KPGA 1LX7A 2NOGA 5CFRA 4Z0NA 5HTOA 5A4JA 3WLJA 3FG9A 4LVUA 4DXHA 4Q00A 4L5YA 3PD1A 5JMOA 3D7SA 2H2HA 3G7SA 1IQPA 1N0WA 5E4YA 2EBFX 1U94A 1LSOA 1QC5A 4J7UA 4TV9F 2QD5A 4AZ0A 4DHEA 2D1SA 3DS8A 3BH6A 2O7QA 3MWKA 5BWLA 4BTVA 3QH4A 3NAQA 4I4LA 1KBZA 4Q82A 4ZDEA 3WO1A 1K39A 5JNSA 1NFRA 4MRPA 3H4MA 3H0UA 3LPCA 3PVZA 2J0EA 4KRGA 4QBTA 5EAIA 4MRAA 4XVRA 2FPGA 1SXJA 1HK7A 3IAM6 2YWXA 4MMZB 5CCEA 5L3SB 2CXXA 1OHHD 2ORYA 1LWNA 1I10A 2IPXA 4ZT5A 4BLWA 4NCAA 2BKUA 4OATA 2PUWA 4NULA 3IT2A 3OQHA 3NH6A 5C1IA 4D4JA 4WLOA 3HEAA 4RVHA 4D4HA 1IXSB 3EZNA 3HXTA 4FFOA 2OR3A 3OIFA 2DQKA 1LDBA 4YQYA 4FJWD 2CMKA 3K1ZA 3LP5A 3L8HA 5CHYA 2OSBA 1NM5C 4A0FA 2C7QA 3ENNA 3ETNA 2MWMA 3P85A 3NATA 4QGAA 1FFHA 1L8QA 4I8IA 1OXBB 1E60A 2LCQA 2P6RA 2YN4A 3I5AA 5CDHA 2E1PA 4KDRA 4AMZA 2X0JA 5EP1A 1Q7EA 3EH1A 4HH1A 4D79A 5J4HA 3DVAB 2XJ4A 3VR6A 2FW1A 4QSMA 4RDCA 4EB6B 5AW1A 5DUFA 2HQ1A 3R75A 4YCJA 4CKEB 2OFXA 2XDWA 1XU7A 3EMKA 1HDXA 4NU6A 1POWA 1RE0A 2VTEA 3PPWA 3IAHA 3I28A 3C70A 3LRTA 4G6ZA 1OFUX 3MQ2A 4RK7A 1KI1A 5CDYA 3N2LA 4CMEC 2QX6A 3WLOA 4LYJA 3ZVKA 2OAP1 1Q1AA 1JPUA 4BLQA 1ZUIA 1F17A 3GCWA 1SXJC 1YOBA 2ODBA 3CSDA 3N2ZB 3W5SA 1BRTA 3A6JA 4O3MA 1I2BA 4NAHA 3N8DA 5FTWA 1UM9B 3AF2A 3ZNPA 1GQQA 4TRRA 3FHTA 4BWFB 1AZTA 4U0GH 1MOPA 1Z0SA 1X42A 1EA7A 2Q8QA 2YBEA 3ZH2A 2DKNA 2EFJA 2B0CA 4OBBA 5JH7A 1VCOA 3J80A 2FZ5A 1KIFA 2WBLC 2GD0A 3LBYA 3UKJA 3HJFA 1U7TA 4LMPA 5KSOA 2GEJA 1Y1TA 2JFVA 3KBOA 3TJRA 2F3QA 4N6NA 3U44A 3SJZA 3R8FA 3HHPA 2YDYA 2QD3A 4MIEA 3ROQA 1W88A 2CK3A 3TTXA 4ZVKA 3W5VA 4ENVA 3D6AA 3ZLJA 3H1BA 1WV1A 2ZDQA 4MUGA 2ZPTX 5HWSA 1O1YA 5BURA 4D3FA 3R6LA 1TEHA 1TKBA 1LBIA 2GHQA 2Q6TA 2ZJYA 3SJUA 2OV4A 3MCZA 4CDNA 1EWRA 3H0EA 3VO9A 1JEEA 1O97D 1SEVA 2NQ8A 2ODEA 3MMSA 4K46A 4DWVA 1MFZA 3BB1A 3BZUA 1AN9A 3TQCA 3WBFA 1DUIA 2AOXA 3F7MA 4GM4A 4J1SA 3Q7HA 3V5IA 3N6VA 1PJSA 2XE8A 3E61A 3DD1A 3S2SA 5LQSA 4W5NA 1QJCA 1ZA1A 1GDDA 1SH7A 1Y9ZA 3EAQA 4GKBA 4YLGA 1OAOA 2C94A 3IAUA 4LKRA 5AIBA 2FLWA 8GPBA 3U3KA 4CQNA 3A4IA 1RCFA 3N2NA 2FJ0A 3UWOA 4CODB 3MJFA 1F7VA 7MHTA 1EBUA 2W70A 2CLOB 3WRXA 3F5QA 5ICMA 3FYSA 1QS0B 2FQWA 3QITA 4L8LA 2HT1A 4NICA 3U3ZA 5JZMA 4GZ3A 1AXGA 2GS9A 4JCQA 1PEYA 3VPDA 3S55A 3ZGXA 4UDXX 1TUEA 1QVVA 2Z2YA 1WM1A 4KXWA 4DDMA 2X22A 3TD6A 5DGCA 2WYWA 4I5DA 4K6HA 4ZAFA 2YHIA 2F43A 4QWMA 3RRJA 4DWWA 4EEKA 2O2EA 3R3XA 5HSGA 2XGMA 1J7JA 5DMXA 1M2JA 3HPRA 2C5HA 3WICA 1NPYA 3L4SO 3HY4A 4UBMA 4C6TB 1Q7GA 1T4BA 2IH5A 1R6VA 5IN4A 1JKXA 2EBWA 3B48A 3MHPA 3FKSD 3L07A 4MUFA 3AF0A 2R6AA 3BCUA 4TLBA 2X6RA 1G4HA 4Y9SA 5FA8A 4X24A 1U6JA 4EJFA 5KYXA 1UKEA 4MV9A 2C98A 2Q29A 2EWMA 4PGMA 2AJLI 1R27A 1QCYA 4H0FA 5JMTA 2OQVA 1XDWA 2YCLA 2RC5A 3P19A 1JMVA 1QONA 1U5BB 2QTZA 5HQTA 1BD4A 1R0SA 2JK1A 3MWJA 1G17A 1ZG3A 2Q0XA 2C9OA 2HSEA 4AY5A 2GUWA 1RXEA 2C3YA 5BWNA 1YZTA 4FW9A 1MDFA 1CZKA 5JJBA 3MJEA 1TCAA 3JAKA 1W2XA 1U9CA 1N6IA 3JPYA 3ZWPA 4LZJA 1NQXA 2ZRHA 2KB0A 3UMFA 1T9KA 3CURA 2IYYA 4C0BA 2UZ4A 3FYUA 3BTUA 3PNOA 4IZHA 5L7WA 3L1KA 2C00A 1NVMB 3B3JA 2ZR8A 4KPYA 2ASEA 1E1DA 2A8YA 1GNRA 2O0MA 1SUFA 1NATA 2W2PA 1BE6A 3NHLA 2Y0CA 4W8HA 4NK5A 2R5WA 1HNXB 4Z4IA 1LZKA 1HLFA 4DXDA 2UKDA 1UMCB 2C2GA 3K16A 4W4TA 2H7CA 4MYTA 3HO1A 4N65A 4BUJA 3ZIAA 2P6OA 1Y33E 5L4LA 4Q47A 1P1KA 4INJA 4KUEA 2P3OA 1V8BA 2QP4A 1G42A 2XEXA 3DAOA 4K05A 3I62A 2X8BA 3LQYA 1G3IA 3JD1A 3PUJA 1V3TA 4L28A 5BP7A 1GP2A 1NXXA 1QYRA 1PLLA 2GHTA 2O2GA 3NTXA 4NBNA 3M81A 3AKCA 4NJEB 2JHFA 1RBMA 3ZGYA 2ZTVA 4MINA 4AN4A 1GUFA 1H2RS 5EFZA 2KYRA 3AX6A 3BE5A 3G0OA 2I2AA 3AHCA 3DOIA 3HBMA 3LT5A 4WLUA 4A6PA 4ALIA 3SC4A 3CGGA 4KODA 3GUCA 1OV6A 4JQOA 4E51A 4U2DA 2A9RA 2ORVA 1D1PA 4OP2A 3QEKA 1MAAA 4YCBA 3EEYA 3PGJA 3UCXA 3DL0A 4IIYA 4S1PA 5KNDA 3MYBA 2GK7A 16PKA 2WAMA 5HUJA 4FDVA 3TIVA 3CLTC 3E1SA 4O8ZA 4DDUA 2QL7A 4X62B 5JCXA 4D0SA 3UH0A 1QUEA 3CSUA 5SYNA 4CIBA 4ZAVA 3EZYA 1B8UA 2IX9A 1JJVA 1RQXA 2P3SA 3TZHA 4DQKA 3B7WA 1PFUA 4TV8F 3FVRA 5TJHA 3ZJYA 2OOSA 3F1LA 1Y48E 3NXKA 4JCRA 5BVGA 1Z0AA 4FX2A 1U63A 1U1IA 3OO1A 3A11A 1Y5RA 1YIOA 3EQ8A 5DRTA 1U2PA 4ES6A 3HDGA 1QHIA 4Y6PA 3OZ7A 1FQKA 2I22A 3PUIA 4OBXA 4RNDB 5A71A 3UB3A 1JJAA 1H5NA 3ZUGA 3L7AA 4BNYA 3EWNA 4JP1A 2Y2UA 3ORFA 3CX8A 1I51A 3L46A 4L6WA 4EGJA 4GHWA 1KVTA 3W3AA 4Q5IA 4O0LA 1C0LA 2IIPA 5E6SB 3OEHD 3O4GA 1V7QA 2MSLA 4A8HA 1E2HA 3ZZTA 3NWBA 4CCYB 4OXRA 5BYAA 1UMBA 2W3PA 4BO9A 5KTSA 1D6SA 1Q7RA 2VP5A 1H2FA 3MTAA 1NC3A 3JATB 2Q5JA 1I24A 5BN1A 3BMCA 1XZGA 4US2R 1HKUA 3TL6A 2Q5IA 1U9YA 2PWYA 4FNAA 2B0JA 4G1BA 1GR0A 3FNFA 3O95A 1PW5A 1BU8A 2PG3A 2QTFA 3RV4A 2GCOA 4WXRA 3MPOA 3Q3VA 2B4AA 3TW0A 5AKXA 7REQB 1RZRA 2VJQA 4BZZA 1TVCA 3I09A 1QWSA 3D8HA 3MB8A 4Q3OA 5FXMA 5IP5A 2AK2A 3N8NA 3ZDZB 4LXIA 2RAFA 3IP8A 4IVPA 3LBIA 3O1JC 2PL5A 5IH7A 4GX2A 1JPJA 3B89A 3OM1A 1U8TA 3PTZA 3FUCA 1THGA 1G1MA 4LWPA 4M99A 1XZQA 4Y1FA 4ZVRA 1CP2A 3GEGA 4RH0A 5DHRA 3S5JA 2R6ZA 2NTYC 4AY3A 5BR8B 2PZAA 1UZMA 3ETCA 1WMEA 1MNQA 3D7KA 1JIVA 3IOBA 5DASA 1WXXA 3P0EA 4AZ0B 4F9TA 2HSWA 4MUJA 4DCJA 2P6MA 5GZ3A 1PFVA 1LH0A 1P4JA 4MW4A 1R8JA 4M8NE 1MRZA 1VLZA 2HA7A 2ISCA 3IODA 3TMYA 3TDCA 1WD5A 1E3LA 4M8SA 1YZQA 1V39A 3QHPA 1HT1E 3GVCA 4KXLA 1UJ6A 1SVWA 1BFUA 5JI2E 5CITA 4M1EA 5CT9A 1BA3A 2IZ0A 3KOUA 4NFLA 3KQHA 2PD4A 1FEZA 1TF5A 2GBIA 4OI4A 3CPSA 2YHBA 1M0EA 3FCEA 2XEDA 3T1QA 4MYUA 4N4AA 4RPCA 3HCRA 3SR3A 4IV5A 1TAHA 3IBYA 3NH9A 4KJZA 3K73O 1EFLA 4JWKA 4RADA 1C14A 1KVRA 3IHKA 3OZDA 2HFJA 1F20A 2KM1A 1I2DA 2FWNA 4HNQA 1R5JA 2XUJA 2B1RA 3H2SA 1RCUA 4IEIA 2AZMA 3BD6A 3WIOA 4B34A 4YA6A 4PZEA 4BHTA 3AB7A 3H2GA 5B6JA 3G1UA 4ND4A 3TXAA 4EG6A 4F86A 3OE5A 3UK6A 2W42A 3C4VA 3V3KA 1J0DA 3SEZA 1LTHR 2NIPA 2FSPA 3M2TA 4F38A 5DDIP 3OOJA 3CU5A 1YZVA 2OILA 3NWEA 1QFYA 5KINB 4XWWA 4URHA 3D5EA 4KFUA 1DRKA 1FNDA 4BAZA 2E5LB 5F7ZA 4DUGD 5I7RA 3Q0GA 4BAUA 2HMWA 4BKQA 4JJ8A 3DBLA 1IY8A 5BQOA 4BFVA 3GUHA 4LK2A 4LNHA 1J0EA 2A9PA 1NWHA 5A4DA 1T5HX 3GLHE 2BFNA 1GY8A 1GLNA 4YUWA 2N42A 2NSYA 1QQ5A 1YBFA 4I42A 2HMAA 4U2BA 3KJHA 4EGCB 4YI5A 4NIMA 1ESCA 3PF9A 4UJ5A 3F1KA 1N5DA 4KYVA 4XCVA 4CG3A 3QG1A 1Z15A 3L7BA 4N8DA 1KOJA 3LQFA 4JC0A 3H3FA 4R9NA 5HRCA 1E5VA 2CLFB 4KQMA 5G02A 1UP7A 1RMQA 4P2BA 3C3BA 1ZUHA 4FDLA 4ARVA 4AS1A 4ZTUB 3WFIA 1QCZA 1ESDA 1EFPA 2B92A 2PSHA 3GRZA 4UVGA 3ROMA 3HFGA 2GK6A 2NTNA 1KY5A 4AF7A 1SCUA 1CVLA 2BMAA 4YP6A 4E09A 2J0QA 2DUMA 3AR9A 1UJCA 3PQ8A 1E89A 1UC9A 1Y8AA 2RHJA 4YK7A 4UTRA 1TEVA 2ZT5A 2BI4A 2Y4NA 3NPAA 2BFDB 2JJMA 4JWVA 5E9AA 4ILEA 5H3CA 4PQEA 3LTNC 3F2VA 3RYTC 3PPIA 1PEKE 1JLHA 2J6HA 1JE1A 2Z4RA 4UM5A 3SSOA 1KOFA 4TT3D 3ZGVA 4ELWA 1JZSA 1TIKA 2H5IA 4UBLA 4CGYA 1JEAA 1Z4JA 5KSWB 4LHXA 2DC1A 4P38A 1W44A 4OX9B 5DNDA 3FPEA 3VXKA 4JBGA 3H5OA 2M6KA 2ZZKA 1HDIA 1U4OA 3UWDA 2D0DA 2P4UA 3SS8A 3QYRA 3P9RA 3HYTA 1OA0A 2QAGC 5CNMA 2FEAA 3Q98A 1PJTA 3WHIA 2PQMA 4AMYA 4OHFA 1FIUA 1VE5A 1F1BA 2Y6UA 3I0MA 3IMEA 4B3SB 1G7RA 5GAJA 3SG0A 1RJ9A 3MT7A 1E77A 4L3OA 4C2TA 3OM0A 3RHSA 1ZOPA 3ORSA 4ZT6A 1Z3IX 3SQXA 2F3SA 3CV3A 4RE5A 4ZOBA 2EJCA 1Q0TA 1BOFA 5AYVA 1HUQA 2J1LA 3NJ4A 4JODA 1ACMA 5FO1A 4F1WA 1NXWA 4B40A 1VC2A 1WY7A 1KY4A 2N75A 3EIWA 1SHKA 3ESQA 1CUFA 2WAYA 3HA7A 4C7KA 1DBQA 1NRXA 4LFBB 2EFHB 3P94A 2F7SA 2RHWA 3ZDRA 2PBFA 5G4KA 1NOKA 3R5XA 3BPSA 5ENDA 2POCA 3FKSA 2F9IB 2DJIA 4IJMA 3CX6A 2BFMA 1K6MA 3PHJA 4IUYA 5DF1A 1OI7A 1ZMXA 3H2KA 3KB1A 3EXHB 1O08A 3UT5B 3ZJTA 4RVUA 5AVOA 3VTKA 1MB3A 2FR8A 2QPLA 4NEHB 2O52A 1TM4E 4HG2A 5AWFC 4BLUA 3A6GA 5JECA 1F5SA 3IULA 1R8XA 1ZD9A 1GNPA 1UPCA 2OCAA 1XWWA 3NOQA 4O4JF 2VAVA 4F8JA 4MHTA 2F59A 3WZLA 3MCWA 5K20A 1JR6A 4UVHA 1E7YA 1P8JA 4RV9A 2BFPA 2IK8A 1X1AA 1XCOA 3D3QA 4DCTA 3A3NA 1WXHA 3ZW7A 3PD7A 2I7TA 1KK3A 2W6PA 5T5QA 5BN4B 1TW2A 5IKMA 4C7OB 1ILWA 3R77A 3RIHA 3RK4A 2R6GA 5KKCA 4RPLA 1JTEA 4Y2PA 4EQ6B 2QRJA 1B93A 2FDXA 5KWIA 3EGXB 4LY6A 2QD2A 5KAMA 3P9QA 5K9ZA 4KO4S 3UOWA 4MAMA 4UXHA 3E27A 4Z51A 3VC3A 4HQRA 3IVCA 4LNAA 3P0JA 3W8DA 2H3HA 2PKRA 3DMRA 2XGGA 2VPWA 3DWFA 3NTVA 1P80A 5B1YA 3PBKA 1ODLA 1UC8A 3LUGA 4X1KA 4YONB 4JVMA 3RUEA 4YCLA 5F77A 2XGOA 1DI0A 1L5RA 4JLJA 5EIBD 3PTAA 4KR2A 3VNUA 4OB6A 4MCIA 3ECSA 1JG1A 5DV9A 5IDXA 3U9TB 2IOHA 2QA5A 4JB8A 1QNLA 4YV1A 4RD1A 4DLPA 3ZD7A 4NOJA 2GCIA 3WB0A 9ABPA 2R97A 1H2YA 3GRUA 1GHTA 3LG2A 1TZMA 2GAJA 1F0YA 2LD4A 4LKOA 1KDYA 1GPKA 2ZT7A 2RIRA 2CHQA 2J5QA 1E6UA 2BGIA 3CTPA 4BGIA 5AR1A 1LVHA 1FA9A 1M1YA 5J2UF 4YGYA 4DLBA 3LT0A 3EYAA 4HTFB 5DN9A 4QG3A 3A26A 1SPXA 4K9OA 1YUBA 2EZ8A 2N1MA 3CBGA 3L6EA 4ZT7A 4YT4A 1Y3HA 2HI0A 2NTJA 1KI2A 3EMBA 3IAM1 5AP9A 4DJ5X 3Q11A 4HF7A 4ZCMA 3GV0A 3DMPA 2JGIA 2B9EA 2NSDA 4KITB 1LF0A 3AY0A 1Q21A 1TQ2A 3NETA 4X7PA 2BIFA 4R6WA 4HXGA 3BRSA 1QK3A 4LW8A 3U4MA 4H4EA 2IQ5A 4RTMA 1U7DA 3RYHA 1VL8A 4RBNA 1E2KA 2C7GA 2VP6A 3L6RA 3RIEA 4DIEA 1A8PA 2AE1A 3R5FA 1YUMA 1L7DA 4FNOA 3WBBA 4EPWA 4EX6A 3NRCA 3QBJA 1TYDE 4RVNA 4GKVA 1G8SA 1T5DX 2J4CA 2LR0A 1HTTA 1XQ9A 1N8SA 2IS2A 2XY4A 2ZAIA 3AI1A 2AEEA 2IYQA 2WV7A 5JJKA 3OP4A 1NONA 3F49S 4OMRA 5KTOA 5EKDA 1K7SN 4S05A 1AQUA 4P4GA 4B6PA 5CUQA 1QG0A 5DNCA 1BGXT 1P72A 4X65B 3KXPA 1M54A 4U63A 2CT8A 2GD1O 3CNQS 1VPEA 3B82A 3QPWA 2ZT6A 4IDFA 3LPDA 2IHNA 1JB9A 2GT1A 4Q3CA 3KYCB 3ILVA 4LZPA 3WLQA 4KRFA 2PMCA 4MX8A 3CISA 4JDPA 4I55A 1QAMA 1JDSA 1PFQA 4KREA 1DUBA 5IM4F 2VK4A 5HOEA 1J0XO 3GBSA 5J2UB 2AFHE 1EGVB 1K98A 5EIWA 3WLEA 2HBYA 1QIDA 3BGVA 1KK1A 3ROKA 3RUHA 1G6Q1 4DJTA 2MJLA 1YZHA 2BBOA 3R4VA 1ZWLA 4IDAA 4G0PA 4BEJA 1ZOIA 1NUHA 5BN5B 3L84A 1CRWG 1U80A 1QF9A 1V6SA 3RW9A 4JOQA 4FMPA 1V9SA 1YQ9A 2H17A 4EG5A 5CFLA 1N92A 5DNEA 3SYNA 2UYYA 3BJIC 4F47A 1A7KA 1EE9A 1RFGE 1XTQA 4PPYA 4QVKA 2IITA 1OR8A 1D2HA 1Y8QB 3A1NA 1EVIA 3EISA 4KSBA 4YC7A 3TTVA 4AZTA 2JDID 2J4FA 3DL7A 4D9FA 2I29A 2WPDD 4KOEC 1YU9A 1MG0A 1NW5A 2DXIA 1QIIA 5A9SB 3QIAA 3G9XA 2FK7A 4YMVA 3L8CA 2WFLB 3WLAA 1LX6A 1PUXA 4Z0PA 5AI5A 5CD1A 4G5SA 5CH5A 1S1MA 3CNLA 3MTGA 5LB4A 5BWMA 3H0CA 4IIGA 2IUUA 2NO0A 2VIIA 1NVGA 2DPXA 1DT3A 2IA5A 5JRJA 2ZLBA 4R5HA 2NU7A 2ECPA 4HEJA 1YRQA 5CT4A 1MHPA 1OKKA 3HSKA 2W83A 3DVSX 4JSTA 5LWQA 1EFRA 3WADA 2J5II 3IILA 1I1OA 3GD7A 3R3WA 1OBHA 4KP7A 3A36A 4FDTA 4C7XA 2R48A 5ERGB 1JAIA 1M5UA 1BQ3A 1SA0A 3OSZA 2X40A 1M8FA 1SJ9A 2V7TA 2W90A 1LWOA 2G8NA 3BXXA 4JUCA 4S1TA 1J2JA 4U3JA 4BVJA 1JDTA 2JHAA 4GGOA 4YHBA 1VKRA 3ONEA 2ZUEA 2HA4A 5HXAA 4GBED 421PA 1PX2A 1J8YF 3KKZA 1U31A 4M89A 3P9ZA 3D4IA 4NCJA 4BO5A 3TIGA 1E3SA 2XNHA 4P7JA 5B37A 3G23A 3PIIA 4D8VA 6LDHA 1RPNA 5LMNB 1L6RA 2HU2A 3LUKA 4CLDA 1NURA 4HNAA 1RJGA 2XQVA 3TLFA 3IIKA 2VPZA 3DO5A 4JOSA 2J9FB 2O2DA 1LNZA 1ICIA 1YZLA 3F6BX 4FBLA 2I71A 4QOFA 4Q9LA 5F35A 4ZU1X 1JVNA 5H16A 1FPQA 1ZNZA 1E32A 2M6LA 3SN6A 4BWVA 4CM9D 1JNYA 4F45A 5K09A 3P8ZA 4WE3A 2W6MA 3B1KA 1DT5A 3BXHA 4TL7A 1DFHA 4FN8A 1TJ5A 4RHTA 3EDRA 3FSEA 4JYCA 4DILA 1X0VA 4R9VA 2I34A 1X1BA 1DV1A 4PYIA 3IH5A 2O54A 1X1QA 2C58A 1U0TA 3D8BA 4IZOA 4HTAA 1QNFA 2OCDA 3PGKA 1V7ZA 3NGLA 2ZSFA 4FFLA 4RAOA 3S40A 4RGYA 2WYOA 5F4BA 1L7BA 1LNQA 5CG2A 4KXXA 3ZWMA 4D9MA 4FB5A 3OKPA 5CJJA 5I7HA 5J58A 5HM6A 4NU5A 1SXJD 2LXNA 4H7FA 1ZCZA 1QQBA 1GQOA 4WN9B 2HL6A 4N3AA 5LD2C 4EEZA 5IF9A 1UBHS 2R1TB 2VHUA 2WLTA 4P33A 2YIDA 1IZ9A 2D7DA 1KIAA 1B26A 2W8ZA 1SD2A 1OX4A 1SZCA 1WU7A 2CW5A 4P31A 4TXNA 1I6WA 5EJAA 4NBUA 1JI3A 2VUTA 1YA8A 1RYEA 2OLEA 4TTQA 1M9NA 4DC0A 1H2AS 2PYIA 3JQ6A 3NDJA 4FHCA 1KHHA 2I4RA 3I9KA 2WABA 5IS2A 1PWEA 3OIDA 2PL3A 4BASA 3NAGA 2E6UX 3MG9A 1UQUA 1Y6FA 1GAJA 1M1NA 2CBGA 1B3BA 1X77A 2VLIA 1NAHA 3EC7A 3F8TA 3FPFA 1TYAE 2OP0A 4QAQA 1M34B 3HKCA 1IHXA 3SAJA 2D5IA 1OYVA 2CL0X 1ZX1A 1EFKA 1SRQA 2NZVG 5KWVA 1WBDA 2WWGA 4HN2A 4BN4A 1ZC3A 3HSSA 4Y2SA 4MWCA 2VPYA 3SF8B 4ZHSA 4E1AA 3HM2A 1ECPA 4DR7B 1NVEA 4DPKA 4TN1A 4I50F 4BBPA 5TJ9A 3V4FA 4ER3A 4JUIA 4MRMB 2K6GA 4YJDA 4IDQA 4EI9A 2JIBA 2B98A 4PLVA 4C6HA 4UQOA 1XA0A 5GZ1A 3RQSA 2CLKB 3GMSA 5KB3A 3PDCA 4LXHA 2V45A 4WPGA 4YXWD 1GDHA 3LYUA 4AT1A 3BN3A 4CN9A 3KQNA 2RIPA 4AQDA 2HZBA 2RHCA 2GPYA 4WMLA 1A27A 1KERA 3M3DA 1CERA 1ISFA 1JNXX 2JLSA 1MO6A 4FDAA 3O8BA 4O02B 1NDUA 5G3ZA 1QIEA 2WWTA 2FH5B 3Q4GA 5EQFA 2H59A 2WWVD 4AJPA 5CVUA 5B2EA 3K9NA 1ZHOA 1VG0B 1XALA 4DMFA 3G7NA 4ZJPA 1CB7A 3LYHA 5KYVA 1ZRMA 4UQLA 3QVJA 1BA2A 1SQ0A 4TLEA 3KU1A 3E3OA 4GGMX 1EGAA 1BDBA 4UZEA 4LYYA 1RU3A 2PEYA 5K3OA 1JYSA 2VT2A 2XUIA 4BU1A 4DA8A 4IJ6A 4IDNA 3GLKA 3SZ3A 3WIDA 2X3FA 4G8DA 3ZYCA 3JVVA 1VKZA 3AESA 4B5LA 3JR3A 1EXVA 3ZTWA 2GEUA 1M0SA 4PQYA 1J2EA 5AHWA 2QMUA 3WC4A 4LG1A 5K45A 1QGAA 4DE5A 4OI0A 2O0HA 4ZKDA 4P35A 4F3TA 3AVYA 2C92A 3PNMA 4KB5A 2ZI7A 4RA9A 2ZQRA 4NX2A 1I9GA 1PO7A 3EVZA 1OIWA 4A5OA 2OD9A 4UULA 4BZQA 3BXFA 4CMIA 1H94A 4OJYA 3OQVA 2DTXA 1GGFA 1N78A 2ZRFA 1N5MA 1Z0DA 1GGEA 3COWA 4K3UA 1N6KA 5LA6B 4RL6A 1OAKA 1XMXA 1FNNA 2Y1KA 1M76A 3UOGA 1H4QA 2E87A 2Q7XA 2E2WA 3CE6A 5BSVA 3UJAA 4EMLA 1G8AA 1R0ZA 1FSSA 1HNNA 2C4NA 3NM6B 4Q9IA 5KU1A 3OCYA 4RIHA 3BDAA 3DP9A 1OAOC 1VXRA 3C8DA 3OKAA 4HLDA 5CYOA 2JRCA 1JEJA 3ABOB 3HACA 1Q7BA 4TTRA 5JVDA 3UV7A 1Q91A 4O33A 3EGCA 3ZD9A 1CKEA 2FV8A 2GWHA 3FMPB 3L41A 4E2WA 1VRGA 4IQGA 4ZZ2A 1VI6A 6REQA 4TZKA 1XVIA 2CB0A 4DREA 1EFHA 3L7OA 4U4AA 3DL2A 4US0R 4DLAA 2VPXA 1NM5A 1ZJ4A 2P1DA 4LMAA 2DPMA 2F3TA 2VH1A 3C1UA 4XH9B 1EQAA 4HFJA 2WQ7A 2DVMA 4MR7A 4MW9A 4DMUB 1R9MA 3UFXB 5LQKA 2CDCA 2Y1XA 4PF1A 1W8IA 2O8EA 3ELWA 3AF4A 1Z35A 1TKAA 5DW0A 1Z2CA 1Y5IA 4GYYA 4WZAB 4EB3A 1XB2A 4EJSA 2DGDA 1B7GO 2QVBA 3DORA 5T6BA 3TL2A 4DDTA 2FZSA 3GDOA 4G1UC 3VVMA 3ONFA 2HQBA 4UZSA 1GTMA 3PFKA 2VHEA 3E2MA 4RTKA 4TLDA 4I1SA 1XTKA 2XUHA 4XM0A 3JSXA 5CB0A 4YCAA 2QL5A 2REXB 4OFWA 1SU8A 2IL1A 4TZ6A 3HRHA 3IRUA 4PSUA 4W5RA 4QPPA 4LF6B 5DLYA 2IHVA 1W0KA 3EFEA 1W6UA 2B8EA 2V54A 1A5AB 2XOEA 1JKJA 3H84A 2CVQA 3JD4A 2HADA 1KJYA 4EK9A 5IF3A 5DP2A 4BV3A 2HF2A 2BRUA 2QTBA 1IK6A 1ZH8A 3COYA 4D8YA 3DFZA 4FFWA 4JUFA 3ONVA 4ZAYA 4DAEA 2IBMA 2ZS9A 4U2FA 5L45A 1NZYB 5IKLB 1UOOA 2IXDA 1HYGA 3H3JA 1YO6A 4REOA 3WRVA 2ZJ8A 4F06A 1FMFA 2J41A 2V6BA 1R3DA 2OAQ1 4Y3UA 1AHPA 2O50A 3ZU2A 2VS1A 1E1MA 5JD5A 1GCUA 1C9EA 3MFYA 4IJWA 2NN3C 1SVKA 4CHTA 4Q24A 3ZIAD 3LI2A 5CYFA 1ZICA 4B4WA 3FYUC 1ISHA 2X8LA 3DV2A 1KU6A 3EASA 3EQ6A 1QC5B 3M9XA 4XVHA 1VA4A 1RYHA 1ZCAA 2ZIEA 4P32A 4AMBA 1AVTA 2PQ0A 4ZVPA 5EHIA 3PEFA 4IIJB 3Q12A 4G5XA 2XWQA 5FOWA 2V6JA 2QEQA 3YASA 4B3DA 2FMKA 3CT4A 1KVUA 1O6ZA 4ATNA 2JFZA 1EUQA 1SUBA 1ADCA 3EXEA 3PGA1 1DBSA 4DV4B 1PJ4A 3NKFA 5FFNA 3U4DA 3T3DA 3TK1A 2NVUB 3L77A 1XT6A 3IP5A 1D0VA 1XO1A 1Y0BA 4DCPA 1O3YA 2BGGA 1E18A 1FXWF 5U4QA 2OKCA 4WESA 4ZTBA 5FUSA 3V4OA 3UT0A 5JCPA 1XK6A 1YC5A 4ONEA 4PC7A 1TGVA 1FOEB 4HSGA 2AUTA 2IYRA 4ZYLA 2CZQA 3SM3A 2JLYA 2GD2A 3OU2A 5CDSA 3TTYA 2XMPA 4L2IA 3PDJA 4D8WA 3SP1A 4HL6A 1C4KA 4JMLA 5IK2A 4CEIB 4JITA 1USVA 2QRGA 3QLJA 2QV7A 2BFCB 3LFHA 3JQFA 4QUGA 3EMDA 1RQ7A 4BS9A 1KYWA 1U8YA 3LWZA 1WXEA 3X2SA 1PJCA 1A4XA 1L4FA 4WFIA 3I76A 3O9ZA 4PSAA 3RS8A 1AF7A 1EVZA 4KQHA 4JLBA 2C88A 3ROTA 1O95D 3C4JA 3I23A 1I1QB 1KZ7B 3IUBA 1M74A 3TLGB 3KAPA 3B5EA 3GZNA 4FMCB 2FPSA 1PVDA 4JHXA 2G4LA 4FR5A 5D1NA 4CKEA 1C0IA 1T6YA 3PJFA 4WZBA 1DG9A 2J9XB 1UMDA 3CVWA 3GRYA 4P53A 1ZHHA 3GLGA 2WD8A 4QLOA 2JANA 2PWZA 1JYEA 1Y1RA 3DZGA 3GFOA 1BFDA 2RGAA 3OAAD 2JLUA 4AJ9A 1FYEA 5JZSA 5LQMA 1AC5A 2RC6A 4FU0A 4Y9RA 4GPAA 3V2HA 5CJPA 1NN3A 4QO7A 4BX0A 4ZEOA 1A76A 1J6UA 1FVOA 2GEFA 3C3JA 2G1JA 4EPVA 2PLFA 6AT1A 2XYVA 4LDQA 4FCVA 4MVWA 3R5TA 3QWFA 1MB4A 5GONA 4OX9Y 5DM4A 4MEJA 3JYNA 2ZTHA 4D4IA 3SC2B 1CS0B 1EWQA 1NR5A 1E1RA 3GRAA 4A0QA 3NYWA 1T9AA 3VBEA 3ODGA 1F4VA 3C3EA 3SXUB 5I45A 3UK0A