2WTRB

Full length arrestin2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
399
structure length
367
Chain Sequence
GDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGRVGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPKEEPLDTNDDDIVFEDFARQRLKGMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Dimeric Crystal Form for Arrestin2
rcsb
source organism Bos taurus
molecule tags Signaling protein
molecule keywords BETA-ARRESTIN-1
total genus 54
structure length 367
sequence length 399
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
B PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrB02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrB01
3LH9A 3UGUA 4J2QA 3GD1C 3UGXA 4GEIA 3LH8A 4JQIA 1CF1A 2R51A 4GEJA 4P2AA 5F0PB 3GC3A 3P2DA 1AYRA 4LL4A 4LL1A 1G4MA 1SUJA 3LHAA 4R7VA 1JSYA 4R7XA 5F0MB 4GFXA 5F0JB 1ZSHA 2FAUA 2WTRB 4ZRGA 1G4RA 2WTRA 5F0LB
chains in the Genus database with same CATH superfamily
5KVFH 4S0SD 4QHMB 4HMEA 2HT2C 5E8DH 2JJTA 2HUEA 1RP9A 3H42L 2OYMA 4HWBL 4AJYV 4N0UB 1YUKB 3LIZA 1HNGA 2FRGP 1DSFL 1CC3A 4PJDE 1KYAA 5HVFB 5KJRL 2X9XA 1NLBL 1TZGL 1JVKA 5EZOH 1TQCB 2XN9B 1XGPA 3HAEG 3JV5A 1DVSA 4ZG1A 3QZOA 4ORGA 5SWZB 1BM7A 3P0YL 3MJWA 5GHWH 3QCVH 3EYSL 2IV9A 1MLBA 1VLXA 3RAJH 3QJUB 3DURB 5D5ME 1FSKC 1W72L 1HZHL 1T7ZA 5E00B 3MBEC 2VLJB 2QKIA 1YG9A 2EE3A 1S9WB 2WJ5A 3BUTA 2V5YA 5C0AA 5L7XH 4CVWA 4ODWB 1JV2B 2ZCHH 3C6LA 3AM8A 3EYVB 5CJQH 1OP5K 3C5JB 4ODTL 4PSRA 5I8CA 5JDSA 3GNMH 2PKDA 3PDOA 3RNKB 3V7AG 4YDKL 3G5VA 3QNFA 3CLEL 2PF6A 2R2CA 4BE6A 2CO2A 3DJ9A 4B0MB 4KUCD 5FYLH 1RFDL 1BJ1J 3K71A 3TCXA 4TVPD 5FLUA 3PUCA 4JNXA 1BPLB 3DC0A 4L9LC 1Y7VA 3VWKB 1CR9H 2WSDA 3K2MC 3RVUD 5IZ7A 3EYOB 3GIVB 1S9XB 2V7NA 4JO1L 3CHXA 3MLRL 1E6OH 2JWYA 3T4YA 4X9BA 5E6ZA 1UADC 1DJXA 2HFEA 1KLGA 4U6HA 3VFVB 3VI3A 3MA7A 2VUOA 1YEGH 2EDBA 5E2UH 4WFFD 1CD1A 5DMKB 2RALA 4YDIL 3O81A 2C3WA 4XNZC 4XP5L 4I0PA 1C5CL 1CTMA 3DOSB 3FT1A 4L8BB 3IRZA 4GH7B 4FYSA 1OP3H 5GGRA 4ELKA 1A6AB 2MWCA 1M71B 4JM2C 3CH8A 1YQVL 1FUNA 4HPOL 2NY6D 1UZ6E 3L5JA 1WAAA 2IVFC 1ZWIA 2J6EA 2BSRB 1G0YR 2OMTB 4JPKH 3HN3A 3FB8B 2P5WB 1TITA 4NAJA 2V2XB 4P3DA 2JJWA 3MU3A 1HCVA 4AVIA 3AU0A 2XWCA 4HMCA 4RFNC 3SDYH 3MNMA 4ZPVA 1WV7T 3P0YH 3WFHB 4QJ5B 3HMWL 4TV3A 4Z7UB 4O2FB 1AY1H 2IGTA 5E5MB 2UZPA 3WYRA 4MQXD 1OSPH 5DUMH 4PRIB 1R3KB 1MJJA 5KJRH 1X44A 1Z5LB 3FK3A 1UXWA 1DDHB 1YLBB 3HZMA 1HC1A 4OQTL 1L9SA 3V4LA 1Q1PA 3O2VL 4NZTL 1Z9SA 1UUSA 1FNLA 4R96A 5K9QG 1DJHA 3X3FH 2LLGA 2NUTA 2F53E 4KTGA 4BXSV 5INDA 4QF1A 2YAOA 1IAOA 2ZUUA 4K2UH 1IGYB 1WEJH 3QFDA 1USZA 1SEBA 5EIIA 1BVOA 5GS0D 1R17A 5E99L 4Y5VA 2Q8BH 3QR2A 3L1FA 1KN2H 2ZXEB 3JTSA 3VG0L 2J5LC 2ZXCA 2LQRA 1F4HA 2VIRA 5KBNC 4N3TA 3P73B 4JRYD 1R3IL 3R06A 3VFGH 1KPVA 2VN3A 2Z35B 2V37A 4JW3A 2ZKYA 4Z3JA 5DEFA 3FQTA 3U7AA 4KRPB 1IBFA 4EUPA 1QLFB 1N7ML 2IH8A 3UAJD 3S8GB 4WK4B 4X6FA 5ITFA 3V95A 1PPIA 2QLVB 3U9UB 2FO1A 2X3AA 3CXHJ 4KO5A 3BQUC 4YXHH 1GYWA 4KROC 5F1NA 1GSKA 1A6VL 2EIKB 2EDMA 1FBIH 1YAIA 4GS7C 1JZ7A 2W8CA 5FUZL 1P1VA 4AJ0A 1WO2A 4PGBB 2AJUL 1G6RL 3GIZH 2UWEF 5K9KB 1OGTB 2DL9A 5EOTB 3N1PC 2BHUA 4JDVB 4NZRH 5T1KD 3AT9A 1KYUA 3E3QE 1K2DA 4HCGA 2HN7B 4YGAB 1T03H 1JNHA 4DP2X 3GJFH 3GMRB 1ZLSL 4XN9A 4YX2L 4JVWA 4X0NA 5PAZA 4ONHB 1MAKA 5B8CC 1YMHA 4GP5B 4LDLB 4PV1C 4MFHA 5J57B 4H5SA 4MS6A 3FU5A 2ORBH 1T0PB 4ZPTB 3HS8A 3ABLB 2GUYA 2NY3D 3ECVA 5FYLD 3FZUD 2A38A 3QC5X 3T4AA 3UYOD 4DEUA 1BQHA 1TQBC 2EQDA 4MNQA 3EYUH 5KZCD 5GGTL 3RBGA 1TZGH 3D18B 4M62H 3D4YA 3Q6GL 3KPRE 1SLUA 4M7ZB 5I5RA 4YPGB 1TZ8A 5IR1A 2DJMA 3THML 1DQMH 2OMBA 2Z65C 1YYML 2CNZA 5GRUH 1EQWA 4ANWA 1BMGA 3IBOA 1T1WA 5MEPA 2KQNA 3MXVH 5D72H 2VWEE 5TH2A 2X6MA 4JHWL 1RHHA 1E8WA 1JGDB 3V5HB 1SVCP 3MMEA 3L7FB 2DIEA 3CQPA 4W6WB 3NFNA 1F1GA 4JO2H 1QZ1A 4PN6A 1HHGA 1IM9D 5AZ2L 1FYTE 3KHOA 1ZLDA 3LDBB 2AXWA 1OKEA 3MTRA 1FN4A 5BRZA 3HC4H 5C6WH 1ZANL 3CDGA 1JRHH 4FABH 3FJTA 1R3LA 2MOGA 3BVTA 1MWAH 3RGVB 1KELL 2DYRB 5HGHA 2HRGA 4NWUH 1RULL 3U48A 4XAWH 1HEZB 5JTWA 4NC2B 1TJGL 1JP5A 2J8UB 4Y19D 4X8GA 4G8FB 3PHOB 2P80A 4CC1A 4N9GB 2XN9E 2AK1H 2DQDL 5TDPB 1CQKA 2EYRB 5D1QC 3QWRA 4LOUD 1NDGB 1P5UC 4TSBH 1ZSDB 1QRNA 5EOCL 4G8EA 5DZVA 3QPQD 4AQAB 1KIUA 2F9BT 2ZX5A 4ZD3L 5FX3A 3BC9A 1BF5A 1NC4A 1OAYH 2AW2A 2QGEA 5G4NA 1KTLA 2IOOA 3TBWA 1YMMB 5EU7C 2M83A 1RZJL 1WWWX 1NCUA 3SPCA 3TZVB 1EEZB 2AEQL 3SKNB 4L0YA 2HPTA 5HYJB 3D6GA 1I8KA 4XCYB 5I74B 4UZSA 5DQDH 5ISZE 1S7RB 1JPGA 3KLAB 5G4OA 5E6YA 2QGCA 3L3GB 3L3DB 5D1ZB 3VFWB 2A4EA 1FN4B 3WUWA 4ZAKB 1RZFL 4GMSH 2VRKA 1X5GA 1A3LL 1YYCA 3L5XH 1KGUA 1MJJB 2AJYL 3HZKA 3CBKB 1E4WL 4U1LA 2OX5A 4JGUA 2WYTA 5A2IH 4KUZH 4YE4H 5AOJA 5FO7B 4APQD 3TNMA 4GBXC 4LQFL 2FJSA 2NX5E 2AK4B 2JI1A 5TQ2H 1RZKL 5IFAH 5DHVH 3ETBJ 2I60H 3NJHA 4RETB 4XCEB 1JGVH 4JRXE 3FSOA 4O2EB 3EYFB 4PJIB 1MZYA 3O9WD 3DOIA 5SWSA 3VFTA 1A6UL 3TBVA 4ZOCA 1LGVA 2YWZA 2CHXA 4ZNCD 1XGRA 1PNCA 1EAPA 4M4RB 4LCIH 3FCBA 3RVWD 5J6GB 2XN2A 2GKIA 3OV6A 1OK8A 2B4CL 3VDCA 1CGWA 3MMEB 3VSQA 1A7PL 4K9EL 2HKFH 2F5BL 5FYJD 2RA1A 4OH2A 2A6JA 2KZKA 2YA2A 1AZZC 5ISZA 2B0SH 1SPDA 4OUUB 4EBQH 3PWPB 4NQVB 3FRUB 3T3MF 1KT2A 2APVA 2WXMA 2DMKA 2YWYA 2WP3O 4WI3A 4XVTH 2JV6A 2IADA 4QHLB 5C0ND 1NFDE 4PJ8C 2YD1A 4YLCA 1A25A 5DRWA 2AK1L 2DQDH 2E7LA 3NZHH 5SX5H 3CVHH 2CRMA 3O45A 5CFHA 1Z7JA 4U7MA 2O4EA 2X70B 3D52A 3QIBB 4GI9A 5DD5L 3GMOB 3IJSB 1G7PA 1FAIL 4F7TB 4PJ9D 3GINA 4TSAL 2NDFA 2BOCA 2E76C 2YKKA 3QUMA 4J5VA 1K2DB 2HFFA 4K94L 4RAVB 3PNWA 2JB5L 3HBPA 2C4XA 3HPLA 3BFQG 5JNYA 1I9IH 2QV4A 3DIFB 5AAWC 1HOCB 1BVKB 1I1YB 3D51A 1HH6A 2EIEA 2WNKA 4JM2A 2VAAA 2VITA 1ZGLM 4QYOA 5E7BA 1EIBA 4ONOA 1I1AA 3E8UL 3P30L 3VFMA 1FLTX 4R7DB 1A7OL 4FQXA 4Z3FA 4BCYA 5FYJL 4LLWB 2ZUTA 4JQIA 4EI5D 1M7DA 5DDHA 4BFKA 2JIXD 5ICYA 3KBEA 1E3FA 5A6LA 4NQVA 1SHXA 1J0KA 4FX5A 1QLFA 1L7IL 4Q74A 3Q6GH 2GCYA 3PJNA 3RVVD 2EDNA 4XNYH 4LLAA 5ITFB 1BQRA 3EH2A 3ZBMA 2OX5B 2CCVA 3MRLA 1RUML 1DHKA 3GMLB 4KNTA 1FGVH 3U1QA 4E9WA 3IDJA 5ACZB 1PDKA 5FHAL 4KMQA 1AXTH 2KQMA 4PJHB 3NEEA 2EADA 3VYOA 4ZMOA 3U0TA 4OZIE 4IYKA 2VC2H 4PJFE 4TQIA 3CFEB 4LPXA 4F1SA 2R7EB 1N9PA 2IBZY 4F93B 1H8SA 1X5FA 1Y18B 3N42B 3POHA 3RWGA 2WWKO 3S3DB 4AW7A 5KVEE 1JN6A 2DIJA 4H0HB 1E28B 4GUPA 4JO4H 4JFZL 4OD1H 1P5VB 3RA7L 2C26A 1ILUA 2CK0H 3I02A 4XCFL 1JHKH 4HKJA 5CCJA 1RIVH 3LH9A 1GVIA 4EQ2A 3SPVA 1R3KA 2A0LD 1OP9A 2BCKA 3VXME 4LCWB 5J11B 4A2FA 4YZFF 1J86A 4UV4L 1WFIA 3QQDB 3R1GH 1KB5L 4HCRA 4HS6A 4PRDB 4RWYH 4AW4A 3ZSTA 1JGEA 3B2PA 1CG9B 4N2CA 4HEPG 2YAMA 2QZQA 1U93A 5C8JA 2YK1L 3FU3A 3NTCL 5EO0A 2MKLC 3V6FA 5GIRA 4EI5B 5F7FA 5E2TL 5INDB 2VDRH 2R27A 2V5MA 3DIDA 1FHGA 3X3GL 1AMYA 3PE9A 3PIQB 5HD8C 1IIIA 1FLRL 1YEEH 4GQRA 2ARJQ 2X4PB 3TF7C 1FNGB 4JKMA 4AQ8C 4EZJA 4FCHA 4XBPA 4F20A 1DDHA 4XWOC 2EXYC 3KDMB 1CE1L 3HEIB 2WIIB 1T20B 3FULA 1KJMA 3WHE0 2HJLB 3BRDA 3ATFA 2HYMA 4JKNA 3HUJA 4MXQC 2EDXA 4KKLD 1EEQA 1XR8A 4MX7B 1IGMH 3BLBA 4RIRA 4H88H 4HK0B 1FVDB 3BPOB 5EULV 5FYJH 5IB3A 2D7TL 2J1XA 4WUUA 4YUEL 3X3FL 2IH9A 4L5FE 2CLRB 2AJSH 3A6CL 3BYTA 4DEWA 5C0IB 3N0AA 3S96A 1A9BA 1XH3B 3QPQC 3TWYA 1K5WA 4PB9L 2FB4H 1PX3A 4FGMA 4GNKB 2D7OA 2CNYA 1CL7L 2P7TA 3UTPD 1TCMA 4FFYH 4HXBL 2CH8A 2EH8L 4ZUSB 3V8OA 3SDXF 1YMME 2YEVB 5DHYA 3IJHB 3FNKA 2V4LA 4JY6B 4N9OB 5DD6B 4ZUWB 2NTFA 2WKOA 4LEOA 1JCVA 1WE5A 4Y5XC 2L7EA 4HD9A 3OAYK 1IEAA 3IXTA 3E8UH 2CKBH 3DO3A 2ZWNA 3C6LB 5ISZB 4N22A 4QNPE 3IN2A 1FZOB 2W94A 1NBQA 3CFJA 3QJRB 1MQ8A 5CFAA 3K81A 1WD8A 4O51A 1UXSA 5TE7H 3MA9L 3BSGA 3L1GA 1QP1A 4XO3A 3KLSA 5B3JF 2MJWA 4GRWE 3RY5A 3VU2A 4M4RA 4PS4L 2X4RB 4NKOA 3BDXA 1QVOA 2XA8H 3KPOB 4QY8A 3IF1B 2OSLA 2E7MA 1MELA 3VYNA 1GGUA 4MCMA 4NFDA 3UERA 3WIAA 3WIIH 3WENA 3T0EB 4X6DE 1YNKL 4H5SB 5C0AB 1N6UA 3KS0J 3GMQA 1OE1A 2YRBA 3FB5A 3QJSB 4NZUL 4N2MA 2R51A 3KNBB 4X4YB 1H8LA 3ILEA 2DQ6A 3MJ6A 3HRZA 5ITBL 3WELA 3MRKA 1HNFA 1X5MA 1NC4B 2B77A 5LCVL 1HH6B 4JM2B 3EO0A 4HG4K 5FA3A 3FTYA 4YFDB 1RD6A 4KK5C 5EU5B 1WC7B 4ALAL 1TSHA 3UYPB 3EBHA 4TVPL 4U1MA 4FFZA 5GGTH 3VXSA 1HH9A 5ESVB 3QISA 1R24B 1ZT1A 3ILDA 5D6DA 4MHHG 1F4WL 5KVEH 4PLKD 1HEZA 5HYQB 1XVSA 5T3XL 2BERA 1AY1L 2OP4L 1LMKA 1UWYA 1W9XA 4HXAL 4LF3B 2CCWA 2LE9A 4PS8A 2X0VA 1RZKC 3RIFK 3VXTB 1AGDB 2UZIL 3D25B 3OAWA 1NBYB 2VMEA 3BSHA 3VH8A 1U8CB 4G7YH 4AGQA 3NJGA 1GJWA 2LTQB 4FCAA 2DEXX 3ULVC 1HWGB 4OIIH 3SKUD 1I7ZA 1MI5A 1GZQB 3GXUB 4YXLH 5FCUH 3S36L 2XKNB 2X4QB 1G6VK 4WWKA 5GZOD 3U4BH 4Z7WF 2XYBA 4MD4A 5D9SB 5DGRA 4HLJA 4XVOA 1WYJA 3ARBA 1A6TA 4PLJD 4MBRA 4RNRB 4KDVA 5A7EA 4OI7A 4JLRA 2CKBA 4YQXL 2COQA 5GS1C 5FEBA 4QHNA 4PMFA 5D1QE 5FR3A 5KOMC 2A2QT 5CEZE 4FMFA 1YPZE 4IW4C 3O4LA 3P9MA 5A2LH 1B4JH 3SGJA 4NKDB 5DJYA 1JXJA 4OLXH 5AD0B 1N0LA 5E9DD 1H8OA 3UPRA 3LRLA 3OXRA 1J0IA 4H8VA 2IFGA 3U0WL 1A7PH 1B2WH 2P48B 4PJ8A 2GAZB 4LL1A 1DSYA 3MUGB 1DQIA 2XWXA 4WNQA 4EN2A 3O3AA 2Z1KA 1C5BL 5HYIA 2EVJA 4EDWL 4L18A 2X10A 4UZUA 1KWGA 5C0FA 1EHNA 1S5HB 1OALA 2CXKA 3KYAA 5SWZE 5JW4R 1YAZA 5BXFA 4FQPA 5HHMD 1TZHB 3F62A 4FULA 5K9JH 3QEGH 5HVWA 1JWMA 5T3XH 4KJPC 5GGUA 1UG9A 2Q3XA 2P26A 3BUYA 5D7KD 2Z34A 4IBWA 1BQLL 3FQUA 3WUWG 2YN5A 2P9RA 1Z9LA 4IIQC 3MRQB 4ADGA 2V3FA 1D5MB 1K3ZA 3H53A 1N8OE 4A2EA 3D3VA 4UTAH 5I73B 5J3HD 1IGCL 4X99B 1I1RA 2AEOA 2B59B 4K55A 1A3RH 5ESVA 3GXDA 2OXGA 5ERWA 4FQ1H 3AS3A 4YSOA 1TQBB 2JNZA 1UZ6F 3DUSB 3O6KH 3QUKB 4P57A 3ZJAA 1U91B 1JWSA 4YLBA 2JIXB 3B83A 1A6WH 4WY7L 4GYBA 4X6CF 2IDUA 5EU7E 1A4KA 2DYPD 3P3TA 4NQDE 4LB8A 5GGSB 1PEZA 4HUWA 1BCIA 4H20L 5IG7A 2G2RB 2M26A 3UMNA 4AXWA 3BD4A 1BAFL 4IRJC 4HFUH 4E5XG 3I9GL 3DPDA 1QG3A 4NUGL 5LCVH 4XMXA 1RPKA 4K5OA 1F4YH 3O8XD 2EDHA 3E6FB 4EN3B 1I31A 3MUUA 3W82A 2E7CA 2PW1A 5BW7C 3NQKA 2A9BA 3HI6H 2HAZA 4MTMA 3PQYE 1WFJA 2WXJA 5HHOE 1F4WH 5TPWL 5KVEL 3VJ6A 1F0LA 1RZKH 4FXKA 3MLRH 4G9DB 2ZSWB 3BKCL 4P2OB 1D5RA 4ZFOA 4HC1H 4DKAA 2F58H 1SHMA 4M8QB 5B1AB 3GRWH 5HP5A 2VOTA 1E4WH 3A0OA 3LD8C 4MJ5A 3ZZSA 2QR0A 3ZRFC 4XCNB 1L0YA 4XAWL 4O2CB 1FORL 2NTFB 4YSDA 5AB0A 4Y2OA 3GI9H 5I26A 1L9NA 5H37G 1EEUA 1SEQL 3MC0A 3QDJA 4GW4A 1CU4H 1IAKB 3WEXA 4NUMA 4OZHA 1XIWC 3C08H 3HG1D 2OXHA 2Q76B 2ARJB 3ARFB 4PRBA 2ODHA 2E46A 1LTXA 3T0ED 3ESNA 1RZIB 1J0JA 5JXAL 4WHYG 5L2KB 1GGBH 1X9UA 1A47A 2PO6A 3LQMA 4NYLA 5JPMC 3WHE1 4OFKA 1PQZA 3VYPA 4KK9D 1J05B 1FZKB 1F4XH 1ULVA 4OCSH 1ETA1 2YR3A 1JERA 1MHPL 4ODXA 3F7YA 5DC0A 4Y4HD 1TEYA 2J44A 3EDKA 4XOAA 2HKAA 2BS9A 1KYFA 2IPUG 5IFJB 4NQSA 3VFRB 4GG6A 3ISYA 1A21A 4PEEA 4ZMZA 5I71B 4I1RA 4J6RL 2AQQA 1J87A 3CWGA 4NO0D 1YSOA 4BFGA 1VSCA 5E9DE 1T04B 3BFOA 4IEFB 4A6YB 3GBEA 1HE8A 5F89A 5FB8A 2GTQA 4QRPD 5KBPA 3FMGH 4R97C 1X6LA 5EPMA 5FHAH 1V27A 5KEZA 4B53A 3FRPA 4J8QA 1AQKH 2WLYA 3H9SB 5C71A 1WWCA 1CLZH 3VA6A 4JPKL 5D2NC 4E9TA 5C0AE 4PRHA 4TSCL 4FJYA 3MCKA 5BJTA 3VG0H 5I1CH 1AZVA 4ZAKD 2J8HA 1NKOA 4KK6D 3ZXAC 1R3JA 1X3DA 3GTVA 4NO5B 1MCQA 2PYED 3DV6B 2QSVA 4Q8BA 4NNYB 4PJXB 3ZTNL 5EWIL 1TR7A 2N1KA 3S97C 1SJHB 3GSVB 3FTVA 3AC0A 2YPVA 1QSFE 2X6AA 5BOZG 1PLAA 1NAMH 4N2HA 5J06A 1MRDL 4LU5L 4WEBL 5HGDA 3THMH 3H54A 5GGQH 5JHLL 3B2DC 4PJ7B 5C86A 4NRZB 3T2PA 5KYUB 3PIQA 3EGXB 5F96L 4HV8A 5BPPA 5EF0A 2KLRA 1NGXB 1T89C 4KK9C 2NR6C 4PAZA 3ROOB 1KGCE 5I8KH 1FFNA 3RFZC 1Z0MA 3MOBL 4I85A 3ISRA 1P4IL 4PI2A 1HHGB 2FHBA 3FQWB 3KM2A 1GS8A 4PJ8B 1XEDA 5EO1B 4ZJ9A 5HBBA 1YYLH 3JV4B 5B8CA 2XG4A 2IBGA 1OW0C 3AWFA 4WI0B 3CVHA 3IPFA 3RGVD 1QTYT 3KXFE 4YSRA 5EIIB 1IEBA 1HQRB 2VC2L 2HWZL 1XF3B 3TV8A 1T22B 4ADJA 5A2CA 3HHSA 3RWHA 5KS9F 2PTVA 4BA8A 2JCCF 5IBLC 3HBGA 4OVUA 4QXUH 3U1PA 3ZLQC 3KPSB 4LLVB 5IKCA 3CDYA 2CO7A 4AEHH 1J0HA 4AY0A 2NSMA 1PU0A 3QH3B 2Z31A 1D7DA 5MEQA 3QNXB 1CURA 1H6EA 3L54A 4M1CD 1INEH 4X7CC 5BZWB 1HHKA 5D70H 1A6VH 5DJ6A 4HUVA 3QEQB 5FYJU 3DX2A 2LV4A 4PSPA 1UB6A 3OAZK 4RX4A 2RD0A 3G6DL 2AEWA 5TPWH 2R9HC 3HBQA 3SCMC 1M3JA 5D1QB 3ZKMD 1AXSA 4M7JH 5TQ0H 3FZUC 5IB1A 3BDYL 2K70A 2UYLB 3WFBH 3WO4B 1U0QA 1NTDA 5B38A 4UT6A 3SZ6A 4TLKA 1R33A 4CDGC 2OS7A 3ZTNH 4KJYB 1KPUA 3TA3B 1TMCB 2OMTA 3Q6FB 1AYOA 5HDLA 4OIBA 4MA3B 5JO5B 4N68A 5LGHL 3PWLA 2VDLB 3IXAA 3V4PA 1TSRA 3BD3A 2E6JA 4JPIB 5T1LB 3TX4A 4DHLA 4D0BB 3IWVA 4B5EA 5GZNC 4EN3A 2B9BA 4JHAL 4PUBL 1A7BA 5CIPA 1SXSA 2BSBA 1TTCA 1RJCA 3VFUA 1WBYB 5ACLA 3BVXA 1R5WB 4YHPB 1MREL 4U3CA 4BZ1L 4MMYB 4HQQH 1B0GB 1L4IA 2PN5A 3VH8B 3RZCB 2DMBA 4KAQL 1MLCB 3V4PL 3BVWA 3WIHH 3IMTA 4LLMB 3PAYA 1U95A 4OM0H 4IU3A 3ZIMA 4ZOBA 4LSUL 4AIZA 2DQHH 4KJWC 3JWNH 3G6JB 4G71B 4P2YA 3IDUA 4QRAA 4V33A 4KKCD 2JE8A 4XPGH 5I15L 5B3JE 4GBXB 5KW9L 4IS6B 2VXVH 2IAMA 4XPHL 2ZSVB 4XTRD 3Q43A 2NXZB 5D1QA 5F6IB 1DQKA 2ZP8A 4TQ8A 2EINB 1HYSD 2NZ9C 2R23B 1ORSA 4ICWA 3UTTE 3WNPA 3IDNA 3I50H 1FFNB 4K9EH 2NW2A 1YEJH 4XNDA 4MRCA 3S6CA 3UMTA 3FT3B 5I1EL 3LKRB 1UHVA 1TZOA 2EKSA 4S2SA 3TEWA 3K5SA 4D9LH 1IVLA 4Y89A 1TPXC 1UWEH 1K8IB 3D07A 3SN6N 3TN0B 4KZDL 2R7EA 3FUIA 2WXIA 4UQ9A 5EO0B 3RPIB 1PFCA 4E9LA 3STLB 5DVMA 3TO4D 4UANA 5D8JH 3QRGH 5EBWA 1QTSA 4L3AA 4W68A 3EW3B 1IGJA 4JY4B 2XETA 1L0PA 2YRPA 4YDLB 4Z9KB 1JNNH 3Q9PA 2NW3B 4MNGB 1HDMB 5HI4C 4FQXD 3LQAH 1JF1A 4LPWA 3OX8B 4BRJA 3UGUA 3S37X 1OD9A 2DWDB 2W0FA 3STZA 2HT4C 2W9DL 2HLFD 4NRXB 5CN2A 1AZBA 1A4JB 3H7LA 2VN5A 1RZJH 1TCRA 2XDHA 2UXGA 3QAQA 2Y22A 3P3RA 3OSVA 3GJFK 1H3XA 1KTCA 4RFEB 1CYWA 3ESPA 5LBGA 3U6XA 2XPYA 4HX1A 2F74B 2F15A 3UTZB 2YD2A 3F12A 1UOLA 3GNML 2KPNA 1JZ3A 4HA1A 2AJXL 2ADYA 4GXUN 3S98A 4QXGL 2EYTB 3T71A 3UCQA 3P4OA 1ETJA 5B39G 2GSGA 1B0WA 2A5UA 4KH9A 1AIZA 1RZQA 2GTWA 1MRFH 3AWGA 3D39E 3FRPB 1H3PH 2BW5A 3FB7B 3KH4A 2VLKD 2XHNA 4TNWK 3SDDB 4DVRH 2GUOB 1E90A 1R5WA 2J2ZA 1JXGA 3P40A 2XSKA 5IOPA 1YRKA 5FCSH 2GJRA 2NY3C 2B2XH 2BVTA 2D4FA 1U8QA 2BVPA 3PFUA 3QORC 2GI0A 4L5FH 2SEBB 1H0DA 3WFZA 5EBGA 4JUSA 5H37A 1YEJL 3CG8A 4YC2B 4L8SA 3NEOA 2WVSA 3VFRA 1WSST 4GG6B 1AI1L 1ETZB 1XF5B 4LCUB 1M57B 1IFGA 3O2WL 4LCIL 3SO3B 3LIUA 1DVFA 4DERA 2FUTA 1R75A 4IU2B 2IO5A 3SYCA 3QQ3A 4OGXH 3EUDA 1AVAA 1WH0A 3CZJA 3FQ4A 4I5BB 5CUSL 1JHTB 4YR6B 4Y2LA 3CTTA 4YVUA 1J12A 1Q9WB 1VEPA 4IRSD 5GGVL 3CMOL 2A9AA 3I84A 2LHAA 3US0A 4IOFD 4KXZH 4PTTA 1YN6A 4LK4A 2ARJA 3ARFA 1I3GH 4LBAA 5CHNB 3V0GA 4UBDC 1SMAA 3T2LA 3V52L 3CZEA 3QNXA 1O7VA 4GRLB 5E9AA 2FJHA 2APWA 2AABH 1AO7D 3RUGE 3VXQB 1V3JA 2RBLA 4LVEA 5KW9H 3FC8A 3OMNB 3ZRSA 4OD3L 4M00A 2UUDH 4L4VE 4OCMC 2XTJC 3PLYA 1P6WA 4EI5C 1PDKB 1AGBB 4XNQB 2XN1A 4DTGH 3MV8A 2VDQB 5D93C 4CC0A 1W15A 1RH8A 3V6OA 2EABA 4N0FA 4QRRB 4M1GH 3AITA 4RGND 2DY2A 4FXKB 1IBYA 4Y4KD 5MEOB 4F1ZA 4PB0L 3LQAC 2J55A 1OV8A 1W8OA 3MCLH 1MFAH 1S5IH 1OGTA 4NFCA 1KN2L 2UZIH 3WIHA 1MNNA 3SDCD 5D2NA 5DT1H 5J1AB 4UQ2B 4YO0B 2E5EA 5IW1A 2FL5A 5ID0B 1LP9F 1NMCC 4B27A 2DICA 3G6JF 4ZS6D 1X9LA 1EMTH 4OLZH 2P80D 2Y7SA 4W93A 5E1IA 3QW9A 3V9FA 3BPOC 4Y4KA 4XH2A 5LBSA 5E8EA 1A4KB 3AADB 2H47C 4N2EA 5DRZA 3QCTL 4CMHB 1MUJA 4LDOB 3WNMA 2CO3A 2D8KA 4UNIA 3VM7A 3P4LA 4UT7L 1OAXH 3JVGA 3L3GA 1MHEA 5EIQA 1O6VA 3VFWA 1KCRH 1UJ3A 4LRNL 1D7CA 4J3TA 2IAMD 4ZUWA 5C9JA 1LQBC 3TEYA 1TEGA 1K5NA 3AG3B 2YAEA 4PJAE 1DQQA 4Z7UF 3GIZL 1NDTA 5JPNA 2FX7H 4PRHB 1FV1A 4N0UE 4NOBA 2B1OA 4PYGA 3NIGF 5MI0B 4QWWD 4F24A 1LDPH 1KBGL 4YHNB 2CRYA 1U8IB 1JPSL 4NQDD 5LDSA 2P24A 4RFOH 1RJZB 4A6YA 2YOAA 3KS0H 1HKLL 4M62L 4G5ZH 4PJ9C 4OIAA 3N91A 5SV4A 1Z5HA 3HMWH 3AJ7A 5CBAB 3H9HB 4GW1B 1QYGH 2G9HB 3OZLA 5I19L 1HJBC 2FBRA 1JI2A 5AOZA 4Y2DB 3GBML 1ERNA 3RTQB 1BF2A 6PAZA 3NPSB 5HHNA 3TF4A 3UTSE 2I25N 2DTML 3EDDA 4TUOA 4PG9A 1B4RA 3CSFA 4XMZA 3BKJL 1BVZA 1AC0A 3NIFB 4GJTB 4JO5A 4PWFA 1KYOK 3WNJA 5AW7B 1T5XB 5I74C 2XU9A 2Z4TA 5E9NA 3FRUA 1IJ9A 4CA4A 3ATEA 1EJ6A 3AXLA 2YC1B 5DS2A 2FVNA 4ABWA 2VN4A 2XQBL 4I0PB 2B1HH 1I8LA 4Z3TA 3RUGF 4JN1H 5GGRB 3NFSH 4ELKB 4IHBA 2FBJH 4KTEH 5BVPH 3GXNA 3VFOB 4Y4FA 1U6AH 3MJ9H 2XY2A 5DJDA 3Q2WA 1MFEH 4TRPL 3O6ML 2VLJD 3V6ZB 2PLTA 5C0DB 3Q1SL 2JELL 1F56A 1RI8A 2CJUL 4KUCF 4S1DD 1HHJB 5MENA 1L3WA 2HTLC 2H1PH 5J8OA 2FR4B 3B37A 3ZDZE 2GC4C 5H4ZA 4U0RC 4QHPA 3ZMNA 3NSJA 2WZ5A 2EVIA 4LP4A 3GMPB 4U7KA 3A4AA 1ONQA 4RQQA 4RCAA 5LUMA 2CIIA 1JYNA 3IJEB 5FO7A 1XB3A 1WAAF 3E3QC 1JXDA 2PP9A 4FQXB 1AZUA 5DK0B 3OJDA 1AAJA 5FW7A 3MNDA 3LN5A 1SMDA 4DP8X 3LY6A 5SWSD 3LPPA 3FFDB 2ZUWA 5AKRA 5F7HA 4NCC1 1XAUA 4G5AA 4PGEB 4QKXB 1QRNB 1RERA 1QBBA 2HMIC 4RZCA 5FUOH 2R69L 4GRWF 2DEYX 2LTQC 4HWBA 3RP1A 2OKMA 1JHLL 1ZY9A 1FL3A 3CLWA 3QCVL 2QVTA 2EDOA 2VR7A 1HXMA 2L7QA 3CFUA 4EDXA 2DF3A 5JOFA 3VW3H 2FATH 3QEQD 1UVQA 4XPGL 4YQXH 5IGXL 1AGFB 1J48A 5FFGA 3PL6D 4JFSA 2WGXA 4WFHE 4CJ0A 2JQAA 5FDYA 1MLBB 1NLBH 1UD4A 4Y5VB 5F8RC 1ZD6A 4DN4H 1BFOA 4R2GC 5CJXC 3IE4A 1O0VA 3HUJE 1F6AA 1OAUH 3ARXA 3EOAB 3RKPA 3V5DB 1SMOA 3WN5B 1CXFA 3AMLA 3VXNA 5HY9B 4FXGB 3UTSA 3EH4B 2YAHA 4YL9A 3QJFB 2EXYD 4OJAA 2MOVA 5CKGA 3BAIA 2A1WL 5AYTA 4Y9GA 4JDZA 1BHGA 4IS6A 3IT8D 3EOTL 4XXDB 4OF8A 4XNQA 3AW5A 1TLMA 2VDML 1UD8A 2I5YH 2FECL 3G5YA 1H6FA 1M56B 2XVLA 1EXUB 4KKAC 5I0ZA 4TNVF 4M1GL 1BZ7B 2A6DB 5AOMA 5K1NA 4GP4B 5D2NB 1PF3A 2BOBB 3MBED 3EO1B 4HKZB 5L6YH 5E2VL 2W9EL 4YWGL 1FZJA 4E42B 4WEEA 1BJMA 5D2LB 5DRXB 5T3ZH 1LE9B 3LEXA 3H2QA 1LM8V 5HJ3A 3G04A 4O4YH 4QHNB 5AW4B 2AEPH 2DM7A 2NNAA 3E8VA 4HKXB 5D7LE 4LHUD 2BP8B 4AEFA 2IXQA 4ILDA 1HVXA 1TEFA 2UXVA 1X5ZA 1SXNA 4LPVA 1S7SB 3UXFA 2L8AA 1SFHA 2XWJA 3P0VH 3R8BB 4UZGA 5DA4A 4HUCA 4Y88A 4XNXL 1GGIH 2X4SA 1AGEA 1FZMA 1NFIB 4PS3A 4QXGH 3SBRA 3OG6B 1RXLA 1C08A 4JFEA 5E08H 1FO0A 4QRQB 3D18A 1ES0A 3VGHA 4RIRB 1NINA 2NY2D 3C2SA 4K5MA 4G8IA 5DTFA 5TF0A 3VXOB 4UT9H 2V2TB 3VWKA 3KL5A 3CZNA 2AQRA 5GRVL 4JAMB 1M7XA 4ABVA 4FHJA 1MFUA 2BSSB 4XPFL 2ZKXA 3WY1A 1NH6A 3CVCA 4PV8B 3L1EA 3S96B 1UASA 3LN4B 3N41F 2C3VB 1R3HB 4K9EC 4MVBD 1DFBL 4KVNL 2HX9A 1GIGH 5TFSL 2WQVA 1G9EA 4XVUC 1JHTA 4H2CA 1U2YA 4OSUL 4HU8A 1IFRA 3HE7C 1MXDA 1MWOA 2LLNA 3E80A 4OCWL 4QGYA 4TS6A 5B8CB 3FO2B 2VWEC 4OCRL 1JN6B 1S9VA 5B3SB 4NQEE 4XVTL 1CFNA 4FTVA 4Q4IA 5DJ2A 4JDEA 3ARPA 1NC4D 4Q56A 3LKOB 5DD3L 4E0RB 2B39A 3LMJH 4H0LC 2X4OA 4O02H 1DBAH 4I77H 4MJJA 4YHNA 3UTQB 5F3HA 4L4TD 5IWLC 2BP0B 2ESVB 2K78A 5ALBL 3C9NA 1QABA 1FYTB 3DYPA 1BIHA 3GMQB 2X1OA 4JZJA 4QYAA 5ECGA 1HEJC 2H6UA 5IQ7H 3KNBA 4QI3A 1EGJL 2H2PD 1M7UA 5JUEL 3EH5B 4AGNA 3N1GC 2DAVA 3AREB 4WEUD 4FKKA 3FH8A 2QEJA 1MCPH 2XFXA 4N2OA 4NHUB 1MFMA 3W5NA 4AMXA 2TSAA 1VFAA 3MOAH 1GTFA 4U4BA 1JF1B 2X41A 4HEMA 1NEUA 3WXVL 2ENPA 2JJSC 1UUNA 3CXHK 3APCA 3EHBB 3B6SA 2IANE 4JFED 2P4AB 1T3FA 4N0YH 4L8SC 3KYOA 2V8MA 3ARDB 2W65A 5IB4A 1YNLL 2A73B 1B2YA 2O61A 2O1AA 1ZK9A 3MV7D 4HSAC 3LVEA 5CBEA 3TT1L 3HS0B 4PRAA 2CWRA 4L3CB 1PIFA 3VNYA 1RAMA 1JWUA 1W6WA 2XFGB 5BQ7B 1C8PA 2V17H 4FN0A 5TF1H 1GGBL 5C2BH 2JJVA 3NDYE 3F7PC 1ZCRA 4IJ3B 4B9ZA 4Q6IC 3C08L 1VHPA 2OQJA 2HXAA 3ZOAA 3NZ8B 4UIMA 5IEKA 3BW9B 3L2LA 4GRLA 3NABH 4ZPTA 3TFKD 3O6FD 4L29A 4JZOA 2FE0A 1MJ8H 3FTGB 1PW3A 4BUHA 5DD1L 3IXAB 5DQJA 3E9UA 1TJHH 3MRBB 1M2OA 1KCKA 4OKVA 1EAOA 3SYPA 2GUOA 3ZU8A 1A9VA 3F83A 2F19L 3MRFA 5DI8A 1TYJA 4OGAC 3HB3B 4EO5A 1KXVA 4FNTA 4UTBL 4WWKD 4TLSA 2Y72A 5IT2H 5F96H 1FNAA 2VW4A 4TSBL 4F57H 1CGXA 3N41B 1JAEA 4QOKA 4WCYH 4UUJB 2EKJA 3S35L 3IFOA 1ADWA 2VN7A 2R0ZH 5C0NC 2CCLA 3Q9QA 1QEXA 4B3EA 3HG1A 4D9RE 2ITCA 5T3ZD 3NIGE 1LVEA 4MA7H 3L4ZA 2FX9L 4NERA 4XC1H 1NCWH 1NM9A 3SDAC 4AEIL 3IYLW 5AVTB 4FL4B 4FG2A 4WI4A 4IRSB 3RFZB 3KHQA 5CN1A 2ITFA 1IU1A 3BP7A 3PWPA 3ZE1F 4PRNA 4ZTEA 2VDRL 3V0DA 2ED6A 4AOFA 3JZYA 4XPAH 5AKSA 1CXIA 3SGEH 2DMGA 3K72B 4JY5L 1P7QD 4L1BA 3O8XA 3T08A 4WJ5A 4X7DC 2DWDA 1QBAA 1U3HB 2VERA 4D8OA 5FFLA 1SM3H 3N04A 3FOLB 3MLVL 4GKSB 3SSGA 3DECA 3GBMH 4R26L 4BSVA 4LVNC 5BNXD 3QZPA 3ZHNA 3O3EA 4EN3D 4PRDA 4WTZG 2IOIA 3O6FB 4DPCX 3JVFC 4JQIL 5EBWB 3RWDA 1D7FA 1LP9E 5AL8A 2W07B 4HG4J 4YXKL 4QMEA 5HGAA 3SZKC 4WU5A 3O4LD 2CUMA 1XZ0B 4DNLA 2EDDA 2EIBA 2AABL 2L4OA 3BIBX 2PABA 4P2QB 4FD0A 4HP5A 4P57B 1E65A 1UZ8B 2QKIB 4IOSA 1OGPA 3CSGA 4MWFA 1HHJA 3GSOA 4NBZB 1T6BX 2Z35A 3NYKA 3IFLH 4OZFA 5DSCB 3VXRE 3FTWA 4Z3GA 3JV4A 4TQHA 1OB1A 3PWNA 4A1RA 2PPFA 3QA3B 2WVTA 1LYQA 3L3DA 3PY9A 4JREB 4E41B 1QKZL 5CEYB 1W8EA 3ZMRA 2EVFA 3NCYP 4HKBB 5IMLB 1V05A 2A6IA 3CE1A 2ZIDA 2F7IA 4K3JH 1IV8A 1DCLA 1ZT7A 4BJLA 3DJTA 5D1XA 1BBDL 4R90L 5INCA 1DFXA 3TASA 3WBDA 4DFIA 1V54B 3W38A 1R9FA 3B3IB 4HYTB 5CEXA 4H8PA 2J8UA 1NMBL 4FKHA 5KSBF 1U8OA 5HHMB 1RJYB 1NL0L 1O5DT 1TKWB 3TIEA 4LSQH 4RGOL 1EMTL 1YNLH 1GS7A 5D2LE 3VGGA 1P7BA 3G5XB 2D0FA 2IAMB 4KITB 4G8EB 3SJVD 1VFBA 5DTFB 5CLZA 1C5DA 2YLKA 2GJZA 3D69B 5F88B 2NLJB 1QTPA 2JTDA 2YIHA 1OO2A 4JG5A 3UZQB 3IGLA 2YBGA 4GXFA 2IH3B 2WPGA 1A6UH 3PAVA 3MNVA 4PJFB 3VGFA 3IB4A 5D5MB 1SM3L 4PP2B 1MHCB 4X5RA 1OQOA 3TVMB 3C60B 1D5XA 1AR2A 3TONA 2PPDA 1KCLA 1TNMA 3MRMA 4PWJA 4D7BA 5AENA 2ALAA 4JFQA 3MLPA 2XVBA 1XGTB 4AUJA 3S2AA 3DX9A 4W9DC 4Z0BL 4HLEA 2Y7QB 2GIXA 3S2CA 3TN0C 3H4FA 3QIUC 2IOMA 1EBPA 3O8XB 4RISH 5AW5B 4OT1H 4Q2ZB 2RAMA 4NHCH 4PCSA 2AV7A 3ORJA 2CO7B 2HFEB 3O2VH 3HMXL 1ZS8A 4B9JA 3Q8EA 2DQUH 4U2YA 1ZLUH 5CBEB 3ELQA 5CD5C 3M07A 3UACA 5L2KA 2EXSA 3HAEB 3ZDZF 1CXKA 5HJGA 5AW8B 3BPNC 2BY3A 5IHLB 5JOEA 4FHKA 1DLFL 4G6FB 2VMJA 2WWOA 2Y5EA 5CO1A 1J5DA 1EUTA 3MLYH 5AW0B 4GAGL 2XQYA 3MUJA 4ZX3A 3V4UH 1N6QH 5IIEA 3DHMA 3QJXA 1JCKA 3UYRH 4RMRA 3PCYA 1J7VR 3ZYIA 4Q0XH 3RL2A 4PJ5D 4K7PL 1AR1C 2C9VA 5DJ8A 1RHHB 1JXKA 4Z77A 5ESQA 1I3VA 3FOMA 1BGXL 3EOAA 1E5AA 3S37H 4KQ4L 4AXWB 1BLNA 1JNHB 1KENL 1AD0A 4ENZA 3APDA 5EEXA 4LSSH 2IPKB 3TM6A 4DGVH 1PZ5A 3DSNB 4LLQA 4AKQA 1A3RL 4OZGF 3RIAK 3KPNB 3IJYB 1SN5A 5D2LA 1D6VL 2PW1B 1T66C 3PWJB 5E2WL 3VRIA 2KLTA 2IANB 1YEGL 1F42A 3QI9B 5EU6B 1NMAL 3OD3A 5I1GL 1EXHA 1R3JB 2X88A 4WUUD 2MHAB 4LEBA 5C7XH 4OM0L 5HYJA 4M03A 2A6DA 3RL1B 5E8NA 4HGWB 3IS0X 3VXUA 5J9PA 1U8LA 3CV5A 2VMCA 3N1QC 3DX3A 3GEWB 4HCFA 2B5IC 1ZHLB 5IB4B 3QFDB 5F9AC 4BQ8A 1OCWH 1PZUB 2C8NA 4GG6F 5HGDB 1I7UB 2XQYG 5HHPB 1AGFA 2VAAB 2VITB 2H6OA 2OXGB 5F93C 5A43C 3SE3A 2NY1D 3MRCB 1D5IL 3GHBL 3NBNA 3DUSA 5KSUA 2NT1A 1BF8A 4A6YH 5CINL 2P8LA 2HVKB 3BAEH 4MNQD 3WL9A 3MLUH 1EDYA 2O26U 4IKLA 2OMZB 4AQZA 1LK2A 1EEYB 4BZ2H 3OGCA 3QWRD 3AU1A 4ZX5A 3CFMA 3I2CL 2BIQA 3LRSA 4PJCB 5JLZA 1T89A 4TUKL 4N0RA 1EO7A 4DZBA 5KYXA 2JKXA 4W9ZA 3O6LL 1ECYA 4E0RA 4ODSH 3ZUCA 3BKMH 5FKPA 1N5AB 4D7PA 1JNLH 3GSRB 3UC0L 4L3ED 1N0XH 3H3PH 3PDGA 4OCXL 2E75C 4JS7A 2JKSA 1Q9LB 1TQCC 1M2VA 1FL6A 4X9GA 3HVNA 4HHAA 4K7PX 2VXQA 1Q9KA 3KYNA 4Z0BH 3NSDA 4L3FA 4F9PC 3HE7A 1AKJA 3KDPB 3VGBA 4D2NA 1R46A 4HKXA 3PGFH 3OKNB 4KX7A 4Y7MA 1NSNH 3G6AB 1ZA6B 5E4EC 1IAII 1T5WA 1ZPLA 2DM2A 3S7GA 2CHDA 3HG1E 3CX5J 4BKTC 4FLHA 2YMXH 3FB8A 3TA4D 3SGDH 4YSSA 3FUHA 4ZW8A 1WT5A 5DD3H 3FONA 5FGCB 4NUPA 1FZMB 4Y4HB 2WANA 4XP4H 5I6NA 3CN3A 4CU7A 1AANA 1IC5L 2YQBA 2XKNA 2MCPL 4GSUA 3T8MA 3UP6A 1FGNL 5A6MA 1E7UA 1O9WA 5AYUL 5FF6B 3CFIC 3MCLL 5EBMA 3ULVE 4ZW7A 2CUHA 3K2IA 3WLWD 2CBPA 4OJFH 1HCYA 3FT2B 3U30C 3VXRB 3K0WA 3F85A 4WW2B 1ETB1 4E9YA 4XTRC 2IDCA 2OI9C 2PXYB 4H8WL 4FXGA 3TOPA 4LFHD 1TQSA 4U1HB 3X17A 2EDEA 2QDVA 3IMBA 3BH8A 3D08A 1H8NA 2N4IA 3WU1A 2E8YA 1Z9NA 4ORGB 5SWZA 1LEIB 4DQOL 4RH4A 1MI5D 3ARSA 2G9HA 2EEXA 2WNGA 4LNRA 2XX0A 3U9PH 5I16B 5KVMC 3G3LA 1REIA 5CP7A 5DJXA 1ZA3A 3DBSA 3GMRA 3IRPX 1I1AB 2GJ6E 5C0GA 3LKSB 2MQ3A 5FO8B 2HVKA 4NFBA 3WL9B 4K3EL 3PFQA 1A02N 1ACXA 1IGML 5I6XB 1NFDF 2QMKA 4R83A 2EYRA 1DLHB 3NCJH 5KVGL 2DLHA 4GRLD 3T3ME 4FYTA 3W1ZA 3LNDA 1XGUB 1QUNA 2GCYB 1Q9OB 1LDPL 1MWAB 1G0DA 4ONGH 4UQ3A 5JQ6L 3A4DA 3L48A 2J6EL 4OCLC 2O6PA 3A23A 5F1NB 3M1OA 2XQBH 2X7LB 3T77A 1IGYA 3D09A 3JWNE 3CC1A 3V4VA 1CFSB 4ISVB 3QEUB 1KCSH 4Z77B 1CGSH 4FF9A 5B21A 4ZMPA 3CCHA 3RGVC 4AK1A 3FH5A 1VADB 2A9ML 2V9RA 3N85L 3II1A 4Z7WA 1T21B 1OAZL 4N0FB 4QRRA 1OARL 1OPGH 5T1JA 3NZHL 3ARWA 3Q6FA 4R97B 5I0XA 5MENB 2A73A 3L7FA 1HFUA 2FX8L 3UOAB 3WMQA 1AHMA 4BINA 3DIFA 2UZYA 3B9KB 4P4RA 3AB0B 8PAZA 4LLQB 4RMBA 3LQZB 1TVDA 1OTUD 4AENB 4Z76B 5FECA 1BZEA 1HT6A 3ARBD 1XCXA 1QYGL 1NCWL 4IMKA 1HSBA 2K8QA 4AMWA 3O41A 3GMNA 4D0DA 4OLZL 4EEEA 3EFFB 2G3ZA 5AW6B 4DKEH 4RMUA 4J3OC 3HMXA 3L16A 2P47B 2MTAA 3GRBA 5GGRY 2CDFA 4Z1PA 1P4LB 4AL8L 5CEZD 4I1NB 3U4EA 3NABL 3TWCL 1F6LL 4DVBB 1K4CA 3N43F 3FONB 4OV6F 2WV3A 4HCIA 1E4XH 4P2CG 3HI6L 2FBJL 4PJXF 3LS4H 1AYRA 1TPXB 2JB5H 4QRUB 4KTYA 1F11A 3KPRD 4KXBA 2QSTA 2YRZA 4FP8L 3RWIA 4WWKB 1GL4B 3MO1B 4LP5A 5HGBB 5FYLL 3CZSA 4LKXA 1SGKA 5KTEL 2XZQH 3PQYB 5C0RH 4HUUB 4GKOA 4PRIA 4Y9BA 1HHIB 1Z3GL 2P1YA 3GBNL 4K8RD 4BEIA 3C60D 5IQ7L 2XPGB 5JPNB 1U2CA 3VWJB 3AQXA 3GBLA 3OLEA 3VXSE 3WE1A 2NNCA 4BFIB 5IW6A 4G8GA 4IRJB 4XP1L 3UBXB 3QQ9C 3X14A 1RVFH 3NCJL 2OSXA 4YGVA 5CCKH 1MVUB 4X80H 1DSWA 2DQJL 3NCYS 3FQXA 1F02I 1CFMA 1T2QL 4G1EB 1TYRA 1IQDB 1NAML 4YDIH 3G5XA 2YMXL 3HVDA 3PWPE 3W37A 2C1OA 3MUY1 2N3JA 5EIVA 4F7KA 1S7XA 1U3HD 3M17A 2LABA 1BAFH 3CFNA 1V3LA 1AIFB 1HILA 4ONFH 2HG0A 3LPFA 5L2KE 5ALCH 4N90D 1OARH 1OPGL 4DOHB 2OMZA 1KLGB 2MHAA 4U6HB 4WU7A 5FAAA 1TUPA 5I6LA 3LPWA 5FGSA 12E8H 3SCMB 3TCLB 3CDCA 2Y36L 4M29A 2CO6A 3CLEH 3DX9B 3MJ9A 1WRFA 43CAA 2A6KB 4Q6IB 3ARFC 1V10A 5B1JA 2F68X 1CVSC 2Q10A 5ABAA 2OMWA 5CIPH 3GB7B 4Z8FL 2Q9OA 4WFGE 5HGHB 4HKJB 3A4EA 3V4PH 4WW1B 1HL5A 4JRYE 3WIHL 3QZNA 3ZDYE 4HULB 3DMMC 5FUCC 3P4OB 2FSEA 2WYHA 3DPBB 1A5FH 3WHXA 4M6NH 2BNQD 1HQ4A 5D6DC 2AXFA 4LCYA 1A7QH 4JQVA 1F4YL 1SDDA 1QVOB 3EGDB 5D7SH 2ID5A 3Q8FA 4BH8A 5IHUL 3GMLA 1GHFH 4ATWA 1CFVL 3O4LE 2Y24A 5C6PB 2UZXA 2GHWB 1W0WB 2VLLA 4PJXE 4K9JA 1YQVH 3HB3D 3ALPA 1QO3A 3O4OC 3SDXB 4JZNB 1VF5C 2F5AH 3QJQB 3ABGA 5CZVL 2AQ1A 5AZEH 1MCHA 5DJ8B 4ZOEA 2CA4A 1JNJA 1Q4NX 5D1XD 4W4OC 4E9SA 4LBEA 1Y18A 2BRRL 4WFEE 1YN7A 4X8JA 5I0YA 5EOCH 5AUMA 4U33A 2W81C 2JB6A 3ULUF 1CWVA 1G9NL 2DQEL 3D39A 4ZUUB 4ZYKB 3OC8A 2UWEE 1JK9A 3C6SB 2H9GA 3FXIC 4OD3H 1XR8B 4AZ8B 5T3ZL 2XZCH 3GI8L 3K1DA 4YHIB 5I24A 1PZ5B 1AD9A 2XY1A 2N0MA 3DSNA 3T8XA 4XT1C 2DWSA 2R23A 2A77L 3UPCA 3RDTA 3V2AR 1OOWA 2KHAA 2X3BA 2A74A 1Q0XL 1TQTA 5JIHA 1JUFA 4MJIE 1JE6A 3UGXA 3FPXA 1JDAA 4GEIA 3D0AA 3AQYA 4Y8AA 4LLYA 4F5CE 2A74C 2YPLE 5DRNB 3VD5A 5D71L 1N18A 3DO4A 4A2MA 1M7DB 5B1BB 3RWDB 3CFBA 1WBYA 5I16A 5LG6A 2VL5A 3BPCB 4KVNH 3VFPB 3MUHL 4TQPA 3O45B 3P0GB 4CJ1A 1DCEA 4V11A 1UOVA 5DC4B 5HPOA 4FLRA 1VAHA 4OGXL 5BRZE 2R0LL 3HZVB 1N3NA 2EIZB 3BH4A 5TDOB 5KSBB 2YPVH 5SX4H 4AIZB 3PXLA 5DVPA 4BQ9A 4Q9QH 5B7EA 5J7CC 1CDGA 3LIZH 1AKJD 2ESVE 2ZXGA 2JJTC 1BZQK 4M43L 2WAQA 3FCUB 2NYYC 4TNGA 4CSTA 3FU6A 2BS71 2E6QA 5C0EB 3GUTA 2CIKA 4HKBA 2GJ6B 5IMLA 2VE6B 3GLEA 5C2UB 5I8EA 1S7VB 2WLKA 3VFUB 5MHSE 1BFVL 3VH8G 4CGTA 3AROA 2AQTA 2ZUYA 3X1EA 3US9A 3QUML 3QO1A 3LRGA 4B0MM 4RAUB 2J71A 5CZVH 3EDJA 4UIMB 5IEKB 4IBUA 1U8OB 2VJ0A 4RAHA 2AXFB 3IKKA 4PJEF 3IKCA 3FRPG 4W9GC 3QG6A 5FO9B 2E27L 2PTTB 2XOTA 3IDMA 3WV0A 2FUQA 2VLMD 4R4ND 4CMMB 1KXTB 1DUZA 4KU1A 1TTAA 4EI5A 2GJZB 3D69A 5IVXB 2LU7A 2OP4H 3EFFA 5EEUA 1PKQA 2FO4B 2ZWZA 3AUVA 4QUOA 3OX8A 3BWAA 1J1PL 3GJFB 2V3DA 2WLJA 4HJTA 4CADB 1NJ9B 3BP6A 4L9DA 1NPUA 5CGTA 1XGYH 3EUUA 2HMID 3U0TB 2D3VA 1HSAB 3L9RB 3DYOA 5IFAL 5I1LA 1OTUC 3KGRA 3WLBA 2EC8A 1E9PB 1T0OA 2Q3ZA 3ZGHA 1LK3L 3UJIL 3NJJA 4Z18A 1NPNA 3ABMB 3ARVA 4YBQC 3JXAA 2W92A 2NY5C 2X05A 3B9KD 3CIAA 2P52A 2NSQA 1A1NB 4WAFA 3HUJF 2IQ9L 4FQHB 5AAPA 4NNPL 2EH8H 1R1CA 2R29A 3O11A 5KOVC 1OZUA 4X8XA 2LAGB 1G9HA 5FM8A 2EUXA 1KBGH 2R4RH 3TEUA 4YHMH 3ABZA 5JHBA 3BO8A 2XZAL 1CF1A 1SJHA 2ZXAA 4FFVC 5CJ5A 3SCMA 3TCLA 1MNUL 4R8WH 3DJZA 12E8L 5H94B 5BUAA 4MB1A 2Z31C 4QLWA 5IQMA 3MN8A 2Z6FA 5HTSA 1GY2A 5TQ0L 4ZFFB 5JPMA 4HPHA 1UZGA 1NFKA 2NY6B 3C6LD 1ZIAA 4P5KB 3RGVA 5DJZA 5BS0D 2DIBA 3E9TA 3HZVA 4HUUA 4PI0A 1OAKL 4X83A 2ICWJ 5CP7B 4FA7B 5T5NG 4E9QA 2DKMA 2IGFL 2QVIA 2P5WE 1QSEB 5IB1B 4F2FA 1SF3A 2VXTH 1WIUA 4OF5A 1OK0A 3VWJD 3B7SA 2XA8L 3MNZA 3QHTC 4U4IA 3QUXA 3ZHFA 1OM3H 3U83A 5C3IA 3TV3H 2QV2A 5SWSE 1CGSL 1M4KA 4HEPA 1UA6L 3SOBL 3GUTB 1N68A 3EJYC 4EI6A 3NGBC 3PWLB 4JFZH 3M46A 4NQDA 4PGCB 4HVBA 4U3XA 2G9KA 1EZLA 5BQ7A 4NRYB 1R47A 1COBA 3KXFD 4APXA 1N12A 1LP9B 2F54D 5ICUA 5CLXA 2Y3AA 5TDNA 3RWHB 3QEHA 4KTEL 4NGHL 1XD0A 5EEWA 2BP8A 2I07A 3CX5K 4OIFA 3KLHC 1QATA 1K4DB 5KBLA 4UV4H 3RWCB 2ICES 4FI6A 1E2WA 3ATBA 3C8DA 3T6QC 1YNTA 1USQA 3GGWA 5I5JA 5D6CB 4JZOB 1PY0A 4JHVA 1O75A 4LRIC 1NAKH 4KGLA 1RU9L 5FUZH 5E2TH 1LEGB 5L88H 4X0KA 4K71C 4ZAKA 4UTBA 3IMUA 4OQTH 4AM0Q 1KBKA 3B8YA 4U1GB 1MFEL 1CI5A 5GRUL 3V4VB 1DEEA 3DNKA 2G5BA 4DUXA 3ZGIA 2VRAA 1LWJA 3M88A 2VMDA 3WEOA 1SLXA 1T1ZA 3TL5A 2C9SA 1UKTA 1JK8A 4DO5A 2IH1A 1I9EA 3ZKSD 5I1KH 2R1WB 4R8WL 3KWWA 2ED7A 4JRXD 4PJ9B 3CBJB 5DHMC 1BBDH 3IETA 4Y1AE 3QRFM 3BN9C 2NXYD 4HHGA 2F18A 4KQ3H 2QTEA 3SE4C 1KCRL 5E03A 4ALAC 4YC2C 2UY7B 1QEWB 2YO3A 2IMMA 3NPSC 2ZWKA 2NPLX 3E6FA 3QHZL 2OMUB 2OMYB 4LCCA 4OLUH 1SHWA 3QNZA 2FX7L 2Z8SA 1IC4L 3ALWA 1ZHKA 3CVBA 5GRJH 3WUZA 3DX1A 4P9MH 2VLLB 2VDLH 2M1KA 4U6XB 4JFYB 2ZJSL 3L3IA 5EN3A 1RZ7L 4CN1A 4G9DA 3GSVA 1LK2B 2ZAHA 1RZ8A 3M45A 2XBZA 5DMGD 5DVKA 3MHZA 4NENB 1NSNL 3ULUD 4I87A 5DHEA 3W0WB 3CPLB 3KMDA 2CSPA 1U58B 3MOQA 4KX8A 2GVYA 2ZF9A 5ERWB 1WD9A 5T1LD 5ANHA 15C8L 4YS4A 1KG0B 3L3HA 4HFWA 1CDIA 2B9AA 4XP9L 3W3BA 4Z7VF 3T2NH 1JGDA 3V5HA 1A4BA 2ZXDA 3BUYB 3D85B 3ESMA 2R56H 1CB4A 3D9AL 2YPLB 4QRPB 1OTSC 2EDKA 2E47A 2G60H 3I75B 3LVTA 3IDMB 1YEDB 3F05A 4P2RB 2CGRH 4P3DB 1X5YA 2FZ3B 2B1AL 3JYCA 2X6CA 1ED3A 1DN0A 2VYRE 4PU2A 5T5FL 2XWDA 3VM5A 1R3LB 3N85H 4FFZH 2WLLB 5AFAA 3QCTH 4RDQF 4WNQB 4HOMA 1RUPH 1IKNA 1I1FA 1HIMH 4H7VA 2KZBA 3PWJA 5EZPA 5GSVA 3QRLA 4YSTA 3QQ4A 5ENWB 4FQ2H 5E4OA 4NS0A 1P4LA 1RIVL 2FQFA 3RWCA 2QSQA 2HA1A 1WA0X 3FCGA 4NQSB 1CT8B 3L5IA 2AKRB 4FQLH 1MEXH 1U2HA 4WUUE 1U33A 1WPCA 1IE5A 5LAXA 2WINB 1TU2A 3OXSB 5BOJA 1KXTA 3IFNL 2WO4A 1GAFH 4JCMA 4LGRB 2ZUXA 5GS2D 5HGBA 5F7EL 3WFDL 4HU2A 5DRXA 4K3EH 1H3WM 1N67A 2BIPA 2DQTH 2XRAL 4U6TA 4L0ZA 1X5LA 2NNAB 3O0RL 1KJ2B 1KCUL 3W11C 3DXAB 4E2OA 4R7NB 2X1QA 2Q86B 5L2JA 3EOYG 1CLOH 2YD7A 4XC3H 1CIUA 4CMHC 3C5SB 5DJDB 4NUGH 1XT5A 3KBFA 4MKMA 5E6IA 5FA4B 3FHAA 3J27A 3CZFA 4NJAH 2JCCB 4FHBD 2JI3A 3VD1A 4LIQH 1YVLA 3G6JA 1RPQA 2VRQA 4WHYH 4WFFE 5CAYB 3B7RL 3ETTA 5I66A 1YMMD 3VFSA 3G08B 4WHTA 1GXEA 3FU7B 1MH5A 1OAYL 1KB5B 4KK8C 3GXIA 3FKUS 4JDZB 2WZ0A 4PJCA 2Z9TA 5JLZB 3KPQB 4BUGA 2ZX9A 4N2NA 3FL7A 4OZHB 3NCEB 4NQXA 1WFOA 1R4XA 3GRWL 3T8XB 1N2RB 1BZDA 3CN1A 1WAEA 3FN9A 3L3IB 4HK3J 1ZMYA 3AG4B 3MJGX 5E1AB 3K6DA 2D73A 3LN5B 2X6BA 4IJ3C 3FB5B 2WUCL 4UDTB 3JWDL 3MODL 4U2ZA 3FUKA 3ZKXC 1D5MA 5FCUL 3ZE2E 4PJCF 3KLLA 3X11B 2IDFA 1NBVL 4Q0XL 1WZAA 3MA7B 4K7FA 5GS3A 3L9EA 4ZFFA 5JPMB 1ZANH 1QLRA 4GBXD 4ELMB 2KZWA 3PWPD 2H2PC 3O2WH 5DZLA 1DVZA 3QG7H 4P4KC 2JK5B 1VZIA 1PEWA 4CW1A 3PHQA 1AP2B 3S0PA 1S5HA 4A67A 2QPFA 4BE5A 4NXSA 1MJUL 4JRXB 4KKLC 4LPUA 1KTDA 4UOJA 5L4IA 4X7SL 3ZTJG 2ADGB 3I9IA 3VXNB 3BP5A 3CDZB 3BW9A 1CFQB 1C16B 4BKLA 3DX8B 1RP8A 4NQEA 3RVUC 3OKDA 4W6YB 1NM4A 1WDAA 3LXAA 3OKKA 4LCYB 4LGPB 1P1ZB 4DP7X 3HG4A 3UBGA 2F8VA 1OT2A 4NLHA 3TTYA 4X8CA 2Q2LA 4P46D 3UC0H 5JPNC 1ZKAA 1LO5B 4OFPA 4OD2B 2X0UA 1ANUA 3SOTA 5DLLA 2OYPA 5K59F 2X2UA 1ZTXE 1WCBA 2DN7A 1ZGLB 5T33L 4TUKH 3RX9A 1F8TL 3QDGE 3ZT6A 2IPTH 3UL4A 2X2JA 2VLRE 4W9IC 3LZPA 4PJHF 2XJLA 3KE0A 3IDXL 5I9QC 4RAUA 3RWEA 4BIKA 1KB9J 4OKDA 1N59A 4V2CB 1KSRA 3HNSH 5E8OB 1FYTD 3MYJA 1JTTA 2X4QA 4B9KC 2E59A 2R2BA 3QFJB 2P28B 4PY7A 5LG1A 1IL1A 1CD0A 2F1AA 5AZUA 4F8QA 5AVUB 4A6YL 2WXRA 1FIEA 5ALCL 1DUZB 3BSZL 4AKPA 4EZLA 1R0AH 1QLEH 2G60L 3KL0A 2Z91B 1QHOA 4N2BA 1BVLA 3R18A 1U8HA 2A1WH 4KUZL 4C47A 1FJ1B 4ENEC 5L2KD 4WY7H 1PYWA 2DL2A 2W60B 1MFCH 3FQRB 4HZAA 4NO2A 4TUOB 2J5LB 2BP0A 2ESVA 3VI4A 4Y19A 1A3LH 1I1AC 3QT2A 4BBWA 1BFVH 2HX7A 4MD0B 1BW8A 1HIML 4BSVB 5FLVA 1X7QB 4JPWL 4JHUA 5GRYA 3NAAL 3S8FB 2D3LA 3CDFA 4N2AA 1ES0B 4HF5H 4NB7A 5E5RB 5JZ7D 2CO4A 2XCMC 4I3SH 4J3WA 1IGTA 1RJLA 4M1DL 4OY9A 4P3CH 4HBCH 4G80A 3ME0A 1M6OB 5FDWA 1PSKL 1ZIBA 3BKYL 2ZCKH 2YS4A 2X2YA 1H0DB 1AIFA 1HILB 1UT2A 1XCQA 2FNWA 1X4ZA 4PJ5E 1WBZB 4ODWA 2W80C 1V8HA 1ETZA 2I69A 2AZUA 2JFCA 2LU3A 1JDDA 1XMEB 1RUKL 2R1XB 5E7FA 3ARQA 2HJLA 2XRAH 4N8PA 3L7EB 1U8IA 3MDJA 3HJEA 4EXKA 2VXSH 3VA2C 2B1AH 4JR9H 1MHHA 1Q9KB 3U46B 4GIAA 2P3YA 2KLSA 4ERSH 3K71B 1OCRB 2XZZA 2QPDB 3DK0A 4P23D 4W9LC 5IK3B 2MFNA 2MCAA 1ZLEA 4OF6A 3B43A 1ZSHA 3V0HA 5CBAA 5IB3B 3D4CA 3POCA 4LNVA 1KBPA 1UA6H 5HVHC 2CGYA 1HWHB 2VR8A 3D25A 4WF7A 1YO4A 5DK2B 4ZZKA 1M1SA 2DLGA 5HDQH 4M8VA 1JGIA 3DUHA 3IVKA 3VD0A 5HYSB 1SVZA 2IDQA 3UBXG 4QXWA 4KDWA 4U6XA 1INDH 1F2XK 2D2OA 4WTZA 4F7MB 1G7JA 2CAKA 3L3KB 3FTGA 4DCQA 1CLYL 1HEHC 4G6KH 4DO4A 2H8PB 3HB3C 1F97A 3A21A 2KBGA 4YDZA 4LMQI 1O7DC 1WEJL 3G5ZA 4U0QB 4PREB 1XZ0A 2H2SD 3IXTB 2ZUSA 4X9FA 4R90H 5I1DA 2DLFL 4C58B 4AITA 3SBWA 3HBZA 1KIRB 1ZJBA 1WVZA 1ZT4B 3RGBA 3RZCC 4I4WA 3KWWB 4XOBA 3T0BA 1QKZH 3TBYB 5LBSL 4OZHF 4IRSC 1QSED 1URLA 4J3OF 2VW6A 4E41D 1YNTB 3KWTA 2VDKL 2IWEA 4AL8H 3ES6B 3BP4B 5CSZA 3HZYB 1T6VN 3FSWA 1CGVA 4KXZI 1ORQA 4Z3HA 3RWJB 3D87B 1NL0H 3P77B 3SPHA 5C0IA 1PZ3A 2BXZA 3AFLA 2E74C 3QDGD 2W0FB 3QULB 4YDJB 3QPXH 2OW7A 2QZ5A 4WCYL 4JB9L 1ZLSH 1NGQH 3Q8CA 3T4AB 1V7NL 3FYEB 1OF2B 5E99H 2OL3A 4R4BB 1NC2D 3NACL 1ZGLP 4OZGE 1UTDA 1PG7L 3BPCA 3VFPA 3VI3E 43CAB 2HLAB 4DN3L 5JIMA 4CW1B 3DHUA 4D0CB 3BN9D 4RGNC 2XZAH 2E56A 2NYYD 2WNWA 3LKNA 4TNFA 1ICTA 4LXFA 2EACA 3HE6C 3MNVB 4PJFA 1OZTG 3T6VA 1S9YA 1IC7L 4W1TA 2NY7H 2YARA 2ZPKH 2GY5A 3DBXA 1W72B 5HJDA 3ZO0A 4U1NA 4QOKD 4L29B 1U41A 2MH4A 2AJSL 5HPMB 4JM4H 4DK6A 5MP6L 1XSKA 5HDQL 2WCSA 1KCVL 3G5WA 3QEQA 1F00I 4I18B 3GMMB 1UKSA 4NQED 1AH1A 4OBSA 3RZCD 3BVNA 4XCCH 4P46B 4JFTA 2VISA 5IQOA 4IHOB 5D1ZC 5E1QA 3I6LE 3SPGA 1D5ZB 3OMZA 5K93A 1RZGA 2ZOKB 3HG2A 3QULA 2CLRA 2KYIA 4YDJA 1U95B 3A6OA 4UINH 5CS7A 4PG9B 5D1XB 2DPKA 1HNYA 2LR4A 4NNXA 4HJ1A 3NJIA 2AK4A 2WVVB 1O6SA 1XF4B 5CSGA 5FYKH 5SX4I 2VSCA 4CVZA 4UT9L 4S1QL 2VH5H 2CHWA 4P3WA 3WDIA 1LE5B 3FB6B 2RFXB 1A6ZA 5GHWL 5IOPB 3NSFA 3ZPDA 4MA7L 4XC1L 1Q90A 3NA4A 2R4RL 2WLLA 5J6GA 4P2QD 2F74A 1H3GA 1PYWB 1I1FB 4YFLF 5GPRA 4DPAX 1NGXA 1QD0A 1UD5A 4MMXB 3JV6A 3IS1X 3GK8L 5HI3D 1SQ2N 2V17L 5TF1L 2CZNA 2GIYA 3MNWA 4MDJA 4HJIA 1ZRUA 4TTGA 3SBPA 5C6TL 2BHFA 3KBPA 3IEAA 6FABH 1QFPA 1D3CA 2MPAH 3CSPA 3RIFF 2P5PA 1ROCA 3H9HA 1Q9OA 3RTQD 2VXTL 1MHEB 3MLSL 1TJIH 2BX5A 4DETA 1KXQA 1DJZA 3D0VA 3BEWB 2QADB 4FFVD 4JFXA 5EZIH 3S36H 1KMGA 4NQCA 1KTJA 1ADQL 2XVKA 1KLFA 3JWNG 2D7PA 4P2QA 5ILTL 1T21A 5F7NC 2WLMA 4GMTL 3IGUA 3L17A 3MSPA 3ZDXB 1CDYA 4S2SB 1MHHB 2CPCA 2EYSB 4Y9CA 3ROLB 2OTUA 4PRPB 4P5TD 5KSAB 1KJ2L 3ZKND 4E9VA 4R0LA 3PWNB 4KZCA 4MMZB 1EH9A 3C2AH 1XO8A 3ZQXA 2ZWLT 2A6KA 2FWUA 3DV4A 4Q6IA 2WC7A 2OTWA 3KYMB 1KTLB 2OMXA 2MMXA 4WGKA 5DEGB 2GK2A 4BZ2L 4HOZA 4MS8D 4ORZC 2LFEA 4OFDA 3WIFB 5D93B 5DRNA 1S78D 1KBVA 4ES9A 3IAQA 3WEAA 1XIWA 1NGZB 2GI7A 4KXAA 2C3HA 3OBAA 3MFFA 4EKJA 3PP4H 4IBLT 1DJSA 4N2LA 4JQXA 3TO2A 3CUPA 2DH2A 4YDKH 4DQOH 1Y0LA 5CEZL 1Z32X 4J3OD 2YMTA 3T0VA 3MO1A 4Q9QL 1YMMA 2HX8A 3FS9A 1DVXA 2G5BB 4LVOC 3WTUA 4Y4FD 2OMVA 1MOEA 3QIBA 4ANUA 2GJ6D 5D4HA 4CNIA 3FW6A 4I3RL 5A2FA 4PRHD 3U4EB 2VR6A 3D2TA 4G6MH 4DKDC 3P3YA 4YVNA 5I28A 1IGFH 4RMWA 1WGOA 4O51B 1B2WL 1S2EA 3L4XA 3KM1A 3MV9A 3EYFA 3N1MC 1O7SA 4BQCA 1JZFA 4FG6C 4YE4L 3HS0A 4P48A 5TGBB 3NJNA 4XP6L 1RURH 4G3YH 4LVHB 5J6SA 4F3FB 2QHLA 4HUXA 4LSRH 4NQCE 5C9KA 3IK2A 4Z7QE 5I2IB 4PJ5A 2ETWA 1NIAA 1NBVH 4P23B 4U1LB 3RURA 1JZIA 3EBIA 1SOQA 3F8UB 3S36X 2RR3A 3SE9L 1NMCB 1ACYH 2FGWH 2AQ3A 2OQJB 5IQ9A 5KG9B 2WTPA 5ICXB 1NC2A 2PPCA 4ZXBA 3UTSB 4TOYH 1HXYA 3DX7A 4JN1L 3VGEA 1BD2B 5HYJE 4M6AA 3GHEL 5EBLB 2IV8A 4KI5C 2YPVL 4BCZA 3L5WB 4DN3H 3HNTL 5JR1H 3I3BA 3ZN6A 1B4TA 4N0CD 4ZBJA 3TJEH 2CRIA 4NZ8A 1UVQB 1MCSA 1T1XA 1N4XH 2J20A 5H8DA 3UROR 3CN2A 3EO9L 1G7LA 3M8OH 5I75B 1K8DB 3NK3A 4KROD 3GSRA 1SXBA 4NC0B 3GWJA 4NAMA 3D85D 1I8KB 1PD6A 1DQDL 2FYVA 2WBJC 4K0OA 1ED3B 2N59A 5KBDA 1OM9A 2YQ3A 5F72S 2VSDA 4HJEA 1II4E 1A1NA 4IGBC 2WQAA 3BEVB 4ABQA 1DJIA 1SEBB 4ANVA 4XMLL 1AQDA 1EANA 3ZDYF 2IPUK 4EVNB 2VABB 4MJ6A 2WWMC 4WDIB 1QNIA 1M7IB 1KTDB 2EXTA 4KY1H 3C9NB 3C5ZD 4NN6B 4NNYA 1JWSB 1NCNA 4OV5B 5SV3A 4AMKL 1EVUA 3BSZH 2BVUA 2VZOA 3I85A 4LFHG 4A7VA 1S7WA 1SOSA 5DEFB 1CG9A 3QG7L 4BSWB 5TDPA 3FU0A 4H25A 5EDSA 4OVVA 3K7UA 4ZO9A 1FO0B 4OCYL 4XC3L 2WZPA 1WFNA 1XL4A 1ZSDA 2FH6A 1SQMA 3SY6A 1ZE3H 1GJUA 2BZ7A 1A3QA 4W9CC 3BZ5A 2Y5TA 1CD9B 2Q3AA 4PJ7A 3T2QA 2LLLA 1L6PA 4O9HH 4AX3A 4AYFB 2BVQB 2CIIB 5GGVY 3RNQB 2ZOWA 5FHBH 1WZ1H 1XQ4A 1OHZA 1PAMA 4BDVB 4ODUA 4NNXB 5MEND 2C3VA 3HKZA 3CHQA 3CAFA 3L1OH 1I8IB 1NIDA 4TVUA 1HYSC 4LARH 1OY3B 4WKXA 2OCJA 1RL1A 1BWWA 3ULVH 4IRZA 2AGJH 2WBXA 4PTUB 2NRDA 3NFNB 1ZLWK 4B5ZA 3FQXB 2Y36H 2DS4A 1OB1B 1QI5A 3G08A 3CFTA 4POZC 4BELD 3TIDA 2X09A 1JRHL 1Z0NA 1C08B 2VDQH 4FABL 5JIKA 4YHML 3RTQA 3FO9A 4YAQB 4ZMVA 2O5NA 1XXFC 1PJWA 4ZFQA 2Z1PA 3A5VA 2Q8BL 3D7PA 5CN3A 1M9WA 3R0MA 4HWZA 1QNZL 3L6FB 3ECQA 4I88A 2QGBA 4W4OA 5DK3A 1S7QB 4JVPA 1E4KC 1DBBH 1N5AA 1HXYB 3DX7B 5F7YC 2VW7A 4NZJA 1FVEA 3PV7A 2VJ8A 2NY4C 3ERXA 3K46A 3MXVL 4ODBD 3MACH 3FSVA 3MJ7B 2HLAA 3QAZC 4PD4K 4E5XB 2ZOUA 4P3CL 4UIKH 3OR7B 4ZS7L 1FSKB 2FAUA 1E4XI 2OZNA 5I8EB 1MDAA 2OR7A 1UQSB 5CXPA 1UT9A 2X7LA 3TYFB 4QYOB 5AL0A 2VDPH 5LNEA 1S7SA 3A6CH 2Y1AA 1KEML 1KN4L 5E56A 2CLZB 5D7LB 3BP5B 3CDZA 4RGMB 3O4OB 4XWGL 1FC1A 2WWNA 3BE1L 3B2VH 3I6KB 3MFFB 2WLIB 3AB0C 4DP1X 4OLUL 1BXVA 2X4TB 2Z0BA 3D0LB 3RFZA 4K8RC 4XVJL 2K3TA 1WIOA 3IM1A 5C09D 4AC4A 4G2AA 3WN5C 3ARDD 4LPYA 3DV4B 4ELMA 5KBKA 3DGCR 3H4HA 3TURA 1CE1H 1KTRL 3CVIH 3VWKC 2HRPL 4TVPE 2BVPB 4WLCA 4Y8DC 1ZHKB 3B2XA 4G43A 3IU4L 3RILA 3TS8A 5JOPD 4LHQB 1CDCA 2ADJA 1NBYA 2QADD 3P4MB 2XUWA 4QCIA 4LL9A 5JHAA 2ATKA 3TEXA 3MGOA 1BZ9A 1FNEB 1S9YB 1ZHNA 1Y6MR 3BDYH 1QWHA 3A47A 3FF8A 3CGTA 3MRKB 1ZV5A 1LLAA 2Z7UA 1GAFL 3ARDA 4UT7H 5IEHA 1Y1DA 2J73A 2VUKA 2FYYA 2GIMA 4DP0X 5H37H 1MPAL 5H2BB 3VXMA 4AIOA 5A16B 2NY4D 2AGJL 2FO4A 4CU8A 2CJSA 5E9DA 1XV8A 1ECZA 3BMVA 4UOW0 1UZ8A 3VGDA 1MCOH 3CZFB 1DBBL 4I4WB 4XMWA 1RUPL 5CMAB 3X3GH 1KFGA 2FWOA 2YPKA 2J7LA 1HQ4B 2BNQE 1EAJA 2FSDA 1OGSA 2HWZH 2V5SA 4XOCA 2ZD0A 4GRWH 4TMPA 4WV1B 5IBUB 5GS0C 3B5GA 5I1CL 1QWNA 3QZWB 4AQ1B 4NJ9L 3BXNB 3O2DA 1NGPL 5EC2B 4KQ3L 5AAMC 3LYRA 5K9OA 5CEYA 2LT9A 3CVHB 5GRZA 2WHVA 3ULVD 1A6ZB 2GSIA 4GQZA 4MNGA 1DQJB 2NW3A 1AQHA 4S0TD 2PW2B 2R1YA 1PY4A 4OZFG 4LGSB 4OZIA 2O5YL 3T3MB 1JZ8A 1CMOA 3U2SA 2WBWB 3VMOA 1U36A 3ZL2A 3HTLX 2D3NA 2Q7AA 1L6ZA 1MXGA 2OSYA 4FFTA 3MRDB 4MDJB 3TT3H 5EHFA 3J07A 1AO7E 4JMXA 4BK8A 3WSQL 2ZG1A 4JY6A 1QW9A 1M3IA 4RNRA 4R6UA 5IK3A 1V7MH 3T65A 5CZRA 2J1ZA 3IDNB 5HDBF 2MEJB 4QRSA 1ZTMA 3OKNA 1WBZA 2I85A 4QJ4B 1UA7A 1XBRA 4M61B 2WLHA 4M5ZH 5HYSA 4X98A 2DQGH 2NXYB 3BIKB 2DYSB 2WUBL 5BUGA 3BJ91 3ZO9A 3CVIL 5IB2B 3V55A 4JFDB 5LJYH 3UG5A 2ALWA 4DQAA 3W9EA 1A8JH 1KNOB 2H5UA 4XBEL 3MRFB 1N6VA 4M5YH 3V6FB 4JKKA 5F9WB 1VERA 3MV11 4GMSL 3V6OC 4BHUA 3ZYOA 5KN5A 4AEIH 4OJFL 5FGBA 1T83A 2EO1A 1UOWA 4YHPA 3HFFA 5AOKA 2H1LM 3HZ3A 5E51A 3WKNA 5AG8A 2YFNA 3HI1B 4DIXA 1TKWA 5J1SC 1FGNH 3H3KA 3MRNB 1H3VA 2N0KA 4D94A 2H2SC 3DVGA 3MRDA 5E70A 1YEWA 3WJMB 4NO0B 2AF2A 3H1ZA 3EG9B 3MZTA 4O2CA 2FNBA 1EZVX 4MLIA 3LTVA 4YSUA 4U1MB 3VXSB 4F8TA 2X4RA 1GKOA 2BY1A 3DIVA 4NKOB 3UEZA 4EDWH 3BUQA 4MAUH 3K8KA 1X5HA 5I82A 4JANA 4FADA 1E50A 4WVRA 3RDTB 3ETSA 3GS7A 4J2QA 4L1DA 1RSFA 4ZOAA 2VO8A 5EZJB 1SJMA 4NO3B 8CGTA 2EZ0C 1FRGL 1I4FA 4JFYA 4WV1A 2VXQH 5E4EB 5D7JD 1K8IA 2J88H 2I7OA 4FQ1L 4PWGA 1DVFD 4Z7UE 4HQQL 3NK4A 3R4DA 2Y07H 4MJ2A 2JXMA 4HIPA 1CICD 25C8L 4JUTA 3RPKA 1YJDL 1IM9B 3L4TA 2I9LA 3PWVA 4JRLA 3IJYA 2DW5A 2XZCL 5EU5A 4LAQH 2RIKA 5T33H 3UADA 5EU6A 4DOHE 2MOQA 3DURA 3DOHA 3HJ0A 5GJSH 1Q72H 4P23A 3RWEB 1SJVA 5JQIB 4GKSA 1IJNA 3IU3B 3BWUF 2MQGA 1QZNA 3AABA 1OCZB 3KPLA 3NCBB 5KTEH 2DRUA 2B15A 3HAEA 5F7AA 4WTXA 2J21A 2NCMA 2ERJB 5EU3B 4XBEH 2AS5M 2P5EB 3JWOL 4DAGH 4YO0A 1ADQH 3IGAB 2WYZA 3ULVF 4PY8J 1DQML 1J9TA 3U36B 4PGCA 3BP7B 2F8IA 3QDMB 5D1XC 1S3RA 3H2WA 4ODVH 1GTNA 3LXUX 1LNUA 3LRHA 4ZSOE 1CN4A 4GOSA 1TG8A 3F7QA 3GLDA 5T1DL 3GSWA 3T1FA 3BIKA 2X70A 1BJ8A 3T0AA 2X9WA 1R5VB 5LGJB 3E0GA 4JG0L 5SWQA 1MY5A 2XN9D 3HS9A 3VB9A 1YPZB 3GC3A 4GP8B 4JG9A 3NOIA 2V2WA 5HDRA 3AS0A 3FQTB 4DH2A 3II2A 3PNWB 4K3DL 4XMPH 2YSSB 5LWYH 2N7BA 4QRQA 4ZFGL 3SBQA 5JNYB 1WFUA 3X13A 1L6XA 3V5KA 4B9CA 4APQB 3UAJA 3ALXA 4JO2L 2C7UA 4WW2F 3VXPB 3M7OA 2AV1B 4HIHA 4WI6A 1JFQL 5BOPA 6FABL 1HHIA 4FNPA 5KSBA 1IKFH 2XC8A 3F7LA 2ORBL 2OCCB 3TYFA 2RQ8A 1XH0A 4L8SB 3T3PB 5T3ZE 3QUXB 5JR1L 1GR7A 4B7LA 1V7ML 1BVNT 2K45A 1EHAA 4OJCA 1W91A 3B1TA 3ARGD 1N8ZA 2E3VA 5EZIL 2WXPA 2UY6A 1FFRA 1P9MC 1U8KA 2GABA 4YR6A 5FPIA 4ZUVA 1PZ2A 4M5ZL 4HALA 3GM0A 2VR9A 4X9IA 1R5IB 5HI5C 4Y4KC 4IBTA 5DI8B 5EBMB 4CILA 5A6IA 5DFWH 4QRRE 3O41B 4D0DB 2BIHA 3SE9H 4X4XB 2J4WH 1SLVA 3B9DA 4OT1L 3UTSD 4KHTH 5F1IB 4KOCA 4HLZG 3HRZC 5DUJA 1P5UA 2GT9B 4LSRL 4PCKA 4L8CA 3C75A 4Q6KA 1T1YB 4FYQA 5IJVB 1F3DJ 1XDTT 3FFCD 1HHKB 4H25B 5DT1L 2CJ3A 5EC2A 3AAZA 3V7MA 1EO8H 4IM8A 4CRPA 3JTTB 5CCHE 4F80A 4U6YB 4AH2B 4Z7VB 3ZL4H 4J1UA 1M9SA 2BVQA 8FABA 1FLRH 2GYSA 3QXWA 1EEZA 1GPOH 2DQFB 2D9QB 1KLFB 3FUDA 5EUOF 1J5HA 1HK6A 4GAJH 2MIZA 1BZ7A 3DSFL 3INUH 1EWHA 2GB2A 3VXRD 5I0DA 2P8LB 1NCIA 2RACA 4ZUTB 2JTYA 1Z3GH 3GBNH 4CKVX 2FCBA 3KLQA 1RZJC 3GDBA 1J8HE 1WISA 3OB8A 4I48A 4XWGH 5I1JH 1B4LA 5C1MB 3PU7A 5HHQB 4FOMA 4UOQA 5JW3H 2WKGA 3GPSA 1JZ4A 4YBQD 1C7TA 4PVMA 4WO0A 2EAEA 1QHPA 3O0LA 4HGWA 1YY9C 1YPZF 2WD0A 2VDKB 2K8MA 2HRPH 3O8XC 4PG2C 1F90L 3CFCL 2ZYIA 3LH8A 4N8CH 5F89B 1O9VA 1T66D 1E27B 3NFSL 1U3JA 3D2UA 1QUNB