2WTRB

Full length arrestin2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
399
structure length
367
Chain Sequence
GDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYGRVGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPKEEPLDTNDDDIVFEDFARQRLKGMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ARRESTIN-1
publication title A New Dimeric Crystal Form for Arrestin2
rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 54
structure length 367
sequence length 399
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain
B PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.640 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrB02
2.60.40.840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wtrB01
4J2QA 2WTRA 3GD1C 2WTRB 3LHAA 4GFXA 1JSYA 1CF1A 1SUJA 4ZRGA 4LL4A 5F0JB 5F0MB 5F0PB 4LL1A 4GEIA 1G4RA 1ZSHA 4GEJA 2FAUA 3LH8A 4P2AA 4R7XA 5F0LB 3UGUA 1G4MA 3LH9A 3P2DA 1AYRA 4R7VA 3UGXA 3GC3A 2R51A 4JQIA
chains in the Genus database with same CATH superfamily
3GBNL 4FJYA 4LBEA 5DFAA 4JFOA 5AW6B 4MAUH 5BO1L 3QW9A 2H6PA 4IDJH 4DN4H 3V5DA 4F27A 3EBHA 3TURA 1KXTB 2YSSB 2ZKWA 2KZKA 1RIVL 3TZVB 4GB9A 1GGUA 4P2OA 1UH3A 2APTA 3NTCH 4J28A 4RH4A 5ILTL 3CDZA 1K4CA 4HUWB 5JPMB 3Q2VA 1NIFA 4GKZA 3HR5A 1PY0A 5F6HI 3GSVA 4JMNA 1PKQB 4X2UA 1OPOA 4QXTB 3EJQA 3RQ3A 3VXPB 2WUCH 1KLUB 4G70B 5B7FA 4JO4H 3L5WA 5IV2B 1T21B 2W07B 1SVCP 3P3UA 2KLTA 2XKUA 3WY1A 1F1AA 1ORQA 1AGCB 2G5BB 1KYUA 4KY1L 1YYMH 2V2XB 2WCPA 2XTJD 3NIGB 3L1OL 1AKJA 3GTNA 4M1CD 4D9RE 3FH7A 5BZXA 4HUWA 5LBSH 1NCAH 3V5KB 4QRPA 5ACZB 2HPTA 5A2CA 1JFHA 1PKQA 2W80C 2DTSA 1BIHA 5C0AE 1KLUA 5KSVB 3CVHB 4EVNA 1BPLB 3GK8L 4NXKA 3EADA 1R5IB 1LEIB 2D7TL 1AG0A 5ICZB 2A6DB 2MNJB 4BDVA 2WYTA 3U30C 3U82B 1U8LB 3H9HB 4X4YA 3RDJA 1BBJA 2XWRA 1AGCA 2G5BA 2WP3T 3QJHA 2V2XA 3P3YA 4JL2A 2YEZB 5E5MA 3JTBA 3ATFA 4PJ7E 2DEYX 3QUML 3I6KB 4PTUB 5C2UB 2XHNA 3FJTA 1V55B 2ZJSL 5L7XH 3NGBC 4X5LA 4AMKH 1SOXA 1KELL 1XGZA 2DB8A 4YZFE 5AAWC 3SPJA 1F4WH 1IU1A 4CSSA 5HP5A 3EG9B 5JUEL 3FUIA 3CVHA 1A4BA 4NM4H 2NY7L 4U6VH 2HJLB 4XCYB 1LEIA 1QRNA 4Q4EA 3K2IA 1KPUB 3H55A 3H9HA 3GHEH 3KJ4B 4TPRH 1F3DJ 4IBYA 5CUSH 3J7HA 1I85A 2QVKA 3TEUA 5JXAL 5TE4H 2YEZA 4PG2A 3A21A 5HHPB 4C83A 1XF1A 3LDBB 2EIZA 2R4SH 3I6KA 5C08B 5LNDA 2BY1A 1YUKB 4LLUA 4M4RB 2ADGB 4S1QH 4HDIB 3Q3GB 4WFHD 1M3JA 3EG9A 4H20L 2BSED 3OB0K 4PRPE 4WK2B 2ZKHL 1CJYA 3L45A 4X0KB 2HJLA 2FVNA 3OR7A 1SDDB 4XCYA 5HGAA 4X98B 3D2UB 3BAJA 4MCYA 2NSXA 3VU1A 3ULUF 1OAQL 1FC1A 3FQWB 2YK1H 5E4OA 1ILUA 3DRQA 4PJXA 1RQ5A 5F72S 3WEAA 3X13A 1J88A 4ZPTB 3SPHA 3OXSB 3VW3H 5I0WA 5DD0H 5DGRA 3L3KB 4OZGA 4MGXA 2YPLB 3MJ9L 2ETWA 4PBDA 3DX2A 3TONA 4AIZA 4F91B 3VFGL 4XX1G 5EHFA 3UIZA 3L54A 2XZZA 2ADGA 4JREB 2ERJB 4HDIA 3EJTA 1Z32X 4NQED 1Z66A 1ASOA 1N5AB 3WO4B 1NBZB 2KPNA 3QXWA 5IG7B 4N25A 4HVBA 5TTRA 3L48A 3G04B 2IPTL 1JE6A 1QWHA 3QAZB 2J25A 1TENA 3OXSA 2XG5A 4ZO8A 2DEXX 3P0YL 4JHAL 4U1LB 4UM8A 2PCYA 5CNHA 4WNQB 3FBKA 3DSFH 4WFGE 4F7KA 1TPXB 3BKML 3OKOA 3P4LA 4YZWA 5L8JB 3ARVA 3VFMB 5AFAA 2WIIA 1GAFH 4CU8A 1KBPA 1BZ8A 1T83A 4XBEH 3CMOH 1N5AA 4HD9A 5GSVB 2W1NA 3N55A 2JMRA 2X0VA 4IEFA 4YGVA 3FAWA 5GRVL 4JZJC 4JPWH 5EU5A 3BDYH 2X4RA 4OZHB 2BXZA 3NCJL 1A4KA 1BQUA 4OW6A 2XWJB 4N8CL 1MPAL 4YHPB 4YHKH 1MFVA 3STLB 3V52L 3ZSTA 2QV2A 4WNQA 1TTGA 2VN3A 2AQPA 5HHOE 3RVUC 4Y5YA 1B0GA 2DLIA 2V17H 1UM5L 1ZGLM 4XWOD 2OXHA 2VDQL 3SDCB 5BV7L 1IFGA 3ULVD 1F90H 4GKLA 6PCYA 4Z18A 4RFOH 3OJMB 4OJFL 4OZHA 4X99A 1TEYA 2DV6A 4XVOA 4R7DB 4WI9A 5KANG 5TDOB 4ALAL 2A7BA 3GFUA 4OKVA 4YAQB 4OCSL 1P2CA 2J88H 4L3ED 2YOAA 1IAIH 4ILDA 2VN5A 1CGSH 1SJXA 2LAAA 4H2AA 2I26N 3QGVA 4N9OB 1IKFL 2ADJB 2H26A 3HG2A 4MDIA 3QUYB 1HCZA 1TETH 3UYPB 2FL5B 2C5DC 4HC1H 1NCUA 1DQLL 4NHCH 2WO3B 3QEQE 3SO3B 4ELMF 1UM6L 5HYJB 3CU1A 4LMQE 1XH2A 4MD0A 5TDOA 4R7DA 4BZ1L 4V2BA 4GUCA 1DVFA 5LGJA 1D5ZA 1CFQB 4DW2L 1TZGH 3T3PF 3WXVL 1WAPA 3OGOE 4YDMA 3HC0B 3GI9L 1XH0A 4YH6A 1BQKA 1KJMB 2LU7A 1IBHA 4P99A 3U0WL 1G9HA 5GGVY 2NTSP 2KZBA 1ZHBA 3UYPA 3GBML 5DHVB 4G1EB 2YGPA 2JIXB 5BCAA 3KPMB 1QEWA 2YD1A 4E41D 1DBBH 1S3RA 2J8OA 1U0QA 3V6FB 2MCPL 3VFUB 2EVIA 4XTRD 3HC0A 5L2JB 1MUJA 2P48B 2A77H 3BUYB 3SE8L 3OPZL 1YCSA 4PJAB 1S7QA 4I18B 4ZD3H 2MCAA 1OTTD 3WI9A 1H19A 5DHVA 5CWSA 4G1EA 3FO0H 5KYXA 3AT9A 4JGJA 3DO7B 2UVEA 4YUEL 4OIIH 3EDDA 4X7EC 3HG5A 1P5UB 1WWCA 2Q8AL 5CHNB 3V6FA 1G43A 3REWB 2Q8BL 1BXAA 3VG9C 3WAKA 5KSBE 2FQGA 1O75A 4X6CB 5ABAA 3DVNA 5L2JA 4WW2B 1LK2A 4DGVL 3B5GA 1FVDB 5FGRA 3L3DA 5F7UA 3EO0B 1R34A 4NZ8A 1UM4H 1TJMA 4P23A 3V0AC 2MEJB 1EERB 3TBSB 5DVKA 1IEHA 2ZPKL 1NQBA 4KDVA 5JW4Q 4PUBL 2R56L 3FUHA 2VMCA 1MIEL 3QARA 2OYPA 2YGVA 1JCKA 5C0NC 2BZDA 1YEFH 1Q8MA 1G87A 3L4UA 3VI4B 3WXWH 5CHNA 5FA3B 4U0RC 2XBTA 3C6LA 5T1LD 2OR7A 4N85A 3QORD 4B6ZA 5J5EA 1T22B 4WW2A 3WNJA 3TU6A 3U4KA 1FVDA 3ZHKA 3D52A 3LHAA 4PCTA 4RMSA 1JYNA 1ITBB 3HJEA 3SOBH 1KCRH 3U46A 3IJYB 1RJZA 3GO1H 4RFNC 3TBSA 3N1FC 4FABL 2FSEB 4QF1B 3UC0L 1LE5A 1U2HA 3CSBA 4YL4A 5GS1B 3DX7A 4M6ML 4PJDB 4MKTA 4OJCA 4P2QB 5AAPA 3GXDA 3SKNB 4PRID 3VI4A 5CD5D 4ABVA 1NFIB 5FA3A 4CL7A 4HUVA 3IDNB 5C07D 3QHZL 3UJTH 4CVXA 5DJZB 2C4XA 5CJOL 2WBJB 1EGJH 3UTSE 4KFMA 1A4AA 4YHMH 5T3ZE 1G1OA 2BW5A 5FYKD 1F2XK 1UKSA 4HUUB 4W9HC 3UYRH 3OLGA 4JS7A 1SJMA 1FFOA 1A64A 4WHDA 4MD4B 3R8BB 5DMIL 2ARJB 5HYSB 2YGOA 3MODL 2HFGL 2N4IA 2GT9A 4MA3B 4WIQA 4WK0B 4PJDA 3EF4A 1KT2A 5I0DA 3FT4B 4KRMB 4HEME 5BUGA 2QPDB 1QFOA 5DJZA 4PLOB 9CGTA 4AGOA 2AK4B 4NHUA 2XNAB 4GQRA 2DQDH 2K45A 3MUGB 3EOTL 4FHJA 4QUOA 2ZG2A 3ZHLA 2APXA 4K07A 4NYLB 4ONHA 1TVHA 2DWDB 5J89A 4J3OG 2F53D 4IGBD 4MZ2A 12E8H 3TO2A 3QUXA 2OTUA 3MRPB 1QA9A 2JQAA 4K8RL 3MRMB 1FRGL 2D2OA 1AYOA 1R46A 3FT4A 3VWJB 4MMXC 5INDA 4GMTH 2XRAL 4MMYA 1P84J 2AK4A 5DZJA 3KPRE 2OLDA 1XR9A 3T0AA 2A73B 4XNYH 3GDCA 1JHKH 3EJZD 2GJPA 2P43B 4PWEA 5IVXF 3A6BL 2R2EA 1T4KB 2OYLA 1F86A 4HUMB 2JKJA 3MRPA 4LQFL 1J8SA 4LHUB 3DSNB 4RDBA 4KO5A 1BAFH 15C8L 2NTFA 4KUCF 3I9PA 4MFHA 3LIUA 1R75A 2ZYSA 2YD4A 3X11B 3QSKB 1RLBA 2XQBL 4DTGL 2XZQH 4PJCF 1KY6A 1QUPA 1U92A 5I66B 3NJNA 1HEHC 1HI6B 5ISZB 5MEPA 1C16B 5D8JH 5EBMA 5CEZE 1YEJH 2G75A 2HYMA 3O45B 4BFKA 5FHBL 3RPIA 3CFQA 4I89A 3OJ2C 5ENWB 2HX7A 5TQ0L 1HX0A 4GQ9H 4RX4A 4JO8A 1WBXB 2AK1H 4HP5A 1ZT1A 4L2YA 5D2LA 5AW4B 1TQTA 4XP6H 2IWFA 4LLYB 4MAYA 1BJ1H 1QSFB 1ZT7A 2WZAA 5GJSL 1X5AA 3FB6A 4YLQT 4GSUA 1X5FA 3OKLA 4K3DH 1XMEB 4HF5H 1EUTA 1I8MA 3K72A 1IBBA 2XN1A 4OFVA 4X5QA 2BSSB 2ARJQ 3MBXH 4H0GA 1TQCC 3V8OA 2F7PA 5I66A 3ECBB 1GA2A 5F71A 1WD9A 4XX1E 2FWOA 2EIMB 2Y7OA 5GHWH 4F5CA 5I1GH 1FIEA 3O45A 4QYOB 1WISA 4XP1H 4QJ5B 2GABA 4WSJA 5AWNH 4DO6A 4B97A 1FAKT 3ZMRA 4FERA 2Q76A 2WBWB 3OAZK 4NO0A 1KYAA 4ZNCD 5TK4A 1WBXA 4HAGA 3HE7C 1HT6A 4LSDA 2VM9A 3GM8A 2VRQA 4LLYA 1GZQA 3LIZL 4NUJB 2CUHA 2OZ4H 2VUOA 32C2B 2XN2A 1W72B 3U0PB 1Y6KR 3ECBA 5I19H 5IJVA 3LSOB 4DGUA 3ULUE 4Z3TA 4QY8B 4N2IA 2R1WB 1OCRB 2NYKA 1RHHB 5D5MB 5CGYD 4Z7WA 1M7IB 2DQEL 2VB5A 4GRWF 4MBRA 5HDLA 4IMKA 1T3FB 4AY0A 4ZZKA 4ZW7A 5IB2A 1J5DA 1W0YT 2YEQA 5C0RH 4EKJA 3ZRFC 1FIGH 4A55A 5ABZA 1BF5A 1G4RA 1MH5A 3N44B 1U3HC 2B39A 3QZPA 1UURA 4JDTH 2R0ZL 4TUKL 3LSOA 3QPXH 4NRZA 2IBGA 1HOCA 2XN9E 5AAMA 2FGWH 2R1WA 4OCNC 3KPNB 1IZKA 1XR8B 4RGOH 5FB8B 1ZSDB 3DX3A 3F6JA 4HXBH 1M7IA 4R96B 2C8NA 1A6WH 5I1KH 1S9KC 4YDLC 4GBXD 3VXTB 2IO5A 2NLJA 1P7QD 5G55A 4HMCA 1FC2D 3F84A 4MHHI 2MQCA 5DJYA 5IHHA 3D34A 3I9GL 2A9MH 3SGJA 1I8KB 4MAZA 2OW7A 3ROOB 4B60A 2ZSWB 3TA4D 3NH7L 1A3RH 1TJHH 3UP6A 5F7LB 4R83A 4F8LA 3CCHB 4IRZA 3S2CA 2B4CC 4AL8L 4LLVB 4JO3H 4ZUTA 3BZEB 2Y69B 4B7IA 1NIDA 3EOYG 1ZSDA 2PPFA 3FMGL 4R96A 1HAUA 1LO4L 1CFBA 1VJSA 3PNRB 4OZGF 5HDQL 3VXTA 2QPSA 2VR3A 3FSOA 4ATTA 2VLRD 4CAGA 1CO1A 4B9IA 3K5SA 4M62H 1I8KA 4XMPL 2EVFA 2AQ2A 2XJLA 2ZSWA 1C7TA 1B4TA 1CL7L 2X1WL 1YN7A 5K9OB 1E8XA 2IGTA 3HVNA 2E27H 5J6SA 1GJUA 4LLVA 2WXFA 3TV3L 2VXQL 2NY3D 4LRNL 3EW3B 5HHME 3T65A 1RK7A 2EKJA 4XAWH 1PX4A 2UX7A 3BZFB 4QRQB 5AVUB 4APXB 2GBAA 4PGDB 3MRHB 3LQAL 4LASL 4IRJC 4K5NA 3VXRE 1J7VR 4OZIE 4NCDA 2DKMA 1IGTB 1BQRA 1IV8A 3LZNA 5A1AA 5E2WL 5IWLA 3D3VE 2VXVL 1CBVH 4YO0B 3ASWA 2YD3A 5D72H 3PPEA 4N24A 1SLXA 4ELME 2AHIA 2GTWB 2Y36L 4GI6A 4P9HC 3BXNB 3UMNA 3MRKB 3ISWA 1DBAH 1FAIL 5LHDA 2ITDA 2JB5L 3T3PE 2R69L 2LTQB 4QRQA 2B1AL 3U9PL 4PGDA 4ZAKA 1NBVH 4L1BA 2B2XL 1IGTA 1A9EA 1YNTF 1YAZA 2OFQA 2VOTA 3K6IA 4P5TA 2ROXA 1B2WH 1SLWA 4O2FB 3V6ZB 4NKOB 3FOMB 3ZTDC 2Y6SD 3ULUC 2ZKXA 2PR4H 2YXFA 3QZOA 4JFFD 1JHTB 2GTWA 4OF7A 1NL0H 4NDMB 3PQYB 1Z5LB 3MRKA 2WXIA 3RY5A 3ZUNC 1E5YA 2JJSC 5T8IA 5CO1A 1XO8A 3GXIA 2BFVL 3HLKA 5CP7B 1UXMA 4XPAH 4DN3H 1G9MH 5L2KA 2J6EH 3D2UD 1K4DA 5G5DA 3H7BB 4JFVA 3U1QA 4O2FA 4HWZB 3A47A 1ZGLP 3FOMA 2JE8A 4U6YA 5I74C 3FSWA 1QNIA 4KNUA 3X14B 2YPLD 2WXKA 5CN2A 1PDKB 1JHTA 2L7UA 2X4UA 3IRZA 2EDMA 2VN7A 3PQYA 1Z5LA 2GAZB 5D1QE 1ZDQA 4XH2A 2AJZB 3SGDH 1SOKA 3RA7L 4BV1A 5CP7A 1BD2A 1OGAD 1PG7W 3WTVA 2QL1A 3SPIA 4O2CA 3HB3C 2H32B 5ADOH 1JXGA 5GGVH 3RIKA 3BJ91 2GSGB 1NKRA 3CZUB 5CD3B 5T1MB 1CTMA 1PD1A 2VLJD 4HWZA 4UT6H 1I3RB 4L4TD 4AVIA 3KYAA 2F54D 4HFUH 3FCUB 1TQWA 5IOPA 1KCUL 1XGPB 4FZ8L 4RAHA 2FE0A 3WD5H 3VYOA 4PG9B 1KJ2B 5HDBF 1PDKA 4LL1A 4GPVA 2KDGA 4O02L 1U8CA 3IDIA 5LN4A 3H8NA 5DFWH 1FYTD 4Q14A 2ZWNA 4OLEA 5DJXA 4XZ4A 3SQOH 3WTUA 1CLZL 3GHBH 5CGBA 1MFAL 2J5LC 1LDPL 3OKYA 3UEZA 2XWZA 4X9YA 3Q5OA 3Q8CA 5CD3A 1NC4B 5T1MA 4U31A 2XQYG 2P5EA 1I1FB 5ANME 4GP4B 4J3XA 2FECL 5HHQB 1PX3A 2EUVA 1N6UA 5E08H 1BSIA 1MFBH 4HJSA 4PBWD 3TLRA 1KJ2A 4G9FA 4IS6A 4HK0A 4PRHB 3FTYA 2EIDA 3T4AC 2XACC 4G7SB 4R0LB 3HC3L 3QJSB 4WI0A 4NQXA 4F92B 2A9DA 1IM3D 4M03A 5K1JA 5DEFB 1ZHLB 5KW9H 3KHQA 1AE6L 4KZEL 3ZPDA 4GRLA 3MRGB 3L4TA 3FO2A 1W8NA 2AABL 2NY1D 1KEGH 2W9EL 5SWSE 1ZD6A 4H8WC 1NCOA 4Y4HC 3LPPA 3RZCC 2UXVA 3WY2A 1JTOA 5J12C 3II2A 2CPUA 4GSXA 1WHOA 2P46B 2QSCH 4JRYE 1ZHLA 4FQLH 1X4YA 2VNCA 4P2CG 1VZGA 2IAMA 2GBTA 2VDNL 4XNAA 3QC5X 1XSKA 2FNBA 2Y4SA 3MRGA 4XXDA 1EBAA 3FB7B 4FQ2L 4NUGH 5HYJD 3JVFC 3NCWA 3I6SA 1MF2H 3EIFA 3M46A 5DWUL 1TF4A 4GXUM 4LCUB 4GS7B 3VD1A 3WJJC 3D39D 4DO5A 2H8PA 4OV6F 4E9VA 5T3ZH 1RIHL 4HKZB 1MJUL 2WO2B 2EEXA 1E40A 3CVBA 2Q7NA 5I0ZA 4YNYB 4AEEA 1PG7L 4GKSA 1JGEB 5CJQH 1QHQA 2FSDA 5EF3A 1SNRA 4QJ3B 4BCYA 4RISH 1MY5A 1QLRB 4JFEA 5D1ZC 2DQUL 5IVXE 2CRZA 2NNXA 4OIFA 3P2DA 4ISVB 5DC4B 1U4FA 4GO8A 5F93C 3DXAB 1S9VB 2COQA 3EHBB 4L37B 3WNLA 2ZP9A 3K91A 3UTPD 4XNDA 2ATPB 2XQYK 1ONQA 5D1QC 2O30A 4HKZA 2VZ3A 3QR1A 4LSSL 1JZ6A 4QXGH 5GRJH 1YEIH 1JGEA 2ZUVA 1OE3A 9PCYA 1JGLL 4YWGH 4E9QA 1ZLUH 5KTEH 4UM9B 3T9WA 3RBSA 1N4XL 2K1MA 1I1YB 2Y25A 4PTTB 1CD8A 4ISVA 3MYJB 2JJVA 4RSVA 4N20A 5C0JB 4W81A 3GSXB 2ATPA 5B38B 3MLSL 3UPRB 3CSFA 4WKZA 5K9JL 3KHOA 1JBJA 2BVOB 3EGDB 4IM8A 1RUPL 4M56A 4DWHA 5JPNB 1H8LA 1I9JH 2IOMA 4PP2A 4H2CA 2B4CH 3B9AA 3L4VA 4HQQL 2E4FA 3OVUB 4G8FB 4EAEA 1F02I 2ORBH 3PL6B 4GLRI 2XX0A 4UM9A 1JDCA 5K1VA 4F37K 1LQBC 2B20A 5KVGE 3N41F 4MKMA 5FFOA 3ARBB 1AGDB 3MYJA 5C0JA 4FI8A 3CH8A 4XBMA 3HHSB 4OCRH 1NOAA 5B38A 3BKCL 4HISA 1A4CA 4M6OH 4LOUC 1AQHA 1E7VA 3UP1A 4QRPE 1UWYA 3JTTB 4BCXA 1A7RH 3ET9F 4MJ2A 5CEZH 3MLYL 4YDVB 2YXMA 3AM8C 4JCWA 4MXVF 5HYSG 3US1A 4XAKE 4KXDA 4G8FA 3ZDZE 3T0EB 5B22A 3RGVA 1AHMA 1GYCA 1LGVA 3ECUA 35C8L 1AGDA 1YY9D 3PWPD 4P2QD 2DBLH 3G6DH 4QKTA 2VQUA 1YUHA 1L6PA 3HHSA 3MRIB 5HVGB 1UFGA 1Z2KA 2BWDA 4DP6X 1HYRC 4OM0L 5CEXB 4XMKL 2PW2B 5D6DC 4WNSA 2DQIH 3E6HB 5ABDE 1ZPLA 4FQQB 2CALA 4MB5A 4YXKL 3PS6A 3BGFB 4P9HH 4KVPA 1LP9B 1G7QB 3HPLB 4AE0A 5B4MC 1A7PH 4LNVA 5C6WH 1QRNE 4Q2ZB 1G7JB 2NY4B 3MV01 4POZD 4KAQL 1RMFL 2R4RH 2GJ6A 3MRIA 2X3CA 4HWEL 4D3CL 4YPGA 1X44A 4B0MM 4FQPA 3PYCA 3SDAB 5J6HB 1HZHH 4CSTA 3ULUH 3E6HA 1CFNA 1FE8H 2C1PB 4TRPH 3VSTA 3CFIC 5FF6B 1QVOB 3L9YA 1WFUA 4EDWH 2VYRE 4KMTH 5GIRA 5KSUB 5FO8B 4JANB 4TQPA 1JK8B 4LHUG 3U7YL 4WU7A 5L6YL 4DOHE 1EAPA 1DLFH 4APQB 1TJGH 2HT4D 4YVNA 4PJXE 5BNXD 3M8OH 3V4PB 3T77B 3UJJH 3IDUA 3RJQB 3VWJD 3VTMA 4MHHG 3JYCA 1WYJA 4Z7WF 4FFZA 4LEXL 2A6JA 4J3UA 4OZGE 1MRFH 2Y9RT 1PJWA 3QR2A 4N0YL 2VSDA 2C1PA 2NRDA 4MJ5B 5EIQA 4E5XB 2DMKA 5FF6A 5BRZE 3SE3A 2IVFC 1QVOA 3TIDB 3QVAA 3CZEA 4L48A 5AOIA 5I1CH 3TA3B 3V4PH 1AGFA 4D9LL 1P4LB 2FEDD 1FVEB 5FO8A 4BSVB 1UYWH 1OIOA 1GGCH 1JPFB 4O58H 2P8PB 5FUCE 4LCWE 3ARTA 4FJ6A 2YGNA 2FATH 2P1YA 1SMAA 1YEDB 4P2OC 4IMLB 3LCYA 1ASQA 4H5SA 2DQJH 1WA1X 5B3SB 2PMZA 1SYVB 4OGXL 4UV4H 5JMOC 5TQ2H 1F00I 4JB9H 1ZHNA 4WRLA 5IOKA 4P4KB 2R8SL 5I1AA 4H4NA 4QHUB 1B4RA 4RDQF 3TA3A 4AG4H 1A5FH 1P4LA 1Q90A 3BYTA 3I2CH 4HCGA 4ZFZA 4G9DA 1IC5H 1Q1JH 4D9RD 2AJSH 1JPFA 3BH9B 3FZUC 2O5YH 5IQMA 2FWLB 3HFMH 2F19L 3MUUA 4XO9A 3NFSL 1NLBH 4GEJA 2Z35B 1CN4A 2ZAIA 4NO2A 4LHQB 5E5UB 1JRHL 3KM1A 2P4AB 3IJ7A 4GW4B 1R3JB 4IOSA 5C0AD 3AREC 1BLNA 4LPXA 4QRSB 2IFFL 3SKMA 2BNQB 3QXUA 1PQZA 2ICWJ 4P4KA 3TBWB 1DQDL 3OLDA 4QHUA 1C5DB 4G6AC 1YEKL 5DVNA 4WV1B 2A5UA 3QIWB 3QCUL 2BP5M 5FUOL 3QUZA 2DH3A 3HC4L 2CKNA 1DDHB 1TJIL 3SYCA 2CDFA 4R4FL 3PUUA 1X7TA 2DDQL 3BN3B 3PP3H 3BWUC 3DJRA 3WJMA 5IMOA 2QQKL 3MV7B 4Y89A 1EO5A 4LDOB 3FS9A 3K6SA 1OSYA 1R3JA 4GW4A 4L1LA 5KVFE 1GTFA 4QRSA 4OVUA 3HKFA 3AADB 3WFHB 1MVUB 5GS0L 3UBFA 4OUUB 1C5DA 2AVFA 5C3TA 4WV1A 2H2SC 3QIWA 2E9JA 4M6NL 1IKNA 5DZ9A 4Q0XH 3EJYC 4AQAB 1IGFH 1DDHA 2CR3A 2Q7YB 3B2MA 5CAYB 1I85C 2IG2H 3BIBX 2CO4A 3V79C 4P5KA 3CFDA 2Y22A 5IF0B 3MBEA 4GRMA 1OP5H 4NZJA 3U36B 1F3JB 5DO2D 3BLKA 5AZEH 3EZ8A 4BZ2L 3LRHA 4XP4L 2VR7A 4JM4L 5AYQA 4JAMB 3WFHA 5F88A 2X9ZA 1OM3L 3RAJH 2GSIA 3RGBA 2X89A 1GHFH 4LARH 3VFNA 3I02B 1SYSB 1PLAA 3HI6H 5HY9A 2X6CA 3ARPA 4MQ7A 5HDBE 3FYIB 2R0KL 4ORGB 1MEXH 3CX5K 3N42F 4M7JH 5CCJA 2ATKB 2JELH 1F3JA 1QFHA 4OTXH 5IM7B 4J4PD 2OP4H 5ESVA 2D03H 1E2WA 4JPSA 1IB5A 2WAQA 4LCCB 5DQDH 4ZX5A 2W91A 1D9KA 3TBYB 1NGWB 2H3XC 2I9LB 2DS4A 3QDJA 4NQDE 4TLKA 3SGEI 2P47B 1BQ5A 1CR9H 2FYVA 3S3BB 5H2BA 3D0VA 3SN6N 4OF0A 5FUCC 1C8PA 3IBOA 3BD5A 1RKRA 4RRPM 1NFAA 3KEDA 3LZFH 4UILL 4WFGD 4ORGA 1JOIA 4G7YL 3C75A 4WEBL 1MCFA 3TEYA 3SKOA 3MXVH 3CMGA 2VDRL 3NCYP 3BP5B 4LCCA 4L5FL 1NGWA 1OZTG 2HA1A 2I9LA 1HL8A 3VXQB 1MHPH 3ZE1F 1T83C 2XWCA 2ZKMX 3A6CL 1GKEA 5C0ND 5E51A 3O6ML 4NZUL 2Y1VA 2BIPA 4KX8A 3OJDA 1H3PL 1ZV2A 3RDTA 1FV1B 2BW4A 5HHOD 3PU7A 4Y2LA 3MBWA 3PWNB 4OM1L 4B95C 2GITB 1OKEA 2HJFA 3RL1A 4Y5YC 2YAHA 2F2HA 3MU3A 3WDIA 5GZOD 5LWYH 3O41B 4JX0A 1HXKA 2WM0A 5DT1H 3WL9B 3KCPB 3SDDD 3B1UA 4OLZL 3UFIA 3VXQA 3BPOB 1PZ3A 3SE6A 4P05A 4ZMVA 5KVEE 4IJ3B 1J0IA 4UTAH 2GEEA 1YA5A 1QSVA 1TLMA 4K3JH 4ONFH 1NKGA 3AS2A 5H37H 4F7MB 5EOQL 3MXWH 4GFXA 1F4XH 1NCBL 3TT1H 5F0PB 3WNMA 4Q8BA 2CRIA 4OF5A 5DUBB 2AEIT 4QOKB 4FFYL 3QS3A 3QEQD 3ZL4L 3SY0A 2NZ9C 2QTEA 4LOVA 2YWZA 1QAWA 3WELA 2ICEB 1ET5A 3FB5B 4AC4A 1AQKL 1DVFC 4KJWC 3ZGIA 2DQFB 3LS5H 4BFFA 2ZXQA 5DJ6B 4MMZB 3L7FB 3V8CA 3D9AL 5DUBA 1CGTA 3CSYB 3CIQA 3S3CB 4LNRB 1A0QL 4WI2A 4XMLL 2Z6FA 4BBWA 2EVJA 3JUYA 3WY3A 5EU6B 1QBLH 1F56A 3WLBB 4Z76B 5E4AA 3KYKL 1IQDB 3DPDA 3RUGB 2ICEA 1OK8A 5C7XL 3X2QB 3D85A 5AUMA 1KTRL 1U8IB 1WC7B 4M9PA 4MQSB 3UTOA 5DJ6A 3WLWC 4MMZA 3RNQB 3L7FA 1KIUA 4WLCA 4PJCB 5B1KA 4BRVA 1E8YA 3CSYA 5J13B 4LNRA 3KWWB 1P0SE 5FUZL 3TPUA 2E7CA 1ZVSA 1V3MA 5I0YA 1BMWA 2C3VA 3U2SA 5KN5B 4GG8B 1X5XA 3ME0A 3WLBA 1MQKH 1LEGA 4Z76A 3HAEA 1H3VA 1S7XA 1U8JB 5JHDB 1J1XH 3ECQA 4P3DA 3WIFA 1GYAA 3BESR 3SJVB 2FJGB 4MXVE 3EGXA 3VNZA 3T3MB 5TDNB 3QWRD 1HKLL 2Q20A 2WXRA 3ULVL 4FLOA 2XUWA 3KWWA 4TXVB 2KS0A 1A7NL 3QDHA 5KAQF 4Z0BH 3MCKA 4PRHD 3LVEA 3RNKB 1SZNA 4P23C 1ZHKB 5KN5A 5I76B 4JHUA 4GG8A 4YOKA 2ZXWB 5EZLA 5FM5O 1BDYA 4PJ5E 4JFHD 1G9NC 1UWGH 4PI2A 5L4JA 1N6QH 5JHDA 5D2LE 3RI5K 3LQZA 2G2RA 3C6LC 5KVGH 2FJGA 5F1NB 2CXKA 2J8HA 2YLHA 2WZ6A 4WW2C 3X1GA 3P73B 3CQPA 3IGUA 4PW4A 4AGLA 2Z0BA 2Z31B 3TXAA 3VXUB 4NT6B 4F5CE 3ZDYF 2GJZA 4A2DA 1IGML 3EFDH 3HE7D 1BLIA 3NFPB 1KWKA 4GRWB 4ZMZA 3D06A 3MV8E 3OF6A 4PWJA 4ADJA 1J0KA 5HHXL 2J55A 4JFYB 2IQAA 4I0KA 1U4EA 3UTSD 1G7MA 1I9RH 3F7QA 3TBVA 4CGUB 2ZCLH 2XT1B 4CKVX 5T3ZD 3VFPB 2DQGH 4A2GA 1BZ7A 1FHGA 4FQCL 3ZT5A 4FI7A 5TGBA 4GRWH 1XZWA 1L9TA 4XPFL 2Z31A 1EXGA 3VXUA 3JWNG 4AMWA 4Q6KA 1KN4L 3HRZB 3OMAB 3NFPA 3SIKA 4QNPF 1JGDB 2OMUB 1P9MA 4Z7WE 1KLFB 3WYRA 3ZKND 1FFTB 3NZSA 4JFYA 3NACL 1Q94B 4XR8C 1RJCA 3G7TA 1U3HD 2D3VA 4RESB 3QQDB 1EDHA 4FNUA 2B3RA 2CGYA 1SHSA 1WFNA 3QISA 1WJ3A 4GAGL 5F9AC 2V7HB 5CKGA 3ZN6A 2DZEA 1MIMH 3R19A 1DFBH 2VXUH 2VCOA 4WAFA 3HS0C 5IK3B 3I50L 5B38G 5IFJA 1RULH 4LHJB 4BQBA 2VSMB 1MLCB 2W81C 3MO1A 3BH4A 4XPHH 2VE6B 4JRLA 1C12B 3HRZA 3VXNB 2JKRM 4L3FA 2ALWA 1AJ7H 1N2RA 2ZOWA 3QUXC 2WVVA 2X42A 4G6MH 1ESOA 4Y9EA 4M7KL 4U1GC 2RACA 2V37A 3RVWC 1Q94A 4L8CB 4FQIH 2A9BA 4ODXB 3KPRD 2W38A 3ALWA 4TUOA 3O0LA 2V7HA 3LN9A 1ZLEA 4PJBF 1D2PA 4D0BA 1DVSA 1IX2A 1MLCA 2HKFL 3TCXA 2VE6A 3CHRA 5E2UL 5MP6H 1K3IA 3O4LB 1J05B 5F0MB 3BH8B 3HI5L 4ZFOA 5DC9B 3RIAK 1PLBA 3AXLA 4NBYB 1ZSHA 4XP5H 4L8CA 1AZBA 3WEOA 3CD4A 2Y06H 4FC3E 5T33L 1CTOA 3N04A 5EF0A 4FNPA 3QUKA 4L18A 1GC1C 5CEZD 2CHXA 4XWGL 5L0QB 5DJDB 5HDOA 2ZUQC 5EUOF 5HHVL 4ZS7L 5FV2A 2OMVA 2NW2A 4WHTA 5C8JB 3O2VL 4WWKB 3UPAA 2E7DA 3O9WB 1JTTA 3V5HA 2J1XA 1W8OA 1J05A 1GYWA 2F7OA 1RZKL 4IRJD 3UEQA 3P0VL 4GH7B 1KB5L 2VDOB 3QXDA 4NQCE 4UQBA 3HMWH 2BRRH 2L4OA 2I60L 2PWFA 1MAML 4RMUA 1G0DA 1FBIH 1QQDB 3H2PA 4MAYC 3SZ6A 5JMRA 4LXFA 3T0ED 3H6AA 1PZDA 1DE4B 5FYKL 4Z3IA 3HNTL 4KVNH 3LH2H 1RI8A 3W39A 2EINB 3B8YA 4Z77A 3TFBA 2AJ3A 1RP9A 2NT0A 3LXAA 4ZUVA 2X1PA 2D3JA 4U7SA 4WWKA 3U7AA 3O9WA 5CJ8A 2Z3FA 2VQ4A 1ACZA 1UATA 3G9AB 2EH7H 1Z7JA 5TPWH 1T0NA 3FTGB 4KC3B 2MKLC 4PJFF 4G7QB 1JZ4A 2EEAA 1KN2L 4OLYL 4AXWB 1EJOH 5FX3A 3BKJL 4ZTPH 3RY6A 2M8XA 1VIWA 3NEXA 3ULUD 5JW3L 1RZJC 1KCSL 3DMMA 3PREA 3LRSB 5IQNA 2AF2A 3IJEB 3NJHA 3RWIA 1XTLA 2GPZA 3V95A 2QZ5A 1LO5B 3SCMA 4C4UA 5HSFA 4QHKJ 3VFRB 1WK0A 4OGZA 5IHLB 1BZDA 3WTSA 2W0PA 1ROWA 2DD8L 3O11B 4HOXA 4NJ9L 3SDAD 4E5XG 4FADA 1EXUB 4IMKC 4PD4K 3VWKA 3WHXB 3B43A 4B27A 2FJSA 3VXSA 2WW8A 2JI1A 5DMGC 1FSKB 2XN9D 4M5ZL 2BERA 5LCVL 1CTNA 4ZK8A 4APQD 1SF3A 3STZB 4XNMB 1AVAA 1LO5A 2WLYA 3DDFA 4Q9QH 4OQTA 4O00A 5AAMC 4LSTL 3ASNB 3VYPA 3FUKA 3APMA 3O11A 3IDXH 3JV6A 3GI8L 5E7BA 5ANHA 3PGFL 3CPUA 4F15C 3W11D 1JZ3A 4K71B 2A4CA 1LO0L 3ZL1A 3T8MA 4G6JH 3BKYH 1UOLA 1BD2E 5HXMA 3RIFK 4GKOA 1MVFA 1WZLA 1XF4A 2GK0A 2OR8A 3REVB 3SGJC 1PSKH 3ZE1E 2KPWA 2QTVA 1N18A 4Y4FA 5SX5H 4XNMA 2EICA 1Q9LB 2N0KA 3GIZH 1QSEE 4OD2B 2YMXL 4KRLB 1NBYB 3FTUA 1X7QA 1VGKA 4BKLA 4F9LA 3QA3B 1MDAA 4DERA 5JW5B 3QNXB 1KZQA 2ZF8A 5JA8B 2CNYA 1KJVA 4YC2B 3TP4A 4A7UA 2CKBL 5I17B 4P59L 1M6OA 1SUJA 3US0A 2VR4A 1YRKA 2YD7A 4HAFA 2E9BA 1PMYA 2BY3A 1T2QL 2P5EE 3WFCL 3UBXB 4HJ1A 3POHA 3GGWB 4QRRE 5HHMD 1Q9LA 4L29B 1T5WB 1YVLA 5C0DB 3QCTH 4XPGL 5ALBH 3BW9A 4OD2A 2EE3A 2VZUA 4AYBA 1OZUA 3MNZA 3VXRD 3UTZB 2NSQA 3QNXA 5D7IB 4JGNA 1FO0H 1KTKE 2J8UA 1OCWH 4F8QA 2HZHA 2C3HA 2IXQA 4RZKA 1VHPA 3D3VD 3FH8A 4PGEB 5JLZA 5C1MB 2V2TA 3VE0B 4JLRB 2VXSH 4GMSL 4I48A 2C26A 3VGFA 5J1SC 4Z8FL 4N2EA 5IWLC 3MI6A 2R2HA 3KLDA 4Y4HD 3RZCD 3QXAB 4YSPA 1N64L 1XWVA 4L29A 1T5WA 4XPTH 3T0XA 3QO0B 4GP8B 3IU4H 1HHIB 1VEPA 1MFEL 1XCTA 3VD3A 5IMLB 1LJMA 2VDKB 4R5TA 4UT9L 3DV4B 3F04A 2FX7L 2D7MA 2UY7B 2F58L 3SKJL 2VMJA 1A2YB 2CDGB 4BKTC 3O3EB 4HJIA 1PLGL 4ZAKC 4JG0L 3UJIH 3ZQ9A 5C2BH 4MRBA 3D48R 5KVEH 1XF5B 3UTQB 3VSQA 5CIPB 4P5TC 3QK0A 5IUCA 4MAUL 2EE0A 3EUUA 4FKEA 4YDNA 4IDJL 4OVVA 1AO7A 5DRXA 4DN4L 2JKWA 3QJQB 2FWSA 3SKUD 4MA8H 1HHIA 4DH2A 3X12B 3MVSA 1QO3B 3NTCL 2DKSA 3GNMH 2GFBB 2HTLD 1VFBB 2CDGA 4GW1A 3O3EA 3FW6A 4NKMA 2CNZA 3TWCL 3QZBA 4Q97A 4N8VB 3TBTA 3ZHFA 3ARUA 2WUCL 1QW9A 3GRWA 2P80D 3OQRA 1ZGLB 4JFEE 4JO4L 1TU2B 1RSYA 3VYNA 5D1QD 3BX7C 1TSRA 1IM9D 3SBRA 2QGDA 1QLEL 4U1JA 5AG9A 1YYML 2DI8A 2V2WB 3N06B 4OFYA 1N0LA 5LBSL 2WKLA 5AW0B 1V27A 3NABH 5C70A 4NRYA 4G82A 4N8VA 3WMQA 2WGNB 4AITA 2AVGA 1SQMA 5C0CB 3RWFB 4TKWA 3UBXI 2AI0L 4JZOB 1ZGLA 3N41B 1TU2A 3BWAB 4FXKA 5CJ5A 5DJ0B 2VLKA 3UO8B 3WE6B 2O93L 3QG6B 4X7SH 3IDYB 1BHGA 3EOAA 4NX0A 5DTFA 1DN0A 5IJCC 2NZ1A 1I4FB 5A3IC 4KVCH 1E4XH 2KHAA 3N43F 4EIBA 3M86A 2XVBA 1Z6JT 3QUMB 5L7XL 3VA2C 5IHUH 2NPLX 4GI8A 4AMKL 5BS0A 1DLHB 4QLWA 4PRBB 4QTIH 1E28B 3R4RA 2VR6A 1F4WL 3NG5A 3MAWA 4YBHA 1DBKH 4BUHA 1DJXA 1H3WM 4NM4L 3PNWB 4U6VL 5DA0B 2B3IA 4A2LA 1AR1C 4JHWH 25C8H 1VFAB 4B9JA 3ZDYE 4KMQA 4XNZC 3WE6A 4MCZA 2VT0A 2E86A 2EP6A 3HPJA 1OAZH 1XIWA 3GHEL 3MUY1 4TPRL 4Z0XB 4BEIA 1E5CA 1I1CA 4I3RH 1L9QA 5TE4L 5KBKA 1FJ1B 2DWSA 4HHWA 2DLHA 4JFZH 4GAYB 3ETSA 4PRDB 4ZMLA 3VRIB 3AY4A 1DLHA 4S1QL 3DHMA 5HBBA 1E28A 1OW0C 2NR6A 5AL8A 5KYUA 4GRLC 5SWSD 4NWUH 3IE9A 2NYZA 3PNWA 3QT2A 1Z9NA 4ZOBA 3NN8B 3KE0A 5GZNA 1VFAA 1ANUA 1PZ5B 6CGTA 3IF1B 4XCNB 3MOBH 5IR1B 1DQTA 1M2OA 4QNPE 1ZAGA 4UQ3B 3X1BA 3WCYA 3OMZA 4ZDHA 3VH8A 4JRYD 1N10A 1G6RH 1R3HB 3GSQB 5DD0L 3BQUC 2X28A 4HMDA 4CN4A 4QOKD 1JZ7A 1V3LA 1D5RA 3CVIH 4ZOCA 5T5NF 5B4MD 1KULA 3RL2A 3KL0A 3OC8A 5MENA 2IAMC 3KXFB 1SEBA 3H1ZA 2XYCA 2P45B 1BVKA 4Y9BA 5LGYA 2XPGB 1R9FA 4HIHA 4YIQB 3GDBA 3P02A 3E8UH 3NN8A 4JBSA 3WOVA 4N5UA 1NPNA 3OSVA 1U58B 4XCNA 4GW5A 2VIRA 2PCXA 5EN2A 1OLLA 1I7ZB 4UQ3A 5C0EB 4QT5A 3W38A 5IFAH 2GJ6E 4UQ9A 4MZIA 4YXLH 1R3HA 2D9CA 2G30A 4XPBH 1RZJH 2WQVA 4M9OA 5F7DB 3S98A 1MFNA 2HT2C 3DSFL 2HP4A 3MJ9A 3NRQA 4HXAL 5GGQH 1E6JH 2AQSA 2XQ0A 3CFUA 3Q1EA 5E8EB 2Q10A 3DPBB 3ZVVA 2ZF9A 1XVSA 4PJBE 2D0FA 5EU6D 3CMOL 4L9LC 3NRFA 3LKNB 3QC6X 1WBYA 2VDMH 1U58A 5DQJB 3OM3B 4JPWL 4KUCD 3BDYL 3GMNB 4X9BA 1I7ZA 3WDHA 4YSCA 2Q5BA 4K9EC 2CGZA 2QKIB 5IMKB 3TT3H 3MRQA 3ZYJA 1IC7H 4PP1C 3MGTB 3PP4H 4YHKL 1VENA 1WIUA 5F7DA 4WW1B 1ILSA 4G8IB 2IDFA 2X05A 1FNEA 4JPVH 3CDYA 3R18A 3UOAB 4L0PB 2V17L 2OYMA 3MC0A 1TYRA 5KBNC 3D25A 2OX5B 2UZPA 3ZBMA 3BMVA 3WTTA 2Y7MA 4UIKH 1F90L 5EUOE 2VDQB 3U83A 5BV7B 1GOGA 4P2OD 5AB2A 1T1YB 1JL8A 4X4XB 4YR6B 4O51B 1CDYA 3WSQL 3ZIMA 4FCAA 2YPVH 2N3JA 1JD9A 1HCVA 3PY9A 4RFOL 3EHBC 1FGNH 2YC1A 4DAGH 3FSVA 1KBKA 2J7LA 7FABH 1B0RA 1MW2A 2QKIA 2BSRB 3QO1A 2JLPA 3SJVD 1J9QA 5E0QA 2L7EA 2Y7QB 3DI2B 2J88L 4KXBA 5F9JA 3DV6B 5K9QI 4E9XA 1FN4B 1IAIL 1RHFA 3TASA 4J8QA 1CGSL 1CGYA 3DO3A 1CT8B 4IRZH 5E56A 4WGVB 1FYHB 3GMMA 4MSWB 5L8LB 5DK3A 1TETL 1T1YA 3BSGA 4YR6A 1AKJD 2EYTA 3G5YA 4O51A 4HC1L 1BJ1J 3BUIA 1M71B 4NHCL 1HILB 5DI8B 4BQCA 4OCSH 4LESA 3ARED 1DTUA 1PLCA 2Y7QA 1UOKA 1S7RB 4XAKD 5JQIB 1JERA 1TZGL 1K8DB 1FN4A 2OL3H 1FFPA 1WCBB 2UXGA 4XRCB 3HZMB 5TE6H 3KWTA 1HKFA 4U4BA 4I2XB 3RGVC 1UM6H 4OZFB 2V8LA 2WXQA 3VD4A 2NNRA 4ZX6A 1M71A 1HILA 4RVBA 3MJ8A 4XOAA 1G7HB 4P2RA 1DBBL 4JDVB 3GI9H 1GVIA 1S7RA 4JQIA 5E1HB 1BVLB 1BOGB 3FFCE 1DVTA 3VQMA 3ZDXE 2Y2YA 4KKCD 1WCBA 1SRDA 1Z9LA 2KBGA 1V05A 5EEUA 4BFOA 4XRCA 4M7LT 5DEZA 1QRND 2PYEE 3GBMH 2DH2A 2G4EA 5I8KH 4JHZA 4ZD3L 3EFFA 2VGLM 2JLLA 1TG8A 1Y6MR 4OZFA 2P7TA 1VPOH 3FO0L 5LB1A 2B5IB 4YSUA 2OMBA 3FTZA 5E4EC 5EWIH 4PLNC 3ZTJH 1J87A 3P3TA 4AC2A 2E7MA 1R0AH 4I1RA 3BAXA 3UABA 4HS8H 4V11A 1BVLA 4G80A 4JEGB 2B77A 5BXFA 3K1KC 1HN1A 1S9WA 3B9KA 2LQRA 3LKSB 3CXHK 3QH3A 2FBOJ 3FQYA 1TT6A 3O3DA 1T1ZA 3BN9C 2BVTA 1JXDA 1UM4L 3ES6B 2MSPA 2O72A 2NY4C 4Z1PA 1QNZH 3TNMA 3FL7A 4XMUA 2WLIB 5I28A 1YEFL 5BRZD 4I7ZC 1YNKH 1JYXA 4WY7H 4B53A 1SJEA 4N2HA 1UH2A 3DYPA 4AENB 1WA2X 1QI5A 3LKSA 3GS4A 2PPDA 1K72A 2MOVA 4K55A 3QDJE 4LCWD 5LGHH 3K2MC 4I87A 3C5SB 4RAUA 4RNRB 5D93B 3UZQB 4ZMYA 4UTBA 4A7VA 4E42B 4JY4B 3SOBL 1KCRL 1QRKA 1EJ6A 1MIEH 4CVZB 3GO1L 4MWFB 1QLFB 1KGJA 4L8SA 5DHXB 3ZE0E 1DVXA 1SDAB 2XLLA 3Q8FA 1OP3H 2AC0A 3K46A 1A6AB 2NY2C 4XBPA 2YXVA 3E6FB 4NZTH 5CP3H 1AYRA 4PS8A 3UJTL 2P5WB 4HS6B 1U93B 1QTPA 3C5JB 3CWGA 1EGJL 4YHML 3BD3A 3UYRL 5I1HH 3IRPX 1OAXL 1ZS2A 1WFIA 4QRRB 3UC0H 3KS0H 2IPUG 4AM0B 1JPGB 4KU1A 1QBMH 1QLFA 1NFDA 5EV7A 4QTHA 3HG1B 1S9XA 1A25A 3L7EA 5BUPA 3UERA 3U2JA 1OHZA 5FCSH 5AD0B 2PTUA 1IAIM 3MSPA 3INOA 4IYKA 1E42A 1BVNP 1U93A 3C5JA 2HKAA 3GJEB 4ELKA 4P4KC 3ZZ1A 4EQ3A 5BQ7B 4NOBA 4OIBA 3F12B 1FPTH 1SDYA 2DQDL 4Q74A 3LPGA 4PQXA 3KLAB 2AV1A 5JW4M 3ARFB 2HFGH 1XCWA 2UY6A 1F1GA 3QUZC 5KVDE 1IAOA 3HMXH 3U6XA 3NP4A 3DHUA 2HVKB 4Y4KB 3LJ3A 2WLZA 3AMKA 4DEPB 5IESH 4EI5A 3O0RL 2DWEB 5HTSA 3CFNA 4F2MA 2F8XC 2EXSA 3GJEA 5F96L 2HX9A 5C9JA 3FUJA 3L8QA 4QHNB 3WUWA 4WTZA 5BQ7A 1AZVA 1JHKL 4OU3A 1IKNC 1ROCA 1DVFD 3MN8A 4KJWD 4B7LA 3FQ2A 4HJTA 4OGYL 4PGCB 4R4ND 1MFDH 4KK8C 1M05B 2CRMA 2HVKA 4ZXBD 3MBEC 4Y4KA 1H6UA 2V8MA 1UADC 4PRNB 5D1XA 1BMZA 3R8QA 1BAFL 1ZXKA 2EILB 3JWOH 5F6IB 1EEUA 4GO9A 4ODVH 3KDPB 4KXZI 1ETZA 3TM6A 1A8ZA 5FC9A 2XZQL 5HI5C 3IT8D 1LE9B 2XC8A 3L9EA 4KROB 4TUJB 2E0PA 5D96C 5F7HA 4H8VA 4WI3A 4LQ1A 5DJCB 2OPCA 5A2FA 3UAEA 5EZJB 4KQ4H 2OA9A 4WDIB 5D8JL 1SOSA 1YEJL 4U33A 1ETB1 3SHSA 1M05A 1CICA 4GQ9L 4L3CB 2K9UA 2AK1L 3PXLA 1B4JH 2IPUK 4MQXC 4NQDD 4PRNA 5EC1A 3UBXG 4XP6L 5KSAA 2PPCA 4BH8B 3H7LA 1XGRB 2LLGA 4GKNA 4NC1E 2JKLA 4HF5L 1D9KC 5AVQB 4X7FC 5DF0A 2ITFA 3BISA 4AM0Q 3WG7B 3IJHB 3MBXL 1BZEA 2WSPA 2ZT9C 5FHBH 5IB4B 4AQ8A 4WDIA 5GHWL 4Z3FA 1MSPA 5I1GL 1H15B 3ZE2B 5IBTH 4LVHC 4XP1L 2APVA 4FMFA 5AWNL 2VDLH 4HJ0D 5I71B 1EIBA 4YFLF 2H0JA 1IEAB 2JKIS 2A83B 3N0AA 3NZ8B 1N7MH 1C08A 2A1WH 2AQ3A 2PWHA 1FG2B 2HWZH 4KH2A 2W0LA 1DL7H 3GSNL 5J3HC 1CLYH 1NMCB 2CBTA 1XGRA 2N7BA 2OZ4L 4U6HB 3BHBB 4P23D 2ED7A 4M29A 3MLPA 4OT1H 1WHPA 3VI3B 4WHYG 2IDCA 4NFCA 2KDYA 5I19L 2Q86A 1T04A 4KGLA 4L1DA 1T66C 3BOVA 1IFHH 4R7VA 5KJ7E 1KPRB 1H15A 2IH1A 3MRRA 4PGBA 5C0GB 1E5ZA 3RDTC 5DFVC 4HALA 4UCFA 3VFTB 1YYLH 2ZX8A 3OKEA 3OQ3B 1IBGL 5E6ZA 4Z7VB 3LKOA 2N1KA 1BZ9B 1DQQA 4BIKA 4P3WA 5C0RL 4IBQA 3MV9A 3LIZA 3JSSA 1KBBA 4FQXB 4KTEH 1EEYB 3B9VA 4Z7UA 4JPIB 4JDTL 2X9WA 3T4YB 2VO8A 1LYQA 1T0MA 3QPXL 2DQEH 1KIPB 2FGWL 1KPRA 4W6YB 3QULA 1JK9B 2EO7A 4N8VG 4IBWA 2QQNH 4HXBL 4N3UA 4OGAC 4PIRF 2JH2A 1S7UB 3CK0H 4M8VA 1A6WL 4JM2B 5I1KL 4AKOA 1FNLA 3O8XB 1BF2A 3AJ7A 1BZ9A 5K39B 1R5VB 2Z7ZA 1NANH 3ISYA 4TUKH 2FX9H 3VMPA 2A9ML 1DVQA 1E5UI 1EEYA 1KCVH 1Y6NR 5FECB 2QGBA 2Z64C 3JV4B 2V6HA 4J8RA 4F7TA 1A3RL 1EEQA 1TJHL 2GC4C 3BAIA 3I9AA 2V0AA 2CHWA 1DQMH 4GT7A 1KIPA 1Z9OA 1RZ8B 1R19A 3LTVA 1NGYB 4JO3L 4YDZA 1IIKA 3F2LA 2X87A 5KUKA 4YHLH 1U8NB 3IAPA 4PJ8B 3INUH 3OL2A 1S7UA 1UACL 1OT1A 1YQVH 4JM2A 4FL4C 3MNWB 5D7HA 5FEBA 4NBXB 2XWEA 2E9GA 1OO2A 2WHVA 5K39A 1A22B 4M02A 4BFRA 2KZWA 4M62L 2BVQB 4AL8H 2JSFA 3JV4A 2IANB 3MFFB 4Y1AB 5KBDA 3V7AE 4B9YA 3LXBA 5A6LA 3RVWD 1LO4H 3GQFA 2E27L 3VCLB 1N26A 1KV3A 5JORA 4Y19B 1U8NA 3BC9A 4LLWA 4PJ8A 5BW7A 1UGNA 3LB6C 2IH9A 4TF4A 4U6XB 1VKXB 4HIJB 2YLKA 4QEGA 1JPST 4XMPH 4X9GA 5D6CB 4NC1C 3RTQD 2FYYB 4BSWA 2H45A 4S1DC 3KLQA 1BAGA 4AE1A 1KACB 2K3TA 4QLRA 2ADIB 1D5MA 5EUOB 3MGOB 4UB0H 2XXGA 1EDQA 3QHFH 2IANA 1CBVL 4PEEA 5J9PB 3TV3H 4A7GA 3QDGB 3BDXA 2NW3B 4NO3A 1UG9A 1A1NB 4JDEB 3QRBA 3DOIA 1F4YH 1SF5A 2Y0SA 5M94B 2KQNA 4LASH 4Z23A 2VXQA 3IDMB 1AY1H 5AYTA 5FK9B 4U6XA 5DZNA 5FYKU 5IVZA 3S3PA 2NY5C 1Z3GH 3I84A 3EYSH 2VZSA 4LZKA 3T1FA 3W37A 4KK9C 5E2WH 5CLWA 4NN7C 2CH8A 4OI7A 3UTTB 5KYYB 1J5HA 1MFUA 1B2WL 4UF7C 2ADIA 2ZWKA 4X8GA 2F8VA 2JB6B 5HVWA 5F1IB 5JQHC 4PJ5D 4DP2X 5I5JA 2PR4L 1QFPA 3CQFA 1UJ3B 3FN9A 4RX4D 2CD0A 1DVZA 1FAIH 4F7CB 3GJFB 1A1NA 5DMKB 1NL0L 4MAYD 4PJFB 4DPBX 4A38A 2FBJH 3C08H 4KNQA 5EC2B 5DK0B 4XXCA 3IDMA 3L1EA 2RFXA 4YK4C 5FK9A 1DEEB 1G5AA 2KT6A 5EFIB 4NZFA 4WI4A 3AWEA 4XPAL 4DN3L 4L4VA 1G9ML 2J6EL 5DDHA 4HWBL 1DUYA 2LE9A 3UTTA 2A3TA 1S78C 4ODBD 3CVDA 5KYYA 2O6DA 5LVEA 2DLFH 1OLZA 2CHZA 4N68A 1NM9A 1RPQA 1SXBA 2WXOA 3MV8D 2E6PA 3X17A 5I1LA 4LOEA 3TVMC 2WTPA 2X4NA 3VXME 2HLEB 1FCGA 2WWMD 4Y2DB 3H4FA 4X5WB 3HR6A 1SVBA 5DK0A 3IFNH 3ILQC 4DZ8B 4JFDB 3KXFD 5DURB 4HMEA 1MW0A 2OSXA 4AVHA 1Z1WA 5ADOL 4AOFA 5GGVL 2EVHA 4Z5RA 1H9DA 2HVBA 4CVWA 5D2NB 1S7TB 5FO7A 4MTMA 5TH2A 5BVJB 4UT6L 3ZKXC 5FYJH 4HFUL 4J3VA 2Z31C 1NDGB 5GRXG 3WD5L 1CL7I 1YEGL 4IOIA 3QNFA 1YNLH 3FBQA 5I23A 1P9MC 3KDMA 2SEBB 3G9VA 4WCYH 4Y2DA 4CW1B 3P54A 4HETA 4YE0A 3BUBA 2VN6A 2PTTB 1TTCA 2XU9A 2BH0A 3FUEA 3SQOL 1BXUA 2R9HC 3GSOA 3HIZA 3GHBL 5F7YC 2JKSA 3VXSE 3QFJB 4RMQA 4BSJA 1S7TA 3IAGC 5JDSB 3QQNA 2JKXA 4F57H 4N6QA 2PCPB 1DO6A 3UAJA 1A65A 1KIRA 4W9LC 3BAYA 5E08L 4JKMA 2OKMA 5E70A 1MFBL 1N67A 2RALA 2A74A 2HLFC 2XTLA 3NZUA 1MHEB 1WGVA 4TQHA 1NEZA 1A7QH 5EU3A 1QACA 1CLZH 1R6VA 5CSZA 2ZCZA 4CW1A 1MDTA 4O02A 5B1AB 2PTTA 2BCMA 4HH9B 4XMXA 4HUXA 1OEZW 3M1BA 4DHLA 5CGMA 3N0PB 3QFJA 5KW9L 2QMJA 5ELIA 2X40A 3AFLA 4UOW1 2D9QB 4IU3A 5JDSA 2F61A 4GXVL 5AKVA 3QDMA 3WIIH 5T5FA 1KEGL 2FJUB 4Y88A 5T1KB 2F5BH 4I3GA 2EDEA 5D71H 3OZLA 2GUYA 1NUNB 1DSYA 2CIKB 1PYWA 2EXTA 3L4YA 4HH9A 4PJ9B 4A37A 4E9WA 2QSCL 4OZFG 3N2JA 3GXPA 1X6NA 2X9XA 1B88A 4FQLL 4KRPB 3K4ZA 2YUXA 1RZFH 5B39A 4XOEA 1WUZA 2VDNB 3ARGA 3BVDB 1PJ9A 3GSWB 1ZT4B 1A7OH 5CBEA 3SBQA 2VQ1A 5ID1A 4NUGL 1OALA 1SY6A 3CHQA 3IAQA 3OMNB 1MF2L 1WAAA 3BEWA 3CU7A 4NQCD 4BFJA 4WHCA 2VZVA 3QQXA 1UVQA 2JTYA 4P46B 3S8GB 2Q6WB 1AXSA 3R06A 2EDNA 5GRVK 2R39A 5ADPH 1WCQA 5T3ZL 2CIKA 3BUPA 1ZEAH 3QFGA 5JYMA 2EO1A 4DZBB 4LPCA 3HCVA 5GGRY 2DI9A 3ESVF 5CJQL 5L4IA 2HXAA 2XZAH 4A2EA 4EN3B 1IUZA 3GSWA 4RISL 1OK0A 4P3CH 4PVLA 4IOFD 4OUOA 1DUZB 4WWKC 5ID0B 3O9WC 3VRJB 1RIHH 1IO4C 1A3ZA 4P46A 5KBPA 3S36L 2W60B 1NFDF 3H0TB 1YPZF 5FM5M 4ZAKD 3SQBB 5DO8A 1FL6A 5EU7E 1J8RA 1I8UA 3L2LA 1KB9K 3B83A 4P5TD 4QXGL 5GRJL 5GXBB 1MI5B 4HIEA 4CNIA 1YEIL 1C1EH 3JQOB 3RY6C 5KVDH 3MA7A 2MTAA 2R1YB 4HHAA 4YWGL 4EN3A 2FLMA 3DMMC 5KTEL 3IKKA 5EO9A 1WIPA 2DBJA 2FECI 2W95A 4DK5A 4U6TA 3QIUB 4HG4K 1CK0H 4DESA 3SCMC 1AO7E 2R2BB 1DUZA 1CDBA 3BAEH 4ICXA 3VRJA 4PS3A 4LSVH 3LEYH 1JZFA 2W60A 3H42H 3QRFM 5E8NA 5E00A 3S2AA 2NX5B 1B3JA 3SQBA 2X70A 8CGTA 2H0PA 4TL5A 4LAJH 3VWKC 2Z7YA 1XX9C 3LN4B 4GXUN 3O3AA 4KQ0A 3KL3A 1I9JL 1UD2A 2WCGA 3L3OB 2B4CL 2R1YA 5EA0L 4HS3B 1U8KB 4XNQB 5EZIH 2ORBL 3RJDA 2PXYB 3B3IB 3LV3B 5E4IA 4Z7QB 3HZKB 4JKNA 1P7BA 5AW2B 2ENYA 4ZODA 2OQJB 2WXHA 1H3XA 2R2BA 5DVMA 1Q9KB 1UXWA 5BMFH 4FP8H 4JY6B 1UWXK 4DVBA 4OCRL 1RUPH 3W3BA 2DPKA 2UWEF 4M6OL 4UQAA 1EHNA 4F8PA 1AFVH 2EYSA 3NCEB 2G3ZA 1A7RL 3LN4A 2DJMA 3APFA 2IWKA 3GPSA 3L3OA 5CEZL 1VCBC 2Y07H 4P5RA 1QSED 1QX1A 4Y4FC 3B3IA 4N90E 3LV3A 1CE6B 3HZKA 5FDWA 1KYOK 4G42A 4URTB 2VLKE 3O6FB 2QHRL 5IW6A 3QHTC 2DBLL 1Q9KA 3G6DL 3BMWA 3BWSA 1VEOA 2R83A 2K78A 4F9LC 1U9KA 2HFFB 3TS8A 2AQRA 3GLZA 2P5WD 3MLYH 1MCDA 2P3YA 4GIPD 1NGXB 3QI9A 2DQIL 2IALB 5BS0E 1AR1D 4QRRD 2TRYA 2X0UA 1P7KA 4LLDA 3M17B 4EUPH 2AJVH 2FJFB 4P9HL 1IGJA 5AW1B 3HAEH 2ZYHA 1A7PL 4HBCH 1JVLA 3HUJA 3ZGHA 1OCZB 5JTWA 4DP0X 3EBAA 4FLHA 4OSUL 4WTQA 5F9OH 4RIRB 5DJ8B 2NY5H 4LAQL 3CSTA 2HG5B 2R4RL 4FNLH 4Q9CA 5SWQB 4A2MA 4WZ9A 4GRLD 3CZSA 3ULUL 2IPKB 3ZLQC 4YC2C 1FE8L 1F11A 1HHKA 4TRPL 2WZPA 3AVEA 3VSUA 1BZQK 2DMCA 2X7LB 4EDWL 3OKDA 2A4ZA 2H2PC 2FJFA 2H41A 3LY6A 3PG2A 4KMTL 3ZYOA 5EF1A 4YS4A 3P9WB 1BCIA 4AQ1C 3LHPH 3DVFA 2NXZB 4N2CA 3AQXA 3MTXA 3HBZA 1DLFL 1TJGL 3FOLB 4RIRA 3BQUD 1AACA 3M8OL 2K7QA 5DJ8A 2HG5A 1DQJB 2QQQA 1FZJA 4D0DA 5EU7C 4LDLB 5SWQA 5CN1A 1MRFL 1K2DA 4CU7A 4NAQA 3KPQA 2PP7A 2IPKA 2YRBA 1OSZA 3D7PA 4FJZA 1P4IH 2Z8SA 5MENE 1GGYA 1XL6A 1R17A 4TVUA 1AZRA 4FFTA 5C0FA 5I1CL 3V4PL 4IBSA 1QI3A 4Z7UF 1AGBB 3BVVA 2AERT 1M1XA 1GGCL 4O58L 2XCMC 3PIQB 4FNTA 2DQCH 4ZFFA 2FATL 4ZG1A 3H3PH 1PGRB 3QQ9D 3KW7A 3OHXB 3C6EA 3PABA 5FR3A 4RRPA 2DQJL 5PCYA 3W0WB 3BCFA 4UQIM 1UB6B 4UV4L 4PV9B 1NUFA 2E5EA 4GNKB 4UQCA 5TQ2L 1MLBB 3B7UX 3ZKMC 3BGMB 4TSBH 1WH0A 2V3EA 4JB9L 3WFDH 4AG4L 2X4SA 1A5FL 3I2CL 1Q1JL 2AJSL 3MMEB 2FK9A 3V4UH 4Y16B 1YMHA 2O5YL 4KKNA 1A9BA 3HFML 1PEZA 4J5VA 2PWEA 2PP9A 4KKBD 4OGXH 3D30A 1NLBL 3OHXA 3QPQC 3L9RB 4OIAA 3DETC 3H9SB 5JXEA 4OCLC 2PWDA 2H1XA 2W0FA 2YZ8A 4YN3A 1OF0A 5TE7H 5AW9B 4HIIB 4UMGA 4CKQA 4YHZH 2IMMA 3B8SA 3CC5B 3ISRA 4WUUE 4FXKC 1R5WA 4FI6A 3S5YA 4JW3A 4Y16A 2DWTA 2ESVB 1ED3B 4K7PY 5C09A 1JCVA 4JN2B 3DX9A 3L4CA 3RVVD 2IFFH 4NO5B 1KGYE 3KPLB 1DJHA 3DK2A 3L9RA 1SPDA 3KGUA 3LNFA 5DXWA 1CE1H 3IVKB 1DO5A 4NEHB 4HKJB 4PVBA 4HIIA 4I4WA 3C5ZB 3QCVH 5FUOH 1F6AB 4DP5X 5FGBA 4M93B 5FKPA 1DZBA 4XODA 4HZAA 1HQ4B 2ESVA 4Q0XL 1UEYA 1RH8A 3A67H 1XIWC 4H1LB 4E9LA 1JZ2A 4IW4C 1UFUA 2IG2L 4I0PD 4JN2A 2AXFB 1UZGA 2JCCB 4M7ZB 5D4HA 4ZTEA 4FQXD 3IN2A 5EOCH 1ES0A 5AZEL 2Z9TA 2P5PA 1J48A 3WIHL 2C7UB 2DQTH 3QNZB 4QRTB 3RAJL 1HWWA 2ZOKB 1GHFL 2NNCA 4LARL 4YPJA 1S9YB 3HI6L 2VC2H 4HJGB 1XHHA 3UXFA 4LB8A 5GZNC 3HE6A 1NCNA 4I1NB 4BK4A 3GUTB 1O6SB 3G3LA 4MA1B 4NKDB 1KC5H 4I9XA 4BK8A 4WFEE 2JCCA 1MEXL 4M7JL 4P2RE 4XP4H 1A6VL 4X7TB 4JM4H 2YD5A 4ZOAA 1MFMA 4G8EA 2JELL 2YPKA 3LH8A 4OTXL 4EE2A 4C56E 3BQVA 4NRXA 1PPIA 2D03L 3FQRB 5DQDL 4BZ2A 2C7UA 1NDMA 3UADA 3SPVB 3LN5B 4N0CD 5TDPA 4V33A 3L3GB 5KS9B 1CR9L 3T8XB 3FC8A 4HJGA 2R0KH 1AXTH 3LMJH 5DRZB 3IJSA 3QPKA 1CXLA 1O6SA 4R8WH 4BK5A 2OSLA 3LZFL 3V9CA 4Z3JA 2XTJB 5TF1H 1D3CA 3ZRCC 4PWFA 4ODSH 3TNNB 3MRCB 1JRHI 3PHOB 4DQAA 1FZMB 3MXVL 4LPVA 3LNIA 3UAAA 2VDRB 2BIQA 4Y1AD 3BIAX 2N7AA 4GYBA 3BIKB 4XMVA 1ZMYA 3KPPB 5F89A 5KWYC 3LNGA 3L3GA 3EOBB 3CSPA 4OFPA 5K33A 3SDXB 4Y19D 2B8OT 1PZBA 2DI7A 2ED9A 4AYEC 2BIHA 3QBTB 5BO0D 3HW7A 3AGWA 1Y7VA 1J11A 1AAJA 3LKPB 5F3FA 3CPLB 5IEHA 5B7MA 5F3HB 5BPPA 4WO4A 2MTPA 3TNNA 1CYXA 2ZX5A 1WT5A 1FZMA 2V5SA 1IJNA 4OQTH 1LO2H 1THCA 3LAFA 4RGMC 5FGSA 3B5TA 5LWYL 3VFOA 5DT1L 2DKUA 4GSDH 4M1GH 1HOEA 1Q0YH 3VSVA 1H3PH 3CDCA 3SDXA 2COVD 2J1KA 1CXHA 4OM1H 2X6AA 4GG6A 4Q6IC 4K3JL 2HVJB 4ONFL 4LSRH 3NIFF 3JWDH 2OR9H 3MXWL 1DJGA 1W0VB 2A9NH 4NN5B 2QELA 3L95A 1F4XL 3KYOA 1ZA6B 1HSBB 1TZAA 2BY0A 4HZLB 3TT1L 2VRKA 5I16A 3U7WH 1RUKH 2YQ3A 1BFVH 4LU5H 4YLBA 3ATDA 5EOQH 3NJVA 1NFDE 1TR7A 1L5GA 4O2EB 4Y5XA 1J5OH 2LT9A 3I6LE 1CXFA 1S4IA 4ALAC 3LS5L 5D7JB 4JM0A 5DA4A 2CBOA 5FO2A 4Y7MA 3ARQA 5GQBA 2QGCA 1HSBA 3QZMA 5ITBL 2DM2A 5I75C 4KKPA 4TNEA 3S8FB 4NQEB 1BJMA 4FFYA 2IAAC 4RAVB 4N26A 1J1OL 5FYJD 4Z78B 3RURA 1QEXA 1WAAF 1PEWA 3SYPA 4C58B 5AZ2H 1KGUA 1QBLL 2Q2LA 4YHNB 3FFCD 1AHWA 4PRAA 3CX2A 5DURD 2ENQA 5FA4A 4HKXB 1T20B 2F74B 3D9AH 4OD1H 2YOCA 2PYED 3D69A 3VGEA 4ABQA 4X80H 3WHE1 4CMHB 3MRNB 2OMWA 3WFBL 5EU4B 1TQBC 4XMLH 4F2ME 2AXGB 1J18A 3UGEA 1RJLB 4MZ3A 4NUPA 1RK0A 1COBA 3CFBB 1U3ZA 4LP5A 3DBXB 1MWAH 1DJZA 2YZ1A 2ZCHH 2ZUTA 4Z78A 5C7XH 4HX1B 3VFVA 2VKWA 4HCRA 4YHNA 3TYFB 3IXAA 1JPTH 2K8QA 3Q01A 1MQKL 4PGJA 1EK3A 1WWWX 2ICWB 4HKXA 1LLAA 3B2UD 1P84K 3AB0B 3QIBB 5J1AB 4FTVB 5D1XE 1J1XL 3DRTB 4AZ8B 2YUWA 5EU4A 3B9KC 3VDAA 1MCLA 5JOFA 1R3KB 3A4DA 2AXGA 3BAKA 3G08B 5J57B 4G43A 3ALXA 2OCCB 2XA8H 4DEUA 1P4BL 1CLCA 3U1SH 3K8KA 4Z0BL 1MCWW 5I24A 4ANKA 2D3NA 5I26A 5DVPA 5E8PB 4LPYA 3L3IB 4NN6C 1RZ7H 4MQXD 1U21A 5CKAA 2PR9A 4Z7OB 2ICWA 1UWGL 1VADB 2M83A 4K4KA 5IEKB 2VMFA 1A4JA 1D9KD 3GRWH 1L6XA 3IK2A 3QDJD 1HKLH 3DRTA 4LDCA 4UBDC 4QXUL 4XC3L 5DZLA 4XE5B 5DMYA 5KVGL 1T1XB 4PJHB 2QBWA 4P2YA 4NIKB 1AI1H 1ZLVK 1IGYA 1XV8A 4HEPA 5T1KD 1UXLA 1UH4A 3GZQA 3P4OB 3DHJA 4AQEA 1BX2B 4NLHA 3EJRA 3CH1B 2QVFB 3O4OB 4JFPB 2K6ZA 5B8CA 3TN0B 5E8PA 3L3IA 2VLLB 3NCMA 3K8MA 5TF0A 1UD8A 1NTDA 3EFDL 3RWGB 3DYOA 5GRUL 4PJ9D 1U2CA 4YDKH 4L8SC 5J3HD 3JTSB 1UZ8A 1LWRA 1ZE3C 4EEEA 3G6JF 2ZYIA 3TTSA 1UT9A 1I9RL 4MJ6A 1KBGH 2BVEA 1G7PA 4L3EA 5CLZA 1KTDB 5E8DL 1T1XA 2X6BA 1KDJA 5GGSB 2ZONA 4R2GC 1T66D 3LNDA 3J27A 4HPOH 3DROB 1CYWA 5E7FA 3MFGB 4K7FB 4N2AA 3T6ZA 4MS6A 4GQZA 3VGDA 1BX2A 2WQUA 2P24B 4O5LH 1U91A 1JWUB 3CH1A 1XQ4A 1CF8H 4IBUA 5HHXH 1TO5A 2VLLA 2MOQA 5JYLA 2I7OA 4AGQA 3N5AA 2Z92B 3JTSA 4E41B 4MS8D 4AQZA 4DP9X 2NCEA 3KG5A 4UINL 3THMH 1KTDA 5ERWB 3RBGA 2RCSH 3MV9E 5AVTB 4XPFH 5GGSA 1JZ5A 5B1JA 3AG2B 1ZS8B 2K9FB 2ZKYA 1DFBL 2VXUL 5G4MA 2JQZA 4Z7UE 2V9QA 3FF8A 1RULL 3WENA 3HUJF 4LIQH 4MNHA 1AJ7L 2ICWI 4G6ML 3QQ4B 1A47A 2AZAA 4V1DE 4GAGH 2D31B 5CFAA 4FQIL 5FKAB 3QYCA 1E9OB 4EI5C 4BINA 5JO5A 5LXGH 2AAVA 1T7WA 1TTRA 3D18B 5JIQA 3FUFA 1VFUA 5DLMH 1ZS8A 1UWEH 2PO6A 3F7PC 5A2JH 4UUJB 2A6IA 3CFKA 4OLUH 1MHCA 2NX5D 1BIIB 3VX1A 4BRJA 5I18H 1S5HA 5MP6L 4UZSA 3QQ4A 4JFTA 4XE0A 4XP5L 2D31A 5D1XC 1U41A 4N2MA 5H35B 2XFGB 4DEPC 2Q2EB 1E9OA 2Y06L 3FRUB 1CI5A 3ENEA 2YGQA 4ODUA 4QCIA 5T1LB 3QORB 4R7NA 3JZYA 1JS4A 1INDH 1JVKA 2W65B 2R29A 3L3HB 4N0UE 4QHLB 2K8MA 1M2VB 5C0IA 4ZO6A 1XTMA 3CZLA 2DAVA 4B9ZA 4XXWC 4XMWA 1CC3A 1BIIA 3LB6D 4PMFA 2Q87A 3IWVA 3D85D 3RWJB 3CZNA 1JZJA 4LFHD 1CICC 4AKPA 3ILPB 2C9AA 3HMWL 2BRRL 4P07A 1KB5B 4PRIB 1QFWH 5KSAC 1FBIL 3FRUA 3GXTA 4LCYB 5EUKA 5T1LA 2PW1A 5C07B 4M3HA 5J11B 5GGUB 3L3HA 4KVNL 3LH2L 3O2VH 3O6FD 3EO1B 3DJZA 4AQ8C 3DUUB 4KZ0A 4PR5A 2NT1A 4FTDA 5G4NA 1JYVA 4NQVA 2G9HB 5KBMA 4ZSOA 1OD7A 3BUDA 2EH7L 3ARSA 4C4KO 2YBRB 2O5ZH 1D5IH 4KK9D 5TPWL 4PV1C 4E9YA 2GBVA 1D5BB 3FB8B 4PRIA 4U1IA 3BO8B 2RMNA 1YECH 1BM3H 2P9RA 1EJOL 4OJAA 1S3KH 1W80A 4ZTPL 4FQJH 3MLTB 3IMBA 3S88H 1CZ8H 2WQ8A 3OXRA 4KHTH 3GIVB 4CC4A 4WJKB 4CVUA 4P4RB 1NEUA 3EO1A 3IDJB 4K7PH 4JL1A 1KG0B 4KQ3H 5D7LB 4U49A 4CJ1A 2NXYC 1FDLH 4JPKH 3C09B 5CZXC 2F53B 1NM4A 1SBBA 1ZA3B 3BD4A 2YBRA 1GSMA 3W57A 3BKJH 1I3GH 2R1XB 4ZTOL 1S78D 5F70A 3FHAA 1GSKA 2IFGA 3BO8A 2VLMD 4L4VE 3MLTA 3TVMD 4F1ZA 5DRWB 2X6MA 5HI4D 1AP2B 4P4RA 1HC1A 3IDJA 2I07B 3OF6D 4GFTB 1AGEB 4Q9QL 4FG6D 4N2NA 2E4TA 3ILQD 5IW1B 2K3HA 4IGBA 3IDXL 4CBZA 3LXUX 1K5WA 1A6ZA 4ZFGH 2DWXA 2QEJA 2NY0C 2R1XA 2VH5L 1T1WB 2EZ0C 2CM6A 4G6JL 3BKYL 4M5ZH 3MLXL 2Y72A 1X9RA 4WJ5A 3W5NA 1PSKL 1QFWI 3WGUB 1FF5A 3B5HA 1AP2A 5LCVA 3ZL2A 1K8IB 3LZPA 2I07A 2WWKO 5SWZB 5I6XB 4DKDC 1VACB 2R7EA 4JQIH 1WTGT 3GIZL 3SD2A 3W0WD 2R9HD 3G6AB 5CZKA 3IFOA 1URLA 4MX7A 4EXKA 2OI9B 5FOBA 2GB2A 4R5VA 5FO9B 2BNRE 5I1EH 3MRFA 3AU0A 4XZUB 2CKBB 1W2KT 1J0HA 3KPSE 1UWXH 1JD7A 3FCBA 1PAZA 1M4KA 2P28B 3GSRB 3L1FA 2XA3A 1MCWM 4H0LC 1K8IA 2D73A 3A4FA 4P04A 4DK3A 3IU3B 1P5VB 5A2LH 4ZPVB 1MCPH 3QCTL 5ALBL 2DF3A 2JKTM 4M3JA 1NCWH 1KNOB 2ENJA 3G6AA 3H9SD 3NIFE 4Y9CA 1S46A 5IBUB 5FGCE 5BW7C 2CO3A 4P59H 4ZI8A 1FO0L 2BXYA 2X4TA 3HLAB 1GW6A 4D0CB 1CFMA 4IK6A 2A99A 4XZUA 4G8GB 2CKBA 1KENH 4H1LG 2VXSL 5HHNB 5DMJB 2JK5B 1OWRM 2ICCA 3Q6GH 3KBFA 4PJGA 3F7VA 4R84A 1UA6H 1G9NL 3DX6B 4LKXB 1G7LB 5E6RB 3QDME 2W9DH 1G84A 4I5BA 3IU3A 3MX0A 3ROLA 3CGTA 1WSST 4XPTL 1OARH 1R3IH 3IU4L 5FS5A 1O9VA 3WN5A 1EFXB 4YGAB 1PAMA 2DQ6A 3S5LB 1E5BA 1IILE 3BE1H 2KLSA 4HGWA 3B6SA 4UTBH 3RWHB 5DWPA 3UJIL 5C2BL 5KVEL 3LQAC 2JK5A 2CJSA 1X9LA 1XSIA 3VGAB 2OS7A 4LKXA 1ZE3H 4PLKC 2QADC 5E6IA 3WNKA 4PREB 1WAAE 4PCKA 1ZLWH 3RX9A 5HDRA 4MA8L 1YPZB 1VERA 2F58H 4Z7IA 4GG6F 4NOFA 1BF8A 3ETTA 3IDGA 3QJFA 2UYLB 4XXCC 2NQCA 3GNML 2ZOLB 3WFEH 1FZOB 4UT9A 1XF2B 3W9DB 4GBXB 4FNRA 1VESA 4F3FB 1P7QB 3RWHA 3KLHC 1FFNA 3VXMD 3JVGA 4FEMA 2XBDA 1PZSA 4LSPH 3RX7A 4FXGA 5LKNA 2EIKB 3LKRB 1U30A 4M61A 1PCXA 2FH8A 2C4FU 4PREA 3NIDF 1HHHB 1H8OA 4JO1H 3U79A 1JNHB 1WWAX 4XN2A 3TWCH 1QLEB 2YBGA 4K73A 3Q48A 2X44D 2EH8H 3W9DA 4GBXA 2XWDA 3NABL 1L0XA 3RU8H 3S96B 2JXMB 1OQOA 1P7QA 4NWTH 4MNQE 4BM7A 1CFVH 2VLRB 2CLVB 1TFPA 3UCRA 3SCMD 2APBA 3U4EB 3WKPA 3ARDB 1B9KA 2M2DA 3L5XH 1KXTA 4IHOB 2YSSA 3P9MB 4ZRGA 5TD4A 5I73B 3TZVA 1QLEH 2BNUB 1HHHA 2H5UA 3CLEH 4X7SL 1XD1A 3VWKD 5JPMA 8FABB 4Y2DC 2NY3B 2UWEB 4LF3B 3VXSD 2ZXGA 1NGZB 3KCWA 4JQVA 4KVCL 1E4XL 5MI0B 2CIIB 3S37H 2QR0B 1XF3B 4QXTA 4MB1A 3A24A 3VXPA 5F7WC 5MHSE 2FEEL 5LBSA 5IHUL 2AEQH 2AI0H 3V0WH 2PABA 2WLKA 4QTIL 2VLRA 3DDGA 3WO3B 3U4EA 2YKLH 3DTUB 5IV2A 4R3SB 1T21A 2W07A 1DBKL 4UOZA 2PKDA 2CDEB 4XVUC 3LS4L 1CXEA 4IHOA 2AEWA 3BPLC 2UUDK 4JHWL 25C8L 2BNUA 3Q8EA 1S7SB 2I24N 4YSSA 5IQ7H 2A74C 1OAZL 3F6LA 3H2QA 5TFSH 2OTWB 8FABA 3V5KA 4I3RL 4LF3A 3G6JE 4U1KB 5ACZA 4Q6YA 5FM8A 4YEFA 2PPAA 2FT7A 2CIIA 4JFZL 5IFHH 1NWPA 2P49B 3EO9H 1WDAA 4Q4IA 1OGPA 4XVJH 1X5ZA 3ETBF 5KSVA 3SD5A 3ML9A 3IB4A 1R5IA 2OTPA 2X53A 3PHQB 1VEMA 5ICZA 2A6DA 4NWUL 4J2QA 1U8LA 1MCOH 4RQQB 2V4LA 1DJIA 5I1IH 1QZ1A 4PJEF 4JRXB 3MOBL 4YHOL 3ECWA 3COOA 4IU2B 1ACXA 4JFFB 4PTUA 3U4BH 2JF1A 1AD0B 4QGYA 2WNWA 4S10A 1G6RL 4RGNB 4FFWD 4U1KA 4FA8A 1VDGA 4TSCL 4ZX4A 5HGDB 1AHKA 1TZHB 4S1RL 4W9FC 2ZOOA 3KS0J 1ITCA 3CVIL 3DURB 2X1QA 3IFPB 3LEXB 5F1SA 1U33A 3MUZ1 4HWNA 3ARGC 3BP6B 1KPUA 2WV3A 4K3EH 4KO9A 4XCEB 3ZT6A 7CGTA 3E8UL 3KVQA 3HUJE 4MYPA 2B59B 4KKRA 4UWQB 5HHPA 5D7JD 2VM4A 3GTVA 4JFFA 5C08A 1WEJH 2F68X 5IFAL 4M4RA 4PJIF 6TAAA 3OSKA 2ZUWA 4YXLL 1QKZL 2CHNA 2AQNA 3DECA 4XPBL 3TJEL 1RZJL 4MLIA 4XHJC 4XN1A 2ZIDA 3BSZH 5I9QB 2H2PD 3Q3GA 1T7VA 5GGQL 1OGAB 5ESAB 1E6JL 3DURA 5BJTB 3IFPA 3QXTA 3LEXA 3SDYL 3G5XB 4X0KA 4LVNB 1SDDA 4ZW6A 2WKOF 4X98A 3D2UA 1A3LH 2R0LH 2EADA 4X8JB 5C0BB 3FQWA 2VLJB 1QW8A 4L4TB 2P52A 2F54B 3TO4D 4MJIE 4FLQA 4ZPTA 2B59A 1YY8B 1I9EA 1E67A 2VDML 2HUHA 3L3KA 4P46C 2J1WA 2WB1A 2YPLA 5HI3D 2EKSB 1NUGA 1E3ZA 4HXAH 4KUZH 5F1OB 3TT3L 1IC7L 2DYPD 4HEPG 4R9HA 3PP4L 1FYTB 3D05A 2VAAB 4D8PB 1KJ3L 4XP9H 2HCZX 4L1TA 3QZWB 4OF6A 1OGAA 4JPVL 4NPYB 4OBSA 3RWEB 4ZMAT 3Q1SH 4CGTA 3QWOB 3HZYB 3V6OE 1AO7D 1NBZA 5LJYH 1YO4A 5IG7A 3IGAB 1MCQA 2NUPB 1E8WA 4UIKL 2EUWA 5I8CB 4L4TA 3G04A 4X50A 2H9GB 2YPVL 3QIBD 4Q89A 4U1LA 1FGNL 4AUUA 4FTVD 4DAGL 7FABL 4X5XB 2EKSA 3KYMB 1RL1A 2AW2A 3DK0A 1FYTA 4QJ4B 3VFMA 3QZWA 4QHKI 1IM3B 1JZGA 4NPYA 4YBQC 4BYHA 1N9PA 4IRZL 4N2GA 5GSVA 1GGBH 4EIZC 3WSQH 5I8CA 1KTBA 2NY1B 4KTGA 2FIKB 1PL3A 3NPZB 2XWJA 2H9GA 4YHPA 1F6FB 3IPFA 3IM1A 4PW3A 4XN4A 3STLA 4X5XA 4YBLB 5C86A 3IMTA 1Q9OB 4JCMA 1HDMB 1IEBB 1FORH 3HHRB 3NPSB 3UG3A 2NY6D 5BQDA 4AJWA 4OZIF 3MLRH 2OL3L 3SDCA 4N90D 3BP7B 1A14H 1N8ZB 3FT9A 3ZHNA 4W9IC 5SV4A 5TE6L 3VTAA 3TN0D 2YWYA 2Z1KA 3P30H 4A1RA 2YRPA 4Y1TA 2XQYA 2QPEB 3BFWA 4JKWA 5C09E 1YJDC 4YAQA 3KYNB 4X6DF 3V9FA 4HC1A 3VM5A 1T7YA 4QO1B 3D39B 2EDHA