2WTRB

Full length arrestin2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
399
structure length
367
Chain Sequence
b'GDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGRVGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPKEEPLDTNDDDIVFEDFARQRLKGMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ARRESTIN-1
publication title A New Dimeric Crystal Form for Arrestin2
rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 54
structure length 367
sequence length 399
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
B PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrB02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrB01
3GD1C 4LL1A 3LH9A 4JQIA 4LL4A 3UGXA 4ZRGA 4GFXA 1CF1A 1G4MA 1AYRA 2FAUA 3LH8A 4GEIA 3GC3A 5F0MB 1ZSHA 1SUJA 1JSYA 4R7XA 4GEJA 4J2QA 5F0JB 2WTRA 2WTRB 4P2AA 3P2DA 3LHAA 5F0PB 4R7VA 3UGUA 5F0LB 2R51A 1G4RA
chains in the Genus database with same CATH superfamily
1OTSC 5ACZB 1T89A 4JRXE 1Z9SB 1LO2H 3MMEB 3KYNA 4LHQB 4YDIH 5E5UB 5C70A 4DP4X 4JY6A 2QLYA 4AGPA 3MV9B 2W88A 4N1EA 3CMGA 3NP4A 4CVWA 1FZJB 2VDML 4ZUWB 4WO0A 2VDPL 1SMDA 2YJQA 3HG1A 3N2JA 4F15C 2ZCHL 1TQCB 4XP4H 4G8GE 2FJHA 3V6FB 3OXSA 4GW1A 1UXSA 2XWDA 3I6SA 3K6IA 3IU4L 1T3FA 3FCSA 1MFBL 4FMFA 3FPXA 2XN1A 5CBEA 1BGXH 2YD8A 3WTYA 1KN2L 4N4YB 4HJ0D 3SBQA 1AS8A 4PW9A 1R9FA 5AKRA 4J5VA 2VE6A 2XX1A 3FT3A 2CAKA 3H42H 3GSUA 3SQRA 1QW8A 4PJ9D 3TYGH 1MNUH 5IF0B 1WQVT 5J56B 4WU5B 4U7KA 5D7SH 3L3JB 1R0AH 3OMNB 2XDHA 2Q7YB 3HHMA 4J23A 2WQUA 3K4ZA 2F53A 2J7LA 4CU6A 1MY7A 1LP9E 4WW1B 2ZOUA 3ARBA 4YSCA 2VDOL 4XP5H 4ZMNA 2XHNA 3DSNB 5JPMA 5KVGL 2JJVA 1V5JA 5CEZD 3BN9C 3W2DL 2WINA 4XNUL 1EPFA 4E42B 3PQYA 4N0UB 4D8PA 3OKEA 3B1TA 2GITB 1JNNH 1WHOA 1ZV9A 1CDUA 1I8IB 2JELL 3GT6A 4U1IB 4PUBH 2DWSA 3BSZH 2E76C 4U0RB 3K8MA 4Y5YB 4TTDD 5K93A 2CQVA 3AM8C 4R7NB 3QC6X 4GIPD 2W59A 3X14B 1G7LB 4I3SH 2F5BL 1U93A 3P3TA 1HL8A 3BZEA 1S3RA 1QYGL 2D4DA 2UX7A 4M6OL 5KOMC 2AS5M 1D3CA 3TYFB 1VZHA 3US1A 3ZDYB 4RESB 5B3NA 2JIXB 2A83A 3TF4A 2R4RL 2DOCA 3KEHA 1F45A 5K1VA 4HIQA 4JFZH 3MLUL 5FK9A 4DESA 2VZ3A 3S88L 4CVXB 3PIQA 3EH2A 3KPNA 2VLJE 3M1BB 3WMSA 1HL4A 4C4KT 3B43A 1GSKA 1KELL 3FQRB 3T0BA 3AXHA 5EO9A 5FO8B 4AVJA 4BV1A 5H94B 3NSFA 1SVZA 3IK2A 4ESKA 1DJGA 2HFFA 3UG3A 4ZMAT 5DZAA 1MFMA 1ZT7A 1LXMA 2X2JA 3H4HA 4Y2LA 1QSFE 3P4OA 2DD8H 5HBBA 3TTYA 1CICB 2K6WA 5AD0B 5DQDL 1FH2A 5E5MB 4IEFA 4LLWA 4P4KC 2BXYA 3MCYA 2LU5A 1C12B 2L04A 2AANA 4M7KL 3OSVA 1AZUA 1CL7I 3MRBA 4U6HA 4W6XB 5KYUA 4JCMA 1BYPA 3PHQB 4EAEA 5ICZB 3WAJA 5F1SA 1SDYA 1HXMB 1BG9A 4PJEA 1MJUL 1U91A 3KS0H 3WUWA 25C8L 4XN8A 4OZGF 5D1QB 4E9SA 1AZBA 1I9RL 3GBLA 1G9ML 1T1YA 1Z6JT 2EINB 3F12B 1DYZA 1JGUH 1E4XI 1MCQA 4LFHD 3EGXA 3HZ3A 1NIEA 3GYRA 4OCLC 2Z9TA 5DMIH 3RGVA 4F5CA 2AHIA 2P80A 3MLZL 2Y0SA 4LL4A 6PAZA 2O1AA 5CJBA 2HTKD 2XWCA 1OAYH 2Z4QA 3VXRD 4J3OD 4I88A 2DQDL 2OL3B 3LNFA 1P53A 3QH3B 2IFFH 4E5XB 3OLEA 5KS9E 5L2KA 3VSTA 4GQRA 3EFFB 1KIUA 3LXCA 3K71A 4OLZH 5JHMA 3AG1B 1LO5B 4JFSA 1J48A 1DEDA 2CO1A 1F4XL 4OZIB 4LK4A 4XH2A 4MNQA 8FABB 4G6KH 1XH1A 3ILEA 5DDHB 4AIZB 5DWUL 5E2WH 3UGUA 1N5YL 1VPOH 3B8YA 3TZVB 2XWJA 5G4MA 1NFIB 3RIFF 1T21A 1KCWA 5ID0B 3KYOB 4NPYA 2D7MA 3FCGA 3U0TA 1EK3A 4LSUH 5JHDD 4PGBA 1WT5C 4P9MH 4IBTA 4G1MB 2J6EA 2RCSH 3SGDH 4KTEH 4QOKD 2XQ0A 4NAQA 3ZW3A 5DHYB 5EZJB 1JFQL 4CN4A 4DEWA 2NR6A 4PH8A 4CNIA 3OLIA 4YS4A 4R0LA 4CADB 3MN8A 1IGIL 3I02B 5C08D 3VD3A 4NNXA 1J86A 4BZ2L 3B7YA 3NCYS 4JO3L 2GUOA 3GRWA 3BP4A 3L7EA 1MJ8H 2ORBL 2Y1YA 3RY6C 3RJOA 4AYEC 2I7SA 2VMCA 3P9WB 5AYUH 5KVGE 3VB9A 1A66A 4MA3A 2ZPKL 2BP8B 4WNSA 2CK0H 3IDJA 3NFNB 4DKDC 4QHNA 2XBTA 5FFLA 3ULUF 3TPKA 4OQ1A 1K85A 3UG5A 2BVTA 1SVBA 2R1WA 2BSSA 1GYCA 4I2XB 4P4RA 4AK1A 4Y9FA 1U8OA 1A6ZA 3UX9B 4UNTA 5CJQH 1KZYA 1UHVA 2EH8H 1AD9A 1PW3A 4JPQA 2DN7A 3AS1A 4KZCA 9PCYA 2G2PA 1KJ2B 3WFCH 3GZPA 4PJ7F 4U1KA 2WXNA 1DQDH 2B14A 3L3HB 1RHHA 3EYSH 3VFNB 3IJHA 4AV5A 5E6IC 4YXKH 2WAQA 2VXSL 1KYOJ 2NW3A 3CXDL 1P6FA 1AE6H 4N25A 3GEWB 5E6RB 4X6EA 1KC5H 2AJ3B 1AIFB 2VQUA 2MHAA 1MXGA 3B2VL 4UILH 3OQ3B 3ZDZF 1JHKH 3BLBA 4JGJA 2BHZA 3GMOA 3IAGC 5FLVA 5EDXA 4F24A 1J5OH 4DP7X 3BUPA 5HYQA 3LN9A 3LS5L 1A8JH 3N0PB 3P40A 2CKBH 3ZZLA 3PWLB 4TKWA 5HHXH 4YHNB 2NYZA 1YMHB 3SDYL 4Z7VF 2EXYD 4AVKA 2O5YH 3NZHL 3KPSA 3HE6D 2IALA 3OR6A 3BX7C 2IGLA 4XOEA 2ZWYA 3TBWA 2A2QT 2D3VA 4P59L 3PP3H 4ODVL 4EN3A 1DQVA 3ZN6A 1TR7A 3ILDA 4DN3H 3A4DA 1C1EH 4MD4B 3HG0A 5CR8A 1T5XB 5KVDL 3JTSA 4IRSD 4PJIF 4LVHB 4M9OA 3AREA 3O6MH 1VHPA 2DYPA 1A6AB 4YDNA 4LCWA 2Q6WB 2X4PB 5HHNB 1V7NH 1A3QA 2A6IA 5I0YA 1XX9C 1PQZA 4KFMA 2J71A 2IADB 1BD2B 4ONFH 2Y1VA 4G82A 3RJDA 1E0OB 1IGYA 2GTZA 1M1XA 4YSUA 1RZKL 1UFGA 2F19H 3VXUD 3LKPB 1T4WA 3CH8A 4ICXA 2OL3L 3IE9A 4BA8A 4NKMA 4JMXA 3LS4L 4IBQA 1WWCA 2FEEL 1YNLH 1IAMA 4HCRH 3OZLA 1A2YB 2I5YL 3KPRE 1UT9A 3EFDL 3DBXA 2KPNA 3FTYA 3NP3A 3H9SE 3BKCL 5BW7A 2YUVA 2LR4A 3GMLB 3CFIC 3CFQA 3ZKXB 5FYKL 3QDJB 3VI3A 4DGYL 2FH8A 2D2CC 2YRZA 5IEKB 4FQXD 4G2AA 5F0MB 4R7XA 3U2JA 3UTTD 1AR1D 1OAUH 3IRCA 4KK6C 1A64A 5LBSH 3A4AA 4QF1B 5GZNC 3H2PA 3BIKA 2YAFA 5C7ZA 4FERA 1EGJH 1WTLA 5JW3L 2AZAA 3CFEA 5F7DB 5DHVH 3VMNA 4H8WH 5GS1C 1J5CA 4U1GC 2LHAA 3UTSD 3IMRA 2X4RB 4LCCC 3N0AA 3DK2A 5HPMB 5E70A 4P2CG 1JTPA 1UZ8A 2AK1H 1IEBB 5DT1L 5HHPB 2X4UB 4QRSB 1P4IH 3SE3C 2AEQH 4YZFF 3I2CH 4Z3EA 4I89A 4AGQA 2B9BA 3ML9A 3F58L 2VSKB 4FXGA 5GGSA 5IFJA 5CN2A 1RK1A 2AZUA 2VLKB 3NIDE 3QNZA 2XVBA 3MV01 4HIIB 4HZLB 3U9UA 4B9CA 4WJ5A 1RJZB 3PPSA 5HY9B 2Y06H 2NY3C 3IGAB 3X12A 4N0UE 2D2OA 2KH2B 2PWHA 2AQSA 2IWGA 3OM3B 4I0CC 5IOPB 2DQIH 5DO2C 1LWRA 2CHXA 1FE8L 3QPXL 1NL0H 1ZT4B 3BPLC 3GXNA 5D8JH 1KLUA 2VQ1B 3KLDA 2QKIC 3H54A 1A7RL 1R34A 2VDRB 4PVBA 1RZGB 1IRAY 4MZIA 3RX7A 1FYTB 1WCBB 4QD2E 1FI8C 3L2MA 1FFPA 3BJLA 1OAZH 3ASOB 2I7OA 4X7TA 3VG0L 1KJ2L 1ZK5A 2Q20A 3VWKB 5E51A 1NGZA 2WXJA 2YPKB 5AOIA 3L5XH 2DDQL 5K9JH 2YLHA 2XUWA 1Z9PA 3QIUA 3LEXB 4YFDB 2VXUH 1NCGA 4LLUA 1PJ9A 1F4YL 3MLTB 2FDBP 2QV4A 3MFGB 5C0AA 1HHKB 2VLME 5LNEA 1BZQK 1T5WA 2AXWA 1T83A 5F6HJ 4NO3A 1E27B 1IL1B 1G6RB 2W8CA 4RZCB 4WY7L 3BZFB 1KPRB 1X5IA 1I82A 2ICWI 4L9LB 1OAQH 4LKCA 1N67A 3VNZA 4U1LB 4G1EB 1ZGLB 1D7CA 2VR3A 4LGPB 3EF7A 15C8H 3O45B 3TT3H 2BPBA 2DIEA 3HG3A 1EANA 1M7UA 1E9OB 4PJ9C 4HGWB 4Y19D 5JZ7D 4ONGL 5DJXB 5A16B 1P4BH 2OZNA 1EFXB 4ZSOE 1RZQA 2UZXB 4M6AA 3E3QC 4ODWB 3NIGF 3CFUA 3MRLA 4O2EB 3RWCB 5DJ2B 1BW8A 3Q43A 3U1SL 5EH1A 3UC2A 3Q7JA 3FO2B 2P8LA 3NJMA 3F7VB 4GO8A 2WY3B 1KCVL 3HS0B 5AAWA 1LILA 2WLMA 1KTKE 3D0VA 1BMWA 5JHLL 2IV9A 4NQEE 3WYRA 2NNAB 3T8XA 4JLRB 4NUJB 1KIPA 4TTDC 1CGXA 1CGTA 3SKNB 1QBLH 3MRCA 1X7QA 5E8NB 5HI3D 4U6TA 4PRHE 2CUHA 1KPUA 5GGTL 4B9YA 3O9WA 4G9FA 3LIZA 5IQLA 3S3DB 3UBHA 1A1NA 3MR9A 3R19A 4GG8A 1XD1A 1J5DA 2BVEA 2AEPH 1FL6A 1KNOB 2W65B 1A14H 3WFZA 4B97A 4MX7B 4F3FB 5C6PB 1A1MA 5I1KL 5MERA 1EA9C 5DSCB 4K15A 2IQAA 3MNZA 3W39A 5KJ7E 4UM8B 3EFOB 1K5NB 3GIVB 1AIZA 4ELMA 3ZL4H 4GMSL 1DVXA 3OXRA 1KWKA 3ZE1F 1CGVA 2L0DA 4D0DA 4FNSA 4M4PA 3G5VA 3KWWA 1OP5H 3U36B 2FQFA 1VFAB 1WAPA 4HKJA 1S8DA 4PCYA 5L7XH 1J0HA 3LV3A 1E40A 1SGKA 4D9QE 4YHYC 3R0NA 2H45A 4YUEL 3NAAL 1RZIB 3WIIL 2W07A 3LRSB 4HBCH 1QPXA 2JCCA 4G7YH 4NQSA 2VUKA 5IB1A 3EJPA 3DRTB 4A37A 2RD0A 3QFJA 5E99L 3T3PB 2PXYA 5FFOA 3W1ZA 3NCWA 4HWZA 3TIEA 5J3HD 2VJ0A 5KUMA 4YDIL 3L4ZA 2DWDB 2BRQA 3LKQA 2QSQA 2KL6A 5CCKL 3FS9A 3CN4A 4XOAA 2KUTA 1VA9A 5JYLA 43C9A 1DR9A 3MUHL 1UACL 1C5DB 2QHLA 3VRLE 1ZKAA 5AZEL 1PZCA 1SXZA 1RUAL 3PL6D 3HKFA 7FABL 1JERA 4F8TA 1HSAA 1TZGH 3LOWA 4KUCF 3O6KH 1M56B 4Y0GA 2V0AA 3BVNA 2XTSA 1Q9OA 4ERSL 1EXGA 4OLXH 1FNGA 2FO4B 3CVHA 4HXAL 3K81A 4ONHA 4JUTA 2IO5A 2AAVA 2CXGA 2VDRL 3AWGA 1TTGA 2A77L 3FQ1A 4IMLB 5TF1H 2YO3A 3S98A 2ITEA 1BVLB 2QPSA 4ZFZB 4G8GA 4LDLB 3WS3B 4DQOH 1P84J 4MD0A 3VXMD 5T1KD 1F4WH 3SCMD 2BC4A 1QHPA 4GPVA 4UNIA 2RGSA 3KHOA 5JW4M 4DKAA 4J3OF 1FNLA 1ZDSA 4TPRH 2X7LA 4XGZA 4HMDA 1JPGA 4XP5L 5GJTL 6CGTA 5IR1B 1MWAA 3DUSB 3V8CA 4NQDE 2XN2A 2VDLH 2X4TB 1G6RL 5BXFA 3BSGA 5AB0A 2YBGA 4J1UA 5BUPA 4P5TD 1ZANL 3DX2A 4P46A 4I0KA 1EXHA 1FNSH 2BCKB 3BSZL 3I9IA 3ARXA 5I18H 4GKNB 4PIBA 2NUTB 5IJBC 2YPVA 5GRVK 2HPOA 5F3BA 1LP9A 1UYWH 4GP4B 5F1IB 2XQBL 4B7LA 5D71L 2ICWA 4LRNL 2FX8H 4Y2DA 4JKLA 2XZAL 5B1JA 2C34A 4XVOA 1VGEH 3RDJA 3A6CL 4MA7L 3B56A 1HEHC 2C3GA 2VR6A 5IESH 3OHMB 2FQDA 3M07A 3ZT5A 3CDGA 2AJSH 4XN2A 4Z0BL 4YXLL 5IQ9B 2E0PA 2NLJB 3MBXL 3QAZB 4AQEB 1YRKA 4KKQA 1G7PA 3ABKB 3ES6A 1N18A 1LQBC 4D8OA 3S8GB 1MRCH 1L9MA 2FBOJ 4PVLA 4WCYH 3LD8B 3I50L 3NA9L 4TMPA 5D70H 2MQ0A 1S5IL 3P0VH 1VEOA 3OKMB 1NCTA 4HSAC 1WFJA 3BAKA 1DBMH 1BZ8A 4JDVB 4L8CB 3JWDC 1FNAA 1DVYA 2XKNA 3EBAA 2J73A 1BZ7A 3LNDA 2VLJA 2PF6A 3IYLW 3VCLA 4ZFQA 4AKQA 1SJHB 1OGAD 4PG9B 3D34A 4L8BA 3RX9A 3IJYA 5SWZA 1AZRA 1M53A 3CMOL 4GKZB 4E9YA 1IGTA 1OSZA 4MB1A 5DHMC 4DTGH 2EXWD 1QSFA 4XCNA 5BS0D 1YMME 4K94L 2C5DC 5IG7A 1A6PA 5FCUH 1MI5B 3TH4T 2E7CA 4WUUD 3V0WH 1OAKH 3H8NA 3QDME 4F7CA 4QXUH 4MCZA 4NB7A 1OLLA 3HVNA 1V27A 3ZYIA 3I6KA 4WFGE 4WWOA 3FFCE 4Y16D 2JV6A 2FZ3B 2EXYC 1NMCB 5KYNA 4WUKH 1MPAL 2HFTA 3X11A 4N2CA 3DIDA 1CFQA 5E00B 1BFVH 1QRNB 1OAXL 4L1HA 5I0WA 4X99A 5F3HA 2CO7B 5LVEA 3QYMA 2YXMA 4JY5H 2A4CA 2Y3AA 2IDQA 3GWJA 3HC4L 3QJFB 4OJYA 2XIIA 1JPTH 4IRSC 2OSLB 1YJDC 1IC4L 3STZA 4WW2A 3FQ2A 5E2WL 4UQEA 1VPOL 3PNWB 5TDOB 5JORB 4P23A 4FLQA 3TA3B 5INCA 2JLPA 2ESVD 2D03H 5F72S 3B37A 2F58L 5KS9A 2G9KA 2FIRT 4U1HB 1KGCE 3NOIA 2YD1A 1M7IB 1R17A 4C56D 1S7RA 1EZVY 3OHXB 2D7TH 2OMTA 4BDVB 1F13A 1DVFD 3ZE0F 1HHGA 3GSXA 4J3BA 5AYTA 4EUPG 4HXBL 4PMEA 3P4LA 4RFEA 3P77A 2XVLA 4L29A 43CAA 2RCSL 3UTZA 1RZFL 2P5WE 5IW1A 5IJVA 2A74C 1BFTA 2FWUA 4I48B 3KPQB 5E08H 4AL8L 2P5PA 1XIWA 3RVVC 1A3LH 1MQKL 4JGUA 2VIRB 1I1AB 1UT1A 4NRXA 3AMKA 4OV5A 2ENPA 4K3GA 4KOCA 4FQXC 3UPCA 2ZNXA 2GKIA 2F8IA 1HXYA 1TJIH 5C3IA 1AR1C 1E30A 1GAFH 1JGEA 3TXAA 1RSYA 2Y5QA 5BUAA 3DOSB 1JZDC 2JKXA 2K3TA 1U8CA 4RMSA 2JH2A 2VERA 5C07B 3ZE2B 3UO8B 4M8RA 3GMRB 4EEEA 5DQJB 5C0GB 1K9TA 3QRBA 4JZJB 1CD1A 1WUNT 4L4VB 4N8PA 3KCPB 4KUZH 3VVVA 1MIMH 2WN3A 3RWDB 5C0RH 2ZX8A 2BZ7A 3VNYA 1GIGH 4QRTB 5I1AA 3HBQA 3CV5A 2AJXH 1Y6MR 2HX8A 5EN2A 1CF8H 1CVRA 3PJSB 1D5RA 4GW5B 5HYFA 4JG5A 4P06A 1ZY9A 4F8LA 1A7NH 5JIPA 3CU7A 1MW0A 1TF4A 1DQDL 1TJGH 2W60B 5A2IH 1CR9L 3EYSL 1XGRA 1AMYA 1P5UB 1BCIA 1QBAA 2RTTA 3JWNG 3K4DA 4NO0D 4HISA 1TVBA 5CD3B 5GRZA 1ZLWK 3MV8D 4YXKL 1ZXKA 3H1ZA 1DDHB 1G7MA 4F58L 1QSED 2V9QA 3C60D 2UZIL 1I7TB 5TJWK 3N9GL 2GUYA 1M6OB 4RLDA 1OGTA 1L9TA 1LO4H 1OP4A 3QUGA 2ZD0A 3LKSA 1BF8A 2APBA 3SPVB 2H5UA 2ZOWA 3CH1B 3O2VL 1KXTB 4WFHE 2YQGA 3H3PL 1OCRB 1PG7L 5CP7B 2P7TB 1FF5A 4XZUA 3FTXA 3ZYZA 3QQNA 4DW2H 4NO5A 3T0EB 1ED3A 3VGFA 2XV2A 4NM4L 1N7MH 1CUOA 2BIMA 2FX7L 4ZXBA 5HHXL 1RI8A 5L9DH 3IE4A 1CLOH 3LPOA 1F02I 2B2XH 2JQZA 4ZFGH 1E4KA 2DI7A 4FQ2L 3QUZD 3WO4C 1YNTA 1OCWL 1QASA 3QNXB 4HJEA 4LVNC 1V05A 4NO2A 1OF0A 4KTDL 4R5XA 4IRJB 3Q1SL 5IVXB 3O6ML 4UBDD 32C2A 1RUKL 1XCQB 3QHTC 2PLTA 3JTBA 3RLSA 3IB4A 4XBPB 1KCUH 3RE0A 4NEHB 1YDPB 4X7FC 3UDWA 4M43L 3WEAA 2LLNA 3BRGC 2JI1A 3TCLB 3I75A 4LPVA 5ISZD 2CO2A 4AKPA 5EF3A 1BXUA 1ORQA 4FKEA 5JZ7C 4PRAA 1QEWB 2KZBA 4FYSA 5FCSH 3S3PA 1KBKA 3AVEA 2EDDA 4XP9H 4FTVE 1J5IA 2WUCL 3Q2LA 9CGTA 5ICXB 2FEEI 2DJSA 1QMUA 4UCFA 35C8H 5J7CC 3BT2H 3HNTH 4XVSL 5BZWA 3VFOB 2JFCA 1F4AA 2DLGA 4R96B 2CCLA 3EXLA 1QABA 4K07A 3S4SA 2CA4A 5D4HA 4Y4KA 1ESOA 4NYLA 2VT0A 5HI3C 4HALA 4S1QH 3SBPA 2C9XA 1BVNT 2VH5H 5E94B 2YKLH 4YSEA 2E75C 4YHLH 4G7VH 5ETUA 3D51A 4CC4A 5J9PA 1IO4C 3KPRA 1I8AA 1NCUA 3H9SA 1KB5B 5J11C 2NSQA 1FZJA 4MXVF 2P24A 5LJYH 2ZYHA 3FH7A 3AY4A 4H8WL 1T22B 3QEQE 1AZCA 1EAPB 1GHFL 5E2TL 4EZJA 3CXHK 4JFQB 4PS4H 4QO1B 4EO5A 3T4YA 2AQ2A 3QJUB 4LAQH 1XDTT 3O11A 3WN5A 3DHPA 1PS3A 3IWUA 5JNYB 3I2CL 3OKKB 5DJZB 4GSDL 3VB8A 2PNDA 1Q90A 1CDCA 2JTDA 4LP4A 5L88L 4ELMF 1I85A 2BOBB 2VXQH 1NPUA 4P2QB 4LOUD 4G70B 2BDNH 5DUPL 4JREC 2IPTL 5C0BB 4BZ2A 2Y06L 3IVKA 4ZX6A 5EBMA 1WFUA 3S8FB 5ADPL 4AEHL 5IF0A 1CJYA 2DQIL 4K9JA 3JWDH 4GMTH 3DTXA 3L3JA 2Q7YA 4KI5F 3FOLB 1NCWL 1V7MH 4LZKA 4N0YH 3LZFH 3SPGA 5HYEA 2C9RA 4QJ3B 5F88B 5F0LB 3RTQB 2WTOA 2GK2A 4LPTA 5J3HC 2AK4D 3KYKH 4S1RH 4E42A 4N0UA 2E5EA 1A7QH 1QWHA 4TSCH 1UVQB 3AB0B 1ANUA 3HTLX 4Q9CA 1KCBA 1LD9B 1JZFA 3IN2A 1ZPLA 4RGNC 4ANVA 1MCOL 3EHBB 4OFYA 4Y5YA 4LL9A 4BQ9A 4LHUB 4R7NA 4N2IA 4ABUA 1BSIA 3X14A 1G7LA 5DRXA 1KDJA 3PL6C 3HZYB 4XAWH 1WVZA 1CYXA 2DQ6A 3FU3A 1MCBA 4JG9A 4ANXA 2A9NL 3GIZL 3HN8A 3VFMB 3GNML 1D5XB 2VDLB 1YN7A 5DJ0B 2JIXA 2DW5A 3WL9B 3H85A 2DEWX 1QNIA 5CJXC 5AVVB 3S35H 3GB7A 1H0DB 4X80H 3V52L 4XCCH 3KR3L 5IKCB 3VI4B 1OQOA 3M1BA 4FFZH 1U42A 2BSBA 1GJIA 2EVHA 1AY1L 1NJ9B 1L9SA 4A67A 4FZEL 1ID5I 1EJOH 2Y7SA 3WIFB 3EUDA 3L5WB 3FB7B 2VO5A 3SCMC 1ZLDA 1JZ2A 1UKSA 3T0DA 2YOCA 1U8LA 1UGKA 3LEVH 2BVPB 5GGRB 3LQZB 4UIMB 3D3VB 3MUGA 4WHCA 3ARDB 3BUQA 2X53A 3NACL 3NK3A 3V0VB 3HUJE 4IDJH 3HNVL 3C6LD 5IBUB 4P5TC 3ERXA 4ZQKB 2P4AB 1NCJA 4X9YA 1QD0A 3ZDXB 3PHQA 3K8LA 4Y1AB 4WI3A 1YEDB 2F9BT 5C0CD 2WSKA 3FQNB 1WCQA 2PO6D 1Z5YD 3PJNA 3PWNB 5D1QA 2OI9C 1BQLH 2AQ3A 4XN7A 1LP9F 2H9GB 4HDIA 5BVPH 3JV6B 1CWVA 4E9LA 1NCHA 4NQEA 5E4EB 1XF3B 2AEPL 3VMPA 4Y4HB 2R0KL 2FD6L 5FOBB 4PSRA 4XWGH 2YK1H 4PBDA 4GSUA 4HCFA 4UAOC 5ADOH 3AT8A 1PLGH 2OL3A 4L8SB 2B59B 2YPLE 2Y2TA 3CFNA 3QH3A 4E5XA 4E36A 1FIGH 2CXKA 5IOKA 4S2SB 2IGFL 5KJRH 1J8HE 1DJHA 2GJRA 3G3LA 5L7XL 4OZIA 4J2QA 4LSTL 4JPVH 4KI1A 4AIZA 3VFGL 4S0TD 1U3HA 1EX0A 4ZO7A 1KB5L 1NANH 5D4JA 1W8NA 2CIKB 1HT6A 1TNMA 5ID0A 3TM6A 3KYOA 2NY6D 4GXVL 4APQC 3ARUA 3EZ8A 4N0RA 5ICYA 2M26A 2A6DA 3ZL1A 3BGFC 4IKLA 5FUOH 1CF1A 5H4ZA 2A5UA 5BVJB 1I8KB 3BVDB 4YFLF 1DBBL 2EXWC 2N7BA 2CRIA 2NW2B 3KPPB 4G1MA 5BRZB 1E28B 3GJEB 4XMUA 5L8KB 4W4OC 1ZTMA 1A5FL 3WEMA 5DHYA 1ZS8B 1JV2A 1MDAA 3JXAA 2WP3T 3ZE2E 1WAAE 4CADA 2Q86B 1S7TA 1BM3H 3B5TA 4JDEB 5D1ZI 3ZZSA 3MUJA 4L4VE 4YDJA 3HC3L 3O81A 4G8FB 1RUPH 3S8WA 3QUKB 4JFYB 4OCMC 4NNPL 4KXCA 3O6KL 3JBG7 4X7EC 2CRYA 1JHLH 4YE0A 3Q6GH 3RB5A 1L9NA 4OLXL 1IBDA 2FGZA 2BP8A 4NJ9H 2YBRB 2G4GA 4PREA 1HZKA 3PU7A 5KZCB 4XXCA 4M48L 4GQ9H 5E8DH 1GA2A 1SN5A 3B1UA 3DPBB 4HS8L 4LSDA 1PY9A 3MA7A 3RWIA 5C8JB 4MYPA 1SY6A 4UTAA 5DZLA 3QI9B 4DQOL 3L3KB 3QDGD 4XBGB 5C0EB 3TFKD 5LN4A 1IGFH 3CPLA 4ZUVB 5T5FL 4UV7H 4MYWB 3NSDA 4F37K 3ZTEA 4WSKA 1NFDE 4NERA 5T3XD 1KJ2A 3WFHA 2FAUA 1DVFC 5FA3B 2Q3XA 1CK0H 3I3BA 4QJ5B 3MRKA 3L3HA 3VFNA 2XA3A 3T77B 2ZUYA 2EDMA 1ZLVH 1GKEA 3G6AB 4YL4A 3D48R 5FUZH 3T0EE 3NJHA 2P26A 1TQBC 1M57B 3MXWL 4BYHA 1UYWL 3S3CB 5F8RC 5HD8D 1NGXB 4CSTA 3FOMB 3O3EB 1MHHB 3FT0A 4NQDA 5I1CL 3C5SB 5D7LE 1QI5A 3U1PA 1MW1A 3BQVA 1ZTXL 4ZMWA 1O0VA 3QO1B 2BZDA 2ZXWB 4OIFA 2HRHA 3VG9B 3D2UB 3WKNA 5IVXE 2EZ0D 1YYCA 1TFPA 3PWLA 2H3KA 4YHNA 3GEFA 3BAEL 1QX1A 1P5VA 4K9EL 4AC2A 3GMPA 3ATDA 3QRGL 3ZDWA 1K2DA 1WK0A 1AH1A 2X4NA 4LASL 4XNAA 3N43B 3O4OC 5FDYA 3TH3T 3UC0L 2FTAA 4BBWA 4I18A 4HVBA 1WSST 5F7UA 1MRCL 4FNTA 4CC0A 1D6VH 1KYDA 1ND0B 1T5XA 5ITBL 1ROWA 4RIRA 4UUJB 3QHZH 5JHLA 1MCCA 1DBML 1V3KA 1YEIL 1BEYH 1A6AA 1ZE3H 4XMXA 5DK0B 2AF2A 4JM4L 1XGUA 2IAMB 5HHNA 5DZ9A 3HRZC 2WMPA 5I0DA 2QQNL 5AZ2H 1U6AL 3O4LD 4Z7QB 2DS4A 1NBYB 3LNGA 5GGTA 4P3CL 1ZGLP 3ATAA 3F5WA 3T3MB 2W80C 3MRRA 4ZAKB 2PWFA 3C60C 4ZZFA 5IHWA 2HMID 4DJMA 4L2YA 4UM9A 4UT6H 1OGSA 2Z91B 3BISA 4A7GA 4BQCA 3T65B 5HVHB 4IKNA 4W93A 2FSDA 1K6QH 2VMDA 4HUUB 5IQOA 2Z92A 2ED7A 2DQHH 4FLRA 3V6OE 4X4ME 2APXA 3MRDA 3IS1X 3ISWA 4EI5B 3EBHA 1WZMA 4WFED 4G5ZH 3KJ4C 3PV6A 5GIRA 1PKQE 3TEYA 3LYRA 2VDQL 4JDTL 1X7TA 5IEKA 1B2WH 3A67H 5DRZB 5GS3A 4KROD 2J4WH 3ABGA 2E27L 1YMMA 4ACTA 2B5IC 3HJ0A 4HHGA 4AH2A 3H7LA 3NRPA 4EKXA 3QUZC 3U6RA 3VFTB 3F05A 4DEUA 4QF1A 5EEVA 4Y9EA 5KW9H 4OUUA 1DSFL 2BRRH 4JY5L 2A6JB 3QDMA 4H2AA 2IWEA 4TULL 4R5TA 1YNTF 5B1CA 3VXQB 1FVDB 1AZNA 3FFCA 4UBDC 5DJAA 3RVUD 1TSRA 2X4RA 1NPJA 1N2RA 2R4SH 2G2RB 4UF7C 5C0BE 3ROLB 5HPMA 1IEBA 5HHPA 4D0BA 4QRSA 2J2ZA 1KJVA 4XCFH 2GK0A 3ARVA 2CPUA 4OT1H 4GUPB 4GIAA 3IEAA 4YDKH 5DVMA 2BERA 1RU9H 4MMXC 4OLWL 4Z3GA 4HJGB 1HCFX 2H1PH 2VLKA 4HIIA 4QRPE 1C16B 5BOJA 5K9QI 4HZLA 5D1ZA 4TNVK 2YD0A 4Z7UB 4GLRH 5KYWA 2ZOKB 5DR5H 3MRJA 4AGMA 3IGAA 3ARBD 1MRFL 1T0PB 2DMBA 5MEPB 5I8KH 3LN4A 3LZPA 2R8SH 2EDEA 2X2IA 3PGFH 3PQYD 3KGTA 4X8CA 2DJ4A 2LFGA 1H6TA 1CFVH 1JGVH 2YQ3A 3QXUA 3B2MA 4LARL 2G3ZA 1RZGA 1XQ4A 3MJ7B 1WCBA 2IH8A 4KO6A 2PTUA 1F3DJ 2DI8A 4YHOL 3MNWB 4Y8AA 2AQTA 1U8IA 3VWKA 1ZLSL 3SN6N 2NY1D 4UT7L 2YPKA 5EHFA 2UWEB 3U30C 3Q6FA 3SKOA 3WCYA 3MLWL 3QR0A 2Z1KA 3D4CA 3LEXA 4MA1B 2VN6A 1JF5A 2LQRA 1OF2A 3MLTA 4CDHA 5JOFB 1WH0A 1GIGL 1R3IH 2BP3A 3MBWB 1S5HB 3CZEA 4HFUH 1N8OE 1N3NB 4ZS6C 1TO4A 4L9LA 4CMMB 5CCJA 3EGDA 4G1EA 3GBNL 3BE1H 5J12C 1ZGLA 3MREB 4L48A 3ILQC 4LOUC 4I77H 5DJDB 1LK3H 4B5EA 4JMNA 3NEOA 4HGWA 2GEQA 2G60H 4FXLA 4R6UA 5AW4B 3TVMA 3BKML 5JIHA 2VOTA 1FZOB 3TO4B 1P9MC 1EFXA 4MDRA 2UZXA 4ODWA 4DP6X 3P54A 2ZUQC 2LW3A 3P3UA 5DJ2A 3ZTCC 1U8JB 3ENEA 2J21A 3E80A 3S97C 1AI1L 1I8UA 3MZTA 3F7VA 3NIDF 5T1LB 2Q1EA 3HS0A 4JDZB 2AJVL 2PYEB 3LRKA 4RFOL 4LPCA 1DZ0A 4GH7B 1AXTH 5IHUH 1DEEA 1RCYA 2ADFH 5C0IB 4BM7A 1QPKA 3GK8L 1CLOL 4PLOB 1ACYL 1QA9B 3SGJC 4MNGB 3L3IB 4ZFGL 3OAUH 2J88H 3N91A 3U7WH 3SOTA 1IGMH 3P11L 2FYYA 1DO6A 2IAAC 5DLML 3WHXB 4DKEH 5C0JA 3O8XB 4K8RD 3WFBH 2HH0L 4JM2B 4ODUA 4E0RB 4LVOB 4FQHB 4MS8D 3RZWA 4KXAA 3UFIA 1QACA 5B8CC 3OGCB 1L0XA 3IJEA 1HE8A 1EO5A 5DMGD 1BA9A 1Q9WB 5GQBA 3O0RH 4GIOA 3O6LH 4UMSA 3ZL2A 4G7QB 3OPUA 5EU6D 4UM8A 3EFOA 3GIVA 1BECA 4AZ8B 3FO1B 4JJ5A 2CUAA 4OUOA 3MRQA 2WZAA 1MNNA 1AMXA 1GCFA 3CG8A 3DHMA 4M7JL 4WNQA 4DGIL 2WSPA 3Q48A 4NT6A 2FO1A 1VFAA 1KCSH 4OCSH 1QUNB 1XGYL 3ZTDC 1MHCA 1RZJC 2G5UA 5HGDB 3H6JA 4X6CB 4YK4C 1T7XA 5DVNA 3BKYH 3I9GL 3C6LC 3BWAB 2X9ZA 3T2NL 3DRTA 4FS0A 2ATPB 2XJLA 4FD0A 3BYTA 2GY5A 4ELKB 3SGKA 4AQ1C 2FUQA 1RZ7H 4HIEB 4PBVC 2AC0A 3HG5A 2VH5L 4S1SH 1GOGA 3B2PA 2YKLL 2Q76B 4MQ7B 4PJFE 3UZVA 4DETA 2A6KA 2XFXB 2DWDA 3Q8CA 1YPZE 2ZAHA 3VXPA 4XHJD 2BIQA 4ATWA 5I1EH 1JXJA 3U2IA 4Q6YA 1OL0A 1KY6A 1ZSHA 1OCCB 2WXIA 4BFGA 4B60A 3QRFM 1IFHH 1D5IH 4G5AA 5EDSA 2N1TE 1QBMH 3GKZA 5CFHA 5K39A 4JE0A 2E3VA 2YLKA 2A4EA 3OKDB 5HI4D 3EO0B 3SYCA 4LAQL 4HG4J 4PJ8B 3CHOA 1NUGA 5EMYA 1Z9LA 2FO4A 1D2PA 4YQXH 2XY2A 4KQ4L 3ZKSD 4HEME 4Q9QH 1ZHKB 1TVDA 3QEQA 1BVLA 4LSVH 3GLAA 4ZFZA 2V2WB 2WXQA 4JANB 1KLGA 1RIHH 1LO0L 3VQLA 4BSWB 5A7BA 2O6CA 4GMTL 2NY6C 4U4IA 3FMGL 2OP4L 3MRGB 5AAMC 1GZHC 2WNWA 4H1LH 2EYRB 2QADD 1PBYA 4PJAB 2OSYA 4M7LT 4YL9A 4XPFH 4HX1B 2GSIB 4FCHA 1AHWC 1W8OA 3WEXA 3SE4C 4GAJL 1GGYA 4F37F 4YR6B 2BCKA 2Z93B 1DN0A 3GI9H 1YUKB 2NX5D 4GKNA 2GJ6E 1U95B 2OK0L 4JFPB 3KL5A 3V9EA 4YHZH 4F7EB 3N85H 1IC7H 3HHSB 1RMFH 2CO3A 3CC1A 4OD2B 4MAYA 4YDLB 5KAQF 2CO6A 4JPWH 3VYPA 3KPSD 3DPDA 1CLCA 4MD5A 1TPXB 4Y88A 2K4AA 5I75B 3Q06A 1DQTA 4G42B 5ANME 3DMMB 2WUBH 2CLZB 3QWRA 1EXUB 5CS7A 4EN3D 2NLJA 3EYQD 4GQQA 4JFFE 4AQEA 3CIAA 1TQSA 4OGYH 2QQLH 3VXNB 1RKRA 1EJOL 2MNJB 2WD0A 4J8RB 4PJ5B 3TFKC 4LBEB 3ULVD 4NWUL 4LCWD 1KXQE 3ELQA 2Y07H 2NZ9C 4DN4H 4PJGB 4G71B 4JVWA 2Z0UA 1U92B 2XN9E 3O3AB 5CGYC 5I9QB 4Q6IB 3TNMA 4N3TA 3VH8A 4R3SA 1FAIH 3ARFD 4IRZH 4GW4B 4MMZA 4F1SA 3LEVL 3KVQA 4JDVA 1OK0A 5ABAA 4FXKB 4X8XA 5TGBB 3AQYA 3LHPL 3LTVA 4IDJL 3U9PL 2N4IA 4XO5A 1WBXB 4G8EB 3S35X 4R97B 3OJDB 4LLQB 1SJHA 4YX2L 5FYLD 3OAZK 4TVPH 4A7TA 1X5AA 5D5MF 4XCEA 1D7FA 4Z7NE 1H5BB 1A4JB 1HQRB 5E6UB 2WXOA 4Q0XH 2VW6A 3CN3A 5HD8C 1N8ZA 3DX6B 3OG4B 3WKML 4RGMC 1BQLL 1HSBB 1N0LA 2IDUA 3HUJA 4X5LA 3SDDA 3UMTA 5EPMB 1EV2E 4P2RD 2W9EH 2LGNA 3ETSA 2DAVA 2EZ0C 2OKMA 4P57B 2XG5B 3A21A 4TL5A 1ZRUA 4HWBL 4NIYE 4MAUL 1MKFA 3QWOB 2LVCA 1PLGL 4BRVA 1I4FB 2J5LB 3D0LA 5JIQA 1VZIA 3QUMA 2BSTB 1QRNA 3QEUA 1BAFL 1GC1C 5IVNA 3EYUH 4XPHH 2NYYC 3AQZA 3FUHA 5B22A 2I07A 1MREL 3A4FA 1NLDH 2VCOA 1KCRH 3BLKA 3HAEH 1FL3A 5ALCL 1QFHA 3V7AE 3PNWA 5TDOA 4JR9H 5JORA 1BQHB 1S7QB 2R1YB 1YLBB 2YPLA 4G8IB 4RGNB 2X41A 1RIUH 2MEJB 4AMWA 2IGTA 2PW2B 3OTTA 2GJZB 5TE6L 1K4CA 1EO8L 1J8HA 1CGSH 2FLBT 2HMIC 2DTMH 3GM0A 4Y5VB 4NRZB 2HWZH 3MV7D 4TL4A 2CHZA 5F6IC 4A7GF 3KPQA 2N7SA 5DFTA 3L4VA 1UA3A 4ODXB 2ICEA 1LWJA 3PAVA 3FN0H 4HIJA 2IANE 4NCC1 1L9QA 4NPJA 5KEZA 1BM3L 4OJFL 4OZFB 2VQTA 1AKJB 5GRYA 4TNVF 1QTPA 2F1EA 2JB6B 3B2UD 4NHUB 3BAIA 2QSCL 5DD5H 4KROC 3UBXB 4B9KC 4QXGH 1ZVSB 5DD1H 4QT5A 3W9EB 2HKHL 1L9OA 3ARRA 3Q6GL 4B9JA 2GFBB 2X0UA 3QIUD 4UTBH 1MHPH 1WAAA 2BOCA 2JKJA 3GS4A 4U1MB 5DQJA 5B39B 2BFGA 1WFNA 4GQ9L 4L4VA 4B27A 4FA7B 5LXVA 4XN1A 5EF0A 2F1BA 3KCPA 2CALA 4ZFOL 4XMPH 1RJLB 3MO1A 1ADWA 5BZXA 4S0HA 4QRTA 1IE4A 4JPKL 3VFRB 1OSYA 2IG2H 4GAYB 2WO2B 1XR9A 3M17B 1ZHNB 3QW9A 4UQIM 3PJSA 2Q3AA 1YEWA 1EJFA 5IMOA 5GSRB 5FEBA 4M5ZH 3SYPA 4RAVB 3BZ4A 3VW3H 2P46B 5CD3A 3UXFA 3ARBC 1MELA 1PIGA 5A2JH 1DDHA 2WQVA 2ZKYA 5JPMC 4MJIB 4W9ZA 1QI3A 1N64L 2OZ4H 4E41B 1MIEL 1NFDA 1NUDA 1M6OA 3G5WA 1M2VB 5F7KC 3KBFA 5HJGA 3HMXH 1JHTB 3CFCL 3CH1A 3D06A 1OPGH 3HZMA 2OLDA 4TQPA 5HDQH 4H88L 2VYRE 5TE7L 2IDSA 5CP7A 2P7TA 3GI8L 4OCWL 2QVFB 2NSMA 3BUYA 3A6BL 3T6QC 3T0EA 3DX9B 4AXWB 1KBGL 1A9EB 4OF3A 1NQBA 2NY1C 4G9FD 4JX0A 4FA8A 3NRQA 1DBKH 1FWXA 4TS6A 1KYAA 2KDGA 4RA0C 4PRNB 1D7DA 2A1WH 3CSYB 4NBXB 4APQB 3GXMA 1WD9A 5D7LA 2O6DA 5KBKA 4HUNB 1SYSB 3G6JB 3FUEA 2LVEA 5IVXA 4R26H 5IT2H 2MIZA 4HUVB 3QIWD 4EIUA 2XT1B 1XFPA 4LKXA 3JSSA 2EDWA 4XBPA 4L2LA 2LT9A 3CDZB 4P99A 4X6CE 2Z34A 3SYAA 1YDPA 3CXFA 3KXFB 1UM6L 5J13B 2HVBA 4Z23A 4OLYH 2YAHA 4MNHB 3GM8A 5D7JB 4WF7A 4K7PY 1KF9B 1M7XA 4Q2ZA 4WO4A 5TF0A 5DS8A 5H2BB 3L3OC 3MGOA 3DNKA 4XMKH 4UT6L 2AGJL 4B6ZA 2ZUWA 3U0PB 4AYBA 4GFXA 3QIBA 1Z9NA 4ADGA 1D5MB 3MNVB 1W0VB 5ICXA 4EQ3A 1II4E 2DQHL 4FQJH 4PY8I 1FGNL 3V8OA 3C08H 3DSFL 4BINA 3VFOA 4G5ZL 2PXYD 3G04B 3NZSA 5F9JB 3ZGIA 4Q8BA 4YO0A 2ZCLL 2YXVA 3ARGD 3NJGA 2NXZB 2FX9H 2W81C 1W8EA 3T1WA 4Z8FH 3MRFA 2R0WH 4A2FA 4KVNH 3EJZD 3G5ZB 3V6OA 4X4MA 4K8RC 1SHSA 1T80A 4MS8C 2JSFA 3AG4B 1T22A 2Y6TE 3AUWB 4Z7WB 3Q3GB 5LGJB 2YZ1A 4DAGH 2GEEA 1H9DA 3PAUA 5DMGC 4W70A 1YO4A 2PCXA 3T1FB 5JQIB 4OM1H 1KTLB 4JFDB 2F5AL 3OKKA 3KM1A 5AWNH 3SYQA 1RIVL 4Z77B 3PE9A 3HR5A 1UCBL 4ODTH 1E9QB 4YDKL 3TWCL 1B3IA 1RU9L 3GRGA 2DLTA 4B5ZA 4YDVB 1FRGH 4XB7A 1X5YA 5AL0A 4BKTC 3BD5A 1VZGA 2B7DT 1VCBC 5C0BA 4N0FB 1MFEL 3B9DA 3Q2NA 5T3XH 1V55B 3UCQA 1G5GA 5FYJH 5IBTL 4XMVA 4UU9B 3FOLA 2V17H 3B5GA 4MQXD 4R90H 3ZJAA 3TEZA 2JKLA 1I9IL 1NC2B 2DYSB 1AYOA 4QRPA 1BLNB 2HYMA 1U30A 1UWFA 2IOOA 4FG0A 4PGZA 1OE3A 3RTQA 2R2CA 4KGLA 1YQVH 2B20A 4KZDL 4IIZA 4A2DA 1HN1A 1CI3M 1PLAA 4JNXA 2YIHA 4XHJC 1LD9A 2APFA 3BCFA 2J43A 4R8WH 4JHWL 2COQA 3WY1A 1KLFB 1MAMH 3OR7B 4K7FB 3QJOA 1U8PA 5T5FA 3LRGA 1Y0LA 5I6NA 3FFDB 5ECJE 4UI2A 1CFSA 4HIHA 3BYYA 3MBEB 4OM0H 2XWTB 1B2YA 2CBTA 2UZPA 3BLPX 3HZYA 3MVSA 4PRIB 2W9DH 3O2DL 3S6CA 5B1BB 1R3IL 2QMKA 5IVZB 2J1XA 3VFMA 3K74B 2X1WL 4LSPH 1NGPH 5DJ0A 5ESVB 5EIIB 2N3JA 5F9OL 3SDCB 1V3LA 3BE1L 1GC1H 2ZXGA 3IAQA 3AABA 4GG6E 3ARYA 4K2UH 2IIJA 1NJ9A 5I1IL 2G60L 3OWEA 2WOBA 5EZLB 3L5WA 1MG3C 3CE1A 1TFHA 3LN5B 3V6ZA 4PB9H 1QFPA 3IFNL 1B0GB 3D6GA 1KYOK 2QADC 1OM3H 5GGRA 3O2WL 4OSUH 4YVNA 3D3VA 4OZHE 5EU3B 4UMGA 5SWZD 3TBVB 3OB0H 2VLRB 1QI4A 4HKBA 3HBZA 3V0VA 5E2UH 1U2HA 5DUJA 5HXMA 1EHLH 5HDOA 3RL2B 4BFIB 4GINA 4KH2A 4ZQKA 5IHUL 5IV2A 5KSAB 4L37A 2ADFL 3DJSA 3SJVE 2WSDA 4HHAB 1DANT 4IHBA 4ILDA 4L0PB 2A9AA 4GUQA 3T04D 2EC9T 3U7WL 4X5RA 5JPNB 4ZW7A 1Q1JH 4DKFH 2HN7B 1C08B 4ECNA 12E8L 3WFBL 3JV6A 4F2MB 1FORL 3IPBA 4DCQB 5D7IE 3BWUF 5LXGH 4JHZA 5TQ2L 2G3NA 4Y4HA 3PWPB 5FOBA 5FWQA 2KZWA 4EN3C 3O6LL 2YD4A 3DO7A 3EYQC 3I3EA 3L13A 3WIAA 3DGCR 3KYAA 3FQTB 3ZGHA 4L8SA 1XXDC 2AQPA 3KPLB 4G6FB 4K3JH 1NM9A 3MYJB 2J1YA 3ULVC 5H37G 3VD9A 4QWWD 4S2SA 4EDXA 1MCIA 3X13B 1EIBA 1SBBA 4P23D 4ZUUA 3QPKA 1MRDH 4HCIA 3ARFC 1SF3A 3P1VA 5TFSH 2B1HL 1KT2A 2LOEA 2JK5B 1WITA 2Y5TA 2E9JA 3NEEA 3PP4H 3VGHA 5IB2A 3MQIA 2K78A 1HEZA 4G6JL 1MAKA 4L3EE 2DKUA 2EO7A 2HUEA 2WW8A 2F7PA 4YDMA 5INDB 5BVJA 4N2BA 1GH7A 1XIWD 1PLBA 1YEFH 3GSNB 5F7MC 5C0ND 2E7HA 4D3CH 2NW2A 5IREA 1USZA 1P1ZB 1QLRA 3RIKA 3MCKB 1RUML 3HAEB 4GB9A 4OZ4B 2EKSA 4N2GA 4PRPD 2NQ3A 4JRYB 1J1XL 1NGQH 2DL2A 1KENH 1QZNA 4ISVA 2HJLB 4IHOB 1EUUA 4M56A 4P5SA 2Q86A 2EDBA 1AQHA 2NY5L 3HUJF 2R2EB 5AKVA 1JUFB 4LLDB 3T0AA 1QBML 4G8FA 4BWUA 2EEAA 4X7SH 5LCVL 5IGXL 3BD4A 4H8VA 3QUKA 5C6TL 3QFGA 3CUPB 2EO9A 4N2FA 2VISA 1VENA 3NCJL 4HPHA 4PJFA 1YPZA 1NSNL 1PFCA 1NMAH 3LDBB 3QXDB 4WV1A 4YQXL 1J1PL 2YBRA 4N3UA 4XNYL 4FC3E 5FM5M 4Q9QL 1DVSA 3RHWK 5AOZA 3SDAA 3U7YH 4JRLA 5FKPB 2F54E 4BQ6A 1VFBB 3DPBA 2HLEB 2YRPA 4LSVL 3V4PB 5FF6B 4EBQH 1AO7B 3DXAD 4OZGB 3WD5L 5CJOL 2AKRA 3QI9A 3LEYH 5L6YH 3P3RA 1GZPB 4XBGA 1WP6A 1GGBL 4FXGC 5E9DB 4AJWA 2CJ3A 3NTCH 1YN6A 4MJIE 3MA9H 4ZUVA 4YHML 3GSOB 2P43B 4B3VA 3W57A 4AQAA 2E86A 3GJFA 4JAMB 4OIBA 1L0PA 3NN8A 3TP4A 3P9LB 2DQEH 2G75B 5D72L 4PMFA 5AVQB 3UH8A 4FXTA 3G6AA 4QXVA 2ZUVA 1E3FA 1L0YA 4PAZA 5KSVB 4BD4A 2WVVB 1KFAL 3PNRB 3QUYB 4LE8A 3NCEB 3BDYL 2F7QA 3T6ZA 1Z5LB 4V2BA 3QQDB 3VD7A 4ZFFB 3B2UC 1NGXA 5DC0A 5EBLA 3N85L 3WU1A 5GSVB 3RNKB 2VDKB 4ZUSB 5AUMA 4ZXBD 1RMFL 1XCTB 2F18A 2BNRB 2A9BA 4NUGL 2F7IA 3KVPA 5D1XB 3RPBA 4BA0A 3V95A 3G6JE 4JPWL 3QO1A 1MVUB 1HH9A 3QIUC 4O9HL 4QHLB 3N1FC 1ZEAH 1LGVA 1UWXH 4JM2C 3VXTB 3DUHA 3NQIA 5AW0B 3ZHFA 1R6VA 2GJ6A 3K7UA 3KAAA 1NC4A 2WUBL 3DURB 4WHYH 3ULSA 1H3XA 2RQ8A 3K5SA 2X3CA 5DK3A 1OTTD 4OGYL 4TNGA 1T83C 2WQSA 1OE1A 2XTJB 1IBGH 2C1PA 2KLSA 4CBZA 3MLSH 1DUZB 4AM0B 1JK8A 5AG8A 2Y07L 2XX0A 3B34A 4KDVA 4F2EA 4DQAA 5HYJD 1IMHC 3FRPB 4LGRB 5D2NE 1EEZA 3F6LA 3U48A 4UUJA 5ANMA 1B0RB 1LE9A 4YLBA 4OFKA 3QCVL 2AJYH 1CDHA 5EEUA 3M7OA 1KV3A 2DWEB 2IAMA 4Z95H 1LQSR 3GSQB 4QR7A 2XTLA 4MJ6B 1H3GA 4GBXA 2VM4A 4HC1L 2WBWB 1TEGA 1WHPA 4QJ4B 2QL1A 1U0QA 4ZAKA 4JO4L 3FTUA 1NCCH 2YUWA 4W4NA 2IDTA 4RMVA 2XY1A 1UGNA 2Z91A 2L4OA 2X6CA 4Q0XL 3NK4A 1FVCB 1A4AA 4ACPA 2C1OA 4N2OA 2AABH 2J6EH 3HLAA 3OLGA 4NP9A 5DMJB 1IQDB 2P8MA 1D9KB 4Y2OB 2ADYA 2V7HB 2BLFA 3I6LD 3VQ1C 2Y7MA 1KTDB 1SLXA 5DRZA 3JWOL 4PJ7B 3F00A 3GRWH 4IBYA 3MV9D 4Z6AT 4IOIA 4S10A 5DC2A 3B7UX 1CLZH 5C92A 4M7ZB 1CBJA 3VFTA 1G7HB 1CLVA 3WXVL 1IBHA 2ADIB 4M4RB 1FVEA 3EYUL 5KBPA 5F1NA 1NCDL 2C4FU 3GSNL 2MWCA 3RZCA 1NLDL 2I9LB 1FVDA 3CD4A 2WXPA 2PW1B 1JDAA 5IVOA 5F9WC 5GS0D 3L5HA 4XO9A 1J0YA 3ZDZB 4ZMTA 4F7PB 2WZ6A 4P5MB 1XAKA 1NANI 3K6NA 3OZ9H 2C9VA 1NIBA 1RIUL 4RBPH 4XO8A 4NN7C 4U31A 5IEHB 4M5YL 4PWIA 3HI1B 4GUPA 4OGZA 1C5BL 3PWUA 3IDIA 4Z7VB 1UA6L 3BP6B 1C16A 1F2QA 4KKLD 4I13B 4L23A 2PCYA 2ZOKA 4PU2A 2ED9A 2HWZL 4KKCC 1RXLA 2G4EA 3EDKA 5F9DC 2Z31B 1X4ZA 2ENJA 2PXYC 2ZJSH 1INQB 3V4PL 2L7UA 1AGFA 3CSFA 4PJIB 1L6ZA 1K5WA 3KL3A 4B9PA 5DD5L 1MZZA 2C8NA 3ARGC 4JFVA 2FR4A 3N55A 3DRQB 2WZPA 2ZOTA 5C09E 2DWTA 4XE5B 2OMUB 3QUXA 5BJTB 3CFTA 5KYYB 5EEYA 3EJZC 4MKMA 1ONQA 3TC9A 2IANA 5FW7A 1LK2A 2GAZA 3C5JB 2R23A 5EEXA 2UWEA 3ZVVA 2VL5A 4Y4FB 3Q8FA 3RFZB 1AGEB 4N8CH 4XMPL 2A7BA 3NSYA 2JIXD 3QEGL 1N0XH 2Q8AH 5JOFA 2ADGA 5EO1B 5G5DB 3E8UL 5B38A 3Q0HA 4NQCE 2XA8L 1P84K 1NIAA 3MSPA 1N3NA 4QRUB 1BDYA 4Q52A 2VDKL 5CM1A 4MXWH 2R39A 4UOZA 5IQMA 5D2LE 3ULVH 1CL7H 2IH1A 5CD5D 2X70A 1MCNA 1IKNA 3VW3L 4G6AD 1MFAH 1S7UB 5IQNA 1NMBH 2IBBA 2Z7WA 4XO3A 1ZPUA 3APMA 1CICD 2QSTA 4YWGH 1E4XH 1X4YA 3UAEA 4FQCL 3E2HC 5JQ6L 2OTPA 2C3XA 4GT0A 4JKWA 3NT0A 1U8JA 4OFVA 1X7SA 2GBVA 4PJXE 3BGAA 1YEEH 2MJWA 2FNBA 5FYLH 2PP9A 3IDNB 3T5WA 3S36L 2R15A 4BFOA 5KSBE 5T1LA 3WTUA 4JDZA 2E56A 2PYEA 2BJML 1E8XA 3MV11 3V4UL 1LVEA 4HQQL 4C4BA 1T4KB 5D1QD 3ZHDA 5JW5B 5EC1A 2D0FA 2HKFH 2A4ZA 2O5ZL 2JKIS 4W9IC 3PWPE 1PU0A 3AG3B 3L7FB 4JY4A 1L5GB 1MVYA 4MNGA 5I5JA 4JL2A 4H20H 4PJDF 1JMZA 3TT1L 1Z3RA 3O8XA 3ULUL 5KWYC 3CGTA 4N26A 1GGCL 4FQHA 5HHOB 1QR1A 1A6WH 5JDSB 4LCUB 4HUKB 4I0PA 1XZ0A 3IN0A 5SWQB 2FHCA 2WTRA 1Q9WA 3IXTB 3NPSC 2Y36H 1DJYA 2W0FB 4G72B 4XB3A 3SO5A 2EDRA 1W15A 2HZHA 4F9PC 4AZ8A 4OLYL 2EYSB 2R29H 2CUMA 2W0LA 4JFOA 4JQXA 1OM9A 1IM9B 1VFMA 5FYKD 3TZVD 1YNKH 3VGGA 4Y7OC 4RQQA 2B1AH 2WKOF 4UQ3A 4QHMA 3GSRB 5IZ7A 4MZRA 3NDZE 5ES4B 1J1OH 2R7EA 4X6CA 3DUUA 3HG1B 4FQJL 4HWBA 4YXHH 5KTEL 1UURA 4P49A 4FADA 4X98A 2FJHB 4H5SA 3BWAA 3ZUCA 1C5CH 3OXSB 1UXSB 4GW1B 4QKTA 3IU3A 1MCFA 4JO2H 3WTWA 5C2UB 3L16A 5D7KD 5EOCH 1VGKB 2ATPA 3FCSB 5AVTB 2XZQL 2P47B 4ELKA 3LKOB 4FQLH 4IIQB 2R2BA 1YEKH 5CBEB 1UKQA 2KQNA 1DBAH 2EE2A 4LGSB 3HIZA 5A2BA 1C9SA 4JFHE 4CKVX 4KXBA 2Q76A 2VE6B 1KCKA 3CLEH 4MQ7A 1ECZA 5EEWA 1XSKA 5MP6H 1QVOA 3N44F 2P48B 4Z7OE 3NIGB 4P48A 3H53A 5BO1H 4C4UA 4F8PA 1WPCA 1KMGA 3KLSA 4G43A 3SHSA 4A2EA 1XL6A 2F53B 4FHJA 1DTUA 3MLVL 2WQXA 2XOTA 2XVKA 4M6MH 1F0LA 4N20A 5CXPA 2UYLA 5T1DH 3UTPE 4YMPA 5JA8B 4FFYA 1ZVHA 4WW2C 4M8QB 3REVA 4ODTL 4WFFD 3LMJH 3OKEB 4QWWC 5I0XA 3UBXI 2H41A 1ZHKA 3H7BB 3NG5A 4P23C 1QEXA 3SKJL 1B0WA 1PD1A 2YSSB 1KJMB 1I1YA 4GLRI 1DJIA 2VAAA 2FJUB 5EZIL 1E4HA 4HHWA 4BSWA 3BZEB 3P30H 5FYJL 1Q0YL 3IJ8A 4R90L 3ZMRA 3CZKA 3MRGA 2SODB 5HDRA 3OBAA 2ZUTA 2B3IA 3QZNA 4PJAA 2DQCH 4IU2A 4W68A 3GD1C 1UENA 4IOSD 1XIWC 2Q7AA 1BOGA 3SQOL 1YQVL 4HX1A 2GSIA 5CNHA 5T3ZL 2FIKB 3EKCA 4A55A 2VUYA 5D1XE 5FK9B 4OBRA 4ZFOA 3LJ3A 2GPZA 3ZE1B 2V5RA 4FFVD 1SOXA 4IBWA 4ZYKA 2Z93A 4RAHA 4XBEL 1IAKB 4TSBH 5I71C 5EO9B 4AYMC 1FH5L 2WYZA 1EO7A 3L4TA 3AMLA 4JFPA 1YY9D 1ES0A 4F7EA 4GOSA 2RQEA 1YHPA 4ODHH 1UD2A 4X6DE 5GXBB 1CLYL 3LIZH 3VD2A 4YGVB 4AENA 4IEFB 4LLWB 4K4KA 4P07A 4JB9H 5T5NG 3UJIH 3DMMA 1HOCA 3L4UA 4H2CA 5FHBH 4AEFA 1EXUA 3OG6B 1FL5A 3NIFE 3MRBB 1U2CA 4K7PL 1UASA 3GHBH 1L7IL 2OR9H 2VO8A 4U6HB 5KYUB 2VR9A 1KSRA 2DL9A 2IPKB 2WM0A 4AQ8A 3WUWB 1U91B 4R5VA 1JGLL 2WXLA 2HUHA 5C9KA 2YGOA 1T1YB 4GS7B 3O3AA 1B4JL 3EUUA 2ED8A 3RGHA 3EGXB 5BOPA 1BD2D 5I30H 4FXKA 2BHYA 5LGKA 4NWTL 1FA4A 2GSGA 3RGVB 5EU7C 3NJLA 4HAGA 5H35B 3H3BC 4B9GA 2WXHA 2EEBA 1XSIA 5C2BL 5TQ0L 3OJDA 5KOVC 4LLQA 4I1PA 5DK2A 3NVQA 3UTQB 2WNGA 5L2KB 3VXSB 4EZLA 2MPAH 1H5BA 1A4JA 2A9CA 4B9ZA 1KIUB 5CIPB 3K71B 3UABA 5EWIH 1A0QL 1Z3GL 5EC2B 3AS3A 3DX6A 1G6VK 2YMTA 4MNQB 3CXHJ 1S7WB 3HJEA 3QDJD 1KGJA 2UZYA 4XNZC 1Q1JL 5CILL 5FOJA 4ZXBC 3R8BB 2WWMD 2C26A 5BV7H 5EPMA 2Y6SD 5FECA 1GTFA 4YSQA 5T33L 4LHUG 5TDNA 2X2UA 2Y9RT 3LQMA 4WWID 4NPYB 3HBPA 4P57A 4DKTA 5EB9A 1IC0A 1HL5A 1WA1X 3GTNA 1WS8A 4GAFB 3U0TB 3SE9H 3QWOA 3CK0L 3HG4A 4PGBB 1NLBL 3ZSTA 4E68A 1OTTC 3SOBL 5I66B 1I4FA 2B0SL 1CGWA 3UAJA 4EXPX 3UPAA 1W6WA 3ZT6A 2WLKA 1CE1L 5E1IA 3CVHH 2WYIA 4BK4A 4BFRA 5D7IA 1HYRC 1UM5L 3APFA 1CB4A 3GLZA 3SPHA 4KVCH 3UO1L 4V1DE 2ZCKL 3UDWC 4CNIB 4A7UA 3GMQA 4R0LB 5IP4A 1I9EA 1DQML 3JTTB 4NNXB 3E6FB 1CU4H 1HCZA 2GUOB 1T2XA 2Y5EA 1CXHA 2VLKD 1TXKA 3L7EB 4LRIC 1UB6A 3UOAB 4U7MA 1EAOA 2PW2A 2GJZA 4MA3B 4FX5A 1ZS2A 3BUBA 2LLGA 2GABA 2RBLA 3IDJB 1YEFL 5DVPA 4D3CL 3VGDA 1PSKH 1MWAH 3KJ6H 4L4TE 4Q6KA 1ADQL 4QHNB 3B2DC 3AUVA 5EORH 4U3SA 3VD5A 5EZOL 1FO0B 4PD4K 4WWNA 1NGQL 3X1EA 2LTQC 2R1WB 4RRPG 1G94A 1I3RB 3HMWH 1MLCA 4M3HA 1J05A 2DTSA 3QXTA 4L3EA 5AENA 1FYTD 4LB8A 4OZFA 1U8OB 1A6ZB 2YPVH 1RFDL 2JB6A 4NHUA 5EULV 4CC4C 4IS6A 3DX4A 1SOSA 1WDAA 1AD9B 3VGAC 3VWKD 4EI6A 3W9EA 4Z7NF 5CEZL 3AY4C 5DRWB 3QCTH 4KZEL 3MDJA 1RHHB 4ZW8A 5T3ZE 1TQCC 1DSWA 2QHRL 2HRLA 3CFMA 3CSBA 4OU3A 4AKOA 3U7YL 4N9GA 4GQZA 2HFGL 4AYFA 3PDOA 4CMHB 1G5AA 4HW6A 5GS0C 1JN6A 2DV6A 1AQKH 1RJLA 3WSQH 4FQ1H 4WGVB 1NOLA 4ALAL 2XWEA 1A7PL 2MHAB 4PR5A 1OT4A 2IH9A 4QXWA 3QK0A 1WA0X 1PCXA 1ZHNA 4K5LA 1TTBA 3BFOA 3DKHA 2H8PA 3IWVA 1FZKB 1ITBB 2CJUH 2FEDD 2F8XC 4NBYB 5HYQB 1F97A 2PPAA 4GNKB 4KKLC 3MRMA 5DF0A 1EFXD 3GZQA 3KWXA 5AW9B 3W0WE 4CVUA 1YYLL 4NQXA 4DPBX 4UT9L 5DUMH 1CT8A 2IALB 3C5ZA 1OV8A 4MJIA 3O2DA 3LVTA 4KK5D 4XPGH 2VERN 5F7EH 2Q5BA 4QRRE 4GKSA 1M2VA 4HJSA 2AFNA 3D4ZA 2IQ9H 3UZEA 4A2GA 3JTSB 3QXAA 3TJEH 3BSHA 3AREB 1EZLA 2QTVA 1OD7A 3N1PC 2DYPB 3D52A 2ZIDA 3P0YL 4U0RC 4Y5YC 5HI5D 3MACH 4JFEB 4F8NA 1MCWM 4W9CC 1PQZB 3DX9A 4HV8A 4AXWA 2H4EA 2BVYA 4XVJH 2HRPH 3ZE0B 4XXDB 4AGNA 3ZU8A 1EJ6A 1IGYB 2GTZB 1AJ7H 2PTTA 4WWPA 1M1XB 3Q44A 3WENA 4HT1H 2EEDA 3DIFB 4PRNA 3MKKA 1E90A 4Z3IA 4NKMB 2EP6A 1SBSL 1JI2A 5K9KA 4PSPA 3QWNA 3V55A 1YEGH 3AT9A 2ZYIA 3G6JA 5AQ0A 1WZKA 2V2XA 2F2HA 3WFDH 1K3IA 3W5MA 1J5HA 2EABA 5AW6B 3DBXB 4NQUA 1QOKA 1N6QL 4I8DA 2Z8SA 4NOBA 3OF6A 3ABLB 4HH8A 4NZTH 5CD5C 2GB2A 2Z7YA 3FSVA 3WNIA 5D7JA 1UD4A 3LRHA 2HJKB 3BUTA 3D85D 2Q10A 1JXDA 1M9WA 1CICC 1DBJL 5H2BA 3BIKB 1JGIA 3B4NA 2FJFA 4AYSA 4L5FE 1G7QA 4WWKA 2VDMH 3CFEB 1W0VA 2VDPH 1IZJA 4ZS7H 5I6KA 4J6RL 4DUXA 2ZCHH 1Z66A 3NDYE 4N85A 3KLHD 1UZ8B 2V4LA 4MMYA 2P5EB 4X4XB 5F9JA 2A38A 5D1QC 1KBBA 3IU4H 1Y1DA 3S37X 1MFBH 1UXWB 3GRWL 1OARL 1TQUA 1ETB1 4FXGB 1KN2H 3ESUF 5GGSB 1RK1B 3QNZB 1THAA 3PCYA 3GXUB 3HHRB 3CJJA 4CSZA 3U9UB 1AVAA 4WJ5B 2V7NB 2ITFA 1I9JL 1VF5C 1RZKC 3D9AL 3DX0A 1T0NA 3PGCB 4M61A 5LGJA 2JXMA 3FU8A 2IDFA 4HH9B 4Z1PA 3Q2WA 1FO0L 4F27A 5E8OB 1ASPA 1PMYA 2PR4L 3E3QE 1KLUB 4Q89A 1KTLA 4JFDA 2BW5A 4U1SB 5KVGH 5ACLA 3QS3A 2EUWA 2GIXA 1IUZA 3W2DH 5CEZE 4XNUH 4Z77A 1E65A 1YZZA 3ATEA 1E9QA 5DUBA 3ZTJH 2JELH 4ZMPA 3TBYB 2WIMA 4KU1A 1Q94A 5I74B 1JS4A 2E7DA 1NGZB 1UWGL 5BZDA 1LMIA 1LLAA 5AB2A 4KGJA 5LCVA 5AB9A 2F5BH 5KSUA 3PYCA 4NKQB 4TV3A 1WLHA 1QYGH 4M6OH 3QNFA 5C0AB 1RVFL 1J9CT 1W80A 3GS0A 1CTNA 1NC2A 4TVSa 4M00A 5MHSD 1BLNA 4NO3B 2YAEA 3BD3A 2NZ1A 2A0LD 3L17A 2R4RH 4FN0A 4LKCB 5J1AA 4HA1A 3BW9B 2ICCA 1EHXA 5DO8A 4H7VA 4ABWA 3MLUH 1OD9A 3S88H 3AFLA 1XH2A 3QULB 2G0KA 1EMTL 1KELH 1WBYA 3OR7A 1P7QA 1I75A 5DS2A 3M7FB 3ZKND 3NCBB 3NFPA 2IMMA 2VJ8A 3B3IB 3FFDA 3WFEL 5HYSG 3GXIA 3MBEA 1J7VR 1ZJAA 5C09A 2XWRA 5AOKA 2FBJL 5CGBA 3S5LB 4XXCC 5I8OL 5IVZA 4ZO6A 4B7IA 3MOQA 5DQDH 1MJJB 3FBQA 4DK5A 5DRNA 1R3JB 4AUUA 4JKNA 3SDCA 5EUOE 3D0VB 2I69A 4M7KH 2EDHA 2UY7B 3B3BA 4BK5C 5HHMB 3SDXE 3DO3A 2VN4A 1VAHA 2V3DA 3ASNB 2Q8BL 3EOTL 4A2MA 1MJUH 25C8H 2AP2A 3LN5A 4EXKA 1I9RH 2EC8A 3O9WB 1G9MH 1Q9LB 4AT6B 1I3GL 2ZUUA 3QP3A 3L2NA 1B0GA 4I1RA 4TUOA 3KBPA 3MR9B 1YJDL 4TQEH 5IROA 3MLZH 4ZNEE 4OTXL 4BFIA 3THMH 4FFVC 4PGDA 4M1CD 2IQAB 3S96A 3W39B 2DQDH 3QPQD 4NHCL 3WKYA 3VXRE 2R9HD 4I4WA 5AVRB 5KSAA 4ELMB 1USQA 1MI5D 1SN2A 1TZAA 2CKBA 4IGBB 4FQPA 4Q4IA 4D0DB 4NX0A 4RDQG 4PJXA 1M7DB 1ZXQA 3KWWB 1YY9C 4HKJB 1S8DB 1F4XH 4H20L 5CWSA 2BW4A 5ICUA 5DC9B 1T0OA 2OJ1A 2WN2A 2DQFB 1GGIL 1XTLA 2W07B 4YLQT 4DCQA 5AL8A 1A6WL 2JCCB 1Q0XL 5D96B 2ZUSA 1KTCA 4HC1A 5IB1B 1HCVA 3VQ2C 1QRND 3PWPA 4N87A 2FNWA 1JZ7A 3LZNA 4K3EL 1HOEA 1XEUA 3HI5L 3D39B 3FQTA 1IILE 5JHDE 3VD0A 4GXUN 4LVHC 3GHPA 5BV7B 4MSWA 1Y6NR 4XNBA 3LKQB 4F9LC 1JFQH 1U8KA 4QOKE 2ZE0A 3TA3D 2J72A 1IGIH 3TO2A 2YEQA 3T08A 3FQWA 4BZ2H 1FHNA 4BXVA 5C08E 2JK5A 3QORB 4EOWL 4YJZL 4OKVA 1YA5A 5AALA 1CURA 2ORBH 4JRXB 3BVNB 1Q9OB 1DQLL 2Y2YA 3U9WA 1QWNA 4GG6F 1XB8A 3PHSA 3CVHB 2B8OT 2ZPKH 4CILA 3VFWA 2I26N 2J1WA 1HNGA 3D30A 3GSNA 4FQLL 5F21B 4EI0A 1YEKL 5AG9A 3PP3K 3HRPA 3MJGX 4KPHH 1I1AD 1P1ZA 3MCKA 4PWKA 3ATBA 3CLEL 3H55A 3ZKXC 3AM8A 3GBDA 4MJ2A 2WWMC 5MP6L 4G8GB 2Y6SC 4OZHF 1JE6A 1FYHB 4IHOA 5JW4Q 1LDPL 1JUFA 1LEGB 4HJIA 5E1AB 3K6FA 1WZ1L 1XO8A 5C07D 1TQVA 4XGZB 3GF8A 2X7LB 1JPGB 1KIRB 1NUFA 3F83A 1KTJA 4E2OA 3QXDA 4CRPA 3KGSA 1ZVNA 2HSIA 4J1UB 4P46B 5HDBF 2VXSH 1HHJB 4J3SA 1VFBA 4K5MA 1JF1A 3V4PA 5CZVL 5FF6A 3CXDH 1AO7A 5D7IF 4MBOA 1NOFA 3NH7L 1QLEB 1OE2A 1FNFA 1LP9B 1OT1A 1P7HL 1MFCH 1G9NL 1GZPA 4Y9GA 1QTYT 4KQ3L 3F85A 5E9DA 3L6FA 1SFDA 4M8VA 1YYML 4Y2DB 5D1ZC 3B2VH 2R69L 2EUXA 3L4CA 4OD3L 1WF5A 3S3JA 2XNAA 1S7VB 2C3VA 4P4KA 4PG2A 3V5KA 4C4KO 3KEDA 1OHQA 5GJSL 1NDMB 3MU3A 2EEFA 3P9LA 4NUQA 1NCBL 1WD8A 1R4XA 2HRGA 3LS5H 2O61A 2C3HA 1H3PL 4RMBA 1E6OH 4JFEE 3NZHH 4YPGB 3R0MA 3PAZA 1G7PB 4M8UA 4FNLL 3QUYA 1Z5LA 1KXHA 4P59H 3AQDA 4KNTA 4ODVH 4HJJH 1BQ5A 1L0QA 1GW6A 1ZA3A 1NGWB 1SZNA 4UQDA 4Z5RB 2RR3A 2A9DA 5DD6A 1G4RA 5GSVA 1AFVL 1QPPA 4Y5XB 4HEPG 3VWKC 2NY7L 2IVFC 3K80A 1XCTA 5D1XA 1O7DE 3LIZL 1RL1A 1MVUA 2VLJB 1QP1A 4QHLA 1TMCB 1WEJL 2GG1A 4IJ3B 3DURA 5IHZA 3QGVA 3B9AA 1DFBL 4UV4L 4JN1L 4M6NL 4RA3A 5EEZA 4IRJD 1IGTB 2VXVL 2WGNB 2OL3H 3VXUE 4XCNB 4X6DA 3LS4H 4L9LC 5LG6A 5IG7B 3FQ4A 2F08A 4IBLT 2NY0B 2L7JA 4OY9A 4NXSA 1F56A 3FRPA 3DYPA 3EFDH 1FG2A 3WGVB 1B0RA 3FF7A 3BKCH 3MHZA 2FEDC 4MCZB 1ZV2A 5HJ3A 1G4MA 5FYKH 4DGYH 2DWEA 4RMWA 2W38A 4E9VA 2BWIA 3L08A 4Z0XA 1WT5A 2JE8A 1R33A 3TWYA 3VACA 4FYTA 2WWOA 4H13C 4TTGA 4DP8X 3QJHA 4KK5C 4JHUA 3WTVA 4PJHE 3CHSA 1JPST 3MCLH 4X99B 2DQTL 4HKZA 3FRUA 2X05A 3BXNA 3HS0C 5EWIL 2GT9A 4GAGH 1BZEA 1FDLL 5BV7L 3STZB 3VTMA 4M29A 1PL3A 5HI5C 5KVMC 1SXSA 4Y2OA 2DIJA 3UTSE 4LNRA 2DWXA 4X0KA 4EDWL 5DT1H 2COVD 2IH3B 5INCB 2G9HB 5HP5A 5C3TA 2KS0A 4WIQA 4PJ7A 1S7RB 3APDA 2EDKA 3F58H 2OMTB 4MWFA 5GRVL 4XN5A 5C0FB 4R2GC 5F7BA 2CGRL 4NN6C 1HHGB 1G7HA 43CAB 3P77B 2VDMB 4L29B 5IW1B 5K33A 4MB5A 2VDPB 1BQSA 1I1CA 5IJVB 4HWEL 1X6LA 4JCWA 1QR4A 4OH2A 3DECA 2I9LA 1IC5L 2X38A 2ESVB 1K8IB 2PW1A 3OKYA 3QPXH 4NRXB 5GGVH 4BFEA 4C56B 1SY6H 5E9NA 3BEWA 1A7RH 4W6YB 1VERA 4P2QD 5IEHA 2PCFA 3FB8A 3HI1A 1JGEB 1BX2B 3BP5B 1O7VA 2CDFA 4DP2X 5E6IA 4Z7VA 3BP6A 1KJ2H 4KKRA 3SY6A 1YUHB 2VZSA 5IFAL 4JHAL 3FU7A 1KCLA 2UXTA 3CHXA 4D7BA 2DDQH 4X9HA 1JRHL 4JE4B 1E2VA 1PX8A 2YAMA 2Z31A 3QJRB 2BINA 2H0EA 3RTQD 5EUKA 2R56L 4AMXA 1QRKA 3M8OL 5I1AB 4J6IA 1QLEL 4MJJA 2Q7NA 4NC1C 5EA0L 3COOA 1JPEA 2J25A 4L4TA 4WY7H 2OYMA 5BNXD 3VDAA 3EHBD 1JSYA 1NOAA 2AMUA 3ETBJ 4LHUD 1OP5K 5KYYA 1KB9J 3DOIA 3L5IA 1XGRB 5SV4A 2X88A 2ZWSA 1I7RB 1S9YB 1FCCA 2CDEA 3DHJA 2HVJA 2NY2B 4HUCA 3GINA 4ONGH 1JZJA 4Y2NA 1G7MB 2CH8A 4A7QA 1J0IA 1AQMA 5D6DC 3RFZA 5CJ8A 1AGEA 2FSEA 3QZWB 1OGTB 4AL8C 5EO1A 1WFMA 1JD9A 4F7TA 4HZAA 5LO7A 3U1SH 2JI2A 1BAGA 1I3VA 3H0TB 1KCVH 4QRUA 4XZUB 5CUSL 5MEND 1ED3B 2BS71 5JHLH 3AGWA 2FBRA 2BVQB 1BQHG 3AACA 3PUUA 1AGBB 4ADJA 3LRMA 1GS8A 3VQMA 3ZHKA 1CS6A 3D3VD 4KHTH 5GGTH 1UWYA 1YNTB 3ARDD 5F7EL 1T1ZA 2SEBB 3EH1A 1CGYA 4X0NA 3U2SB 4XX5A 5CGMA 2NXYB 4QTHA 4QGYA 2A0LC 2QPEB 5AW8B 32C2B 4FMKA 3OJVC 4XXWC 5DYFA 3A24A 3MACL 4Y1AD 4ZMLA 5DA0B 3PWVB 4A6YA 5I1KH 4M5TA 4H4NA 4K71B 3Q2VA 5SWSD 4QRRA 3I75B 3UBXG 1TYJA 4GMSH 4AYID 1T7WA 1KTRL 3ZKNC 5JW5A 2XQYG 3L7FA 1OZTG 5EBWB 3D39E 5EU4B 4Y4HD 4JFWA 1CFBA 2NY3D 3DVGB 4YUEH 5B39G 3NAAH 4I7ZC 3WFDL 3WIIH 2J3SA 3QAZC 1JNHB 5HHOA 5JDSA 1JZHA 4LCUA 3C2SA 4WTZA 5DO2D 4N22A 5BZWB 3SE3A 3HW7A 3IPEA 2OQJA 2EJ1A 2W0FA 4Y4KB 5MEQA 3UJJL 3UROR 3ZR5A 2HCZX 2PABA 1FGVL 2J12B 5E99H 2EYSA 3FCBA 1YVLA 3CBKB 1IM9A 5ETUB 4K3HA 3P02A 5J9PB 1PY4A 3KPRB 2PETA 5CCKH 1JFHA 2AJUH 3VGAB 3H9SB 1K4DA 2P24B 2F15A 3GSRA 4YBLB 3S5ZA 1UACH 4FULA 3TN0B 5J6GA 2F74A 5AZEH 1M05A 3D1MC 4ZS7L 1RUAH 7FABH 5D2LF 1FFNA 1IM3A 4DHLA 2QKIA 1E67A 1ROCA 5BRZD 3T4YB 4MQSB 5IB3A 4M1CC 2ITDB 1CBVL 3QPQC 3O11B 3WN5B 4ODSL 4ABVA 2R9HC 5AAPA 1VGKA 4ERSH 4HXAH 1H8LA 3LKOA 3FAWA 4IIQA 1M71B 2VDRH 4Q97A 2A77H 1V10A 2X09A 3AGVA 1HXKA 2WK2A 2BNQB 3EDEA 3DVFA 1EVUA 5DLLA 4PJXF 2EEXA 3IVKB 5EO0A 5EBMB 1NMCC 5C3LD 1PCSA 5KSBF 2FO8A 3DTXB 3VXME 3SPIA 4NQTA 3FH5A 3HC0A 4YBQC 3BVWA 1B9KA 4PCTA 5KZCD 3NIDB 5GJTH 1DVQA 2FHFA 6FABL 4ZX5A 4I5BA 1ADQA 2YMXL 4JL1A 4M8QA 4WI4A 4WDIB 3QI9D 2BX5A 1G6RH 4PJ9A 2DM2A 5H37H 3H7BA 1ZANH 3ISYA 3TA3C 4LF3B 4TQIA 4IBSA 5ALBL 2YSSA 1KJMA 3OHXC 5DRXB 2XQBH 4DK3A 1LDSA 5D71H 4LRNH 3VU2A 2RALA 1TCRB 2D0GA 4P05A 1DFXA 4GRWE 2XZAH 4OCYL 3RWJA 4H8WC 3IFPB 3A6CH 4MA7H 3T0VA 3QYNA 4RVBA 5BQ7A 1KEML 1YN7B 2CSPA 1SN0A 4B50A 1WC7A 5CINH 4GI9A 5G2NA 1I1AC 4KZ0A 4Z0BH 5AVUB 1I31A 4YXLH 2FIKA 3GB7B 2MNUA 3AS2A 2DQMA 3F6IA 5KBDA 3MBXH 1UXLA 2E4TA 2XPGB 3QG6A 1IAKA 5CU9A 3JVGA 3VFUB 2QZ5A 3RUGE 1PZ5A 2FWLB 1MW2A 4JN2A 4QRQA 4M7LL 3FW6A 3I50H 3NA9H 3D2UD 1S5IH 3EDFA 3CZUB 1U8LB 1UWEL 1BVNP 3UAFA 3P9MB 5DZPA 2A73B 1MFUA 4JZJC 4QEGA 4FG2A 3MUGB 3CC5A 3D50A 3FT2A 3MJ6A 4YGVA 4MHHG 3BRDA 3UCRA 2ROXA 5I76A 4UT9A 3LPGA 2XIBA 2YARA 4YAQB 4Z7OF 1DP0A 2EECA 4ZSOB 3CMOH 3FUNA 1ML0A 2ZG2A 4ORGB 4B0MB 2IPKA 3SQBA 4K94H 4J4PA 2GBTA 3F7YA 5BS0E 2DBJA 1BYOA 5JIMA 4HDIB 1AP2A 3EJYD 1P5UC 1Z5HA 4WUUE 2YR3A 1A7OL 4NQEB 4TQEL 1T5KA 1ZLUK 4ZAKD 4QTIL 3CZFA 2K7QA 2YAOA 5H35A 3BPNB 3WIHA 4P2OB 4PRHB 3THML 1MPAH 3K72A 2PO6B 4LQFL 3UTQA 5LBGA 3VXSA 4OFDA 1OAXH 3A5VA 1A47A 2CO4A 4PJBE 3C09B 1K8DA 4XMLL 3P4MA 3PUCA 5CLXA 5CIPA 1HJBC 4EI5D 1T2JA 3HC4H 4TQHA 4H0HB 5EC2A 1MCKA 3P2TA 1IJNA 3T0EC 1U4FA 3L8QA 1S7WA 3DX7A 4NAMA 4ZNEA 1IC4H 2MOVA 5HTSA 3X2QB 2BP5M 4JPSA 1WZLA 4AEIL 1T2QL 4LHJB 4NQQA 1J9TA 1U3HB 2FGWH 3LSOA 2BS9A 3M45A 2GC7C 4TYUA 3QCUL 1NCOA 2F58H 4H1LG 5ICYB 3FUMA 1R5IB 2A6DB 1SF5A 2ESVE 3BFWA 3T71A 1DQQA 4I9WD 2N7AA 3X3FL 1P6WA 2PPCA 4C56E 2HB0A 1X44A 2ZF8A 1NA8A 5I66A 4F91B 4IRJC 4JO5A 1LO3H 4HXBH 3KWTA 5EIIG 1E7VA 3P3SA 1TMQA 1RZFH 1D5ZA 3IMSA 2CBOA 4FZ8L 4AL8H 1JV2B 1REIA 4LSQL 4X6DF 1MQKH 1S7TB 3LXAA 3JTTA 4UOJA 3L3DA 4YDJB 3E6FA 2FJGB 4BELD 1HH6A 1MCSA 1DCEA 5JHDA 3W5NA 5I73B 5KBLA 3JUYA 4ZW3A 1QQDA 3NIFF 3HPJA 3KDMB 4L3AA 2JTYA 3L45A 1PPIA 3R7QA 2QPUA 5E23A 2H47C 5HYIA 2OMWA 4PREB 1R5VA 1TZIA 3ISRA 2BP0A 3W37A 4KPHL 1U8HB 5A7EA 4GAAA 5C08A 3CFBA 4ZW5A 1FO0A 4WI7A 1KACB 2Y72A 3MA7B 3RWIB 1AHMA 1I3RA 3TBBA 2VZUA 2QTEA 4JUSA 2CR3A 2CK2A 3CPLB 3CLFL 5GS2D 3K6SA 1A4KA 4HLZH 1ZIBA 1TNNA 4DVBA 2DJMA 5FGBC 1BV8A 2NNCA 3FCTB 3WFHB 1QTSA 5DRWA 2N01B 2FT6A 3B9VA 3MRKB 1CR9H 4ES9A 4HGKC 5D5MB 3RPIB 1AKPA 4NI3A 1K72A 4F58H 4NKOB 1TJXA 2UZIH 3I9PA 3LHAA 1QSEE 4R7VA 3QG7L 3N9GH 4W9LC 1MFCL 1G7IB 4FJZA 2MH4A 4HMEA 5E5LA 3DJRA 4QHUA 1JGDB 3O2VH<