2WTRB

Full length arrestin2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
399
structure length
367
Chain Sequence
GDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGRVGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPKEEPLDTNDDDIVFEDFARQRLKGMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Dimeric Crystal Form for Arrestin2
rcsb
source organism Bos taurus
molecule tags Signaling protein
molecule keywords BETA-ARRESTIN-1
total genus 54
structure length 367
sequence length 399
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
B PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrB02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrB01
2FAUA 5F0LB 3UGXA 3LHAA 3P2DA 4J2QA 1CF1A 1AYRA 1SUJA 4R7XA 4GEIA 1G4MA 4GFXA 1JSYA 5F0JB 4GEJA 3LH8A 1ZSHA 1G4RA 5F0MB 4JQIA 4ZRGA 3GD1C 4LL4A 5F0PB 3GC3A 2WTRB 3UGUA 4P2AA 2R51A 4LL1A 4R7VA 3LH9A 2WTRA
chains in the Genus database with same CATH superfamily
5K9OB 5EU6B 3RURA 2DQEH 3FMGL 1BZOA 5LGYA 1Y6MR 4TSAL 3GMPB 5FA3B 4AIXA 3CHXA 5EZLA 2B7DT 2XIBA 2EYTA 4YWGH 2BH0A 2J25A 4YWGL 5BS0E 1MF2L 2VR5A 4HEPG 4BA8A 2D8KA 1CU4L 3Q2LA 1E9PA 2B9AA 2LTQC 4FQIL 5E4AA 2UXFA 4L4TA 5FLUA 2FLRT 4XNMB 1WSST 2P5WE 4CC4A 4RAHA 1HSBB 3MV9B 4PGDB 4BWWA 1JGIA 4HT1L 1DEEA 3W0WB 3FQ2A 3VXMA 1QSZA 3LKRA 4JCMA 4JFYA 5IVOA 1I8UA 3BHBB 2P48B 3AREB 4G8IA 1MNUL 5F9DC 1RJLA 3Q1SH 3H9HB 4AYDC 3LPGA 3T3PF 3LZFH 5JMOC 1EO8H 5D6DA 2A9AA 5CNHA 4BH8B 3KPLB 1NFAA 3O0RL 1NGWA 1HX0A 4I13B 4P2RA 2RIKA 4NRZB 3OTTA 3QZPA 4GPVA 1BA9A 4QHUA 3RVVD 5KG9B 4O2CA 1J9SA 3NP3A 4TOYH 1F6AA 5HYJB 3TFKC 3UG5A 5L8JB 2H0EA 1XIWD 5EFIA 1S9VA 2VDPL 3GSWA 3NT0A 4N5EC 3WMPA 2VDQH 4JFED 4LRNL 3BP6A 4QYAA 5EBLB 4F33A 3GHBH 4GRLB 4AEHL 5FYJD 2ZX9A 1JZ7A 3QDJB 4QTIH 1OD7A 4U05A 3PWLA 3R4DA 2F5AH 1SJHB 3ULVL 3P9WB 3BC9A 4Q6KA 3OSKA 2WYHA 5D7LD 4PGJA 2BOCB 2BJML 1EK3A 3BD5A 4WU5B 3IT8D 4LNRA 4MNQE 5I0VA 1O7DC 4KK5C 1NPNA 3K8MA 1YYML 1H9DA 4GG8B 4HZ1A 1P4BH 1ZHLB 5C9JB 2GBAA 3QIWC 3ECBA 3QFDB 4GSDH 3WXWL 1RUQL 3Q5TA 4PB0H 1QEXA 4LP8A 5DFVD 1F3RB 5DD3L 2FX8L 3IM1A 2J1ZA 4NNYB 4FTDA 3CE1A 4M1DH 4KNSA 3AG4B 3I9GH 3V4UL 5C7XL 4HKZA 1A6AB 2XKUA 4ZJ9A 4K5LA 4KITB 1UA7A 2HMIC 1SMDA 3BYTA 1XGPB 2GJ6D 3LJ3A 3VXUE 1CVSC 1LP9E 4PRHE 4PJAF 3ZKNC 3VG9C 3HUJE 4RWYH 5CP7B 3IMTA 4JRFA 5I76A 3BUYA 5KSBB 3O3AA 1I7RB 3BMWA 3OR6B 4GQRA 8FABA 4IRJC 3IU4H 2CCLA 3U0WL 4MQXC 4EMZA 2J20A 3APNA 3SE9L 3L81A 3CQPA 5IB1B 3VW3L 3AUVA 3NJVA 4JFPA 4LP5A 2ZWSA 4UOQA 4OI7A 3QQ4A 1CDUA 2GITA 1L6ZA 4ZPTA 3BVVA 1XMWA 3QEUB 5AD0B 4FQHA 5E8DH 3B9VA 4G42B 4NO2A 3MNDA 2ETWA 2HPTA 4C4UA 3D25A 4QO1B 1T1YB 2MPVA 4MJ6B 4MD4B 3IPEA 4H5SA 3CBRA 3B2UD 2AQ1A 2FGZA 1I1YA 4PRHB 1B0IA 1DDHA 1U8MB 5ESAA 4ABQA 3Q2CA 4PTTA 3RGVD 3EJYD 3A0OA 3WY4A 2FX8H 4LEOA 3SY0A 2YPLE 2XBZA 5FCUH 1S78C 2P3YA 1SOXA 4ONOA 1THCA 4KKLC 4F92B 1ZVSB 4LGPB 2DN7A 4S11A 3RBGA 3SQRA 3I3DA 5FKAB 2HH0H 1LLAA 2OMTB 3FONA 3OPUA 5A16B 5I1EL 3QYNA 3BKYL 2ARJA 1YMME 3SDCB 5CMAB 2BDNH 4PBXA 1JIBA 1N3NA 3G5YB 5HJGA 3U4EA 2O6PA 2X12A 5FM5M 1HSBA 2GSGA 3BDBA 4Z7UA 2VH5H 4AEHH 3V0FA 4R5TA 2Z91B 1NCAH 2VR9A 4GEIA 4G7RB 2CM5A 2VLKE 3LD8B 3AAZA 4HDIB 4TOYL 5CMAA 1T0MB 4UQ3B 5F89B 2EYSB 4I85A 4M5TA 2H6OA 4OIFA 4CU7A 2J8UF 5D7KD 4P5KA 4F5CE 5IM7A 4POZD 4YGAB 3ATBA 1XCQB 3VD0A 2AC0A 4M7LH 4P5MA 3HS0A 3RNKB 4XNZC 1B90A 2GBTA 1G9MH 1I7UA 5HI5D 3SDAB 1JMXA 5D2LF 2BSDA 2A4ZA 1TLMA 3FUKA 1QTPA 3TV3H 4JFFA 3FT9A 4PJBF 5E2TH 4Y16A 5TPWL 3L6FB 1K9TA 3NN8B 1TENA 4NJ9H 2Q86A 3J2PA 3QEQA 4HLJA 2X0VA 3ZPDA 2WY3B 3OLEA 4HS6B 2YO3A 4EIGB 3FB5B 2JJTA 3FO9B 5EU7C 2VDOH 1AGFA 4OJAA 5BO1H 4UU9A 4FJYA 5C09E 5KUMA 1EVUA 5GHWL 2AJVH 1UJ3B 4XP4L 3INUL 3NESA 4JLRA 5C0DA 4XXWA 2A6IB 2ESVE 4KXZH 4XPHL 3HI5H 4KTDH 2Y5TA 2ED6A 4L8BB 4R7XA 4WO4B 3T71A 4B5EA 5HD8C 2JCWA 4MB1A 2DQGH 3RWDA 4JRXB 1RJZB 2WXRA 1MVUA 2FEJA 4JAMA 5EO0A 1N5AB 3CZEA 1LEKB 4I2XE 4Z0XA 3A6CH 3C08L 1NMAH 1IGYB 2FJFA 1CFSB 3B9KD 1KCLA 5G4OA 2WQRA 5I74C 3FU9A 4OCMC 1WFNA 5CIPB 1WITA 5E1AA 2X40A 2ZWLT 3BVUA 3QCUL 2L7UA 4JPVL 2W0KA 3BEWA 4R2GB 4K7FB 1KEGL 2OTUB 3I84A 1G5AA 4ETQA 1VADA 3GO1H 4HPHA 5GS0D 2XQYG 4BCZA 2XFGB 1WZ1H 4HJ0C 2X88A 3B37A 1IKNC 1FC2D 4YZFF 3U36B 4L9DA 4M6NH 3TBVA 4HYTB 2H45A 4QRQA 4WV1B 4ZUVA 5IHWA 1YSOA 3RWIA 3VGFA 2GFBA 3BN9C 5EF1A 3EH2A 3ME0A 1QFHA 1XCQA 2P8LA 4Y4KC 3KPSB 3ES6B 2J88H 5I66A 1MCSA 4DPAX 4RGOL 1NC4A 4UMSA 4WRLA 4RISH 3HZMB 3G6DL 4N3TA 2Q20A 1WA0X 1MN4A 5KJ4A 4MCYB 3HG0A 1KULA 2E6JA 3DMMA 5BZXA 4HOWA 1HZKA 4JGUA 4HF5L 1BZEA 3SY6A 4YC2C 3WFHA 3B2XA 2ALAA 2BIPA 1GYWA 1N8ZA 3DRQA 3HR5B 4X99A 4OZHB 5EUOF 1HAWA 4L4VE 3G5XB 2HT4C 5DMKA 3QQ9C 3VXPB 1DQJA 7CGTA 2PR9A 1F4HA 2I9TA 3HG5A 3K8KA 1OAKL 2NMSA 3BZ4A 4J3OC 1WAAE 3MRHB 1TJIL 1VAHA 4LAQH 2RB8A 5KVDL 1X7QB 5JOPD 4OB5L 4YHZH 3QO1B 2DMBA 25C8H 4Y4FA 2A9DA 5DWUH 2J72A 1V7NH 1DVUA 5E9DD 1UT1A 4GFTB 3VQ1C 3VNZA 4HV8B 4A2MA 4D0BA 4L1SA 3P11H 5KUKA 2XIDA 1LP9B 4HMEA 1M1XB 1MHCA 3ZDYE 1H0DA 2W65B 4IIQC 1BZ9A 4M6ML 1GZHA 5L4IA 2FIKB 3EG9A 1U2CA 3QUGA 4JJ5B 5BUAA 1AI1L 4NAMA 3RAJH 5CJOH 3Q2NA 3K4ZA 1NCJA 1XV8A 5C9KA 1HAUA 4MCNA 2X4SB 4Z77B 3MYZA 3QHZL 5IUCA 4NSKA 2CHNA 1T04B 3DX2A 4DNLA 4JJOA 2YWYA 4GG6F 5AVWB 5TDPA 5E9DE 3NCFB 3OKKA 4ANVA 2V17L 5F1IB 4MVBC 1V3JA 3VXTA 4YAQB 3EFDH 2Y6SD 5JMRA 5JPNC 1CICB 2B1OA 2EEBA 2BSSA 3IDMB 3LKSA 1ADWA 1UACL 3ETSA 5IBLC 5IQ9B 3BKCL 1IC1A 1M7XA 4HPOH 1GW6A 5DRZA 1KB3A 3D0AA 2J56A 1A14H 2F19L 1OTSC 4CVXA 4JFFD 2WLMA 3W82A 5KSBA 2OQJA 5D1XB 3TN0C 2EDOA 2LQRA 3CFJB 1S7UB 2VDNL 3DUSA 4UDTB 3WIHL 3ZDZE 5LGKA 5L8LB 2Z3FA 2K6YA 1NAMA 4YXKL 3QEHB 4OV5B 1MHPH 1A66A 4FTVB 2PO6D 2LFGA 4NO0B 4WUKL 1PX8A 1QKZL 3SDXF 1KIPB 3ARGC 4LDEB 2DYPB 2BRRL 2XG5A 3D39E 4D94A 3FUJA 3LV3A 2NY5L 4DVBB 1ZWIB 3D18A 3DBXB 4K7PH 4FQLH 1A6VH 4X5LA 3U9PL 2YEQA 4HSCX 3T0EA 4LO9A 3QDJE 1PTZA 1T2QL 4PUBH 4Z7QB 3GJFK 5IREA 2XXFA 4OZHF 3C87A 1PLGH 4PJCE 4U1HA 3DSFH 4AEIH 2B4CL 4X5XA 4IJ3C 2WLIB 2IH9A 3BWSA 4LVOB 1OIOA 5E2VH 3TCTA 2XFXA 3BGFC 2V7NA 4PJHF 2Y5QA 4GEJA 4J3WA 4L37A 4NO3A 2YGQA 4MAYC 2VN4A 1NUFA 2OMXB 1NLDL 3BO8A 4AH2B 4A7QA 3WTVA 4PI0A 3SGJA 3BVNA 2X4UB 3FT2A 4FZ8H 3ULUF 1PLAA 2H4EA 3K46A 4P2AA 4G1EB 4HKXA 5H94B 5SX4I 1KN2L 4XPTH 1KIUB 1QSEB 3QQ9D 1H6TA 3WDIA 1Z5LA 1SXSA 2R4RL 1M2VA 1QUNB 2WLYA 4C4KO 3C5ZA 4I3RL 3A67H 1KJ2L 2NZ9D 3T0VA 2VW7A 4I0CC 2V5RA 1E8YA 3QUKB 4M56A 3ZKXC 1I9JH 1GSMA 1X7SA 3C6LB 3IN0A 2ITEA 4JM2D 5KJRL 3VB9A 4ONFL 2YQ3A 1MREH 2C3HA 1IM9B 2VXVH 1VB9A 3CFNA 1IQWH 4FKHA 3VFVB 5AB2A 1X5IA 1CIUA 3T6XA 1CFQA 1AZRA 3IETB 1N5YH 4Y1AE 1BFVH 4ZFOA 4HUVB 2EDBA 5D4QA 4W9LC 1KCWA 3RP1A 4YX2L 1SF3A 5EC1A 3QIWD 5GPRA 5J89A 5BMFL 4K73A 5J5EA 1U6AH 2EKJA 2XN9B 4N4YB 5T5FL 5C6TH 2YEVB 1N3NB 3S34L 5F96H 3OB0H 4C55A 2D7TH 3RTQB 2IBGA 3DK2A 4Y19B 1A6AA 1DVTA 2P4AB 1Z1WA 4H1LB 5L88H 4F1ZA 1RJZA 3SYPA 1MHPL 5CF3A 4TUOB 3RE0A 1HXMA 2IANE 4KDTA 1UH3A 4ZUUB 2F7RA 3DHPA 4GXUN 3MV8D 3WYRA 2FT8A 3NEEA 4CMMB 2ENJA 3B3IA 2KMWA 4JL1A 5B39A 4UI2A 4FC3E 5TFSL 4D0CB 2A2QT 3JWDC 5GS1C 4UTBL 5DDHA 3ISWA 3VWKC 3DPDA 5HHVH 3H0TA 4UDTA 2P49B 4P5RA 1PFOA 4QXWA 2X4RB 3FQNB 4OD1H 5CZKA 4JR9H 3KYNB 1C16A 3X1BA 4ELKA 1JFHA 1T66C 1UQSA 1U8PB 1F1AA 4B5ZA 4MSWA 3MMEA 2W9DH 3FO1B 1XF4A 5I0WA 2APBA 5DYOA 3VXOB 4M7ZC 5B8CA 1UOVA 4XC1H 1WWCA 3ZHNA 3HI5L 1FC1A 3X12A 2DBLL 5D9SB 2ZPKH 1PZ5A 4O00A 3Q6GL 1AO7A 5CJOL 3VMOA 1NOLA 2V9RA 5AW2B 3BH9A 3QH3A 5K9QG 12E8L 3MOQA 3OLIA 4CBZA 5CBEB 4Y1AD 1CBJA 4JG0H 1O5DT 4GS7B 4UUJA 1R5VB 2PP7A 4A39A 1SEQH 1ND0A 1OM9A 3GXDA 5JIMA 1YCSA 4FZEL 4ZQKB 2YRPA 1X5YA 4OBRA 1AKJD 1MCFA 4HZAA 3NJIA 3U25A 4S1SL 2GSGB 1RFDH 2C9QA 1CF8H 1JHKH 1TJGL 3V9EA 4X4ZA 3LRSB 4FYSA 4BQBA 3PWPA 1S7VA 1WBZA 3ARQA 1CVRA 3U0TA 1P4LB 5HYQB 3UBXG 4HG4J 3GMPA 1Y6KR 4L4VA 2Z31D 1NSNH 4X7EC 1IO4C 3K2UL 5EPMA 4H25A 3LZNA 5CJ5A 1MCKA 1NDGA 4R7VA 4M1DL 2YRLA 2PPFA 4ES9A 1OP4A 4QCIA 2C9XA 2AJZB 4FABL 1QI5A 1X7TA 2J88L 5HHMB 1KJ2B 3Q06A 4P2OD 1DLHB 3BX7C 2JTDA 1VGKB 1DJSA 3S2AA 1W8OA 5IMOB 1KNOB 1U8IA 4L1DA 5GJTL 4DGIL 5M94B 4E9LA 2ADFL 1DBKH 4WI9A 3MLXH 1CXIA 4PIRF 3QIBD 4BXVA 5DRNA 4Z78A 1WZLA 2F5AL 1F4XH 5HBBA 2CO3A 5J6SA 4FQHB 5IW1A 3N50A 1JZ6A 1HEZB 3VD9A 2AI0L 4Y5XA 1MCRA 1ERNA 2NTSP 3MUJA 1IEBB 4L4VB 1SLVA 2VDPH 5DI8A 2APXA 5C07D 4JY5H 1NC2D 5IIEB 4L5FL 1GS7A 1RI8A 3MLTB 2XBTA 2ITDB 5CN2A 1JZJA 2FVNA 1MVYA 3KJ6H 5DUBA 5C0RL 1E5ZA 2HJFB 4FA7B 3PJSB 5KS9F 4FD0A 4WENB 4KZEL 4AQAA 3V4PL 4F24A 1T2XA 1EXUB 4ANXA 5SWSE 1AR1B 1F11A 2DD8H 3P69A 3W81A 4DK3A 3IBOA 3AXLB 2VR4A 1T21B 1YC8A 2NY7L 4HAGA 3NIDF 4XXDB 3SDDB 5JHLH 3SE8H 1OSZA 2O30A 3ULSB 2HTLD 35C8L 4X6BA 3EHBD 4NNXB 3DUUA 4X7SL 4LMQE 1TLKA 2L0DA 2HPOA 1EBAA 4UZUA 3LEXA 1L7TL 1Z9NA 4KMLB 2XWJA 3HW7A 3DIFB 3PHAA 5EZOH 1LDPL 2E4FA 5C9JA 1BD2A 3BQUC 3FPYA 1EZLA 4EN3D 3TWCL 1PSKL 2NY0D 2NQDA 2C9RA 3FB6B 3S3DB 4V2BA 4OJFL 5PAZA 2I32A 2J8OA 3FCTA 1IBBA 1JZ3A 1YEJL 3TN0D 1ZKAA 3O4LD 4JREB 3QI9D 1YPZF 1KENH 5B7MA 3UX9B 1DLHA 2YK1L 4DAGH 2K7QA 5IQNA 2CO2A 3EYQC 1JGDB 2WVVA 3ARUA 1M2OA 4JFFB 2G5RA 3VH8A 2F7PA 3QJFB 1U95A 4IIZA 1BW8A 1OSPL 3FPXA 1CD1A 3MRQA 3OKDB 4TNWF 3VWJD 4NYLB 2UX6A 3WEBA 4MASA 5M95B 3STLA 1EZUA 3RDTC 1FBIL 2EE9A 4X98A 4KQ0A 3ARSA 3RWEB 5CD5D 2OV0A 1U8OB 1OKEA 3RWGB 2IH3B 4PJGE 3DPBB 3LS4H 1ZSHA 1GTFA 1XB6A 1XSOA 3BKYH 1NFDE 3GJFH 3F7LA 4GKNA 1GZPA 3AS2A 4X9FA 2FDBP 3P73A 2VDQL 2W0FB 3EJUA 2WBXA 4L29B 5GRJH 4YVUA 1I7TA 2EZ0C 4GT7A 1MCWW 2C1PA 3JV6A 5EEYA 4NWTH 1GSKA 3G08B 3G7TA 4M9PA 2YD8A 4QOKB 3QRFM 3D6GA 4JG9A 2A6JA 2OFQA 4TLSA 2JV6A 5C0FB 2IPTL 1MWAA 4V1DE 5FA3A 4NKIL 3IDXL 4NDMA 1YJDH 1CF1A 4DAGL 4PJ5E 1SHXA 3C9NA 5F93C 1KXTA 4NXKA 2VC2L 1A4BA 5DD5H 1X7QA 5K9OA 4J3OD 3K4AA 3ECQA 3O2DA 1D5XA 2B1HL 2BVTA 5D6CA 5IMLA 2EZ0D 3NCBB 3QUMB 3QEQD 5CHNA 4UM9D 1N67A 4Z7VB 1IAOA 3K2MC 1NGXA 4I1RA 4E41A 5KYXB 5BRZE 2AK4A 4O5LH 1HOCA 3SGJC 1RCYA 4QHMB 4PYHA 4YGVB 3NQKA 4NQVB 1I8AA 2FWOB 2VDMH 3IGFA 3DO4A 3HC0A 4QMEA 4LBEB 1AYOA 3GKZA 3ARFB 1FNAA 4KKAD 2WKGA 4NQCE 4P46A 5F1NB 1EAPB 3H8NA 2F54E 1H3PH 2HLEB 4N2LA 1YEEL 3IRPX 4KY1L 1VGEL 4HWBL 4NZUH 4FG6C 4HUMB 4HFWA 1LTXA 4G70B 3CHSA 4WW2F 2K6WA 3UMNA 5FUCC 3QZWG 3D87B 1DQTA 3HS0C 4LNVA 3QNXA 3WBDA 2X05A 1X9UA 4FFWC 7FABL 1WGOA 3BGMA 3V55A 1M71B 1JSYA 1J9CT 3RZCB 3OAYH 3QG7H 1I8IB 3U7WL 3VFTB 2XPZA 3OXSA 4J27A 3B2VH 4NRYA 4LHUB 4N2DA 1JV5A 3EYUL 4L9LA 3WOVA 3R06B 4PFEA 2CO1A 4XPTL 4AXWB 4ZUTB 4G6KH 1LEKA 1TQCB 5BW7C 5BJTB 4BHUA 2EUWA 1O6SA 2AXFB 2VQUA 4PRPB 5E08H 5IJKA 5L6YH 4IS6A 5I24A 1NMCC 5ACLA 1NEPA 3RL1A 3DYOA 4Q4IA 1P4UA 5I9QC 2VSCA 2VDLH 3EGXB 1L5GB 1H5BB 2QVFB 4Z7NF 3QIUC 2DIAA 5A40E 4X6FA 4G6JL 3OMAB 4IQHA 2ZNXA 5FV2A 5H37G 3IN2A 1HYSD 3BAIA 2MH4A 4K4KA 1Q94A 3QISA 2BRQA 2HX9A 4N0UA 1UM6L 4A2FA 2BHFA 4DN3H 1BQSA 2FUQA 2Z8SA 4NQCA 4LHQB 3B8YA 5EIIG 3LOWA 4ZXBC 2IQ9H 2JLPA 5HGBA 5CZXD 2W9EH 2IPUK 3ARTA 4Y0GA 5FKPA 4CSSA 4RMVA 1NTDA 4B60A 3LXCA 1GOHA 3DOSA 4KGJA 3GSVA 4KO9A 3EYVA 3OGCA 4R5XA 2W94A 1A3QA 3KL5A 1V3LA 2E7LC 2IC2A 4HS3A 2OR9L 2Z4QB 3QULA 4HMDA 4PWEA 3U7YL 2ZOTA 1AQDB 2WTOA 8PAZA 5KSVB 4XGZB 3RIFF 3DX6A 5CJXC 3GSXA 3K1DA 4M3JA 4G9FE 1CGVA 4HAFA 2Q10A 4JO1L 4OLXH 4PY8I 3NVQA 3BISA 3DIDA 2BSBA 2JXMB 2W07B 2WZPD 4IOFC 3KPQA 3QXWA 5LXVA 2FSEB 1U8JA 2K4AA 1UWYA 1NBQA 1U36A 5I1LA 2I7SA 3ULVF 3I2CL 5AOKA 4HJJL 3KLAA 5CSZA 2FJGA 3F7VA 2XETA 3KH3A 1DEEB 4ZFZA 3G5XA 3ZT6A 3ESUF 4JPKL 5DMIH 1HHHB 1OB1A 5F21B 4J3OH 1WISA 2EEAA 1ZLEA 5KVFE 1MUJB 3QVAA 2ENSA 1EEUA 4Y2DC 1ZVNA 1A7RH 3L3DA 5A6LA 3H55A 3KPRE 2APWA 1OK0A 3GQFA 1AE6H 2LVEA 3QDJD 4JFDB 4RMRA 5JOFB 5BNXD 2D2CC 2VITA 4JGJA 3WLBA 2YAHA 1F4AA 3OKMA 5JYMA 3BVDB 4XPFL 4QRBA 5E9DB 3AS3A 3OMZA 4EAEA 2PTTB 2WQWA 4U2ZA 4NAQA 2RHEA 1OARH 1Q9WA 2NOYA 1JZFA 1RZJL 1KDIA 5AWNH 5GRUL 4GLRI 5F9AC 5LUMA 4XNXH 5AVQB 2QVKA 4J3XA 3UC0H 4UNUA 1IQDB 4HJUA 2IH1A 3V8CA 3WIFA 1F3JB 4OB5H 4YHZL 3V0GA 1JN6A 1Z9MA 3DJRA 4LAQL 5KVDH 1Q38A 5F3BA 3HB3B 4AE0A 1C9SA 2IAMD 1J1OL 2ICWJ 2XZQH 4L4VD 1JD9A 1P53A 4JO2H 4PRBB 1G7QB 3DJZA 4KJWD 4JJ5A 5B1KA 4W6XB 1YECH 3BSGA 4UTAL 4X4ME 2F54D 4HD9A 2LABA 2WNWA 4GRLD 4MMXB 1SEBA 4ODSH 4OUUA 1S9KC 1OSPH 2PCPA 5EU4B 1T03L 4ZSOE 4RFEA 1MH5B 3LRGA 3T3MF 4P5TA 4RISL 4XP9L 4L8SA 4OFIA 4DK5A 3I6LD 2ITFA 1KEML 5JNYB 4NC1E 9PCYA 5DHVA 4J3BA 2EDNA 2L04A 1UM5H 3TBWA 1EDQA 4Y4HD 2B0SH 3ALXA 1QYGH 3Q05A 5D71L 3Q3GB 3CMOL 2DTSA 4AQ1C 3FQ1A 4KKBC 3QORA 2IWFA 3FO9A 4ZX4A 3RI5F 1XCTB 3IMRA 4HKZB 5I2IA 2IFFL 1YYLH 1A1NB 1RIUL 3GO1L 3MRDA 3MNVA 4JFTA 5C0BA 3WV0A 2XG4B 1EXHA 3PV6A 4JDZB 5MP6H 4ZAKB 3QS3A 4BFEA 4AX3A 3I6SA 3CVBA 3TGXA 4CMHB 5FDWA 5TDNA 2XRAL 3KE0A 5CWSA 4LE8A 3UGUA 1U58B 1SZNA 2VUKA 3GIZL 3OHXB 5E94B 3A4AA 4M62L 2GSMB 1CGYA 4N87A 3RFZA 4ZMOA 3JV4B 4FQ2L 4B97A 1FVCA 2DM7A 3UZEC 1HHGB 3C6LC 1FUNA 5B22A 1AO7D 3PV6B 4RVBA 4X6CF 1VGEH 2OCJA 2XV3A 4NZUL 5D7IB 1VIWA 2GK0B 3UEZA 3ALPA 4AIZB 1G43A 3QUZC 4LCYB 1B6DA 1D7BA 2P43B 4XP4H 2IALB 4ZK8A 2PXYD 5F0PB 4D7PA 4PPTA 4ODBD 1L6XA 2EH8L 2EXWC 3BO8B 4AH2A 4D9RE 4E9VA 4K23L 2OSWA 2IJ0C 3DOHA 4GP4B 5DA4A 3DBSA 4LASL 2DW5A 4L23A 3QUXA 3PAVA 5C08D 5L7XL 3N1QC 3OJMB 3EH1A 2H3NA 2G3ZA 3ZDZF 2A9ML 3U6RB 2BSRA 5EOTB 5SWSB 3RUGA 1AQHA 1INDL 3HE6A 3RU8L 3C5ZC 3C12A 3FQXA 3NUKA 4NBYB 4RFEB 1TNNA 4FNLH 4K8RC 4AG4L 4ADGA 3WIHH 2DZEA 1V7ML 3AACA 4ISVB 3DXAD 4IU2B 4XVTH 5GGTH 3T77B 2Y06L 2E6PA 4JFFE 3AVEA 5IB3A 3P9MB 5F71A 4I48B 4X4KA 2D0HA 2N7SA 2Y3AA 1DJYA 2ZSWA 2HFFB 2XBDA 3QZOA 1SXNA 4GOSA 1OGAD 1LO3L 1EEZA 2UVFA 4QO1A 5EDXA 2XZCL 4HCRA 4XN5A 5LAXB 5J3HD 4KUZH 1GY2A 2G75B 2R0ZL 5LXGL 5I5MA 2E7HA 3ATEA 3X3GL 1ZCRA 2WJ5A 2P5EB 2AITA 4PVLA 4ZFGH 1T5WA 4IMKA 4KV5F 3ILQC 4UT6A 3RGBA 3LIZL 1FAIL 2NY0C 4JKPH 2ICWI 5IB1A 4JFXA 4D9RD 2PR4H 4ERSL 4BZYA 1HXYA 1FRGH 5D5ME 3FFCE 4M7ZB 4JBSA 3M17B 1IEHA 4UIKH 1S5HA 4M93C 5G5DA 2ZKXA 4K3EH 4WNQA 1PPIA 5J4MA 1TQSA 6TAAA 3MRRA 1ZMYA 4PJ7E 2QQQA 2X4RA 1OCWL 2G0LA 4JFDA 3F01A 1K72A 2J43A 3S0PA 5GSVA 4FNSA 3FB6A 3HLKA 4YXHH 4FYRA 3SQOH 3IRZA 1KWGA 1RIVL 3QFJB 5D2NA 4KDVA 4TVPH 1P7BA 4Z7UB 3WEXB 5GSRA 5JTWA 2JQMA 1M6OA 2X6AA 2R9HD 4PJ8D 3EYFA 3HEIB 5ICXB 3U46B 5E5RB 1S7SA 2GEEA 2K45A 2R29L 3GMQA 4IOSD 2R2BB 3N1FC 4K94L 2FSEA 3GWJA 1YN7A 5DUMH 3MRLB 4FJ6A 4J8RB 1PSKH 5JHDB 1N0LA 3ENEA 3UAJD 3KPNB 4I87A 1OGAA 2NW3B 3LQZA 4JFZH 5TDOB 3NFSL 4ZX5A 2BOCA 5HYSG 4O2FA 1MAKA 1H3VA 2ATKB 2B4CC 5DMKB 4EN3A 3UTPE 1DEDA 4PRDA 2XYBA 5J13C 1E4WH 4Z76A 1A3RL 1HESA 3DO7A 2GK0A 2MTAA 3CUPA 2VO5A 4FNUA 1F4WL 4IGBA 1ZHKA 1BFOB 4ODWA 4RSVA 2QMJA 2QADC 3HZMA 4FNLL 5DHDA 4AG4H 4FTVD 2CR0A 4WWOA 5FKPB 4RGMB 3LEVL 2FHFA 1XZWA 4MJID 3MLYL 3HE7B 5FECB 3QGVA 5IJKC 4O02L 3TYFB 3GLAA 4LSSL 1EHLH 1BZ7A 5FF6A 1E6JH 4JFDD 4UAOC 4UCFA 5CZVL 3QC6X 1GJIA 2PYED 1BXVA 3TEWA 4KI5C 2HX7A 2BW5A 5IJVA 3P0YL 1AZUA 1VFAA 5EOQL 3DTUB 1G9NC 4B9FA 5SWSD 1NCBH 1MAMH 2G5BB 1N8OE 3O3AB 5D96C 5HHNB 1DQQA 1U8NA 4ZXBA 1D5RA 3WXWH 1RK0B 2VJ8A 1B0RB 3DXAB 1RP9A 3D2UD 2EEFA 3NJGA 3QPXH 4CAGA 2AFNA 5INCA 5E8OB 5K39A 1CK0H 3QO0B 5EU5A 4L0PB 4EBQH 3SE4C 2N7AA 3HKFA 5AW0B 4F3FB 2HT3D 3HS8A 5HPMB 4XPHH 1SDYA 4QHLA 3ZO9A 3INUH 3TJPA 4RCAA 2OZNA 3GZQA 5E70A 4XP5L 3VACA 2APFA 1CE1H 1JL8A 1MCIA 1R5IB 3S6CA 4PG2A 1J86A 2G30A 1KYOJ 2VDKH 3ESVF 4GQQA 4URTB 3ELQA 4NUQA 3M45A 4NUPA 4ZTEA 4AJVA 4E9SA 4Y2OB 3FCSA 4H88H 3G04B 3V95A 4MA3A 2Z8VC 3WMQA 4G3YH 3IK2A 3P4MB 5HDBE 4ADIA 4D8PB 3RB5A 2JIXA 1MJJA 3U2IA 2P5WA 1FAIH 2HKAA 4XN9A 2NLJB 4FFWD 2ZIDA 1A9BA 3IF1B 2H9GA 1BIIB 1KTLA 3ESMA 1GGTA 2IWEA 1RZGB 4Y5YA 5ADPL 1MW1A 1HVXA 4U0RB 5T3XD 5BVPH 1B2WH 2NR6D 3L6FA 3NN8A 4NQXA 2EKSA 1IGML 1FLRL 2OLDA 3I6GA 4HJGB 5D2NE 4G2AA 3SDAA 1BVNP 1RKRA 4NUGH 5K59F 1MFBH 4QNPE 5DJ2A 2J5WA 1NCGA 4YDZA 4HJEA 3K6SB 3C09C 2ZCKL 4NWUH 3ULVD 4U1JB 5CEYB 2EYSA 3A6OA 3OHXC 1J1OH 1MI5D 3PQYB 4U6TA 4EDXA 1GZQB 2YPKB 2VT0A 2DV6A 3I50H 1TETL 4FFVC 5LKNA 5E6RB 4F8PA 2EJ1A 3QIUB 5FYKE 1X5ZA 1RK1A 4P9HH 4TUJA 4U3SB 3FB7A 2A9MH 3L2MA 2DLTA 4N2AA 2FIKA 3EG9B 3EYQD 3K81A 1KZYA 4NUMA 1N0XH 2IGFH 3PL6B 3D39B 3TA3A 1LO0H 4Z1PA 2YPVL 2GKIA 1N68A 2FJGB 4GAYA 1UWXK 3BKCH 3LNEA 4HPOL 4ZW6A 3HHRB 5JW5A 1RQ5A 4HIIB 2CDEB 2CIIB 4PGBB 5CGYD 1E5UI 1UD4A 1QSFE 1MXDA 4PGCB 5JXAH 3DLQR 2BSEA 3UH8A 4RAVA 4QJ5B 4YJZL 5HGDA 4KVCH 1IC5L 2Q8BL 3QZWB 1EUTA 4G59C 1D9KD 1JFQH 1A9VA 3U82B 5AAWA 2DLHA 4HUUA 1K3IA 2YKLH 4IOFD 3H1ZA 3UBHA 4C83B 1H8SA 4R0LC 2NUPA 3CCHB 3BRFA 2QSQA 3ZN6A 4GFXA 2Q7AA 1G7PA 3KEHA 3L5XL 3MZTA 5GJSH 3VXRA 5IOPB 1DQQB 1U8NB 4JRXE 1QR1A 2X9WA 3IFLH 3DGDA 2VRQA 1ZDQA 1CI5A 5DGQA 4Q89A 2GUOA 2E6QA 4HZLB 4R4BB 2JVUA 4MCZB 1XF3B 4JQXA 5SX5K 3V4VB 5DVMA 3F7PC 4UOW1 3TC9A 4NPYA 4TSCL 4G6FD 1AZBA 2Z0BA 3JYBA 3KWWA 2F53A 1BSIA 4OSUH 3SIKA 1MY7A 4WJ5B 5I1JL 4I0PC 2ZX8A 1CGWA 1E2ZA 2FBRA 1JRHL 3K3QA 4H8QA 4MHHI 4AMXA 1QUNA 1OXYA 5T3ZH 3JSSA 3HCVA 4OVUA 4Y9FA 1DQML 3MV11 5GRWA 3FOLA 3MRGB 4JFQA 5D7EA 2RTTA 4YE4L 5BZZA 1FO0L 2A5UA 3VWJA 3ZRCC 3EO1B 1N4XH 5KYYB 2R2HA 3EZJB 1U2YA 3WNIA 1UGKA 4KKPA 1FL6A 4QRPB 4ZSOB 1JVLA 3ROOB 3BKJH 4GIPD 4I3RH 4N1EA 5FEBA 5EZIL 1O7VA 1DSYA 4ALAL 1G0DA 1IE4A 2DJ4A 3O6FA 4JEGB 1FYTB 3TBWB 4OZFG 4OCSH 2Q6WB 1E43A 2YJQA 3MNWB 2MRYA 4LSPH 5D1QE 3BLKA 4XO4A 4PJ5D 2XV6B 3D4GA 4KJWC 1G6RA 4FG6D 1LEIA 1ZGLA 4HOMA 3DBXA 4RX4A 3MREA 4JHUA 3L08A 3SGEH 3DX3A 5FX3A 1A4JB 1GOFA 2XVLA 4I4WA 2FLMA 4PLNC 5GSRB 1UC6A 5A2CA 2G3XA 1IMHC 3NYKA 1WBYB 3B83A 4XOBA 3ZXAC 2IAMB 4LL1A 4U6VL 3SDDC 5DS2A 1DE4A 2HTKC 4PP2A 1QRND 2WXHA 5FO7A 3VYPA 1BLNA 1HI6B 3EH4B 3SYOA 3CFCL 5DZVA 1IAKB 2G2RB 1KJ3H 1S7WA 4KK9C 1UJ3C 3UG4A 4ODVH 1GRWA 4YXLL 1ZTXL 4PRPD 1C5BL 4MMZC 1J11A 1NFIA 4JL2A 3IGLA 4ACTA 3NJLA 3STBA 4MKTA 4XMWA 3S4SG 2XDHA 2AF2A 1AQ8A 2UY7A 1UZGA 4MQ7A 1J5DA 3IDMA 3K91A 1WICA 4XHQA 3ELAT 4ZPVB 1MSPA 4D9LH 2E7DA 4YBLB 3LXUX 3BPOC 5D7LA 4JK0D 1BBDL 2VLRD 3IJEB 2JJSA 2CK0H 3LRMA 4K5NA 3ZHFA 3MLZL 5BV7B 2PO6B 1CU4H 2R0WL 4XN8A 3LVTA 2NT1A 2H0FA 1P4LA 1DYZA 1LQBC 2YD2A 2ZYHA 1CN4A 5E6UB 1FV1B 4BDVB 1WAEA 4Y1TA 3LKRB 5B1CA 1UD8A 4CW1A 2VLKA 1MELA 3O2DH 4F2ME 1BREA 5AEAA 4PBWD 1HCVA 4X9HA 4PJIA 3MV9E 4YVNA 4LCWE 3JWDH 2H26A 3BXNB 43C9A 1JGLL 3AADB 4ZUSA 1FV1A 1X44A 3QSKB 3UMTA 3KYKH 1BCIA 1SLWA 3WKNA 2VLLB 2X3BA 5E00B 5D9SA 1IGTB 4UNVA 4HIJB 3BZ4B 2WTPA 3VYOA 3O3EB 2N4IA 4JO3L 4XGZA 2WBJC 3FTYA 3RDTD 4Z95H 2OSLA 3FRUA 4YDVA 1D7CA 3BPNB 4A68A 4J3OF 1N7ML 2DJUA 1NCAL 4MB4A 4X83A 1WV7T 1ASQA 2F1BA 3TPUA 1K2DB 5C0EA 5C7ZA 3RVTC 4XHJC 2KC0A 1TVHB 4YK4B 1OAKH 3MGTA 3KHQA 1DBML 3LXBA 1IAKA 5IW3A 3CHPA 5I0YA 5DRWB 5J12C 1PD6A 3KL0A 4O58L 3IFOA 2HLFD 3QPXL 4D8PA 3SDAD 1M9SA 3ABGA 1AR2A 3VTAA 2FEEI 1RP8A 1OANA 1IBYA 2V2WA 1NEZG 2YD0A 4B41A 5K9QI 2AJ3A 1T20B 1MAML 2E9JA 1K4DA 3O9WD 1L5GA 5D1ZI 3CZUB 4Z0BH 3OB0K 3GMRA 3POCA 3D0LB 4H8WH 4PGZA 1TJMA 2Q7YB 3QNYB 4YHIA 1M7DB 1T83C 3MA9L 1T21A 3EXLA 4MB5A 4R90L 2IEPA 3KW7A 4BFIB 1T0NA 4O02H 5IVXA 2QV4A 3KLSA 4ZD3H 3T1WA 3N6YA 4FL4C 3RZCA 1PD1A 4HWBH 3BYYA 1M9WA 5JHDE 3ILPB 1WTGT 3PWVB 4G8GE 4PJBB 3ULAB 1W15A 5I1JH 5L0QB 4N2GA 3QQNA 5DK2B 2JCCB 1ZLVK 2C9VA 4FQPA 4OLYL 1OM3L 3TEUA 2B15A 2IXQB 3MRGA 1JZ8A 3DXAE 1OM3H 4PJ9C 3QDMA 1EO7A 2J1XA 5D72H 1OF2B 3HOGA 1OHZA 3IFLL 2FQEA 1H19A 5D93C 3LKNA 1NBZA 1IILE 3C2SA 5FF6B 2ATPA 4IU3A 4G7YL 2VDRH 3L5JA 4Y4HC 4Z8FH 2GAZB 2HFTA 5CEZH 3CLWA 3IFPA 4Y7OC 3RNQB 2F58L 3AS1A 1OZTG 1SXBA 3HE7A 3BDYL 1NEUA 1P2CA 1SN5A 2DJSA 3DHMA 1ZTMA 3NJFA 5I8EB 1SJHA 1AQKH 2DL2A 4GKZA 5T1KA 5H8DA 1HL4A 1U2HA 1CLYL 1OTSD 3ILDA 3B4NA 1VGKA 4KU1A 4PRDB 3IXTB 1KOAA 4KQ3H 2WLLA 2X4UA 1TZGL 4KFZC 3QARA 4GH7B 4O4YH 2HXAA 2E76C 1XAUA 1YNTF 5ABDE 2ICWA 2OMBA 3KPRA 4NLAA 1MOEA 2NW3A 1KJVB 1BQRA 4GKOA 3GDBA 2EILB 3VA2C 1YYMH 4P59L 3CFEB 5TE4L 4H25B 4ZQTA 1UEMA 3UO8B 3MRFB 3AREA 2A6JB 1DBMH 2R69L 4H26B 2PR4L 3CX5J 4MD5B 4TTDC 4P8QA 3FO2A 4ERSH 1NDTA 1OL0A 2C9SA 4OV6F 4WFFE 2HFGL 5K69A 1A6TA 1WFMA 1CCZA 4F7MB 4MNHB 1G9ML 4QTIL 4FF9A 2IBZY 4Q6YA 4FGMA 3CZNA 3HNTH 4P46C 5GZOD 3LNHA 4F8QA 5HVHC 4HGKC 3ZL1A 1JNNL 3S37X 4MJIB 4NUGL 2UZYB 3CLEH 4YE0A 4WFGD 1MDAA 2ZG3A 4M5ZL 4F91B 4JO3H 4OGZA 5HYEA 2UV3A 1NANI 3TIEB 4KOBA 2C4FT 2I60H 2FECI 3TA3C 1WCQA 3QRGL 2K78A 3EJYC 5CBEA 4D3CH 3MFGB 2R39A 5IFAH 4XNAA 1UD5A 1P5VA 4LSUL 4WHTA 2MQCA 1HXYB 4K8RD 5GGTL 3DX8A 4YDMA 4PJFF 1KB9J 4MGXA 1G87A 4K7PY 4P2QD 4ZOBA 4HJGA 4YHOL 3UAFA 1X9RA 2XXGA 3HG3A 3ZGHA 1E67A 2X4TB 1KDJA 3U0PA 4P59H 4Q4EA 3FQNA 2KS0A 2N01B 5LAXA 3N2JA 2KUTA 3L4TA 1ODUA 3GBLA 4NUJB 4NX0A 3FH8A 3RY6A 3RIAF 2R0WH 2Z31A 4U1IB 4W81A 3NDZE 3OV6A 1Z9OA 1E5AA 1KPRA 2BS8A 3MLZH 4HG4K 1KXVA 4QT5A 5CLWA 2X4QA 5DJ6B 2C9UA 1H0DB 5CINH 2B08A 5FGBA 5FHAH 4X9IA 1DQVA 5CKAA 2VXUH 3MV8B 4M7KL 3GPEA 4XNQA 3HZYA 2R0KL 1Z32X 3B5GA 2G9KA 3O11A 4W9JC 5I8KH 2Z92B 5ERWA 3K0YA 3UZQA 2F68X 4Z8FL 2F0CA 2R0LH 5FA4A 3V4PH 4LLUB 2K6ZA 1KG0B 3MBED 3GIZH 3MVSA 4YNYB 1P6AB 5DC0A 5E2UL 1ZTXH 1I8MA 4GUQA 2DKSA 4OZFA 5D8JH 4YPGA 2PO6C 4P3CH 4FNPA 3SDYL 3A4FA 1EZVX 3KXFA 3CXDL 2PUQT 2V9QA 2IFFH 1B4TA 2NCMA 3LMJH 4LSSH 4MNGA 4DZBB 5AVRB 3MI6A 5EMYA 1FGNL 3LHPH 1J8HE 2KPNA 1EANA 1AOHA 2ZAHA 4L1BA 5I15L 1F4WH 1TKWB 4LLWA 2WMPB 3RJOA 3DIVA 4AGPA 2FWUA 5D7JD 2ZE0A 3VGBA 5CWSB 1RPUA 2I5YH 2APVA 4AV5A 5C0AD 5DZPA 1PZ3A 5B3JF 1L0PA 4UOW0 1E9OA 4MZRA 4TN9A 5DZOA 2IH8A 4AYID 3RGHA 1ZA3B 3B3BA 3WJLA 2AK4B 4A6YH 4JMNA 3PWJB 1YECL 5DD1L 3RI5K 3OC8A 4UTAH 1VFOA 5I1HH 1KCUH 2VLJB 4W4OA 4MXVE 5FW7A 5F9OH 5CGBA 5I30H 4AJYV 5L8KB 5LJYH 4FOMA 4ELMB 1UH4A 2V7NB 2PYEE 2H7WA 5GGVH 4BK5A 3LDBC 4EVNA 3GT6A 1BP3B 2X1QA 3HAEA 1WIPA 3MRLA 4HIPA 3TBYA 4KKNA 4CVUA 5I1AA 4ODHH 3EW3B 4F27A 4HPYH 3SCMD 3RIFK 3U0TB 1BEYH 1GGYA 3MV8A 4B9KC 3RGVB 5DXWA 1OCWH 5C0GA 4S1RL 3ZMNA 3TZVC 2EYRA 1QACA 4CU6A 4APQD 4FQXA 1MJUH 2MNWA 3ROLA 1J0KA 2XN9D 3HNVH 4FZ8L 3Q1SL 4PWFA 4I0PB 2X89A 4EUPA 3JVGC 3KYKL 3CLFH 2E27L 4UUJB 1F86A 1ZJAA 3DX9B 3OJDB 1EFXA 3UTQB 5D7JA 4NUJA 1U93A 1P7QB 1A7QL 3HNSL 4FS0A 3MRMA 1QASA 3HKZA 4X98B 4L8SC 4KI5E 4M93B 1JPFA 3H3PH 4YIQA 4ODXA 4ZUWB 1H8LA 4PJHE 1I1RA 5CLXA 2G9HA 1I9IH 1A25A 3GJEB 4JHBA 3SE4A 4BV1A 2JNZA 3W2DH 4LGRB 3MAWA 1IC7H 3EDFA 3CN0A 4GRWE 5D6DC 5J11C 4OBSA 3C5SB 1OQXA 3B5TA 4N8PA 2RBLA 4ABVA 3G5VB 4L4TD 4FXTA 1HU8A 1AR1C 4FXGB 1SN2A 2XWTB 4HS8L 3HRZA 3NQIA 2Y06H 4P9HL 3AY4A 1P6WA 1BIIA 5E1HB 4PY7B 2E4TA 3CVHL 4HH9A 4KKCD 3D33A 3FCUB 3WO3B 3VFOB 4HJTA 5DDHB 2LHAA 4AUJA 2OI9B 1AQMA 3KVQA 3OMNB 3BZEA 2DF3A 1HHHA 4LGSB 1R6VA 3B2DC 1HJBC 4UF7C 2QGCA 2WXPA 1IL1A 5I16B 3K2KA 2GUYA 1QWNA 3HG2A 4N2HA 2DQTH 2P5ED 1FZOB 2P5PA 2JXMA 3H3PL 4KK6D 4L2YA 3DNKA 2O26U 1BX2A 2P47B 4G9FA 4HKBA 1D6EB 3LH8A 3PP3H 4HWBA 1OEZW 2OCFD 2JJVA 4MDIA 3ZDWA 5HSFA 4YSTA 4Q2ZA 1YQ2A 2P7TB 3EO0B 5F6HI 5HGAB 3MJ9A 5F7UA 2ODHA 4NI3A 1VFUA 5H4YA 1FCCA 4Z7OE 3P3RA 4OLUL 3RJQB 4RGNB 3APMA 3GSUA 1KTJA 3IJHA 3GYRA 4PR5A 4ZW7A 3HC4H 4X6EB 2J8UE 1QBBA 3B9KB 4WWKC 2CDGA 4PD4K 4EKJA 4N8VB 1FVCB 4XWGL 1UENA 5B1BB 2X4OA 1NC2A 3HHMA 1BZ7B 1D2PA 4HJ1A 2H2SC 4C56D 5AVSB 2VXQA 4HALA 3QYCA 3JYCA 4GQPH 1AZCA 1QO3A 3MLSL 2OP4L 2ZUUA 1Q9LA 4FMFA 2WYIA 4PW4A 1BQUA 3MV9D 1CGTA 1XZ0B 3HBZA 5DRXB 3S3JA 1UXSA 4FE9A 3W11D 1OOAA 2JI1A 3KGTA 3MJ6A 3OG4B 3VDAA 3KLLA 5JZ7D 3MR9B 1VADB 4U4IA 1XCTA 1AC6A 2W60B 3B8SA 3PDOB 4XB7A 3TNMB 2Y36L 1FYTA 1CG9B 1CXHA 1OCCB 2DQFA 3N0AA 5AG9A 1T80A 1RZ7L 3H7BB 3VTMA 5HI4D 1I7ZB 2JKIS 2HVJB 3F6JA 4FG0A 3NZHH 1OGAB 4U31A 4OCLC 3UL4A 4QRAA 3D07A 3ARPA 2CLZA 4G6AC 1A0QL 5IGXH 3K7UA 3KWVA 4N8UA 1XMEB 2CNYA 3NFPA 3QWOB 5CU5A 1JPSH 2R7EB 3VSVA 4WFHE 3MBEA 2AJ3B 5E5MB 3TT1L 1KWKA 1F58L 2BIOA 4YHPB 1OGSA 2FRGP 3HUJB 3NA4A 2ICEC 1IGIH 1SDAB 4U4BA 3NOIA 4YDIH 4MBOA 2WW8A 1KIQB 1R3IL 4KFMA 2HT3C 2J12B 4HK3N 1JPGB 1U92A 3CHRA 3RWFB 3V0AC 4H8WL 2QKIC 1PGRB 6PCYA 4P3CL 4OZIF 2MMXA 3ARFC 4YDLB 2LU3A 3QXVA 1MQKH 4NHUA 3QI9A 2FIRT 1ZT1A 2X6BA 3L3OB 3ULUE 4OCWH 5CCJA 1HOCB 4HHWA 1EFXD 2ZCZA 4LPCA 5KYWB 3EKCA 3UFIA 5GS0H 1MFUA 1L3NA 1PZDA 3S3BB 4J6IA 4E9QA 5DD6A 4UANA 1BDYA 1IGFL 4YH6A 1VENA 5CINL 5FHAL 2VDNB 5FYJL 1X4ZA 3HS0B 3CHQA 4J7RA 3S5LA 4FULA 4QHNA 3SPVB 3VRIA 3VSTA 1TXKA 1A4AA 1ZK5A 3DRTA 2BFGA 2YMTA 2ZUYA 3NIDB 3SBPA 3PLYA 4DKAA 4DERA 5GS1B 5HGHB 2X4NB 2EECA 5TH2A 5DJ8A 1UOWA 3P11L 2QFRA 5T1MB 1KGIA 3BXNA 3ZL2A 1TZIA 3ZTCC 1S9XA 3MTRA 2I07A 3TBTA 4DCQB 3NK4A 5TQ2L 1YEHH 4JRXD 3IE4A 4JDTL 3EFOB 1NFDA 4V1DA 4TPRH 5I0XA 4UT9A 3BVWA 1ZE3H 3OPZL 2O6FA 1CR9L 1FFQA 1ZHNA 3L17A 3T6ZA 1H6FA 1U8KA 3AU1B 3FS9A 3ISRA 3BH8A 3D34A 4PCTA 3QJZA 4D0DA 3HRZB 3STLB 4M3KB 4PREB 2K1MA 1OAUH 4H88L 4X4XA 3OKNB 1LDPH 2OULB 1NPJA 4Q14A 1C8QA 4MLSA 2XWRA 3U83A 2ZAIA 3BH4A 1A4KA 1YDPA 3CLEL 2WVVB 5CCKH 4TSBL 3FSAA 2WLLB 4PRHA 3BPNC 2CQVA 3ZR5A 5DLMH 3SPHA 3W1ZA 3DTDA 1BD2D 2N7BA 4ICWA 2X9YA 1DUZB 2YUZA 3QBTB 4BWTA 2CA4A 2P80D 1LYQA 4XI5C 2HUHA 4RDQG 2IIJA 1ZA6B 2BNQD 3DYPA 4XODA 1IV8A 4ZPTB 1AIZA 4BBWA 2BM3A 3PWPD 1KXQE 5TF1L 4IRSD 1QD0A 5E8EB 5D55A 1H5BA 3ARVA 5AUMB 1MFCL 2BX5A 1X5GA 2R7EA 5HTSA 2E86A 3KHOA 3MNWA 3AB0B 5IEHB 1TQUA 1NAML 3WLWD 2CXGA 2BNRB 4IBQA 2W9LA 3EBHA 1YQVH 4LDOB 4KZCA 4KGLA 1WVZA 1Z5HA 3ARFD 2DQGL 1ANUA 4NKOB 1A6WL 1GKOA 4M4RB 4F37K 3GI8L 3WS6C 4DKTA 3GRWL 5GJTH 4GW1A 3BGMB 3HAEH 3BAXA 1YEEH 5DLML 3UJIL 5J6HB 3QNYA 4YHIB 3GRGA 4FERA 4JRWA 4DP8X 3AC0A 5GHWH 5BQ7B 5E6YA 5KW9H 3PJSA 4JFQB 1JCKA 3D0LA 1E8ZA 4NZTL 2V7HB 3CDFA 3KPPA 5BRPA 5K9JL 5C0JA 1IIKA 2RCSL 2ZSVA 5IT2H 2EIBA 1XHHA 3QUYC 5I19H 2Y6TE 1RXLA 1J18A 1YYLL 4JFZL 5JDSA 4Y5XB 3VQ2C 1NEZB 3I75A 4N28A 2AXGA 2JKTM 3D09A 1J0HA 4JQIL 4L0ZA 1TNMA 4RBPK 5F72S 2AXWA 2ADJA 1XF3A 4LHUD 3AWEA 4X5PA 1BXAA 3PIQA 3UDWC 4OLVL 2EDJA 2MCPL 2FWOA 1ZLSL 1BVNT 1FFRA 2X6CA 3GSUB 5INDB 1J5IA 5T1DL 3GBML 5ICYB 5E8PA 5CR1A 2MPAL 5BV7C 1AVAA 3GXUB 4TVPL 3EO9H 4OQ1A 1G1KA 1RUML 5FS5A 5MEPA 1BQLH 4PJ7A 2YD3A 3PJLA 4M48H 5JIKA 3F64A 3QT2A 5JPNA 1K8DB 1I8MB 4ZS7H 4NERA 3PNRB 2Z6FA 4K5OA 4LCWA 1A6UL 1NGWB 3IDYB 2VLLA 4TVPD 5AOZA 4E5XB 3W38A 1GJWA 3S37L 4LRIA 4AZ8A 4F2MA 5EEXA 2CDEA 2CIIA 3CSFA 3NCWA 2NY4D 2Q87A 5HHPA 1IL1B 5I16A 4PRNA 1XB3A 4NBZB 1G9NH 1SYSB 2VWEE 2PCFB 3PL6C 3SZ6A 2A74C 1IC5H 4MQSB 3QFJA 3S3CB 3THML 5JHDD 3WNMA 3FTXA 2IMNA 2PWDA 3EOYG 3RWHA 1T4KA 2YEZA 4NNPH 4PHZA 2C4FU 3RILA 4I18B 2HX8A 3IDNA 1SQMA 2BOBA 2NQCA 1RZ8B 1RZIA 4G8FB 5D4IA 5HHQB 1UUNA 4K2UH 3RVUC 5FO8B 5DJ2B 1R1CA 2KBGA 3MRHA 3ZKND 1K8DA 5ANMB 2OMYA 1U95B 4TTDD 3TVMA 1CD1B 1CMOA 1LWHA 1REIA 3ARDB 4N3UA 2AVGA 5JHMA 3R8BB 5J1TC 4XNUL 1U8PA 3V4VH 5B38G 3US1A 4HS8H 3N41F 1WG3A 4OM1H 3AREC 1MKFA 3EYVB 3L1GA 4AY0A 1AKPA 3D30A 2GCYA 5HJDA 3E6HB 3E2HC 4LU5L 3DX0A 4HWEH 4F15C 1DHKA 1TCRA 5T5FH 2JK5B 5I17A 2D31A 5JZ7C 1ETZB 3BIAX 5H4ZA 1FF5A 2BLFA 4WEBH 3VFRB 2VDMB 1JPGA 1U92B 5GGUB 2XIIA 3IXAB 7PAZA 1AMYA 5GS2H 1FN4B 5H35B 3SDXA 2IANA 1TPXC 1BIHA 2ZXCA 3QDHA 3QUXD 3TLRA 4FFTA 4NOFA 4XPAL 4PV9A 1IQWL 3FOMB 3LRHA 2K8MA 4LPYA 1R46A 1GMEA 1AG0A 1PG7L 1ILUA 3HA0A 1VKXA 1SNRA 5M7QA 4S0TD 5K5YA 4JB9L 3MUGB 3DV4B 4MNQD 4ZO7A 3U79A 4MYPA 4ZZKA 4KO5A 1RPQA 3ATFA 3C2AL 3UP1A 3VQMA 3QO0A 3H9SB 1DVQA 4KX7A 1II4E 2B5IC 4DP5X 4GUOA 2Q2LA 2NXYC 3QK0A 3ABKB 3PAZA 3EO1A 1PDKB 4TLKA 3WFBH 3BWZA 4LCYA 4NQUA 5JA9A 3M7OA 3UIYA 2BJMH 2YUVA 2PABA 4U1GB 4KUCF 4P23D 1U21A 5CILH 1IC0A 2FB4H 3MLXL 5CILL 3CX2A 4LHJB 1Z66A 4XX1E 4ZBJA 1ZPLA 4R7NA 2YA0A 2WLJA 4Y89A 4YHMH 4FCAA 5GRZA 2W0PA 4A7TA 4AEIL 2X4OB 3MBEC 1PLGL 4QGTA 4HC1H 2Y6SC 2DQTL 3BWAB 1QPPA 3STZA 5IB5A 4DGWC 4X6EA 2BWQA 2CDGB 1NCBL 5MEQA 3BUBA 4QY8B 4QHMA 5GXBB 2AEPH 3LNDA 4PJ8B 2E8YA 3H7LA 1B3IA 5IOPA 1JXGA 4MFHA 4MMYA 3NSDA 1BVLA 2GW5A 2IADA 3VXRB 3LB6C 3HB3C 1AD9B 4BINA 5GGRB 4Z7VF 4BE5A 4C83A 5BOPA 4EN3B 2BW4A 4UILL 5CP3A 4YPGB 3T4AB 3UROR 3O3DA 4PJGF 3RPIA 1AD0A 3UC2A 4Y9BA 3VAEA 2ADGA 3CFIC 1M7DA 3M1CA 3HG1A 5I23A 4K9EC 2X53A 4JG1L 4AE1A 1A7PH 1NBYA 2CO7A 3QIUD 4ZOCA 5B8CC 5CXPA 3NCXA 1EQWA 2GIXA 4O2EB 4P57A 2ZP8A 3FSOA 2F54A 2ITCB 4AUUA 5IVXE 4Q0XL 4H1LH 1QFWH 4YSCA 5JPMA 2VL4A 4N2MA 5B1JC 2LVCA 1E8WA 1NGZB 1S8DB 3D39A 4PRIE 3H4FA 3TA3B 3WIIH 4MMXA 1QSED 5D1ZD 2YAEA 3NIFB 2DPKA 3BP5A 3T6QC 1KIPA 1JDAA 3E1F1 5CCHE 1GC1C 5AKVA 3BGAA 2I07B 1ACZA 1ND0B 1QZ1A 1UA3A 4OGYH 3FK3A 3VI4F 5GSVB 5JLZA 3AGWA 2VRKA 3HN5A 2I24N 2M1KA 2VXUL 1EERB 1SJXA 3FCBA 4FP8L 1HJCA 4F93B 1CYXA 2Q76A 2HVKB 3S96A 4U1JA 5CEYA 1K2DA 4HFUL 1SJMA 2YPLB 3QDGA 3G5ZB 5GGSA 4IBUA 1IQDA 3UTPD 2I26N 1BMZA 3D0VB 5GZOC 2DTMH 1M7IB 2YD6A 4ICXA 4DHLA 3HTLX 5DHYB 4CMHC 1OOWA 2ZOLA 1JVOA 2OMVB 3N44F 2NTFA 3U2SB 3W9DA 4GYBA 3A5VA 4MA7H 1AKJA 4OTXH 3QJHA 1EUUA 2F74A 2YGNA 1A7PL 5TDPB 3QDGB 4V1DD 4Y8AA 1RZGA 4NCC2 3OKMB 1P7QA 4QRRB 4WJKB 4Y5YB 5ID1A 4JO1H 1EDYA 4OLXL 1GYAA 4M29A 5T33L 2VZ3A 3ZSTA 4UV4L 5DHVH 3VG0L 4N0FA 4WO0A 5FFLA 2IPKA 3FTGA 1NBVL 3R0NA 3FQYA 1W0WB 4NO2B 3Q8FA 1AH1A 1S5IH 4RMUA 3FB8B 4D0CA 3APFA 4R96B 5JIHA 1GIGH 4GSXA 1JHLL 4LF3A 3MUUA 1GH7A 1K3ZA 1E4XL 4UAOB 4HGWB 2Q3XA 1SLUA 1XCWA 4YZWA 4AGLA 3T77A 3FULA 4NFDA 2Z9TA 4JDEA 3HUJA 1A6TB 1QPXA 3S34H 4M48L 3AWGA 3SD5A 1HXMB 1KN4L 2EDFA 4UT9H 5IBTL 5I1LB 1QG3A 3BWUF 3SBRA 4F2MB 3AZUA 4XMPH 5EU3A 5FFOA 2AJUL 2CGYA 4I7ZC 3OWRA 4PY8J 1IVTA 4WLCA 2W07A 3LPFA 2XOTA 1GVIA 4LSDA 1QFPA 4G80A 4HBQA 4JZNB 4HKJB 1ZTXE 4N6RB 3CSBA 1W91A 3QFJD 1IRAY 2C3WA 2ZKMX 5F8QC 4HLEA 4X0KA 5EU5B 1SXCA 4JPQA 3O41A 1G7JA 4YBQD 2CLRB 1NJ9B 1TQBC 3MJ8A 5AB1A 2XWCA 4YQXH 3AY4C 3DXAA 4FX5A 2DOCA 3HB3D 2QPSA 1DJGA 2BVPA 2WLZA 4FFYH 4AIOA 4U3HA 3RA7H 2RCSH 5FGCE 5IT2L 4OGQC 1KTRL 4GKZB 5FM5O 3TT3H 1TCMA 3ZE1B 3ZRFC 1D7DA 1UB5B 1E9QA 1HHGA 4E41D 2ESVB 4TQEL 4Y9EA 1E4XI 3CN4A 1CGSL 5C2UB 3C09B 2N56A 2E8ZA 2JKWA 5HVFB 2KDYA 4WK4B 3UCQA 4Y2NA 2IPUG 3RWIB 4I3SH 3R4RA 3DROA 1PAMA 3FN0L 4PJCB 3QHTC 5IQ7H 4LCIH 3QDMB 4LPUA 1NBCA 4N0YL 1N70A 3WNOA 4O51A 4OF7A 1QBAA 1CDGA 1Q0XH 2XRAH 4IJTA 1FSKC 2CLRA 5IB2B 4N2IA 2OXHA 3QORB 4K94C 1DDTA 2WB1A 4Q2ZB 2DY2A 3ULVE 1WZMA 1HIML 2AS5M 1PAZA 5D1QA 5TQ0L 4MAUH 5IFJA 2PYEB 4I3GA 3ARXA 1JWMA 3A23A 4U2YA 5JNYA 1C8PA 4IMLB 1GCYA 2MIZA 1FZOA 3RX7A 1BECA 1NIDA 2JQAA 4B9GA 3LEVH 2F61A 3KLHC 4OCRH 1JD7A 3LQAC 2XTJE 2Y5TB 4Y7MA 5E03A 3FU6A 4G1MA 1VPOH 2Z31C 4L3FA 1HEHC 2CIKA 3HHSA 1W72H 3IJYB 3ZK0A 3FFCA 3WD5H 4BSWA 4LDLB 3TO4A 2DQHL 4NT6B 1IM3D 1GC1H 1JXJA 2MOGA 4NNPL 2A74A 1NWOA 1JN6B 2I27N 5ILTL 1SXAA 1CZ8L 2R2CA 3K2UH 4DPRA 4HSAC 2X5PA 1AFVL 3GMNA 5C09A 2JB5L 1CR9H 1G9NL 5F6IB 4Y16B 3SKMA 5C08B 3CFKB 1JF1A 4XMKL 3NPSC 3RKDD 2CRIA 1X5HA 2YBGA 1YN6B 5FW8A 5IROC 4QOKE 1L9OA 3C60D 4DP4X 1G7IB 3T5WA 3WFCH 5LDSA 1SHMA 2ZUWA 5DUPH 5JDJA 4LLVA 3MRMB 2VERN 5D96B 3GMMA 1UM4H 3WFZA 1HSAA 5HDBB 4NHCL 3MROB 4EZKA 2G60L 5HI3D 4I48A 2W0FA 2HFEB 1EZSA 1XSJA 5FUCE 4N24A 1QSFA 2L4OA 2OYKA 2YAPA 3PWUB 5AW7B 1AQKL 1MWOA 3L3GB 4AV4A 5CGTA 3FQXB 4XZUB 3T8VA 3JWNC 4JM0A 4Q6IC 4JFEA 4QI3A 1AFVH 1S3KL 3T2LA 4KJPC 2D7MA 3ULVC 2VIRB 1T66D 4LCWB 4UQAA 4M61B 2VSMB 2FO4B 1X9LA 3KPRB 5D5MB 2IOIA 1KYUA 2VL5B 2WOBA 4W4OC 4Q0XH 5KYNA 3B9KC 4P2OA 4WWKB 5FFGA 1ZIAA 4UM8A 3ETTA 4NRXA 5GRYA 3FU7B 2DWSA 2XQYK 3FT3A 4TLUA 3IU4L 4FMVA 3QEGL 1IU1A 1Y0LB 5EBWB 2XQ0A 2EDWA 2P1YA 1EAQA 2X44D 3GRWH 4D9QE 4EIUA 4RWYL 5I18L 2KZBA 5GZNA 1GYVA 4Y8DC 4L2LA 1M57B 3C60A 4X6CE 3CFDB 4QYOB 4HWUA 4OT1L 4W6YB 3ZMRA 5B38A 3KPSA 3DSNA 1JDDA 3BJLA 3RFZB 1DBBL 5I6NA 2CCWA 4FQXC 3V4UH 5C7XH 4UNTA 4JFPB 4C57C 1MLBB 2OSYA 3OKEB 4MZ2A 1CTNA 5EUOE 3WS3B 4WFHD 5I0ZA 3FQ4A 3R8QA 4IHOB 3P4NA 3TF7C 5J13B 3DI2B 4GY4A 5CEXA 1Q1JH 4MJJA 1S6NA 5DMYA 5J6HA 4UIMA 1KUMA 1AXSB 1ASPA 4A6YA 4UTAA 1EJFA 4PWKA 3L4VA 3SGDI 2VDLL 4NT6A 2E7LA 4XHJD 3MRNA 2C9PA 4BUHA 5EOCH 1RMFH 1NMBL 4RGND 5DS8B 5FYLH 2UWEA 3KVPA 4AQAB 3GHBL 2DRUA 5CCKL 2E9IA 2A83B 3WKYA 2HLFC 3PUCA 3B2VL 2B2XL 4JRXA 5T3ZE 2AHIA 3VXRE 2F8IA 3HCVB 4YOKA 2BNRD 3MRIA 2B1AH 4Y9GA 5HI4C 4NFBA 4KI5D 5A7BA 4ZW8A 4CSZA 1X9QA 1A7BA 3TVMD 3GUTA 2UUDH 1XF5A 1EO8L 1OP5H 1BVOA 5IW1B 4LZKA 2ZOKB 2YQGA 4BELD 1UJTA 5CFAA 3NH7H 5EEUA 1ONQA 2YQBA 4POZC 1T89C 3ERXA 3BOVA 3L4WA 3PAUA 4QHKI 2GUOB 5FB8B 4APXB 5A2LH 3ZQWA 4BGDA 3FB5A 2YRZA 4FDWA 4NP4H 2PETA 1MQ8A 5IMOA 2ZNWA 1ED3B 2WSPA 1Y7VA 3DO7B 4F33B 4WY7L 4S1SH 3T0AA 3QNZB 4TSCH 4ZDHA 3NG5A 3QQ3B 2H1PL 3VQLA 1UHVA 1SY6A 3GMLA 5IVNA 3MHZA 1HZHL 5IMLB 4HIJA 4ODSL 1D6EA 1J0YA 1M7IA 2BRRH 3PJNA 3FFDB 5EBMA 1ZEAL 2HKHH 5C0IB 3L4XA 2XPGA 4S0HA 3FMGH 1I53A 4LMQI 4FL4B 4P05A 3NGBC 4L05A 3L54A 4OKDA 2F15A 3FUNA 3U1QA 3PHQA 4JY6B 3FCGA 5E5LA 4WJG3 4PGDA 1OP3H 3M1BB 3BP7A 1J5OH 2VC2H 2GJZB 4PW9A 5AVXB 5CD3B 2GT9A 1VESA 2ZX6A 4DVRL 5KSAC 3TL5A 1RIHH 1IC7L 1M3IA 1TSRA 4TV3A 1T0OA 3KR3L 4KPHL 1VA9A 3DPBA 1INQB 3VXME 3GI9L 3PQYA 3RVWD 3EDDA 1JZIA 4EDXB 4LCUA 4MLIA 4PJ5B 1G7IA 1VEOA 1J5OL 3MJ9H 3M17A 2D0FA 4NN5C 4QHNB 3TJHC 3VRIB 1OVZA 1ROWA 5EBMB 4EQ2A 2ZD0A 2WIMA 4KQ4H 4QXVA 2X4PB 3J7HA 4B9PA 4FHBD 1F56A 1LL1A 1AYRA 4M6AA 2CPCA 2FCBA 3KBPA 2JE8A 2ESVD 4ELKB 5L0QC 4E0RB 2AAAA 5DJAB 1F18A 1BEYL 5FYKD 1H3WM 1HZHH 2AGJH 4HBCH 2FL5B 4UT6H 4Z6AT 3NCCB 1FGVL 1BHGA 2OA9A 3LIZA 3QW9A 4LOVA 1JMZA 4MDJB 4PP2B 3GBNL 1X6NA 4AITA 5E9AA 3EJQA 4I5BA 3W9EB 1TJIH 4KV5E 1MFEL 2CKBL 3TU6A 3NABL 1N19A 1N6UA 3IKCA 5TK4A 1JUFB 3DIFA 1NAKH 4BXSV 4BKLA 3MLSH 4MWFB 3RL1B 2WM0A 2HT4D 3ABMB 3KBEA 3TN0A 4A6YL 1D9KB 3MZGB 2ERJB 2YFOA 2Z8RA 4HHGA 4ELMA 2OJZH 2OXGB 4KXCA 4CGUB 4W1TA 4YDKH 4F3FA 3V5DB 4X6DA 1DVFD 5JXED 1JI2A 1CFSA 5AENA 3RUGE 5CM1A 4OGXH 1J8HD 5T1LD 1FYTE 2BFVH 1KN2H 5ESQB 2IALA 4FG4A 1QLFA 1TR7A 1JNHB 3LZOA 4OJEH 3B6SA 3DJ9A 4IKNA 4PJDB 1AGCA 1U3HD 4ZOEA 2YD5A 3QZBA 1IFHL 4U1SB 3X1GA 1A6ZA 2BIHA 1FNHA 1VFAB 3QDGD 4I0PD 2DWDB 1RV6X 2BY3A 4WJ5A 3S4SB 3K71A 3IXAA 1NC2B 2RACA 4LRNH 3VTTA 1PJ9A 4UM9B 4H20L 1XIWB 4FHKA 3GM0A 3GTVA 4G8EB 3H2QA 2OYLA 3CPLB 4FNQA 4LEXL 4DF9A 3V6FA 5EOQH 1XSKA 2GJ6E 5GGRA 1SUJA 1TO4A 5A2FA 4KTEH 1CFNA 2YA1A 1E8XA 1LO0L 2AI0H 1G7PB 3DKHA 1JPTL 3HPJB 1BXXA 3OJ2C 4MJHA 1PG7H 3CZGA 2EACA 2XZAH 3L3JA 1QHOA 2TSAA 5FGSA 4I2XA 4KAQL 1E5YA 3CZKA 1P84J 3L4ZA 2ZWZA 2V5TA 1UTDA 2YA2A 2COVD 2AEQL 5CJBA 3N9GH 2AJVL 2X9ZA 5EN2B 5HHQA 1A3RH 2GJPA 5IM7B 2X09A 4PJ5A 3O4LE 3H9HA 2DWDA 1ZXKA 3RPBA 4PGCA 3SZKC 1Y07A 4OZIA 3N1PC 4JFYB 4MS8C 2VDOL 2WQ8A 3L3GA 3NFNA 3QYMA 4MTMA 4XP1L 1ACYH 4DEPB 1YNKH 5ICXA 5ITFB 1IGMH 1QHQA 3MQIA 3TXAA 3VDCA 4HGWA 2DYPA 3V0EA 2X7LA 1T7YA 5C09D 1WQVT 1ZOXA 3L3IA 4JFEE 4GKNB 1MAJA 4CSTA 5IMKB 2FAUA 2FATL 4KK8D 3NFNB 5AW6B 3NIDE 4AYBA 4YFDB 5T1JA 2NDFA 2UWEF 1YY9D 1I1FB 2YAOA 3HNVL 2BC4A 3EYOB 3HI1B 4WTXA 2UX7A 1TTUA 2R83A 1AKJB 5F97E 4Q6IA 3QFJE 1BBJB 2IQAA 4ZFFB 5ECGA 3MXVL 3BAWA 4XMVA 2O5ZH 4IK7A 5AAMA 5LLIC 1LO5A 1PKQB 3D06A 1QFWM 1M1SA 4ZX3A 4NQEB 2Q2EB 3WS6A 2JI2A 1KTDB 2LE9A 2NY5C 5ID0B 1QSFD 1AP2B 3ZOAA 4WW2A 1KELL 1C5CH 2DLFH 5EOCL 2FYVA 1LK2A 1CT8B 2WNXA 2P46B 4A55A 1UFUA 3C6LD 3KDMB 4AVKA 2VLKD 5C2BL 3V6FB 2DLIA 5L2KA 3GDCA 3LN5B 2JB5H 5DJ0B 3EJTA 3VFWA 1P7KB 2WN3A 4KH2A 3MJ9L 5KANI 1KTBA 2HH0L 1XF5B 2K9FB 1O7SA 3BP5B 5I1EH 4ZS7L 1GYCA 3FCSB 5LXGH 2XXCB 1ZHBB 3C60C 3C8HA 1G7HA 4QKTA 1HH6A 4QPEA 1BQLL 1KXHA 3F84A 4HH8A 3FTWA 4PVBA 5K59E 4RGOH 1QNIA 1HILB 1LWRA 5LCVH 4FG2A 4QRRD 3HAEB 3CK0L 4W9KC 2PPCA 1R3IH 2K4WA 4WHYH 3KGSA 1YEJH 3VX1A 5H2BA 2IDCA 1KCVL 5IV2B 1V54B 4HWNA 1QAWA 3KPOA 3RTQA 4Y4FC 1SJEB 2XA8L 1LO2L 4KY2A 1NIAA 4NP9A 3IDJA 5AZUA 5G4MA 4NN7C 2JKJA 5E2JA 1BYPA 4HS3B 1BVLB 2AV1A 2ICEB 5AB9A 2UUDK 1OP5K 3MCYA 2XACC 1GZHC 2YSTA 3NBNA 4JY6A 3L1EA 1BF2A 2J4WH 2BSTA 4NZTH 5FHBL 2AQ2A 3HBQA 1KIRB 5ES4B 1OWRM 1BOYA 2O5YL 3WE1A 2DM4A 4Q9RL 1NIBA 3HBGA 4GG8A 1CDIA 1MXGA 5CP3H 4XVJH 1YPZE 3VI4E 3CFBA 1N5YL 1S3KH 1LWJA 1A22B 3BKMH 2ESVA 1W8EA 2QEJA 2VXSL 4QF1B 3FN0H 4PR5B 2YIHA 4MNQB 1KGCD 5IKCB 1O0VA 5C0NC 3NZUA 2BHYA 5JHAA 4IRJB 4AT6B 3ASWA 1T22B 3LPPA 4PAZA 3REWA 1XR9A 3WL9A 4JE4B 1U42A 5IHZA 1PZ2A 1PZBA 4CRPA 2FD6L 4AEEA 4LPWA 3X14A 3ESPA 5LNEA 4HUUB 5BZDB 4JHVA 3NRFA 4X5XB 2GQHA 3DV4A 2WLIA 3VGGA 3VMNA 3M46A 4OI9A 4NKDA 1F1GA 4U1NB 4UIKL 5AOJA 1S7XB 2H32A 2BVQB 1YMMB 5E99H 4XX1G 3MRJA 4EO5A 3PNWA 5KZCD 1ZWIA 1QVOA 3D18B 3O3UN 1VEMA 5E7BA 4BFGA 5BXFA 2EDEA 2B0SL 4TNWK 4WZ9A 3T4AC 5JR1L 5D2NB 1IM3A 3OJVC 1RZFH 3QCVH 3DSFL 1WTLA 1EJOH 1ZDSA 3LSOB 4GMTH 5DHEA 5E0FA 3WEXA 4TQPA 3BZEB 4WWPA 3FTVA 1JV2B 3ZKSD 4JFWA 4KHTH 2R9HC 5IG7A 1K85A 3FTGB 4XN1A 1LK2B 2QLVB 1GC1L 1CB4A 4MAYA 4JPSA 1JYVA 4YUEH 2NYKA 4OGAC 1A9EB 1BVKB 2QPUA 1ID2A 3BH9B 3QH3B 1Z9SA 1WT5C 3NA9L 1GIGL 5KBKA 1E90A 5T1LB 4LVOC 3L7FB 2XUWA 3P4NB 2DEYX 4IW4C 4AK2A 1FL3A 3PWNB 1O5PA 2R56H 5D1QC 3BPOB 4FFZA 4PJXB 4X8CA 5B4MC 4MSWB 1X3DA 2R69H 1QEWB 1PEWA 3FO1A 3KG5A 4PMFA 5DZLA 3UG3A 4AMKH 3QNZA 3NPSB 5EO9A 1BVKA 4MAUL 3TCXA 2DEXX 3ISYA 5EO1B 3OJDA 3MRCB 3E6FB 2AABH 2ZXAA 2MHAA 2JIXB 1FIEA 1KLFB 1FPTL 1TG8A 1LP9F 2PP9A 4OFKA 3ARDD 3BQVA 4RRPG 1BFSA 3RWCB 1XF1A 2GTWA 3GRBA 4PLJD 1PEZA 5I1DB 2VLME 4GSQA 3X13B 4FQQA 2VMFA 1QTSA 5JO5A 1QZNA 2PXYA 3HN8A 4LLDA 5FOBB 5I6MA 2XTLA 5F7NC 2ZUTA 2BPBA 4A2EA 3ZZSA 1SHWA 3L16A 1J1XH 4UINH 4TVPE 5EOTA 4BFJA 3ZHDA 3CFEA 4E5XA 1XDTT 3VGEA 5DSCB 4JZOB 5HPOA 3W0WE 3PUUA 2MFNA 3ILQD 4QUOA 5HHXH 4G82A 4XCEB 4AIEA 3DHJA 4HAKA 4ODTH 4XPBL 3NJHA 5EC1B 2APTA 4KMQA 5ESAB 3GMOB 1AY1L 2FX7H 4L4JA 2WINB 2NXZB 5BOZG 4AQOA 3QCTL 4G43B 5E8PB 4ZFOB 4MCYA 4YQXL 1E4JA 4DGUA 1ZT7A 3O6FC 1C1EL 2COQA 5DR5L 3MYJB 1OAZH 3P40A 2R56L 3GMMB 1ETB1 1OLLA 3V5KA 3QQXA 2RAMA 1IARB 3O45A 4Z3HA 4W93A 5GS1A 5IJCC 1TU2B 3STZB 3N55A 4PJ9D 4EOWH 1FHGA 4XMXA 3OVUB 1GYUA 4OCSL 1VFBB 4U6XA 1R3LA 5DEGA 4Q9QH 4QWWD 1YN6A 2MCG1 5DURD 5FDWB 4AYGA 1OLZA 1RJYB 1F2XK 4EEEA 1FFPA 4I77H 1J05B 1KB5A 2F6AA 1T03H 4GMTL 4A1RA 1PVHA 1E4XH 3WY2A 3L95A 3IPFA 1VPOL 1JHLH 3QHFH 3GINA 3GXMA 2KERA 1RZQA 1OB0A 3IJ8A 3HZKA 2KKQA 4XAWH 4HISA 2RQEA 1J12A 4NHUB 3D3VE 4NZRH 2JI3A 4M6NL 1TTCA 4L5FE 3OSVA 3HZ3A 4XTRD 2E3VA 4G80B 2Y69B 4WTWA 3DVNB 3WO4C 5FCSH 3PABA 4GO6B 1AACA 2CMRH 4G5AA 1QVOB 2QADD 1MDTA 2YGVA 5EIIA 2WNGA 3MCLL 1ZY9A 4HJ0D 1R3KA 4MXQC 3NP4A 5I1CH 1OCZB 1V3KA 4F7TB 1J1PL 4UZGA 1UD3A 3A6CL 4C4BA 1R75A 4QXGH 2D7OA 3T6VA 1OZUA 1TQWA 1RLBA 4HFUH 1BM3L 3G6JA 4UU9B 1XR8A 1QA9A 5F6IC 1YEKL 4S1DD 2MNJB 5SWZA 3CQQA 5D7HA 4G7QB 4HZLA 5FYKU 1A5FL 3MV7E 4L9LC 1U3YA 3CVIH 1Z9PA 4R7DB 5CO1A 1A64A 4DETA 1G9MC 4RGNC 2G0KA 3ARDC 2GHWB 5DMGD 2IH1B 4JFOA 1HT6A 4FFZL 4ATWA 5DRXA 4JPKH 4N6QA 4TYUA 4G71B 1S9VB 2D03H 4Z7VA 2J4WL 4MYWB 3U9UA 1VDGA 5G2NA 3TT3L 1I7UB 5C08A 1ZJBA 3N5AA 4XWOD 1MLBA 3OKEA 3CFBB 3IWVA 1AJ7L 4PRAB 1D5XB 1I8KA 3G5ZA 3OL2A 4IM8A 1L9PA 4YPJA 5BVJA 5E9DA 3NCEB 4NIKB 5J6GB 3RVVC 2BIMA 4UQ3A 5F89A 4U3CA 5F7HA 1DFXA 5FR3A 1UCBL 2BSTB 1TETH 5GGSY 5CFHA 1PNDA 5EWIH 1D5IH 4U7SA 2WZPA 2CNZA 3AAZB 1NA8A 4KTGA 3UJTL 3OQ3B 3KLDA 1HCYA 3RKDC 4OCNC 2AJUH 2UZIH 4LKCA 2H2PC 4NKIH 4JGMA 4F7MA 1TZIB 2QSTA 4UM8B 1WAAA 3G5YA 2QQKH 1NCHA 1QRKA 2GB2A 1AGBA 2W95A 3VFNA 5AKSA 4CADA 4MS8D 1IBDA 2NY2C 3K1KC 3TP4A 1A6PA 5F7EH 3LQAH 2WP3T 3WKPA 1RSFA 3D2UA 1JGEB 1IEAB 1HHJB 3RDJA 2M26A 4PJHA 5BZDA 4XVOA 3LS4L 3VG0H 4YDJA 5I5JA 4N0CC 1TZ8A 4AGNA 1NDMA 3N06B 3MJGX 5A6IA 2YARA 1N8ZB 3BUDA 1K8IA 3DRQB 3HR5A 4RZCA 4W9FC 4XO3A 4FJZA 1UQSB 2ZKHH 1T3FA 1TO5A 1USQA 3BUTA 3FNKA 3UZVB 4DP7X 3Q01A 1FNFA 2FO8A 3FB8A 2X0UA 3HN3A 4AM0Q 4ZW5A 4PJEA 3IF1A 4WI0A 4GNKB 4N0FB 3UYOD 5K9KA 3QG7L 1R24B 3U7WH 1FG2A 3KPMA 1RL1A 3OAZK 3IDYC 2WANA 1SUHA 1GGCH 1TVBA 1WBYA 3FAXA 4XBEL 3RHWK 4DWHA 3H2PA 4HUNB 5JDSB 3P3SA 3UCRA 2YSSB 3TTYA 1JZGA 3TO4C 2A4CA 1DQMH 1JK8B 3LZLA 3VO0A 3ET9F 4JDZA 3T8XB 3DURB 4R97C 5E8DL 4HF5H 2AXFA 3FO0H 3HE7C 3JUYA 4GSUA 2AK1H 1P84K 3C5JA 1KY6A 3MJ8B 2B77A 2E7CA 2A6KA 4JANA 3CZFB 4LCCB 1SN0A 5IR1B 4N9GB 4R8WH 4JZJB 5K39B 5INCB 4KROD 1BFTA 2VZVA 5JUEH 4Z7AA 4Z0XB 3KYMB 5LQBL 3NAAH 2RR3A 1H6EA 1NGZA 1S8DA 4I9WE 5GIRB 3OG6B 3Q6FA 2A73A 3GSQA 4XNUH 3V4VL 4NGHH 2VN6A 3F58L 5AUMA 4EUPH 4KRPB 2JSFA 2WUCH 2H32B 2DD8L 4RMSA 5D2LE 5KVGL 2PTUA 2CG9X 5IB4A 4IBTA 5I8OH 1TYJA 4NC2B 1DANU 5C8JA 3TO2B 3SDYH 1ETZA 3GLZA 5CGYC 4CSPA 3UTTA 3C60B 2QDVA 1AZZC 3LCYA 3WEAA 4AQ1A 1ZLWH 4JQIA 3KR3H 4XMZA 1WWWX 2IPKB 1CXFA 5IB2A 1NMAL 4Z7OF 1KCRH 1RUAH 2VW6A 3VJ6B 4P2QB 4EDWL 4BFBD 5KS9B 3ARED 1YNTA 1SRDA 4M1CC 1LDSA 4K94H 4NQDA 2O61A 1D5MB 3MA7A 5I1IH 1T4WA 2ADFH 4HC1A 4LCVA 4PVMA 4WSJA 4P23C 5DJZA 1L7IH 3WDJA 4P49A 3VE0A 5AW3B 3DTXB 1ACXA 3II1A 4YFLF 5SV4A 4G8AC 3SPIA 1OK8A 3IMSA 1HKLH 1MFAL 4YS4A 4ELDA 3Q7JA 4OJCA 3RVTD 5JOFA 4BZ1L 2EC9T 1NGPH 1R33A 4GT0A 5ABZA 3DV6A 1I7TB 4Z18A 4U1GC 4L4TB 4NO0A 3DK0A 3IVKA 3TV3L 4ADJA 4MX7B 1HSAB 1C7SA 1NAKL 1R5VA 3CZFA 1H3UA 4Z5RB 4OZFB 1XGQA 4JPIA 4Z9KB 2R1XA 1FVDB 3NZ8A 5IBUG 4JVPA 1L9MA 1XEUA 3LAFA 5DQ9B 1DL7H 2R2EA 5C0IA 3LY6A 4FQIH 4FYQA 3IEAA 1XXDC 1W72A 4AENA 3CFKA 4ZT1A 5I0DA 3OX8B 2Z35A 1R3JB 5F7MC 1PKQE 3CFTA 5SWZD 3REWB 3VRLF 2ARWA 4YAQA 4HHAB 3REVB 1BBDH 2XU9A 1RULH 2AEQH 3IMUA 3MLWL 1YMHB 5ICYA 5DJ0A 1E5BA 1VFMA 1JAEA 3SE3C 4DUWA 3MDJA 4YMPA 3CTTA 2VZUA 1JHTA 2ZAGA 1CE6A 1YMMD 4PB9L 3FFCB 3PL6D 3K2IA 5D70H 4K3GA 5JYLA 4UV7H 3VFGL 2GI0A 2ATPB 4IU3B 3ETBF 1Q1JL 5KVDE 1ADQA 4AMWA 4J23A 4M8QB 4ZUUA 2R1WB 2O72A 4XO8A 1TZGH 1WDAA 5D1ZB 2EINB 5A7EA 2BSED 3GSQB 5EF2A 3U4BH 2EVGA 3HJEA 5GGSB 3BUYB 5JOPE 3B6SB 4I1PA 4LOEA 4J4PA 3L48A 3PCYA 3GTNA 1CLYH 1UUSA 1EJ8A 1EGJH 2H5UA 1V55B 1OT2A 1Z0MA 1QFUH 4LPVA 2WCGA 1INQA 1W0VA 4QKXB 2EXYD 1JV5B 4IHBA 4RA3A 1N12A 4XCFL 5HHMD 1J9QA 1ROCA 4MD0A 1VCAA