2WTKB

Structure of the heterotrimeric lkb1-stradalpha-mo25alpha complex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
371
structure length
311
Chain Sequence
SFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFDMPATQMLLEKLVPCLFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTDWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Lkb1-Strad-Mo25 Complex Reveals an Allosteric Mechanism of Kinase Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/metal-binding protein
molecule keywords CALCIUM-BINDING PROTEIN 39
total genus 82
structure length 311
sequence length 371
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtkB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtkB01
1JSVA 3W1FA 5FP6A 5HTCA 3OWJA 4FA2A 2B1PA 1Y57A 2ITUA 3LIJA 4RLKA 2QI8A 5ANEA 3VW6A 4O0TA 5KO1A 1PXOA 3IDBA 5EW8A 2IW6A 4PPAA 5IA0A 2BROA 3LFSA 3OG7A 3MI9A 4IVAA 3NIZA 4OTIA 5IKWA 3GXLA 3TEIA 2XK4A 4F08A 2XBAA 3KXHA 2XMYA 4TZRA 4NZWB 2JKMA 1U5RA 3GCPA 3HGKA 4BHZA 3RPVA 1SVGA 3VS2A 3C5UA 3DBFA 3R01A 3R8MA 3F88A 4RC3A 4HYUA 3GCUA 4RFMA 1XWSA 4IBMA 4FTMA 4EHZA 4YJOA 3VBXA 5J9YA 2W1IA 3CGOA 1Q24A 4FKWA 4FUXA 1ZAOA 4BCHA 5DBXA 3IOKA 4IFGA 3G5DA 4G6LA 2VV9A 4F09A 4KD1A 4WHZA 2EWAA 4NTSA 1YDTE 5HIDA 4PQNA 3PXZA 2IVSA 3EYGA 3EZRA 3TXOA 2UZEA 3OT8A 5HE0A 2IPXA 4CZYB 2PULA 5LVNA 2Q0NA 1A48A 2FB8A 2VNYA 2GNLA 3BE2A 3RZFA 4O7NA 3QQLA 4UMUA 4MCVA 1ZARA 4EHVA 1Q3DA 4DITA 2YIRA 1OM1A 2WO6A 3I6UA 3UYSA 5FEQA 2UUEA 4LL5A 4C2WA 3F5UA 4AGWA 3UDBA 4YTFA 5C8MA 1T45A 4CEGA 5CALA 4U3YA 5GJDA 4DCAA 4G6NA 4C0TA 1PMVA 3HMOA 3LPBA 5HX6A 3KXGA 1CKJA 4CD0A 4BC6A 2BTRA 3PE1A 1Q61A 5FM2A 3FWQA 2NPQA 4GVAA 4RQVA 5JGAA 3PA4A 4U5JA 1IEPA 4JQ7A 3V5LA 3RHXA 4S32A 3ROCA 4PTGA 4BKJA 4RWIA 4AA0A 3CJGA 3FQSA 2I40A 3RNIA 4ANOA 3EQFA 1PMEA 2ERKA 4BBEA 3A7JA 3C7QA 5E1SA 1OITA 2ZVAA 1JOWB 3KL8A 3LOKA 3NGAA 2QOOA 5G1XA 2OBJA 1OPKA 4L46A 4M69B 3GU4A 4U8ZA 2F49A 3OEZA 3PUPA 2PUIA 4X3FB 1V0PA 4ID7A 1U5QA 3EMGA 3JY0A 4DBXA 2RG5A 4XX9A 2XNGA 4B8MA 4BB4A 5A54A 5C1QB 4DA5A 2C6KA 1OECA 3FMLA 3RINA 2RSVA 2V22A 3FMKA 4IWQA 4IDTA 4BL1A 5B7VA 4OTFA 4FIHA 3GQIA 3ENMA 3RMFA 2OF4A 4L3JA 3CKXA 2LAVA 3ZFYA 5CVHA 3QTUA 4RIXA 4IHPA 4OGRA 4HPTE 3ZLYA 4CGAA 5LMKC 3HEGA 5E8WA 1NVSA 5K4JA 2WOTA 2XS0A 3FLWA 4KS7A 4R1VA 4XOZA 4C4IA 5IZFA 2AC3A 3DAKA 4II5A 4AZWA 3ZEPA 1J91A 4JAJA 4CFWA 3R28A 2YABA 3R30A 5ACBC 4BTJA 3NMUF 3AT2A 5FQDC 4IB3A 4R7HA 2ZM3A 3KRJA 4MXOA 4FKVA 3FKNA 4GU6A 3VQUA 2R5TA 5BVNA 5C01A 5I9ZA 4PF4A 5L4QA 1ZRZA 1UKHA 3LQ5A 4WRSA 2R2PA 2BRNA 4ZZMA 5F94A 2YDIA 4AFEA 1YI3A 4C2VA 2I0HA 3TKIA 3FLYA 4D2PA 4F9AA 2X81A 3RWQA 4UMTA 5CY3A 3RAIA 2BZHB 4D1SA 4N6YA 4JBVA 5IA3A 3POOA 4X2NA 2OH4A 4O1OA 2B52A 4IMYA 4OLIA 1PYEA 4FKRA 5CQUA 1WFCA 4FKIA 1WBNA 3AGMA 1V0BA 2R3MA 2XP2A 3BGPA 2YM3A 1WAKA 2UZDA 2XKCA 5FGKA 2UVZA 5HG9A 4DBNA 3U6HA 4CXAA 5JGBA 1Q8ZA 4O82A 4CKRA 1QPEA 2CKOA 2R9SA 2ITNA 2QOCA 4BDAA 4E5BA 5JQ5A 2C0IA 2DS1A 2JBOA 3LFCA 3NLBA 3PG1A 3KN6A 3LMHA 3LCKA 2HWOA 2WEIA 2WQOA 3FXXA 4QYGA 1H1PA 3GNIB 5JFVA 3PXKA 3IECA 3WZKA 3EQHA 3K3JA 4FTQA 3V6SA 3OCTA 4P7EA 4W9XA 3ORLA 4LM5A 4EZ7A 3OP5A 5FXSA 2PVMA 3KRXA 4QTBA 2F7XE 5J5SA 3TV7A 3AMAA 5JK3A 4D5HA 3OXZA 3ZS5A 5FRIA 2R3OA 4DEDA 2WMWA 4UYAA 2PPQA 3DPKA 5EKNA 3FKOA 3NWWA 4OTHA 4XV9A 4O7TA 1ZY4A 4R5YA 3EFWA 5HCYA 3V5QA 2FGIA 4MQ2A 4BCFA 4ZZOA 5DE2A 1OB3A 4IZ5A 4L44A 1KV2A 2WPAA 4ORKA 1UKIA 5IMXA 5IMEA 4RJ3A 4IWDA 3E7VA 4PRJA 4BZNA 3CXWA 4B0GA 4D2RA 3TNHA 2OGVA 3D15A 2BAKA 4XS2A 2ERZE 1PKGA 2QKRA 2YCSA 4TWNA 1Q8YA 3QRUA 4JG6A 5AP3A 2PVNA 4OTWA 4ZSEA 4CQEA 2C6TA 4D9UA 4RJ8A 3ZC6A 4ZSJA 3LXPA 2HZ0A 2OIQA 3GB2A 2GMXA 3KULA 3UMWA 5DNRA 2ACXA 3F61A 3A8XA 5AV0A 5EHOA 2FSLX 3NNXA 1YDSE 4RPVA 2WMQA 3TACA 3ZBXA 1NXKA 5KMJA 5A46A 5HNIX 4Y83A 5M4IA 5CEMA 5CWZA 4DTBA 3TG1A 2XIYA 4WKQA 3UZRA 2QCSA 5L3AA 4YUQA 3HYHA 1H8FA 5FUTA 3D0EA 2C6OA 2DUVA 4LYNA 3BX5A 3ORKA 3RPSA 4ASXA 4RWJA 4J8MA 2NO3A 5EKOA 3Q2JA 4QMXA 5GZ9A 3QXOA 4RQKA 2UZBA 3OOGA 5CU6A 2HCKA 3RNYA 1MUOA 5C26A 4USDA 4DCEA 2G1TA 3V04A 2VTNA 4AT4A 5EM5A 3D9VA 2JAVA 3BHYA 3FZTA 3ULZA 3KRLA 3M42A 1PXNA 2VGOA 3FZRA 3IPHA 3S0OA 1NY3A 2XB7A 3HUBA 3IW7A 2XNOA 3ZMMA 2JIIA 4FV5A 3Q4ZA 1GJOA 2XNMA 5DN3A 3WYXA 3ZU7A 1H28A 4JDJA 5AR2A 4EH2A 2GCDA 1M2QA 2I0YA 3BIZA 3K5UA 4AT3A 3CTHA 4PUZA 4P90A 5FDPA 3C9WA 1U54A 2C0TA 2C5VA 4NIFB 1O6KA 4CFMA 3NSZA 5AR5A 5A4TA 3WBLA 3VUDA 5J1WA 3NVKI 4F6UA 3MH1A 4DFXE 2C68A 3UIBA 4CMUA 3NNUA 3F3UA 2P33A 2XRUA 2OJIA 1YXSA 2YCRA 3EQGA 3QX4A 4EOPA 3QTRA 4O7ZA 3V5WA 4L3LA 3IW5A 3C1XA 2X39A 3FY0A 4HCUA 3RBWA 4BCNA 3UO6A 4X21A 1NVRA 1IA8A 3V5PA 2WTKB 3ZXZA 2ZDUA 3MGYA 5EHLA 3VS5A 4QQTA 2VWXA 5LWMA 3AXWA 4UZDA 2J7TA 5IQFA 2X6DA 3GOKA 4AOJA 5A4CA 4BHNA 2YCFA 3P79A 4ANSA 1XO2B 4RC4A 4H1JA 5DT0A 4X6QC 5BYZA 3T3VA 2XA4A 4I94A 3OY1A 2YIWA 4FZ7A 4NWMA 5FD2A 2R3QA 4JX7A 4NYEA 2HELA 5C03A 1IAHA 2GDOA 4ZAUA 3DFAA 2Z7SA 5BYLA 3COKA 4EH8A 1Y6AA 2WB8A 5F95A 3LKMA 4DH3A 4YZ9A 4D1ZA 3JUHA 4OAVB 1WZYA 5HNBA 3O23A 5TOZA 3AD4A 4TRLA 3R6XA 4YZBA 5AA8A 2W9ZB 3CE3A 3FZPA 2CSNA 4JG7A 3QA8A 4NSTA 4WUAA 4NIFA 4Z7GA 4MXCA 1G8AA 3W32A 3DS6A 3LFNA 2PYWA 5GIPE 4RIYA 2G01A 2FUMA 2ZM4A 5EI6A 2UZTA 1JKTA 1J7LA 2QKWB 2PUUA 4EYJA 4DTAA 4X2FA 3ZOSA 4YTCA 3P0MA 3ERKA 2QR8A 3QZHA 4O6EA 2CKPA 4X0MA 3E87A 1REKA 2YEXA 3SW7A 4UMRA 2HENA 3UP7A 4NK9A 3OBGA 3BQCA 4BWPA 2J0MB 4NM3A 2V55A 1OMWA 3JPVA 5CX9A 4G17A 3TZ9A 2XNPA 3RWPA 2X9EA 4QP2A 1Q97A 4RSSA 4JI9A 4AA4A 4U45A 3CS9A 3DDQA 3F3TA 3LCOA 2QD9A 4FZFB 2C6LA 5DEWA 5KNJA 4XOYA 4EKLA 1OIUA 4V04A 4AZEA 4FNZA 3HV5A 3I5NA 5EI2A 3W8QA 5GZAA 4O0XA 2X9FA 4LGHA 2FH9A 4F6SA 4FSTA 3SHEA 3D5XA 3FQEA 2A0CX 1PKDA 3QD3A 1O6YA 4YNOA 2BAJA 3TUCA 2VO0A 2BHEA 3QQUA 2A4LA 4BF2A 3V8WA 2QOQA 4PTEA 3UG2A 3OROA 1QPJA 3GEQA 2E9NA 5E8UA 3PRIA 4DH8A 2WMXA 4QYFA 2WTIA 3BWJA 3PPZA 4ZJJA 3PTGA 3CEKA 2VNWA 4IAFA 3C13A 5E7RA 2UW3A 1J1CA 5BQ0A 2XNNA 4DFLA 5KMOA 3ZLWA 2FYSA 2PVRA 3H4JA 4IIRA 5K3YA 2VWBA 3MTFA 4EC8A 4FGRA 5TO8A 3E8CA 4QMVA 4RJ4A 1OBDA 4U80A 2WMRA 3IK3A 5AR4A 4F9YA 1YDRE 3L8XA 3R2BA 4I21A 5D1JA 5GJGA 3UVPA 1JAMA 1ZMWA 5F20A 1YXVA 4O0SA 5HCZA 5AADA 4EK5A 4ZS0A 3ATTA 3D7TA 2VTLA 3N9XA 3OC1A 3QCSA 1R0EA 4F0IA 4YP8A 1JPAA 3ZO4A 4EOKA 3NUSA 1SVEA 4XG6A 3WOWA 3ZYAA 1OKYA 4DEEA 1OUYA 3O2MA 4C38A 4E1ZA 5CAOA 3LVPA 3LXLA 4FVRA 2LGCA 3I81A 3A4PA 5EDPA 3R71A 3GC9A 1DAWA 3RGFA 4JBQA 1GIHA 3VUTA 1QMZA 3G33A 4TYEA 4JDHA 3VS7A 3SD0A 4G9CA 1BYGA 5HD7A 1SVHA 2QVSE 4JQ8A 2WTVA 2OF2A 2YIXA 4KKHA 3OD6X 1BLXA 5CU4A 4M8TA 3QBNA 5AV3A 3ZC5A 4HVHA 3IQ7A 4BR3A 2JDRA 5LWNA 4CFVA 3AT4A 4AZTA 2OI4X 2W1EA 5IA4A 3C4EA 2OZAB 1STCE 4FNWA 1L3RE 4ACHA 3R7GA 2YM5A 5EK7A 4EOJA 4ASDA 4DHFA 4Y73A 3GC0A 5IEXA 2WMAA 3H10A 4QNAA 4E93A 2OXYA 1BKXA 1W98A 4LGGA 3TL8A 3RAKA 1OGUA 4FIFA 2RFNA 3VS1A 3OTUA 3QD4A 2BRHA 3G51A 4FKLA 1W8CA 4GMYA 3ZUUA 4Z16A 3RAWA 1B6CB 5HBEA 3DBEA 3TUBA 4RIYB 2ZB1A 4X2GA 1IA9A 4P5QA 2W9FB 2UV2A 3MFRA 3G15A 1NA7A 1CTPE 4RA5A 2EXEA 3E8EA 4F7LA 2ONLA 4ALUA 3A7HA 1P14A 3EZVA 3HMPA 4IDVA 3I7BA 4ITJA 5D9HA 4KA3A 4DGGA 1WVYA 4IX4A 3R7UA 3R9NA 5CXZA 3R9DA 5B2KA 3KMWA 2PVKA 2F4JA 1WBWA 3UPXA 3RK9A 3VVHA 1UNGA 4KBKA 4QTEA 3FI3A 3SXRA 3CQEA 3BWFA 1YI4A 2QO9A 4GYIA 4C34A 5IH4A 5CLPA 4A9UA 4EYMA 3ODYX 2KULA 2PZRA 4E73A 5GNKA 4N57A 2C5YA 4LFIA 3OS3A 5CT7A 4YZNA 5EDQA 2VAGA 3AC3A 2RL5A 1OI9A 3F5GA 2BKKA 4I24A 3MN3A 4LMNA 4C35A 3PFQA 5DH3A 3BEGA 4O91A 4RX8A 3VAPA 3QALE 5A3XA 3COIA 2GHMA 3DXPA 4MF1A 3UIUA 4K77A 5E91A 3QZFA 4S2ZA 3I0OA 3SOAA 4GV1A 3GC7A 4XRLA 3TKHA 4AT5A 5BUJA 4MVFA 1AGWA 4QTAA 3H9FA 5B0XA 2CGVA 4EQUA 1YXUA 4GG7A 4FUYA 3BU6A 5HD4A 4QMNA 4USEA 4MWHA 2P2IA 2PE0A 3LFFA 2JGZA 4U44A 3HA8A 3MIYA 5TT7A 4ACMA 4IE9A 4EK8A 1PXJA 5ETCA 3IKAA 2OH0E 3RPOA 4GL9A 4FIJA 5BUEA 2C69A 4EH5A 4CKJA 2OK1A 3BQRA 4ANBA 2F7ZE 4B6LA 4E6QA 3BYSA 4M7IA 4D2WA 4HYIA 3HRBA 3OW3A 1Q4LA 2EXCX 4IB1A 2VO6A 4FTOA 1MQBA 3V51A 4ZMEA 4GIHA 3BYVA 3Q04A 4FT5A 3MVJA 5BVFA 4G6OA 4AGUA 3ALNA 4IM3A 3KN5A 3E63A 5EQPA 4IC8A 4FV1A 4QD6A 4XH6A 2IVTA 4QP7A 2YM7A 4RIWB 3HAVA 1XBBA 2QHMA 3CD3A 4AOIA 2VWWA 3PIXA 3UNKA 4ZOGA 3UPZA 2VWZA 5H8BA 4DG3E 5CF6A 3HMIA 1FQ1B 5CU3A 5IF1A 5M09A 2GNHA 3OXTA 4KAOA 1JKKA 2JAMA 3BV2A 3PPKA 1Z5MA 5I9UA 5AX9A 4EHEA 3DAJA 3KA0A 2XJ2A 2OLCA 4I0TA 3HMMA 4W9WA 3DZQA 3BHHA 2FSMX 1CKIA 5I9YA 3IS5A 2O2UA 3DBDA 3PVBA 4TWOA 2JEDA 2ZYBA 3E92A 4EH7A 4F7NA 4FEWA 2CHLA 1OVEA 4WOVA 1PXKA 3PY3A 2YZLA 4S31A 3U9CA 2BVAA 1UWHA 4Q2AA 5AR3A 2ZV2A 5H8GA 3BELA 1WCCA 3WF6A 3C50A 2NP8A 5T68A 4PPBA 5LVMA 1KE8A 4K6ZA 3GU8A 5D7VA 1GNGA 1XHAA 5M56A 5F9EA 4EJ7A 3M11A 4E5WA 5JRQA 4RJ6A 4PDSA 4BWXA 3EFLA 3C5IA 4WNKA 4PP9A 4JOAA 3ITZA 4K11A 5BVDA 4EOQA 3QXPA 1F0QA 3DK3A 5A6OA 3VUMA 3HRFA 2P0CA 3ZRMA 2WEVA 4AZSA 5L8JA 3LCTA 4WA9A 2QC6A 3AMYA 4OBOA 3ODZX 2R7BA 5KX8A 4M84A 2JKOA 4MNFA 3UE4A 2YM6A 1OL2A 5IA2A 3ZXTA 2VRXA 4TPTA 4D5KA 4C4EA 5GIOE 2ETRA 4I6QA 3QUEA 3CJFA 4GJ3A 4XG2A 4PPCA 3MDYA 2H6DA 1OL6A 2IN6A 2V5QA 4YC6A 4LGDA 5EHYA 4IJ9A 2J6MA 2YZAA 4RWKA 4UMQA 4DGNA 4AW0A 4TYIA 5EYKA 3DY7A 5GINE 3PJ2A 3QTXA 4Z9LA 4JLCA 5AJQA 3R9OA 4ZTNA 3ZBFA 4D2TA 1GIJA 1PJKA 5E8VA 2YCQA 2PVHA 4TYHB 4MTAA 4XV1A 2UW0A 3PSBA 3DKOA 2Y6OA 1JSTA 3LFAA 1URCA 2BDJA 3R63A 4FNXA 4J71A 5E8TA 3TI1A 1GAGA 3U8WA 2UZNA 3LFEA 4IX5A 1Q3WA 5LMBA 4KABA 2ZV8A 4D4VA 4FV4A 3NAYA 2IO6A 4K8AA 1WBVA 4JX3A 4A4LA 3UNZA 4AF3A 4AW5A 5EOBA 5ACKA 5M4CA 3TDWA 5FBOA 2Z7QA 3ALOA 3Q9ZA 5HE3A 3VNTA 1UNHA 2H8HA 2JDOA 3G6GA 4OTDA 5CSPA 3EQPA 2OZOA 4PDYA 4BI2A 3QRTA 4A9YA 3FL4A 5EYMA 4BCOA 3DNEA 5DEYA 2YIQA 4QPAA 4RZVA 3F2AA 2OFVA 2QOLA 3FZ1A 4BKYA 5BNJA 4I5MA 3ZLSA 4S30A 3T9IA 2KTYA 3G90X 5K5NA 4OAUC 4CV8A 4OUCA 2UZWE 3GP0A 4W4WA 3R7YA 1Q8WA 2Z2WA 4FV8A 3WZEA 4YMJA 2XKFA 5HEZA 2HOGA 4K2RA 3E93A 4QMYA 1ZYDA 2IVVA 2WELA 5HG7A 3H9RA 3OZ6A 1QPCA 3Q32A 3NYOA 3OF0A 4QQJA 3WF9A 4IB0A 3TZ8A 1GIIA 1K2PA 3ACJA 4LOQA 3ETAA 3O71A 1G5SA 3H0ZA 4UXQA 5C4LA 4JS8A 4FV9A 2CLQA 3R7EA 2GHGA 3B2TA 3ZCLA 5DT4A 3H9OA 1YWRA 4I4EA 3EQCA 2YAKA 3NUAA 2FVDA 4BRXA 2G2IA 2UW9A 3QCQA 4LQMA 2C6MA 4N4SA 3HECA 4FI1A 4QO9A 2VTAA 4WUNA 5J9LA 4DFBA 2O8YA 4XG9A 3AGLA 4I93A 5CNOA 1H08A 4YO4A 3KCKA 3OT3A 3O8PA 2WU7A 4KKEA 4FSNA 4GYGA 3TT0A 2VX1A 2X8IA 5E8SA 4O83A 1R39A 3P1AA 1FGKA 2R0IA 4BKZA 5I9XA 3EIDA 4C59A 5J9ZA 2QQ7A 4O86A 4NCTA 2VTTA 2JIVA 5JFSA 2WQBA 3UP2A 4EZ5A 3HDMA 3R1NA 2XYUA 4JRVA 5AP6A 2PWLA 4YJSA 4UEUA 2P2HA 4GKHA 5CEQA 1IG1A 2XF0A 4B7TA 5CAPA 4H58A 4H3BA 4IW0A 3WE8A 4XV2A 2P55A 4M3QA 4HZSA 3O8TA 4NFNA 4LRJA 1BL6A 3UYTA 2W05A 1Q8UA 1FVRA 2YDJA 1YRPA 3EN5A 5LQFA 4APPA 4D2SA 2I6LA 2BUJA 3TM0A 4ZJVA 3C0GA 5FEEA 1SMHA 2YITA 1O6LA 2WOUA 4KSQA 4BDIA 4CT2A 3QHWA 5CAVA 4FTTA 2XNBA 4CYIA 2XIRA 2ONLC 5BX0A 3MB7A 3OEFX 3WI6A 4QNYA 4AW1A 1MQ4A 3QCXA 3FKLA 5HICA 4JAIA 4TTHB 5BPYA 3QL8A 2XCHA 4MXAA 3S1HA 4EH9A 5ETAA 1QL6A 3JR1A 3VBTA 4J7BA 3CR0A 5KBQA 2CPKE 2QU6A 4WD5A 1J7IA 2VU3A 3E8NA 2J50A 5HZNA 2VX0A 1Y6BA 4XYFA 1FPUA 2WTCA 4DEBA 4H39A 4Y5QA 1R0PA 2WQMA 4FSQA 2XRWA 4RIOA 5HO8A 2W06A 1PY5A 3Q3BA 2PMIA 4YO6A 3ZUTA 4J1RA 2WZJA 4QOXA 1M7QA 3RVGA 3A99A 3D7TB 3LCSA 4F7JA 1KE6A 3R8VA 3ZM4A 3FUPA 1UU8A 4EL9A 3LLTA 5AP2A 3FHIA 4C58A 1R1WA 2EB3A 2ESMA 3ACKA 4IJPA 3MY5A 5HE1A 3IOPA 1J1BA 3AC8A 3NW5A 2FSOX 2XIZA 3AC5A 3FMNA 4FSWA 4GSBA 4RMZA 5CI7A 4B4LA 3Q4UA 4XMOA 3RK5A 1QCFA 3NVMB 4O84A 1XKKA 3U51A 4RJ5A 3VQHA 1SYKA 3PYYA 4JT3A 4ZY5A 5EFQA 4EONA 1YW2A 4EOSA 4WRGA 3PXQA 3O96A 4HNIA 3ORIA 4O2ZA 3CY2A 3KEXA 4KRCA 2WMTA 3IDCA 3W2QA 3ZTXA 4LRKA 3QKMA 4FZ6A 5HQ0A 2YFXA 3ZHPC 4NW5A 3LM5A 4AW2A 4B8LA 5J79A 3HAMA 3KF4A 4J95A 3CPCA 4G2FA 3TJDA 5CVGA 3VIDA 5AUWA 5FWKK 4G5JA 4M68A 3JS2A 2UW7A 3GFWA 3NUXA 4FG7A 4C37A 3D2KA 4E7WA 4W4VA 3Q5IA 4G31A 5EDRA 3OHTA 1ZYLA 4LUEA 4WNPA 4R1YA 5DOSA 4CLIA 3V01A 2A2AA 3IGOA 4FTCA 4JR7A 3OVVA 2GQGA 3JYAA 3FLNC 4FTAA 2B53A 2QOHA 5J87A 3DFCB 5CEPA 3FLQA 3RM6A 3EFKA 2R3RA 3MWUA 4F4PA 5IQEA 4FSZA 3QZIA 4IVDA 4GK2A 5BMMA 2YM4A 2SRCA 3A60A 1UNLA 2H9VA 4X6RA 3TCPA 3ZLXA 4BWKA 2AC5A 2B9FA 2VWVA 3ROYA 4YZCA 3MW1A 4FNYA 4HGLA 2CCHA 3SC1A 2BCJA 3A7FA 3ELJA 3FY2A 5CU0A 2ITWA 1AQ1A 2CNUA 4DINA 2PY3A 4EUTA 4KIKA 4L52A 3KC3A 2G9XA 4NKAA 4DH1A 2XUUA 5JZJA 2OIDA 4KINA 3NIEA 3O7LB 4Z3VA 3VW8A 4DTKA 2WGJA 4FKTA 3E5AA 4E3CA 5DGZA 5JH6A 3RM7A 5KHXA 2VGPA 4AZVA 1GZ8A 3QUDA 2Z02A 4DN5A 4O0RA 1ZY5A 4OBPA 5LVLA 5EI8A 4CFFA 4E5AX 4Z55A 3U87A 4EEVA 4P4CA 2GS6A 4QRCA 4USFA 3U54A 4O0VA 4Q5HA 4DLIA 5IDNA 4KB8A 3CPBA 1VJYA 2QONA 2UW5A 3TIZA 4BDFA 3NNWA 1VEBA 1XH6A 3D5WA 3PJ8A 4JDKA 1H01A 3BLQA 5I0BA 3F2RA 4O1PA 4J99A 3BLHA 4QMOA 5IUHA 3MVMA 2W99B 3EQRA 3QTIA 4PNIA 4GFMA 3R0TA 4L7FA 5KMMA 1W7HA 1YXTA 3MVHA 1RDQE 4V01A 3S00A 3E3PA 3PJ1A 2XK6A 3BGZA 4HZRA 4F6WA 4AN9A 3NX8A 3QD2B 4JR3A 1KE9A 4HVSA 3OY3A 5A9UA 2QG5A 2UZVA 4YJUA 1TQPA 3W33A 3DDPA 4YBJA 2BZIB 2F2UA 4QQ5A 4X2KA 2OJJA 5KZIA 3KULB 4L6QA 4S34A 4ZEGA 4MBJA 3MESA 2X2MA 5AFVA 4DT9A 3GFEA 4IFCA 1U54B 4F1OA 2BFYA 3BHUA 3MH3A 5DPVA 3WIGA 3UQFA 4FSUA 3GU5A 2OU7A 1M2RA 4YTHA 4R7BA 3FE3A 4A9SA 4I22A 3L8PA 4BIBA 5LVPA 4TWPA 4J53A 2EVAA 2W1FA 2E9VA 4HVIA 4BCQA 2BIKB 3RCDA 1SNXA 2AYPA 5L2SA 1H00A 5I3OA 4M13A 4AS0A 3LLAA 5AP4A 5CNNA 2QURA 3FPMA 3U4UA 1UA2A 4Q5EA 3EB0A 3VJNA 1LP4A 4JJRA 2RFSA 2X1NA 4Y5HA 1YOLA 4ALVA 4BCMA 4C7TA 1K3AA 5L8LA 4H05A 2CNVA 4DFUA 3T3UA 3ZH8A 2B9JA 3BBTB 4IVBA 3P5KA 4L7SA 4CCBA 4PX6A 3HKOA 3DKGA 3FBVA 4OTGA 3W55A 1XH8A 1Q99A 5M51A 2BRGA 4CFNA 3OCGA 2XVDA 2JFMA 1YKRA 1PRYA 2DWBA 2YHVA 3KF7A 1W82A 2I0VA 5IEYA 1KE7A 3GUBA 3NUPA 4IZAA 4U79A 4WIHA 3UO4A 2QLUA 2VX3A 1Q41A 5EM8A 4FL3A 2ZDTA 4D0XA 2CKEA 3KFAA 3MYGA 4GRBA 5ANJA 3QRIA 3D83A 4PL3A 4C57A 4EH4A 4DT8A 4ERWA 2C5NA 2YACA 4BGHA 4XP3A 3K54A 3FYKX 3I4BA 3IW6A 5IA1A 3AT3A 4G34A 3GT8A 2JDSA 3TTJA 4BI0A 2JITA 4PL5A 2O3PA 2WD1A 2JD5A 3KK8A 4BY9E 1OIYA 1NVQA 2XK8A 4I41A 5FBNC 1YI6A 5KZ0A 3KU2A 4OR5A 4EI4A 2C47A 1ZOGA 4TN6A 1GZOA 3GCVA 5HBHA 4O0WA 3VULA 4KNBA 1H1RA 5M4UA 2H34A 3QLGA 5FLFA 4I6BA 3U6IA 2IZSA 2PSQA 3V5TA 3UC4A 4FEXA 2EB2A 3OWPA 3GQLA 1XH5A 4FKJA 4FTUA 4YR8A 4IADA 2IZTA 2PE2A 1ND4A 5HI2A 4EK3A 2R3PA 3A2CA 3Q52A 5GHVA 2RFDA 2VUWA 3NAXA 2HW6A 4OTQA 4RT7A 3DJ6A 3QHRA 1H0VA 3ORMA 4HVGA 2QO2A 3PY0A 4QPSA 4IAAA 4G1WA 2ZAZA 4BDKA 2A1AB 4FZDB 4H3PA 3RK7A 4AU8A 1DS5A 1PXMA 4E6CA 4KIKB 1FMKA 3HV6A 3EWHA 4YJTA 4FSYA 3QAME 3F69A 2W7XA 4LV5A 4ONAA 3OUNB 4GT3A 4C8BA 2V0DA 4FIIA 4EK6A 2BR1A 1DAYA 2GSFA 4L68A 2XH5A 4LL0A 5F1ZA 4CG8A 5ETFA 3R1SA 2J2IB 3EL7A 2W1CA 4L9IA 4NL0A 5M08A 4QMUA 2HZNA 1BI8A 4IC7A 1XBAA 1ZMVA 3FL5A 4M0ZA 3GGFA 2VTJA 4Y95A 3A7GA 4FF8A 3W18A 2PTKA 4ALWA 3UVQA 2E2BA 5FXRA 3PZEA 3R2YA 1CSNA 4YSMA 4F0FA 4GH2A 3UVRA 2QO7A 4PY1A 3KCFA 5T3QA 3QWJA 3VF8A 1PXLA 1UU3A 3UMXA 3TKUA 3VN9A 4AOTA 3MSSA 4CYJA 2XJ0A 3ZDUA 5ICPA 4FK3A 3IDPA 3PJ3A 4KBAA 2PVLA 5AR8A 4PV0A 3PRFA 4QP1A 4TKSA 4C4JA 2HY0A 4F9BA 3QQJA 4A9RA 4ZY6A 3TWJA 3PXRA 5C8NA 2PUPA 4A4XA 2PZIA 2BZKB 2J0LA 3FYJX 3W2RA 4OTPA 3LXNA 3FC2A 3P78A 3PG3A 3GENA 4EQMA 2W4KA 2JFLA 4Y85A 4OTRA 2IG7A 5HU3A 2OXXA 2B7AA 4FT7A 5FM3A 3R7OA 3COMA 3QRJA 4F64A 3EL8A 2PUNA 4O7YA 1JKSA 3WF8A 5DIAA 1FBNA 3PY1A 2BRMA 4ZP5A 4O7VA 2GS2A 3R7IA 3LCDA 5KBRA 3AD6A 3OCSA 4XP0A 2XM9A 3Q6WA 4FIGA 3TV4A 3E8DA 4EH6A 3O17A 1KOAA 4RJ7A 2HWPA 4PNKA 4APCA 4P5ZA 5EYCA 4QTDA 2ETMA 4RIXB 3N4TA 2OXDA 1KSWA 3LJ0A 5D11A 3I6WA 2CNQA 2F57A 1YHSA 1SZMA 1Y8YA 3VHKA 5CEIA 4ZJIA 3Q9XA 3I1AA 4BIEA 5CSWA 2DQ7X 3RALA 3LJ1A 3QCYA 4NH1A 4W8EA 2B54A 4A7CA 1BL7A 5I9VA 5EYDA 4EJNA 4IB5A 3Q9WA 4QP9A 3SLSA 2NNWB 2PVJA 4MXXA 5L6WL 3KMMA 3G0EA 4UYNA 4FYNA 2XCKA 5I4NA 1HCLA 3Q9YA 2E9PA 3C4FA 4G16A 3DU8A 4RC2A 3UOKA 4CNHA 4CMTA 5AV4A 2PZYA 4AXAA 3KXXA 2QODA 4ZLZA 1EH4A 4AUAA 2O63A 5BVEA 4B99A 3HV3A 5I5ZA 4BTKA 3T9TA 5HLPA 4JNWA 2R3JA 4NW6A 2H96A 3E88A 3W8LA 4ACDA 2VTPA 3Q5ZA 5D41A 3TNQB 5L2WA 2W0JA 5L2TA 2CCIA 3BYOA 4BCGA 5K4IA 5JEBA 2OJFE 4QMPA 5KMIA 4L67A 2PU8A 4FOBA 3NYVA 3UOJA 3U55A 2XK3A 1F3MC 3BGQA 3VJOA 4O2PA 5IPJA 4FTJA 3ZSIA 2HIWA 3N4VA 2R3HA 2Y9QA 4FKQA 2ZB0A 2X8DA 4YGAA 2RKUA 3F5PA 1GZNA 1ZOHA 3OUKA 4DLJA 3ZM9A 5DR9A 3TZ7A 4U9AA 4LRMA 2QLQA 4MHAA 5HGIA 5JGDA 2B9HA 4YU2A 2FA2A 2JC6A 2HZIA 4U6RA 2W96B 3Q6UA 3R1YA 4QMQA 3PSCA 3L9NA 3UGCA 4CLJA 3PXYA 5J95A 3LQ8A 2WFYA 5CXHA 4M15A 4D1XA 4U7ZA 5AUYA 3MH0A 2R3NA 1ZWSA 1YXXA 4FKOA 4G5PA 4U42A 5AAEA 4AGCA 2JLDA 4LI5A 5I3RA 4F9CA 4CG9A 4QT1A 2CGXA 2PHKA 4O0YA 4O6LA 4FVQA 4EK4A 3KKVA 1R78A 3PVUA 3UQGA 3AQVA 4A07A 3G9NA 4J52A 5CI6A 4HNFA 5C9CA 2C4GA 4R3PA 3V6RA 5IQCA 5TF9A 4E20A 4QMLA 3CBLA 1T46A 3ORZA 3II5A 4EOOA 4U97A 3N51A 3VBQA 4V05A 3E64A 4DEHA 5KE0A 4AWIA 4PMMA 5DVRA 2XNEA 5CQWA 2IWIA 3A61A 5DLSA 4ZTHA 3DGKA 4C62A 1YHWA 2HZ4A 4BIDA 5IDPA 4IX6A 1M52A 3REPA 2IW9A 4EOLA 2BILB 5J7BA 5HLNA 2OICA 2BIYA 3DB8A 1W0XC 2PK9A 3ZO2A 2FSTX 3HV7A 5EQYA 2R7IA 4QP3A 4FKSA 1CKPA 2YJSA 3R8ZA 4C02A 2X6EA 3D2IA 4RX7A 3NR9A 2GS7A 3S3IA 2YISA 2WMVA 2GTMA 3BYUA 4UWYA 4ANLA 4EC9A 2BTSA 2X7OA 4O96A 5AIKA 4ZTQA 4GCJA 2HXQA 4QMWA 1GY3A 1K9AA 4R6VA 2IJMA 5AV2A 3WIKA 1XBCA 3NCZA 4G3EA 4BZOA 2ETKA 4MH7A 3MVLA 2O65A 1OPJA 3SDJA 5KHWA 2PVFA 5LVOA 4BI1A 1OKZA 3VBWA 2I7QA 2CDZA 2E9OA 4QYHA 5HNGA 3KXNA 3COHA 2WQNA 4G3GA 4O7SA 1J3HA 3P4KA 2VD5A 2X7FA 4IM2A 3DTWA 3KVWA 5HESA 5L8KA 3W2OA 3QZGA 5DWRA 3F5XA 4UV0A 2C1BA 4YLLA 3NYNA 4FKPA 2HAKA 5DT3A 2OJGA 3P7CA 4R77A 4FT3A 1XR1A 3LJ2A 4FTRA 4M69A 3BPRA 2XM8A 4J8NA 4IAZA 4GKIA 3R7VA 2ITPA 2HK5A 4HGTA 3HDNA 4I92A 2EUFB 1PMNA 2A19B 2HXLA 5AIRA 5ANGA 5CF8A 4ITHA 4NCTC 4V0GB 5IISA 4X3FC 5B2LA 5JQ8A 3L8SA 4EKKA 5JRSA 3CKWA 3NS9A 3UZTA 3R22A 5AM7A 4ZS4A 1YOMA 3CSVA 3SQQA 4D4SA 1Z57A 4FK6A 3QQFA 5IQDA 5BVWA 3TN8A 4GW8A 5DMZA 4WSQA 4FX3A 5KKRC 3K2LA 3F9NA 4DEAA 4NUSA 3MTLA 5CSVA 4JXFA 2W4OA 4XNEA 1KUTA 3FJQE 2XJ1A 2BAQA 2G2FA 1CM8A 4GUBA 3I7CA 1JWHA 1MRYA 2CJMA 2WHBA 4M97A 5C4KA 3GCSA 2J0KA 2UW6A 5L6OA 5K0KA 3HNGA 1UU7A 2VO3A 4UMPA 4HCVA 2QOKA 4FEVA 4MXZA 5HVKA 3D5UA 1RJBA 3BHVA 3EH9A 1Z9XA 3QTSA 3R00A 1MRUA 3IGGA 3I60A 4XUFA 4DEGA 1WBOA 2WTJA 4BICA 3P7BA 2UZOA 3ZSGA 5M07A 2JDTA 2WKMA 3P23A 3ZONA 5A4EA 4AN3A 4UZHA 3BU3A 3Q96A 5KUPA 2ITZA 3PPJA 3EN6A 3V8SA 1CMKE 3N4UA 2RIOA 4M12A 4EHGA 5K5XA 4K9YA 1M17A 4XBRA 4GFOA 4HPUE 3UC3A 4BBFA 2YWVA 3KQ7A 2W5BA 4XLIA 4ITIA 1M2PA 4RVKA 2XK9A 5LMKA 1TVOA 2VWYA 5CEOA 3UIMA 5JKGA 3ULIA 5EM7A 4BTFA 4IEBA 3F7ZA 4E8AA 3F66A 5E8XA 4IQ6A 3A62A 3FV8A 3MFSA 2J51A 3F3VA 1LUFA 4HGEA 4O7RA 4BN1A 4D9TA 2YIYA 1W84A 4Q9ZA 1B38A 5K9IA 3GOPA 4FOCA 1LEZA 3Q60A 4W4YA 3MPAA 5AV1A 5CF4A 3NDMA 2R0UA 1RE8A 3TNIA 5FP5A 3UG1A 1R3CA 2F9GA 5HO7A 2X7GA 3WZJA 4RVMA 5DRBA 4YURA 2ITYA 5EQEA 3D7ZA 4AG8A 5CU2A 4D58A 4YC8A 4CTBA 4ASEA 3PWDA 3ATSA 1BX6A 4NM0A 4B9DA 3GU6A 4MF0A 2WXVA 3QLFA 4KRDA 3EJ1A 1B39A 3QQKA 4U0IA 4FG9A 5HG8A 5IH6A 1YOJA 2J5EA 4L45A 5IUGA 2R3FA 4TNDA 4OT6A 4IXPA 1G8SA 2BFXA 5DG5A 4BCPA 4PMTA 3VUIA 4UX9A 3AMBA 3IONA 3PXFA 4YJVA 1PYXA 4AGDA 3FEGA 2IW8A 3MY1A 4GT5A 2QOIA 2Z8CA 1APME 4L01A 4JBOA 4PWNA 1ERKA 1IRKA 4TYGA 3FMHA 2PMLX 3KRWA 4CCUA 4WO5A 1XQZA 4M67A 4UWBA 4RG0A 2Z60A 2VTQA 3QQGA 3UODA 4BDHA 4YC3A 3RZBA 3LFQA 4FSMA 4BBMA 1H25A 2OFUA 4ZZNA 4PMPA 4C3FA 2QNJA 5AP5A 4DGOA 3LAUA 3QKKA 5BYYA 1E1VA 3ZO1A 2RG6A 3FQHA 1OKWA 4O0UA 2QHNA 2J0JA 5ANIA 3WF5A 5LJJA 3KMUA 2GHLA 4G9RA 3S95A 1H1SA 4G3CA 3VS4A 3MV5A 3W2PA 2PVYA 1MRVA 2ZV7A 4XG3A 3L8VA 1KV1A 1XJDA 3C0IA 3DLSA 5FG8A 3ZEWA 4BGQA 3B2WA 1W83A 2GFCA 3BZ3A 2QOBA 1YWVA 3HLLA 4NKSA 4RLLA 2XKEA 3VS3A 3SVVA 1PXIA 4ANQA 3QFVA 1WVWA 3UJGA 1VZOA 3ZSHA 2VTRA 5CTPA 2R3IA 4FV7A 5DRDA 3VUHA 1S9JA 5ANKA 4TL0A 5L6PA 4ENYA 5JZNA 3CD8A 1P4FA 1E1XA 4XG7A 3SGCA 1BI7A 5D12A 2Y0AA 5BUIA 4CVAA 4G3FA 4ZTMA 3RCJA 1IR3A 4I20A 3UZPA 4HVDA 3GU7A 4EUUA 1YWNA 3KVXA 4R8QA 4LMUA 5KMKA 5HU9A 4JVGA 2OZAA 1IASA 4M14A 5ITAA 3F7WA 2BHHA 2W4JA 3OMVA 4BCIA 2YDKA 4X3FA 3BYMA 3CY3A 5H8EA 4YTIA 3Q4TA 3IG7A 3EHAA 5CENA 3V3VA 2XYNA 4FTNA 2VZ6A 4AN2A 4D0WA 2C6DA 1WBSA 3C0HA 3EFJA 5M44A 3U6JA 4J98A 4KIOA 2CN8A 2W17A 4AFJA 4TW9A 1YVJA 1SNUA 1U59A 4MEDA 4CMOA 3GBZA 2J4ZA 4Z7HA 1RQQA 4FODA 5AUUA 4NJ3A 3BI6A 1PMUA 3GCQA 5CSXA 5HORA 5M06A 3OWKA 3TNWA 3ZZWA 1H1QA 4WG4A 2HW7A 1Q62A 3QU0A 3JXWA 3RAHA 3A7IA 2BPMA 3SXSA 3KREA 3K5VA 4ZK5A 3FZSA 2PE1A 3MPTA 1G3NA 4E26A 4MKCA 5AUVA 4XHKB 5HO6A 3CCNA 4RX9A 2QU5A 4U43A 5DR2A 5HIEA 4E6AA 5K0XA 3PVWA 5LOHA 4XBUA 3FDNA 3ZFXA 3TUDA 2VWUA 3PIYA 4LOPA 4WBBB 2YAAA 4NM5A 4I6FA 2XEYA 4LOOA 1OKVA 3SAYA 4Y46A 5IU2A 5JT2A 2C1AA 5CASA 4TNBA 4IWPA 4F1MA 4N70A 3MS9A 2C6EA 4RRVA 2R3KA 3NYXA 3W10A 3DXQA 3QYZA 2ZV9A 3ZO3A 3HP2A 3GI3A 5HVYA 3VS6A 4HW7A 5AEPA 4UXLA 1FVVA 4MBLA 3PE2A 4L43A 4DH5A 3RHKA 4M0YA 3OXIA 3PVGA 1HOWA 4V0GA 5J8IA 4GG5A 4E4XA 4FE2A 1JVPP 1PW2A 3ANRA 3MJ2A 2HY81 5AP1A 1I44A 3O7LD 3ANQA 4S33A 5E92A 2VTHA 3BLRA 2IZUA 3FI4A 3PIZA 2VTIA 3NZ0A 4LUDA 3CGFA 3KGAA 3F6XA 3RPRA 4JDIA 1H0WA 1OPLA 1DI9A 4OW8A 5CZHA 3R9HA 5AP7A 3KK9A 1UU9A 4CQGA 3R02A 4NT4A 5JSMA 1PF8A 1H1WA 3PLAE 3UOLA 2J9MA 3MH2A 2XZSA 3MA6A 4D4YA 4PDPA 3D5VA 1GOLA 4EBWA 4KIPA 3C4ZA 3VHEA 3QQHA 2W5AA 3HUCA 2X2KA 4IZYA 4GUEA 2R4BA 4TXCA 4M66A 4I6HA 4WSYA 3EQIA 4AACA 4J96A 5DHJA 5J7HA 3P86A 1JQHA 4DFYA 2W1DA 3DBCA 2GQSA 1FGIA 3DXNA 4YHJA 4ASZA 4FKGA 5IQHA 2ZOQA 4C36A 4YJRA 5JFXA 4DC2A 4XG8A 5F4NA 2B0QA 3DJ7A 3L9MA 3MY0A 2EU9A 3NEWA 3DB6A 1V1KA 4C4HA 2WMSA 4MBIA 5EG3A 2E9UA 3L1SA 4KS8A 3TJCA 5J5TA 3BV3A 4FICA 1P4OA 5IQGA 1FINA 3D94A 2B9IA 4A4OA 3PWYA 2Q0BA 3E3BX 5BVKA 3F3WA 1ZMUA 2Y7JA 3NRMA 5H2UA 5M53A 4A9TA 3VF9A 3ZFMA 5HOAA 4E4NA 3BKBA 4XJ0A 4DG0E 4BDDA 3UBDA 1Y8GA 4YJPA 4AE6A 5AA9A 5IQBA 3ZRKA 3QGYA 4IH8A 2BMCA 4O38A 3BCEA 4MK0A 4Y8DA 3W2CA 1IAJA 4K33A 3OW4A 3VUKA 2REIA 3SG8A 4U41A 5E90A 1NW1A 1O9UA 1OIRA 5HBJA 4UN0C 5IA5A 1J7UA 4KWPA 5FEDA 1L8TA 3DK6A 3DTCA 3ZUVA 5KMNA 3DBQA 3JY9A 4L3PA 4WT6A 4MX9A 4PL4A 4LG4A 4GT4A 4RZWA 2J5FA 4JBPA 4QMMA 2XEZA 3MB6A 3VBVA 4P2KA 3OTVA 3OFMA 1UVRA 2XIKA 2YA9A 3AC1A 2YERA 1H4LA 3QTWA 2BALA 5AAFA 3S2PA 4CT1A 4F9WA 4HYSA 4CRSA 4D4RA 3DNDA 5TR6A 4DYMA 4O22A 4N6ZA 2GQRA 3GC8A 4IANA 4H3QA 4HOKA 3ORTA 4GVJA 2O5KA 4BFMA 3UO5A 3WZUA 5IEVA 3G2FA 2Y4IC 3I0QA 4FV6A 1HCKA 2PMNX 5FTQA 3WZDA 5GZ8A 2OKRA 2CGUA 3PZHA 2G15A 2ITTA 4KKGA 4EQCA 1TKIA 3NCGA 4TYJA 3RP9A 5DA3A 3THBA 3V5JA 3QGWA 3C51A 4HCTA 4BGGA 4UB7A 5HTBA 1ZOEA 3TIYA 1X8BA 2JKQA 5D7AA 3M2WA 1FVTA 4GJ2A 3LQ3A 2UW4A 2W5HA 4MD8E 5EOLA 5FDXA 2VTMA 3EOCA 4W4XA 4BDJA 4YSJA 4C4FA 4DG2E 4BDBA 4AQCA 4WNOA 4ZSGA 3L9PA 4EOMA 3GVUA 3ORXA 3KY2A 2VTOA 4OBQA 3ENHA 5J1VA 4CZUA 1OL5A 1VYWA 5G6VA 2WMBA 3AD5A 3EQBA 3VRZA 3DQWA 5A4QA 4I5HA 4K1BA 2AUHA 2ZJWA 2V7AA 4RA4A 4ARKA 3NNVA 4XLVA 4RIWA 1YHVA 2WTDA 2ZMCA 4IX3A 5AX3A 2GNFA 1WMKA 4FVPA 2W1HA 4AAAA 4CFXA 1OL1A 4U40A 4FV3A 3HP5A 1WBTA 1XH7A 2WIHA 1WBPA 3NUYA 3P7AA 4NM7A 3LXKA 5HVJA 1LPUA 4FL2A 1OZ1A 3KXZA 5EW9A 2EXMA 1P2AA 2W1GA 3KRRA 5CT0A 4CKIA 2I1MA 2Y6MA 3QKLA 2R64A 2GNJA 4ZY4A 4TY1A 3EYHA 4C61A 4CZTA 2ZMDA 4XRJA 3AOXA 4FL1A 1KE5A 3QC9A 4H1MA 2C3KA 3MA3A 4X2JA 4EBVA 3ID6C 2A27A 3FPQA 5IG1A 4QYEA 2PMOX 3DA6A 2VWIA 4FT9A 3UIXA 1ZYSA 3EN7A 4F1TA 4N0SA 2WTWA 3JVSA 2I0EA 1SM2A 1JNKA 3LZBA 3QC4A 5AMNA 5HCXA 1PXPA 2UW8A 3R8LA 3FMDA 3IW8A 3C4WA 4DFNA 4KUJA 2OO8X 3QX2A 4QP6A 1ATPE 5CSHA 4PP7A 4O7LA 1VYZA 5KMLA 2JIUA 3WE4A 3E62A 2OIBA 2FO0A 1BUHA 2F2CB 2Y8OA 3NPCA 5E4HA 1Q5KA 4MNEA 3SKCA 1V0OA 2YLEA 3TTIA 3LFBA 3NW6A 3QF9A 5HKMA 3PLSA 3O8UA 3OCBA 3QD0A 3ZZEA 4WG3A 5ETIA 1F5QA 3FC1X 4RX5A 5DYJA 3FSFA 3JVRA 5A14A 5IQAA 3IO7A 4BCJA 2YN8A 3HMNA 4F99A 3UOHA 3QTQA 3WILA 3QUPA 4DAWA 4YJQA 3BBWA 3HZTA 4NTTA 4I5PA 4ANNA 4O7WA 4WNMA 4HJOA 3RTPA 4AP7A 5H9BA 4O81A 4FYOA 5FTGA 2Y4IB 4IAYA 5M4FA 4JL9A 1JKLA 3HX4A 3DJ5A 3FMEA 4IM0A 5EW3A 5AAGA 3R9RA 3Q53A 3OOMA 4YNEA 2BKZA 2YLFA 3QTZA 1LR4A 2WIPA 2ZM1A 4ZLOA 3CLYA 1FMOE 3OBJA 4Y72A 3FI2A 5LMAA 2X8EA 3DK7A 3FHRA 4XCUA 2C0OA 4YHTA 4MD9E 4L8MA 2WMUA 3VUGA 1OL7A 3F3ZA 3AG9A 4YHFA 5AR7A 4JRNA 2ITQA 2CKQA 2ITXA 2JKKA 4GFGA 4PTCA 4QMZA 5AWMA 2WNTA 5CZIA 4K0YA 3V8TA 3SRVA 3G9LX 3NUNA 1ZYJA 4H36A 3HL7A 3FXZA 3PSDA 5JN2A 3POZA 2B55A 1LEWA 3BRBA 3FZOA 3G6HA 3R8PA 3A4OX 4EZ3A 4F70A 2OW3A 1PHKA 1UV5A 3LMGA 5DI1A 4QP4A 1DM2A 1ZZLA 2QOFA 4FV2A 4RBLA 4C33A 3ET7A 4ZXTA 5AM6A 3TNPC 3VC4A 3OWLA 4YPSA 1KWPA 5AP0A 4FEUA 2PZPA 2UVXA 4FG8A 3DT1A 3SX9A 4R78A 3CIKA 4WBOA 4F65A 2BDFA 4RFYA 1NT2A 4UY9A 5AUXA 2YJRA 3HRCA 4JQEA 4L00A 2UZLA 2C6IA 5CS6A 5C8KA 4AZFA 1CDKA 1ZXEA 4NU1A 4R3RA 4R7IA 3PDTA 1M14A 3PA5A 2V7OA 4I23A 4O27B 3RPYA 4NEUA 2C3LA 2OSCA 2PL0A 4HYHA 4J97A 4IVCA 4JIKA 5E8ZA 3UNJA 3QYWA 2BRBA 4RWLA 4FBXA 5IQIA 4JG8A 3QWKA 4ZTRA 2JBPA 4MXYA 3ORPA 2G2HA 3U4WA 1JLUE 1S9IA 2J90A 3R21A 5EM6A 4FGBA 3PP1A 4FEQA 4GIIA 5AUTA 4FZAB 4QPMA 3KXMA 4FC0A 3HA6A 5DFPA 4BDCA 3DKCA 2O64A 4PDOA 1QPDA 4MNEB 3RJCA 1JBPE 2BDWA 2R3LA 3MFTA 5B2MA 2O0UA 3DOGA 2Q83A 3LE6A 2R3GA 3T8OA 3BEAA 3MJ1A 3FAAA 4JIAA 3FMJA 5M55A 2WQEA 3QRKA 4IAIA 5FTOA 3QA0A 2C5XA 2WU6A 3VO3A 3NW7A 4C3RA 4BVUA 3KB7A 5IUIA 5KCVA 4EWQA 3MIAA 3G0FA 5LXMA 3MPMA 3A8WA 3TZMA 2X4FA 3PP0A 2HYYA 4CTCA 1UWJA 2NRYA 4MAOA 4ZSAA 2IZRA 2WAJA 4ENXA 4FMQA 3HVCA 4ZSLA 3FLSA 4BYJA 3H30A 4AA5A 1ZZ2A 2ITVA 3D4QA 4FSRA 5HX8A 2CLXA 1WVXA 2RF9A 5E9EA 4IAKA 3EN4A 3H3CA 4QTCA 1Y91A 3EKKA 4I5CA 3L9LA 1ZLTA 4I0RA 2GPHA 4MWIA 4QMSA 4C3PA 2XIXA 3I5ZA 3FXWA 4FT0A 3C4CA 2P4IA 5D10A 5JFWA 4BZDA 3RI1A 2CMWA 4UBAA 4YLKA 4DEIA 3F2NA 3R1QA 2QG7A 4MQ1A 3MBLA 4TWCA 3SRVB 3EQDA 3S4QA 4BYIA 1BMKA 5T6KA 2GTNA 4XV3A 2CGWA 4FR4A 4FTLA 5H3QA 1OUKA 3K3IA 5TKDA 4YZDA 4ZTLA 4F7SA 4QMTA 4ERKA 4GU9A 4R5SA 3W16A 3DQXA 5LCJA 5E1EA 1MP8A 5E8YA 3SW4A 2VTSA 5HHWA 3TV6A 5L2QA 2PZ5A 5CF5A 2QR7A 3VRYA 5CAUA 2GU8A 1DI8A 5ANOA 4ACGA 1YQJA 3CTQA 3M1SA 4IACA 4YPDA 5AUZA 5HLWA 3WYYA 3H0YA 3ZDIA 5EH0A 3AC4A 4O21A 2X4ZA 3C4XA 4RVTA 2RFEA 2XKDA 3LMIA 2VO7A 4F0GA 4ZTSA 2UZUE 3P08A 2V62A 4DFZE 2VN9A 4QYYA 2X0GA 2B4SB 5HG5A 4KSPA 4EORA 5BVOA 2NRUA 3DZOA 4U81A 4DH7A 3CQWA 3O0GA 3IW4A 4YZMA 2DYLA 4R3CA 5KKRB 2C3IB 4GS6A 4XEYA 4EOIA 1REJA 1U4DA 3F82A 4FKUA 3R8UA 1JSUA 1URWA 2Z7RA 3Q2MA 4HGSA 4D55A 2ITOA 4EWHA 4I3ZA 3CQUA 4TYHA 4E4MA 4DF3A 1P5EA 1H24A 5GJFA 2C5OA 1XH4A 1U46A 2JDVA 5CAQA 4BCKA 5LARA 4MYGA 2YWPA 3R73A 4GK4A 3SV0A 1ZYCA 4D28A 3P9JA 3DKFA 2WTKC 4RVLA 3FSKA 4I4FA 3MFUA 3BE9A 2OWBA 4CV9A 5HE2A 2X2LA 1H27A 4U3ZA 3TDVA 2YM8A 4YJNA 3FLZA 4L53A 4IWOA 4X7QA 3O50A 5I9WA 4FIEA 5TE0A 1OBGA 3EKNA 3DCVA 1H26A 4RGJA 2C3JA 2J0IA 1FOTA 3CTJA 1H07A 1TQMA 3NUUA 3R04A 3SA0A 3O51A 4ZMFA 3E7OA 1A06A 3WARA 3D14A 4FV0A 3UQCA 5JMSA 4DE4A 3I79A 3CP9A 3ZRLA 2IVUA 3B8QA 1A9UA 5FXQA 1AD5A 1VR2A 2P3GX 4OT5A 4ANMA 5HTIA 5IH5A 4CRLA 3AC2A 3ORNA 3PJCA 3U9NA 5DR6A 4BDEA 4RFZA 4XP2A 4NFMA 3PA3A 2W1ZA 4DGMA 1GZKA 3EN9A 4GK3A 5ANDA 1OIQA 3SXFA 4I1ZA 2F7EE 4Q9SA 2GNIA 2OG8A 5CVFA 1E9HA 3Q4CA 4GEOA 3RKBA 3UTOA 4DGLC 2OJ9A 4E4LA 2BZJA 4G3DA 2RGPA 4W8DA 2Z7LA 3DLZA 3DAEA 4KIQA 2UVYA 4LV8A 4BTMA 4FTKA 1M7NA 4K18A 3VWAA 4KBCA 4YBKA 3WF7A 5CYIA 2GFSA 3LM0A 3SOCA 1Q8TA 4NJDA 3LHJA 2XBJA 3VBYA 5L2IA 5C27A 5A6NA 1TQIA 4IZ7A 4TT7A 1I09A 3BU5A 4MD7E 4WG5A 3W2SA 4C4GA 4CFUA 3FMMA 4ZLYA 4D2VA 5A4LA 3FI8A 3DV3A 4QP8A 5LCKA 3HV4A 3R83A 3VS0A 5CANA 3BHTA 4UWCA 2XK7A 4QQCA 4I0SA 3LW0A 2Y4PA 4ZIMA 4X3JA 4L42A 4AE9A 1RW8A 1XH9A 4YLJA 5HIBA 5BMSA 4FTIA 2C30A 3LFDA 4A06A 4AX8A 5CEKA 3CC6A 4EH3A 5M57A 3B8RA 4CSVA 4BDGA 4E6DA 3SG9A 2CN5A 4PMSA 4UALA 2GNGA 4F63A 1KOBA 4XG4A 4ACCA
chains in the Genus database with same CATH superfamily
1JSVA 3W1FA 5FP6A 5HTCA 3OWJA 4FA2A 2B1PA 1Y57A 2ITUA 3LIJA 4RLKA 2QI8A 5ANEA 3VW6A 4O0TA 5KO1A 1PXOA 3IDBA 5EW8A 3TMOA 3TYKA 2IW6A 4PPAA 5IA0A 2BROA 3LFSA 3OG7A 3MI9A 4IVAA 3NIZA 4OTIA 5IKWA 3GXLA 3TEIA 2XK4A 4F08A 2XBAA 3KXHA 2XMYA 4TZRA 4NZWB 2JKMA 1U5RA 3GCPA 3HGKA 4BHZA 3RPVA 1SVGA 3VS2A 3C5UA 3DBFA 3R01A 3R8MA 3F88A 4RC3A 4HYUA 3GCUA 4RFMA 1XWSA 4IBMA 4FTMA 4EHZA 4YJOA 3VBXA 5J9YA 2W1IA 3CGOA 1Q24A 4FKWA 4FUXA 3ML1A 1ZAOA 4BCHA 5DBXA 3IOKA 4IFGA 3G5DA 4G6LA 2VV9A 4F09A 4KD1A 4WHZA 2EWAA 4NTSA 1YDTE 5HIDA 4PQNA 3PXZA 2IVSA 3EYGA 3EZRA 3TXOA 2UZEA 3OT8A 5HE0A 2IPXA 4CZYB 2PULA 5LVNA 2Q0NA 1A48A 2FB8A 2VNYA 2GNLA 3BE2A 3RZFA 4O7NA 3QQLA 4UMUA 4MCVA 1ZARA 4EHVA 1Q3DA 4DITA 2YIRA 1OM1A 2WO6A 3I6UA 3UYSA 5FEQA 2UUEA 4LL5A 4C2WA 3F5UA 4AGWA 3UDBA 4YTFA 5C8MA 1T45A 4CEGA 5CALA 4U3YA 5GJDA 4DCAA 4G6NA 4C0TA 1PMVA 3HMOA 3LPBA 5HX6A 3KXGA 1CKJA 4CD0A 4BC6A 2BTRA 3PE1A 1Q61A 5FM2A 3FWQA 2NPQA 4GVAA 4RQVA 5JGAA 3PA4A 4U5JA 1IEPA 4JQ7A 3V5LA 3RHXA 4S32A 3W0SA 3ROCA 4PTGA 4BKJA 4RWIA 4AA0A 3CJGA 3FQSA 2I40A 3RNIA 4ANOA 3EQFA 1PMEA 2ERKA 4BBEA 3A7JA 3C7QA 5E1SA 1OITA 2ZVAA 1JOWB 3KL8A 3LOKA 3NGAA 2QOOA 5G1XA 2OBJA 1OPKA 4L46A 4M69B 3GU4A 4U8ZA 2F49A 3OEZA 3PUPA 2PUIA 4X3FB 1V0PA 4ID7A 1U5QA 3EMGA 3JY0A 4DBXA 2RG5A 4XX9A 2XNGA 4B8MA 4BB4A 5A54A 4BJJB 5C1QB 4DA5A 2C6KA 1OECA 3FMLA 3RINA 2RSVA 2V22A 3FMKA 4IWQA 4IDTA 4BL1A 5B7VA 4OTFA 4FIHA 3GQIA 3ENMA 3RMFA 2OF4A 4L3JA 3CKXA 2LAVA 3ZFYA 5CVHA 3W0NA 3QTUA 4RIXA 4IHPA 4OGRA 4HPTE 3ZLYA 4CGAA 5LMKC 3HEGA 5E8WA 1NVSA 5K4JA 2WOTA 2XS0A 3FLWA 4KS7A 4R1VA 4XOZA 4C4IA 5IZFA 2AC3A 3DAKA 4II5A 4AZWA 3ZEPA 1J91A 4JAJA 4CFWA 3R28A 2YABA 3R30A 5ACBC 4BTJA 3NMUF 3AT2A 5FQDC 4IB3A 4R7HA 2ZM3A 3KRJA 4MXOA 4FKVA 3FKNA 4GU6A 3VQUA 2R5TA 5BVNA 5C01A 5I9ZA 4PF4A 5L4QA 1ZRZA 1UKHA 3LQ5A 4WRSA 2R2PA 2BRNA 4ZZMA 5F94A 2YDIA 4AFEA 1YI3A 4C2VA 2I0HA 3TKIA 3FLYA 4D2PA 4F9AA 2X81A 3RWQA 4UMTA 5CY3A 3RAIA 2BZHB 4D1SA 4N6YA 4JBVA 5IA3A 3POOA 4X2NA 2OH4A 4O1OA 2B52A 4IMYA 4OLIA 1PYEA 4FKRA 5CQUA 1WFCA 4FKIA 1WBNA 3AGMA 1V0BA 2R3MA 2XP2A 3BGPA 2YM3A 1WAKA 2UZDA 2XKCA 5FGKA 2UVZA 5HG9A 4DBNA 3U6HA 4CXAA 5JGBA 1Q8ZA 4O82A 4CKRA 1QPEA 2CKOA 2R9SA 2ITNA 2QOCA 4BDAA 4E5BA 5JQ5A 2C0IA 2DS1A 2JBOA 3LFCA 3NLBA 3PG1A 3KN6A 3LMHA 3LCKA 2HWOA 2WEIA 2WQOA 3FXXA 4QYGA 1H1PA 3GNIB 5JFVA 3PXKA 3IECA 4QDEA 3WZKA 3EQHA 3K3JA 4FTQA 3V6SA 3OCTA 4P7EA 4W9XA 3AKJA 3ORLA 4LM5A 4EZ7A 3OP5A 5FXSA 2PVMA 3KRXA 4QTBA 2F7XE 5J5SA 3TV7A 3AMAA 5JK3A 4D5HA 3OXZA 3ZS5A 5FRIA 2R3OA 4DEDA 2WMWA 4UYAA 2PPQA 3DPKA 5EKNA 3FKOA 3NWWA 4OTHA 4XV9A 4O7TA 1ZY4A 4R5YA 3EFWA 5HCYA 3V5QA 2FGIA 4MQ2A 2X0OA 4BCFA 4ZZOA 5DE2A 1OB3A 4IZ5A 4L44A 1KV2A 2WPAA 4ORKA 1UKIA 5IMXA 5IMEA 4RJ3A 4IWDA 3E7VA 4PRJA 4BZNA 3CXWA 4B0GA 4D2RA 3TNHA 2OGVA 3D15A 2BAKA 4XS2A 2ERZE 1PKGA 2QKRA 2YCSA 4TWNA 1Q8YA 3QRUA 4JG6A 5AP3A 2PVNA 4OTWA 4ZSEA 4CQEA 2C6TA 4D9UA 4RJ8A 3ZC6A 4ZSJA 3LXPA 2HZ0A 2OIQA 3GB2A 2GMXA 3KULA 3UMWA 5DNRA 2ACXA 3F61A 3A8XA 5AV0A 5EHOA 2FSLX 3NNXA 1YDSE 4RPVA 2WMQA 3TACA 3ZBXA 1NXKA 5KMJA 5A46A 5HNIX 4Y83A 5M4IA 5CEMA 5CWZA 4DTBA 3TG1A 2XIYA 4WKQA 3UZRA 2QCSA 5L3AA 4YUQA 3HYHA 1H8FA 5FUTA 3D0EA 2C6OA 2DUVA 4LYNA 3BX5A 3ORKA 3RPSA 4ASXA 4RWJA 4J8MA 2NO3A 5EKOA 3Q2JA 4QMXA 5GZ9A 3QXOA 4RQKA 2UZBA 3OOGA 5CU6A 2HCKA 3RNYA 1MUOA 5C26A 4USDA 4DCEA 2G1TA 3V04A 2VTNA 4AT4A 5EM5A 3D9VA 2JAVA 3BHYA 3FZTA 3ULZA 3KRLA 3M42A 1PXNA 2VGOA 3FZRA 3IPHA 3S0OA 1NY3A 2XB7A 3HUBA 3IW7A 2XNOA 3ZMMA 2JIIA 4FV5A 3Q4ZA 1GJOA 2XNMA 5DN3A 3WYXA 3ZU7A 1H28A 4JDJA 5AR2A 4EH2A 2GCDA 1M2QA 2I0YA 3BIZA 3K5UA 4AT3A 3CTHA 4PUZA 4P90A 5FDPA 3C9WA 1U54A 2C0TA 2C5VA 4NIFB 1O6KA 4CFMA 3NSZA 5AR5A 5A4TA 3WBLA 3VUDA 2X0QA 3NVKI 4F6UA 3MH1A 4DFXE 2C68A 3UIBA 4CMUA 3NNUA 3F3UA 2P33A 2XRUA 4O4BB 2OJIA 1YXSA 2YCRA 3EQGA 3QX4A 4EOPA 3QTRA 4O7ZA 3V5WA 4L3LA 3IW5A 3C1XA 2X39A 3FY0A 4HCUA 3RBWA 4BCNA 3UO6A 4X21A 1NVRA 1IA8A 3V5PA 2WTKB 3ZXZA 2ZDUA 3MGYA 5EHLA 3VS5A 4QQTA 2VWXA 5LWMA 3AXWA 4UZDA 2J7TA 5IQFA 2X6DA 3GOKA 4AOJA 5A4CA 4BHNA 2YCFA 3P79A 4ANSA 1XO2B 4RC4A 4H1JA 5DT0A 4X6QC 5BYZA 3T3VA 2XA4A 4I94A 3OY1A 2YIWA 4FZ7A 4NWMA 5FD2A 2R3QA 4JX7A 4NYEA 2HELA 5C03A 1IAHA 2GDOA 4ZAUA 3DFAA 2Z7SA 5BYLA 3COKA 4EH8A 1Y6AA 2WB8A 5F95A 3LKMA 4DH3A 3PFYA 4YZ9A 3VONA 4D1ZA 3JUHA 4OAVB 1WZYA 5HNBA 3O23A 5TOZA 3AD4A 4TRLA 3R6XA 4YZBA 5AA8A 2W9ZB 3CE3A 3FZPA 2CSNA 4JG7A 3QA8A 4NSTA 4WUAA 4NIFA 4Z7GA 4MXCA 1G8AA 3W32A 3DS6A 3LFNA 2PYWA 1W2CA 5GIPE 4RIYA 2G01A 2FUMA 2ZM4A 5EI6A 2UZTA 1JKTA 1J7LA 2QKWB 2PUUA 4EYJA 4DTAA 4X2FA 3ZOSA 4YTCA 3P0MA 3ERKA 2QR8A 3QZHA 4O6EA 2CKPA 4X0MA 3E87A 1REKA 2YEXA 3SW7A 4UMRA 2HENA 3UP7A 4NK9A 3OBGA 3BQCA 4BWPA 2J0MB 4NM3A 2V55A 1OMWA 3JPVA 5CX9A 4G17A 3TZ9A 2XNPA 3RWPA 2X9EA 4QP2A 1Q97A 4RSSA 4JI9A 4JMQA 4AA4A 4U45A 3CS9A 3DDQA 3F3TA 3LCOA 2QD9A 4FZFB 2C6LA 5DEWA 5KNJA 4XOYA 4EKLA 1OIUA 4V04A 4AZEA 4FNZA 3HV5A 3I5NA 5EI2A 3W8QA 5GZAA 4O0XA 1ST0A 2X9FA 4LGHA 2FH9A 4F6SA 4FSTA 3SHEA 3D5XA 3FQEA 2A0CX 1PKDA 3QD3A 1O6YA 4YNOA 2BAJA 3TUCA 2VO0A 2BHEA 3QQUA 2A4LA 4F78A 4BF2A 3V8WA 2QOQA 4PTEA 3UG2A 3OROA 1QPJA 3GEQA 2E9NA 5E8UA 3PRIA 4DH8A 2WMXA 4QYFA 2WTIA 3BWJA 3PPZA 4ZJJA 3PTGA 3CEKA 2VNWA 4IAFA 3C13A 5E7RA 2UW3A 1J1CA 5BQ0A 2XNNA 4DFLA 5KMOA 3ZLWA 2FYSA 2PVRA 3H4JA 4IIRA 5K3YA 2VWBA 3MTFA 4EC8A 4FGRA 5TO8A 3E8CA 4QMVA 4RJ4A 1OBDA 4U80A 2WMRA 3IK3A 5AR4A 4F9YA 1YDRE 3L8XA 3R2BA 4I21A 5D1JA 5GJGA 3UVPA 1JAMA 1ZMWA 5F20A 1YXVA 4O0SA 5HCZA 5AADA 4EK5A 4ZS0A 3ATTA 3D7TA 2VTLA 3N9XA 3OC1A 3QCSA 1R0EA 4F0IA 4YP8A 1JPAA 3ZO4A 4EOKA 3NUSA 1SVEA 4XG6A 3WOWA 3ZYAA 1OKYA 4DEEA 1OUYA 3O2MA 4C38A 4E1ZA 5CAOA 3LVPA 3LXLA 4FVRA 2LGCA 3I81A 3A4PA 5EDPA 3R71A 3GC9A 1DAWA 3RGFA 4JBQA 1GIHA 3VUTA 1QMZA 3G33A 4TYEA 4JDHA 3VS7A 3SD0A 4G9CA 1BYGA 5HD7A 1SVHA 2QVSE 4JQ8A 2WTVA 2OF2A 2YIXA 4KKHA 3OD6X 1BLXA 5CU4A 4M8TA 3QBNA 5AV3A 3ZC5A 4HVHA 3IQ7A 4BR3A 2JDRA 5LWNA 4CFVA 3AT4A 4AZTA 2OI4X 2W1EA 5IA4A 2XALA 3C4EA 2OZAB 4QEBA 1STCE 4FNWA 1L3RE 4ACHA 3R7GA 2YM5A 5EK7A 4EOJA 4ASDA 4DHFA 4Y73A 3GC0A 5IEXA 2WMAA 3H10A 4QNAA 4E93A 2OXYA 1BKXA 1W98A 4LGGA 3TL8A 3RAKA 1OGUA 4FIFA 2RFNA 3VS1A 3NFGB 3OTUA 3QD4A 2BRHA 3G51A 4FKLA 1W8CA 4GMYA 3ZUUA 4Z16A 3RAWA 1B6CB 5HBEA 3DBEA 3W0RA 3TUBA 4RIYB 2ZB1A 4X2GA 1IA9A 4P5QA 2W9FB 2UV2A 3MFRA 3G15A 1NA7A 1CTPE 4RA5A 2EXEA 3E8EA 4F7LA 2ONLA 4ALUA 3A7HA 1P14A 3EZVA 3HMPA 4IDVA 3I7BA 4ITJA 5D9HA 4KA3A 4DGGA 1WVYA 4IX4A 3R7UA 3R9NA 5CXZA 3R9DA 5B2KA 3KMWA 2PVKA 2F4JA 1WBWA 3UPXA 3RK9A 3VVHA 1UNGA 4KBKA 4QTEA 3FI3A 3SXRA 3CQEA 3BWFA 1YI4A 2QO9A 4GYIA 4C34A 5IH4A 5CLPA 4A9UA 4EYMA 3ODYX 2KULA 2PZRA 4E73A 5GNKA 4N57A 2C5YA 4LFIA 3OS3A 5CT7A 4YZNA 5EDQA 2VAGA 3AC3A 2RL5A 1OI9A 3F5GA 2BKKA 4I24A 3MN3A 4LMNA 4C35A 3PFQA 5DH3A 3BEGA 4O91A 4RX8A 3VAPA 3QALE 5A3XA 3COIA 2GHMA 3DXPA 4MF1A 3UIUA 4K77A 5E91A 3QZFA 4S2ZA 3I0OA 3SOAA 4GV1A 3GC7A 4XRLA 3TKHA 4AT5A 5BUJA 4MVFA 1AGWA 4QTAA 3H9FA 5B0XA 2CGVA 4EQUA 1YXUA 3UDSA 4GG7A 4FUYA 3BU6A 5HD4A 4QMNA 4USEA 4MWHA 2P2IA 2PE0A 3LFFA 2JGZA 4U44A 3HA8A 3MIYA 5TT7A 4ACMA 4IE9A 4EK8A 1PXJA 5ETCA 3IKAA 2OH0E 3RPOA 4GL9A 3NFFB 4FIJA 5BUEA 2C69A 4EH5A 4CKJA 2OK1A 3BQRA 4ANBA 2F7ZE 4B6LA 4E6QA 3BYSA 4M7IA 4D2WA 4HYIA 3HRBA 3OW3A 1Q4LA 2EXCX 4IB1A 2VO6A 4FTOA 1MQBA 3V51A 4ZMEA 4GIHA 3BYVA 3Q04A 4FT5A 3MVJA 5BVFA 4G6OA 4AGUA 3ALNA 4IM3A 3KN5A 3E63A 5EQPA 4IC8A 4FV1A 4QD6A 4XH6A 2IVTA 4QP7A 2YM7A 4RIWB 3HAVA 1XBBA 2QHMA 3CD3A 4AOIA 2VWWA 3PIXA 3UNKA 4ZOGA 3UPZA 2VWZA 5H8BA 4DG3E 5CF6A 3HMIA 1FQ1B 5CU3A 5IF1A 5M09A 3W0OA 2GNHA 3OXTA 4KAOA 1JKKA 2JAMA 3BV2A 3PPKA 1Z5MA 5I9UA 5AX9A 4EHEA 3DAJA 3KA0A 2XJ2A 2OLCA 4I0TA 3HMMA 4W9WA 3DZQA 3BHHA 2FSMX 1CKIA 5I9YA 3IS5A 2O2UA 3DBDA 3PVBA 4TWOA 2JEDA 2ZYBA 3E92A 4EH7A 4F7NA 4FEWA 2CHLA 1OVEA 4WOVA 1PXKA 3PY3A 2YZLA 4S31A 3U9CA 2BVAA 1UWHA 4Q2AA 5AR3A 2ZV2A 5H8GA 3BELA 1WCCA 3WF6A 3C50A 2NP8A 5T68A 4PPBA 5LVMA 1KE8A 4K6ZA 3GU8A 5D7VA 1GNGA 1XHAA 5M56A 5F9EA 4EJ7A 3M11A 4E5WA 5JRQA 4RJ6A 4PDSA 4BWXA 3EFLA 3C5IA 4WNKA 4PP9A 4JOAA 3ITZA 4K11A 5BVDA 4EOQA 3QXPA 1F0QA 3DK3A 5A6OA 3VUMA 3HRFA 2P0CA 3ZRMA 2WEVA 4AZSA 5L8JA 3LCTA 4WA9A 2QC6A 3AMYA 4OBOA 3ODZX 2R7BA 5KX8A 4M84A 2JKOA 4MNFA 3UE4A 2YM6A 1OL2A 5IA2A 3ZXTA 2VRXA 4TPTA 4D5KA 4C4EA 5GIOE 2ETRA 4I6QA 3QUEA 3CJFA 4GJ3A 4XG2A 4PPCA 3MDYA 2H6DA 1OL6A 2IN6A 2V5QA 4YC6A 4LGDA 5EHYA 4IJ9A 2J6MA 2YZAA 4RWKA 4UMQA 4DGNA 1G8JA 4AW0A 4TYIA 5EYKA 3DY7A 5GINE 3PJ2A 3QTXA 4Z9LA 4JLCA 5AJQA 3R9OA 4ZTNA 3ZBFA 4D2TA 1GIJA 1PJKA 5E8VA 2YCQA 2PVHA 4TYHB 4MTAA 4XV1A 2UW0A 3PSBA 3DKOA 2Y6OA 1JSTA 3LFAA 1URCA 2BDJA 3R63A 4FNXA 4J71A 5E8TA 3TI1A 1GAGA 3U8WA 2UZNA 3LFEA 4IX5A 1Q3WA 5LMBA 4KABA 2ZV8A 4D4VA 4FV4A 3NAYA 2IO6A 4K8AA 1WBVA 4JX3A 4A4LA 3UNZA 4AF3A 4AW5A 5EOBA 5ACKA 5M4CA 3TDWA 5FBOA 2Z7QA 3ALOA 3Q9ZA 5HE3A 3VNTA 1UNHA 2NYAA 2H8HA 2JDOA 3G6GA 4OTDA 5CSPA 3EQPA 2OZOA 4PDYA 4BI2A 3QRTA 4A9YA 3FL4A 5EYMA 4BCOA 3DNEA 5DEYA 2YIQA 4QPAA 4RZVA 3F2AA 2OFVA 2QOLA 3FZ1A 4BKYA 5BNJA 4I5MA 3ZLSA 4S30A 3T9IA 2KTYA 3G90X 5K5NA 4OAUC 4CV8A 4OUCA 2UZWE 3GP0A 4W4WA 3R7YA 1Q8WA 2Z2WA 4FV8A 3WZEA 4YMJA 2XKFA 5HEZA 2HOGA 4K2RA 3E93A 4QMYA 1ZYDA 2IVVA 2WELA 5HG7A 4DDIA 3H9RA 3OZ6A 1QPCA 3Q32A 3NYOA 3OF0A 4QQJA 3WF9A 4IB0A 3TZ8A 1GIIA 1K2PA 3ACJA 4LOQA 3ETAA 3O71A 1G5SA 3H0ZA 4UXQA 5C4LA 4JS8A 4FV9A 2CLQA 3R7EA 2GHGA 3B2TA 3ZCLA 5DT4A 3H9OA 1YWRA 4I4EA 3EQCA 2YAKA 3NUAA 2FVDA 4BRXA 2G2IA 2UW9A 3QCQA 4LQMA 2C6MA 4N4SA 3HECA 4FI1A 4QO9A 2VTAA 4WUNA 5J9LA 4DFBA 2O8YA 4XG9A 3AGLA 4I93A 5CNOA 1H08A 4YO4A 1XMLA 3KCKA 3OT3A 3O8PA 2WU7A 4KKEA 4FSNA 4GYGA 3TT0A 2VX1A 2X8IA 5E8SA 4O83A 1R39A 3P1AA 1FGKA 2R0IA 4BKZA 5I9XA 3EIDA 4C59A 5J9ZA 2QQ7A 4O86A 4NCTA 2VTTA 2JIVA 5JFSA 2WQBA 3UP2A 3O5AA 4EZ5A 3HDMA 3R1NA 2XYUA 4JRVA 5AP6A 2PWLA 4YJSA 4UEUA 2P2HA 4GKHA 5CEQA 1IG1A 2XF0A 4B7TA 5CAPA 4H58A 4H3BA 4IW0A 3WE8A 4XV2A 2P55A 4M3QA 4HZSA 3O8TA 4NFNA 4LRJA 1BL6A 3UYTA 2W05A 1Q8UA 1FVRA 2YDJA 1YRPA 3EN5A 5LQFA 4APPA 4D2SA 2I6LA 2BUJA 3TM0A 4ZJVA 3C0GA 5FEEA 1SMHA 2YITA 1O6LA 2WOUA 4KSQA 4BDIA 4CT2A 3QHWA 5CAVA 4FTTA 2XNBA 4CYIA 2XIRA 2ONLC 5BX0A 3MB7A 3OEFX 3WI6A 4QNYA 4AW1A 1MQ4A 3QCXA 3FKLA 5HICA 4JAIA 4TTHB 5BPYA 3QL8A 2XCHA 4MXAA 3S1HA 4EH9A 5ETAA 1QL6A 3JR1A 3VBTA 4J7BA 3CR0A 5KBQA 2CPKE 2QU6A 4WD5A 1J7IA 2VU3A 3E8NA 2J50A 5HZNA 2VX0A 1Y6BA 4XYFA 1FPUA 2WTCA 4DEBA 4H39A 4Y5QA 1R0PA 2WQMA 4FSQA 2XRWA 4RIOA 5HO8A 2W06A 1PY5A 3Q3BA 2PMIA 4YO6A 3ZUTA 4J1RA 2WZJA 1VLRA 4QOXA 1M7QA 3RVGA 3A99A 3D7TB 3LCSA 4F7JA 1KE6A 3R8VA 3ZM4A 3FUPA 1UU8A 4EL9A 3LLTA 5AP2A 3FHIA 4C58A 1R1WA 2EB3A 2ESMA 3ACKA 4IJPA 3MY5A 5HE1A 3IOPA 1J1BA 3AC8A 3NW5A 2FSOX 2XIZA 3AC5A 3FMNA 4FSWA 4GSBA 4RMZA 5CI7A 4B4LA 3Q4UA 4XMOA 3RK5A 1QCFA 3NVMB 4O84A 1XKKA 3U51A 4RJ5A 3VQHA 1SYKA 3PYYA 4JT3A 4ZY5A 5EFQA 4EONA 1YW2A 4EOSA 4WRGA 3PXQA 3O96A 4HNIA 3ORIA 4O2ZA 3CY2A 3KEXA 4KRCA 2WMTA 3IDCA 3W2QA 3ZTXA 4LRKA 3QKMA 4FZ6A 5HQ0A 2YFXA 3ZHPC 4NW5A 3LM5A 4AW2A 4B8LA 5J79A 3HAMA 3KF4A 4J95A 3CPCA 4G2FA 3TJDA 5CVGA 3VIDA 5AUWA 5FWKK 4G5JA 4M68A 3JS2A 2UW7A 3GFWA 3NUXA 4FG7A 4C37A 3D2KA 4E7WA 4W4VA 3Q5IA 4G31A 5EDRA 3OHTA 1ZYLA 4LUEA 4WNPA 4R1YA 5DOSA 4CLIA 3V01A 2A2AA 3IGOA 4FTCA 4JR7A 3OVVA 2GQGA 3JYAA 3FLNC 4FTAA 2B53A 2QOHA 5J87A 3DFCB 5CEPA 3FLQA 3RM6A 3EFKA 2R3RA 3MWUA 4F4PA 5IQEA 4FSZA 3QZIA 4IVDA 4GK2A 5BMMA 2YM4A 2SRCA 3A60A 3BL9A 1UNLA 2H9VA 4X6RA 3TCPA 3ZLXA 4BWKA 2AC5A 2B9FA 2VWVA 3ROYA 4YZCA 3MW1A 4FNYA 4HGLA 2CCHA 3SC1A 2A98A 2BCJA 3A7FA 3ELJA 3FY2A 4FJVA 5CU0A 2ITWA 1AQ1A 2CNUA 4DINA 2PY3A 4EUTA 4KIKA 4L52A 3KC3A 2G9XA 4NKAA 4DH1A 2XUUA 5JZJA 2OIDA 4KINA 3NIEA 3O7LB 4Z3VA 3VW8A 4DTKA 2WGJA 4FKTA 3E5AA 4E3CA 5DGZA 5JH6A 3RM7A 5KHXA 2VGPA 4AZVA 1GZ8A 3QUDA 2Z02A 4DN5A 4O0RA 1ZY5A 4OBPA 5LVLA 5EI8A 4CFFA 4E5AX 4Z55A 3U87A 4EEVA 4P4CA 2GS6A 4QRCA 4USFA 3U54A 4O0VA 4Q5HA 4DLIA 5IDNA 4KB8A 3CPBA 1VJYA 2QONA 2UW5A 3TIZA 4BDFA 3NNWA 1VEBA 1XH6A 3D5WA 3PJ8A 4JDKA 1H01A 3BLQA 5I0BA 3F2RA 4O1PA 4J99A 3BLHA 4QMOA 5IUHA 3MVMA 2W99B 3EQRA 3QTIA 4PNIA 4QDVA 4GFMA 3R0TA 4L7FA 5KMMA 1W7HA 1YXTA 3MVHA 1RDQE 4V01A 3S00A 3E3PA 3PJ1A 2AQXA 2XK6A 3BGZA 4HZRA 4F6WA 4AN9A 3NX8A 3QD2B 4JR3A 1KE9A 4HVSA 3OY3A 5A9UA 2QG5A 2UZVA 4YJUA 1TQPA 3W33A 3DDPA 4YBJA 2BZIB 2F2UA 4QQ5A 4X2KA 2OJJA 5KZIA 3KULB 4L6QA 4S34A 4ZEGA 4MBJA 3MESA 2X2MA 5AFVA 4DT9A 3GFEA 4IFCA 1U54B 4F1OA 2BFYA 3BHUA 3MH3A 5DPVA 3WIGA 3UQFA 4FSUA 3GU5A 2OU7A 1M2RA 4LV7A 4YTHA 4R7BA 3FE3A 4A9SA 4I22A 3L8PA 4BIBA 5LVPA 4TWPA 4J53A 2EVAA 2W1FA 4O4CA 2E9VA 4HVIA 4BCQA 4AQKA 2BIKB 3RCDA 1SNXA 2AYPA 5L2SA 1H00A 5I3OA 4M13A 4AS0A 3LLAA 5AP4A 2XAMA 5CNNA 3W0MA 2QURA 3FPMA 3U4UA 1UA2A 4AXFA 4Q5EA 3EB0A 3VJNA 1LP4A 4JJRA 2RFSA 2X1NA 4Y5HA 1YOLA 4ALVA 4BCMA 4C7TA 1K3AA 5L8LA 4H05A 2CNVA 4DFUA 3T3UA 3ZH8A 2B9JA 3BBTB 4IVBA 3P5KA 4L7SA 4CCBA 4PX6A 3HKOA 3DKGA 3FBVA 4OTGA 3W55A 1XH8A 1Q99A 5M51A 1OGYA 2BRGA 4CFNA 3OCGA 2XVDA 2JFMA 1YKRA 1PRYA 2DWBA 2YHVA 3KF7A 1W82A 2I0VA 5IEYA 1KE7A 3GUBA 3NUPA 4IZAA 4U79A 4WIHA 3UO4A 2QLUA 2VX3A 1Q41A 5EM8A 4FL3A 2ZDTA 4D0XA 2CKEA 3KFAA 3MYGA 4GRBA 5ANJA 3QRIA 3D83A 4PL3A 4C57A 4EH4A 4DT8A 4ERWA 2C5NA 2YACA 4BGHA 4XP3A 3K54A 3FYKX 3I4BA 3IW6A 5IA1A 3AT3A 4G34A 3GT8A 2JDSA 3TTJA 4BI0A 2JITA 4PL5A 2O3PA 2WD1A 2JD5A 3KK8A 4BY9E 1OIYA 1NVQA 2XK8A 4I41A 1TFFA 5FBNC 1YI6A 5KZ0A 3KU2A 4OR5A 4EI4A 2C47A 1ZOGA 4TN6A 1GZOA 3GCVA 5HBHA 4O0WA 3VULA 4KNBA 1H1RA 5M4UA 2H34A 3QLGA 5FLFA 4I6BA 3U6IA 2IZSA 2PSQA 3V5TA 3UC4A 4FEXA 2EB2A 3OWPA 3GQLA 1XH5A 4FKJA 4FTUA 4YR8A 4IADA 2IZTA 2PE2A 1ND4A 5HI2A 4EK3A 2R3PA 3A2CA 3Q52A 5GHVA 2RFDA 2VUWA 3NAXA 2HW6A 4OTQA 4RT7A 3DJ6A 3QHRA 1H0VA 3ORMA 4HVGA 2QO2A 3PY0A 4QPSA 4IAAA 4G1WA 2ZAZA 4BDKA 2A1AB 4FZDB 4H3PA 3RK7A 4AU8A 1DS5A 1PXMA 4E6CA 4KIKB <