2WU1A

Glucosamine-6-phosphate deaminase complexed with the allosteric activator n-acetyl-glucoamine-6-phosphate both in the active and allosteric sites.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
b'MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-6-PHOSPHATE DEAMINASE
publication title Glucosamine-6-Phosphate Deaminase Mechanism: The Substrate Piranosic Ring Opening
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wu1A00
1JT9A 2WU1A 3ICOA 3LHIA 3KWMA 3BXFA 1UJ6A 1FS6A 3L7OA 2GNPA 4L4YA 2RI1A 3HN6A 4IO1A 3TX2A 1UJ4A 1NE7A 4GO1A 1FS5A 1O8BA 4R7TA 3CSSA 4GMKA 3NWPA 3ENWA 3BXGA 2BKXA 1CD5A 3ENQA 2O0MA 2RI0A 1UJ5A 2BKVA 1HOTA 3KV1A 1VL1A 1FSFA 4L5JA 2J0EA 1HORA 3E7FA 3NZEA 4M8LA 1DEAA 2R5FA 5HJ5A 2F8MA 3OC6A 1XTZA 3EB9A 3ENVA 4L5IA 1KS2A 4L4ZA 1Y89A 3UW1A 4R9NA 1M0SA 1FRZA 1LKZA 3BXHA 3EFBA 3CH7A 2W48A 4TM7A 3HHEA 1PBTA 1LK5A 4L50A 3U7JA 4L51A 3E15A 1FQOA 4X84A 2OKGA 4NMLA 4OQQA 4TM8A 4OQPA 1LK7A 3BXEA 3IXQA 3LWDA
chains in the Genus database with same CATH superfamily
3GRCA 3BD8A 4D8VA 1C7QA 3PLNA 4M0UA 3SZ3A 3A1EA 1KBZA 1KC3A 1Q3HA 1T0PA 2ZI4A 1OVMA 3UNXA 4MEAA 2PBFA 2VXCA 4AB1A 1JQJC 5JMPA 1B42A 4ABTA 2EEZA 1DAKA 4KJZA 1HETA 4XH9B 5B1EA 2P8JA 1K63A 5FV7A 1TPZA 1JF8A 2BFFB 2DY1A 2F4VB 3CONA 3FB4A 5ALKA 4YRMA 5EWLA 3NIBA 4DSTA 4ZYZA 5ITSA 2ZTSA 1PI3A 2NXCA 3MTAA 2B61A 3FRJA 4OY3A 1X8KA 4RACA 5GONF 1EFPA 2XYGA 4F3YA 4I19A 4QLOA 4Q93A 2V74B 4LTMA 2A14A 3BPSA 4A1FA 2Q0XA 2B30A 4B0PA 2PGAA 5CITA 1X1AA 5IM4F 1EFHA 2CC2A 3LBHA 3PR1A 4BWVA 3NORA 5IAJA 4J0CA 3KE9A 1TQDA 2Y77A 5LP6A 1CUWA 3NWPA 2XGOA 3FOCA 3H7AA 2KI5A 3F8SA 2VRWA 1P44A 3GEIA 2ZTHA 4TN5A 3W77A 1K2WA 2CXXA 1S96A 2DUWA 2JHCA 3F7NA 4M83A 2BFOA 1XDSA 1K4MA 1U7UA 3S44A 3ROGA 4A9AA 4PZZA 1NVUQ 3PQDA 4G5YA 3WL5A 3IAXA 5IXSA 1JIJA 2O19A 2SCUA 3GLVA 3EGCA 1F06A 2XGGA 4MVJH 2GDJA 3K1ZA 1PD1A 3Q85A 2ZI7A 5H3LA 5AQ1A 2OLJA 2YC4C 1RM3A 4NRDA 5H82A 1L5ZA 3G0GA 1MX9A 2JZCA 4NJOA 3KPYA 2PWYA 2WSMA 3I92A 3QVXA 5FTJA 1DIGA 1H0HA 2BW0A 2FK7A 2CK3A 5DI3A 3JQGA 3W4JA 4YRKA 4F2HA 4D98A 1TMYA 1C41A 4NESA 1N6RA 1UAGA 2XVXA 3PC2A 4LWZA 4JJ7A 4DSNA 3VNRA 3WFZA 1PJZA 1NONA 4KRYA 1N92A 2P6PA 2X2OA 5JDCC 4YUAA 2ZTVA 1A97A 2P3OA 2GUWA 4LFCB 1Z29A 3ONEA 4HB4A 3W4KA 2IYYA 4JLOA 4RVOA 5AM0A 5CXUA 4M2LA 2JASA 3EQ8A 1BHJA 3QHPA 1QK3A 1YJAA 5HX7A 5AI4A 3U7QA 3MB5A 3WRWA 1G42A 2H57A 5AVVA 3W3AD 4OFWA 4KCGA 4N5IX 3V6MA 1QDLB 2V6MA 5K05A 2QWXA 3FFBA 5JZBA 1OZ0A 5DN6A 5HFNA 2DR3A 4MTLA 1N6NA 3K6JA 1JSCA 2YVQA 3AEYA 3GZ4A 2OB1A 3OTGA 1ARZA 4LGYA 4MJ3A 4QPCA 4CKZA 3BK7A 3EARA 3NP9A 3LDFA 2PNJA 2OFFA 4UEWA 1H2ZA 1U5CA 3IVGA 3HUTA 1ORDA 2FN3A 3DTNA 4BBAA 3D59A 3Q4GA 3GLSA 4MPRA 1AHPA 3PUYA 1M5RA 2P7HA 3RFTA 3RUDA 3O8CA 1VIVA 2IE0A 2OUIA 2PKRA 2C2GA 3FSEA 4RH1A 3SU8A 1EVJA 3WKAA 3FYUC 3DT6A 2OXIA 4V2UA 1U3WA 2P91A 3OZ7A 1N2GA 2CXTA 4IDGA 2WV9A 1G59A 4D1YA 4C6TB 1K3TA 3STWA 1SQ5A 3GVIA 4AJ9A 4KDCA 1F1JA 2DFNA 3EAGA 4TZ0A 2O7QA 3QKSB 3UMSA 4IS3A 1LSJA 5KYNA 2DHCA 1IY2A 1LTQA 1Q91A 3RSSA 4FB5A 3FM9A 4F5EA 2HHAA 4K28A 2R7KA 1WB6A 4Q9LA 1SVLA 4LBYA 3DVSX 2GR9A 2H4FA 1I7PA 3HK2A 1Z5PA 4NQZA 1ZVKA 2OR3A 4RS4A 4KOEC 3ENWA 2RGRA 4QD3A 1OX4A 2NO9A 3GAAA 3JD0A 3L93A 1U0HC 2NPIA 1GGHA 2AMJA 3IQWA 4FSHA 4Q00A 5JAUA 5IVDA 1ORVA 2A8YA 1E60A 2D5BA 2NVWA 3QG5A 4O4IF 3L0IB 5EJEA 1RI1A 5ALUA 2OHOA 3CCBA 2JLRA 1NPTO 1KK3A 3UGTA 1OFIA 3O84A 4KXLA 2WM8A 4KXWA 4DV3B 4RA9B 4EYOA 1C5KA 1MJFA 1ZEMA 2ID4A 3AP3A 3BEOA 4HDRA 4QICA 4BVBA 1JFRA 1R66A 3AKEA 1P1RA 3AY0A 2G1JA 3OQBA 4EHAA 3MJTA 1CUYA 1TK3A 2CNKA 2GAFA 1QHXA 4MCHA 3NC1C 3OC6A 5YASA 1V6CA 3BGVA 1EFCA 4A2CA 4L8VA 1P80A 1WKVA 1ZGHA 2WU4A 1C4OA 3ETLA 1QZUA 1EVQA 2OP0A 3ITEA 1BMQA 4DA0A 3AEKA 3RT7A 4M1KA 2ZUCA 4LJ4A 1DOHA 1IUNA 4JGBA 4D4KA 1EVZA 4LXUA 4MWZA 5LQDA 3FPLA 2VP9A 4AF7A 1O6GA 3HWX1 4NHOA 4PAGA 5JAMA 4JI0B 4YX9A 3WLFA 4CEJB 4CCYA 3GLRA 1F2UA 2NO5A 4XUDA 1R10A 4JXXA 2QAGB 2D2VA 3ZV4A 5LDHA 4QYMA 3BMQB 5J1TB 1J2UA 3GELA 1I4LD 3IAFA 5GAJA 3BT7A 4S1NA 5F35A 5C8XA 1SB8A 2IJGX 1NMQA 2WPNA 5B37A 1A50B 1KYVA 2A2ZA 3R41A 1D2NA 1YQWA 2ILTA 1DUVG 2HRQA 3EWNA 3MMSA 4FINA 3GLUA 2GCIA 4IIFA 1SOVA 2C4KA 2QRVB 3DZIA 2XYVA 3CRQA 4KLNA 2B5WA 5A9SB 1R4NB 2PKCA 3OQVA 2XBMA 4U3JB 4WZ6A 5FNVF 1MO4A 1U1EA 4BB6A 4E12A 4RQTA 2JJ8A 3HVIA 3IURA 2R11A 1I80A 1MJNA 1TDJA 2B4YA 2GPTA 3C1TA 3PG5A 4BNGA 1C2TA 4DLTA 4YHHB 1KI3A 2FPUA 1MAUA 2Q5QA 5GMOA 4C7BA 1G9SA 2HKIA 5E2BA 1XMSA 2BI4A 2J48A 4N82A 4U8HA 3UT5A 1FRQA 3WMGA 2Q1UA 4DA9A 2OO3A 2YVLA 4ZOQI 5KOJB 3HB7A 3U1BA 3B85A 1FU4A 3PGKA 4RK4A 4H6PA 2Z4TA 1W8IA 4FHCA 2VHZA 4QXQA 5IM5A 4NENA 3W5JA 1ORTA 4LCEA 1N2ZA 2W0SA 2NU8B 3KB2A 4QECA 1H2AS 3VAYA 3H9JA 1GV1A 3QFFA 4WTOA 4YUXA 5AVYA 1XMQB 3IKLA 3C87A 2F3QA 3IKJA 3NPAA 3WYDA 1H2XA 1AUPA 3LY5A 2BOVA 3JALB 3NBAA 2UYGA 2Z6QA 4KUEA 2NVOA 4L15A 1GCOA 1UZAA 2X6TA 3H75A 3H87A 2QVZX 1GRQA 1LH0A 1RVV1 1IULA 2QYHA 3HB1A 3R3ZA 4HQ6A 4IH9A 4YRAA 3BFXA 2E4XA 3BL6A 1BWQA 1DEKA 1G55A 3URMA 1KTIA 1SVUA 3GPLA 4E14A 3G5AA 3GCGA 2QMYA 1H0SA 1KEUA 2BKLA 4LOHA 5J4LA 2JIZD 1BCSA 1CUZA 2PXXA 1P6UA 4M36A 2ZYHA 3OF5A 4TLMB 4F11A 2VQFB 3CX7A 3AGQA 1U28C 3STVA 3UAVA 4E3ZA 2BC9A 1G7RA 2MSNA 3HG7A 3I2YX 2OMEA 4IIJB 1I3NA 1O9GA 4FEGA 3ELWA 3C5VA 2XH8A 1GM5A 5F9HA 1I5EA 2ABWA 3D3JA 4WT7A 3EUWA 2Q6KA 2IELA 3QLUA 4NBLA 3AR3A 5JPCA 5JJIA 3HEMA 3H5AA 3PDJA 4U8GA 3ZPXA 4DWOA 4EQZA 5JXHA 4FZ3A 2DU8A 1XA0A 2M32A 4AWBA 4YRCA 1B8NA 3EJWA 2JH8A 5E9AA 1Z5GA 4JD5A 4DN6A 2HA0A 4YCMA 1ZIDA 2CL6X 4OXXA 4NYJR 1MXHA 3EUAA 3GJXC 1XTZA 2RKOA 4ND5A 4S12A 4ZJYA 2I1WA 3QEMA 1PKXA 2OCYC 1CC1S 5FA6A 3TQSA 3UAOA 3OECA 3FHTA 4UFOA 3D2AA 5BN3A 3KEOA 2BCGY 1P73A 4LTDA 2H1LA 2GSWA 3C5CA 3NHUA 3P1JA 1XDUA 3AUYA 2YHBA 5EMLA 1OC4A 3ZHSA 1RQPA 3U9SA 1NC1A 2K7ZA 1VSUA 1RMYA 2AD1A 1TJ5A 3AOGA 3EVZA 3K1TA 4MV8A 1GL9B 2C2YA 4O25A 4I8DA 4Q02A 2GYUA 3TUJC 3VHXA 4RM2A 4LK3A 4ZVRA 4QOJA 3FKSA 1VHLA 1QRDA 1EE1A 4GLJA 4B3JA 1ONBA 3EOBI 4OLHA 1Y8ZA 3SYLA 1TL7C 1M1UA 2XVAA 3AYXB 3HHEA 2Z8XA 4C5CA 3A32A 1P9OA 1UPBA 2NSLA 4EF6A 2FE4A 2Q8PA 4Q24A 5FWXB 4TPKA 1R3DA 1P2UA 3DEAA 4G5GA 1XJWA 1O4VA 1GZ3A 1LK5A 3B51X 3ED1A 4TQUS 4WESA 3ZV5A 4CDGA 4KE7A 2QN6A 3TD9A 4L3VA 3B1XA 5I4KA 3C15C 3LBNA 3Q11A 3UC5A 2B4TO 2QMHA 4TS9A 2AJLI 5BWBA 2O14A 5JY1A 4HX5A 3HR7A 5B1IA 1SVMA 3GHHA 3T7SA 4DTIA 5JAIA 4CM4B 5KNBD 4F92B 4A7PA 2ACKA 4K0KB 2ZT8A 1FP1D 3Q3JB 1XMPA 5CB4F 4OO3A 1XA3A 5IZ4A 5I9BA 2GHQA 3VPFA 1OV4A 4MRPA 3VMFA 5J4HA 4K8RB 4MR9A 4BUJA 1JDSA 3ZWOA 1XTVA 1PJRA 1SVNA 3I4CA 4YO7A 3ZGLA 2WNIA 3VKGA 2AFHB 4QL3A 3SICE 2LCIA 3RS8A 3OJXA 1P0FA 2WTEA 3IE1A 3P9YA 4JUDX 3HKCA 1FLVA 4XOIA 4C4YA 2IH4A 1PEKE 4OJNA 4EA7A 5FPPA 2FNAA 2VTKA 2YWEA 3ZBQA 2BDEA 2QZ9A 3CJTA 3IOEA 2CDAA 2Q5FA 3TYXA 1YBHA 2QYTA 3ESYA 3FI9A 2W2XA 4BFYA 2O2DA 1P1JA 3IJEB 2A4MA 3IOMA 4CCWA 1ZI9A 4YTEA 1UPXA 4H18A 2GI4A 2VN8A 1QC5B 3UAXA 1GTRA 3ICEA 1YMVA 5KNDH 3MGKA 4A5OA 4B4WA 1G6HA 1I0ZA 3GGSA 5COBA 3NH9A 1ENOA 2I76A 2QT0A 3TX2A 4R54A 1NVTA 1Q0UA 3COWA 3EODA 3REOA 3ILHA 1RYEA 1MUUA 3OM8A 1PEAA 5L40A 2XUQA 2YIMA 3PP8A 4WE3A 4BQRA 1ECPA 1TZMA 1CUCA 2ODEA 2IHKA 1K7SN 3GT0A 3FNBA 4MVJA 3UQZA 1KK2A 1O96A 1YDFA 4BMOB 1MJ5A 3JSXA 5EIEA 1M1ZA 2PMWB 1L7DA 2HBRA 1JHYA 4IJVA 2CXHA 3A6LA 4P4UA 3F5MA 1L4UA 4DLBA 3NFRA 5FB3A 5J1SB 1XZIA 3GQBB 4AUEA 3GJQA 4EDFA 4WWHA 5LYYA 3TD6A 1Y1SA 1QH8A 2C5LA 4ENUA 1GR1A 1TVKB 2LZ0A 4M55A 5TRTA 2O5CA 2RGUA 5LWQA 1CF2O 1YGPA 3ICPA 4RX1A 3KSBC 4NV1A 3E27A 4RORA 3PEEA 4DV6B 3LO8A 4N3GA 1EUZA 4NMMA 5K8UA 5KQLA 4QU9A 3HDTA 4QO8A 5BR1A 3H99A 2WSSD 5LUAA 3WB1A 3PE6A 2PGXA 2R8PA 3VPSA 1W6RA 3X1ZA 4IUYA 1IQPA 2J0UB 3M6IA 1V4NA 4CLEA 2C5FA 2XNSA 3K73O 1P7YA 1W4ZA 2ACVA 3HKEA 2BGKA 5E95A 1VE1A 3OIGA 4JJGA 3T5CA 1JG3A 1RYMA 1DIRA 1GZDA 2O3JA 5HGXA 3I5XA 3TCNA 2R1ZA 2VF5X 2X2PA 2I22A 2PX8A 3SE7A 2NU7A 2XGSA 1GZUA 2I7CA 2PMCA 2GS9A 4P0PB 1M7HA 1OTHA 2V03A 3BK1A 3CYFA 3L5KA 3LCUA 4D42A 2FPSA 5JI3E 4LNAA 2AN9A 3MAGA 4D9IA 2JFPA 4P33A 3MELA 3VH3A 4P3NA 3NEPX 4JVOA 4OYYA 2FKNA 1VLZA 4DEYA 3OKPA 3AKCA 1TIPA 1SO8A 1J0DA 5ADWA 2J5BA 3F46A 4PPQA 5K0TA 3TR0A 1PQUA 1ETHA 1Q0RA 2DHEA 4RW0A 4RY9A 3Q5GA 4YCJA 2OILA 3SFVA 2ZITA 1MTZA 1UM8A 5EE1A 4BVGA 1H22A 2PNFA 2DY0A 3VR0A 4EZEA 4Q6BA 3EDQA 3W5BA 1KC1A 1MU0A 4JLDA 3OZWA 4PFJA 3VSEA 4B34A 4ZV7A 2JFWA 1BG6A 5H4HA 3IQIX 4B5KA 3GDOA 4G0WA 3ESAA 1N7IA 3E58A 1ID1A 2XRFA 2XIQA 3R2JA 1WU8A 2QPLA 3OCYA 3WQRA 3ORRA 3DOEA 5JARA 4QULA 3PUXA 2QQ0A 1YZVA 1DIHA 2PMDA 4AJIA 2XVZA 2MIIA 3DFFA 3WS7A 2XWSA 2V4MA 3OPMA 3C4QA 3HN7A 1GU0A 2LVBA 1MHTA 3ZI0A 4U2EA 1WMDA 1CR6A 1JX6A 2GTHA 3LFUA 4JKYA 5CB0A 2EU8A 3VR5D 3D54D 3GEPA 1UDCA 3VR2A 3U2QA 4G4GA 3ET4A 2BTQB 1E96A 4N3AA 3CN7A 1C3JA 4YRTA 1E6EA 5BN5B 4CV2A 5BMVF 1UJBA 4YY3B 5G53C 2UAGA 3D3WA 4ZT3A 1GPYA 1QV9A 1FNBA 3CSUA 4YQFA 3F3MA 1FVXA 1BNCA 2IC5A 2VUHB 1Z5NA 1AKVA 4DRYA 4NE2A 2C2OA 2VPIA 4D3XA 1ZD8A 3K8ZA 5DK4A 4ATNA 3LQYA 4HX9A 2QGFA 4RABA 4RPIA 5LJLA 3QG1A 2I65A 1IG0A 2BFFA 2CFIA 4RHUA 3B8HA 2HSZA 4K6GA 5LQSA 4YS6A 1RI3A 3IQFA 2B4RO 4H1UA 2QPAA 4Z3DA 1C14A 2NPFA 1U9IA 1KVQA 3HB4X 3HSKA 3OY7A 3R8XA 3S8EA 1ZGJA 3EVBA 2QQEA 3CBQA 2A0YA 2BVNA 3PL1A 3QWAA 3PHHA 2ZT5A 3GPIA 2AZ4A 1GQ2A 2G76A 2PX4A 2VJYA 2YWGA 3JX9A 3KZXA 1B93A 3P4UA 1B26A 3B6KA 4G0YA 4JDPA 1S3FA 1T8WA 1CDEA 1ZH2A 2OORC 4Q12A 3TIVA 3KOOA 5KKCA 2GN8A 1ZOLA 3WDKA 1NSTA 2DR0A 3R44A 1TF2A 4E2ZA 2VJOA 3IMCA 2RHOA 1KMQA 3GXBA 4DXDA 3G5MA 4GQAA 4Y0AA 1RJFA 1T2NA 3EBLA 1CUHA 1YQGA 2VBFA 3N58A 2F8MA 3QRWA 2NPOA 4QDTA 3BC1A 4UEQA 5JE8A 1YQ9A 2RHWA 2IU6A 3UANA 1YVPA 4G0MA 1R00A 2ZYDA 3GLHE 1VI6A 1I2BA 1YS4A 2IXAA 4JOCA 4V39A 1WZIA 1FU7A 3Q87B 4NARA 3RS0A 3AEUA 2ZRIA 4GWLA 3D5EA 5I3ZA 1DKUA 3FVQA 2WY2D 5KTRA 4I55B 3KYIB 4PSAA 4HNSA 5LA6B 2V7GA 1FDWA 2V97A 1Z7EA 4MA0A 2B2XA 3L0PA 1PTJC 4M1TA 4H9GA 4RHXA 1A1SA 3OX3A 3SGLA 3OPYI 3CO0S 3GUHA 4XFDA 1WULS 1E0DA 3ELDA 3ZIUA 3IGFA 3WK7A 4DCPA 2W48A 1D4FA 3KDSE 4LYYA 2EYUA 3IBSA 4B09A 5B7QA 4GRDA 1K4YA 2QMUA 5D87A 3PDWA 4OFZA 2LP4Y 1U63A 1P81A 3AFOA 1PDWA 1JDNA 4DMRA 1OPRA 1WVMA 3S2IA 3T38A 5LMUB 1O9HA 4JR0A 3SYTA 4KQFA 1GPKA 1DXOA 1RYDA 1KR2A 2G0AA 4Q48A 3E5HA 2W37A 4IDCA 3U17A 1Z4IA 1DJMA 4YJKA 2ZTLA 2VL7A 1OTYA 2FEKA 2XE7A 3GARA 3KVYA 5FR2A 2HSJA 4QYIB 3QJ5A 4RIIA 2QUHA 5CVDA 5MF6A 5UKDA 3FGNA 5C8ZA 1L0BA 2REOA 3OE4A 2QE7D 1EWVA 3BTVA 4MGKR 2ONKA 5GY7A 1SHJA 2VP3A 3AR2A 4HDOB 5GWXA 3ICVA 1QBKC 4C3VA 4D6PA 5CA0F 5GJCA 1DUIA 2ZUTA 2OECA 3DYVA 2L69A 3PJEA 3JPYA 5BWCA 3OZXA 5DHPA 1JBKA 4IWYA 1KJWA 2BR5A 4C3OB 3GP8A 4BRZA 4OQDA 3HJGA 2XWBF 1OYOA 5HIIA 1ENYA 2BPOA 3ESDA 3FLEA 3Q7PA 4OQZA 2G25A 3WB2A 3ZBTA 3O8RA 1QGUB 1NJFA 3CW8X 4JT9A 5KOHB 3KZNA 3B3JA 1JYEA 3QWFA 1XTSA 1B1CA 1JR3A 2FFRA 3IP5A 4L4UA 1EFTA 5IAEA 4YB8A 1JLKA 5FI3A 3GBSA 2XMZA 2RC5A 3TXXA 3MYRA 4CF3A 2RHBA 3H5VA 4XE5A 5TVKA 4ZHQA 3BBLA 5JSHA 3RC7A 4NV3A 1E2FA 2G80A 4HQ0A 5DHTA 4MIYA 4A0QA 4BATA 2Q6IA 1VL0A 5I8ZA 5IW8A 1GAEO 1G7SA 3HDHA 5ECWA 4F8JA 4F91B 2VF2A 1JB9A 2H4YA 1GILA 1HLDA 3GLQA 4P4GA 4ENTA 1K89A 1SM4A 4BASA 2HF8A 4DJJA 3OM9A 4NPCA 4Y7DA 1LDEA 4J16C 2X4GA 4FWBA 3OAAD 1ZGBA 3FE2A 3IE2A 4I5FA 1S8NA 1XJCA 3T3IA 4C3ZA 3WP0A 1TI7A 5C4IA 1P2GA 5JD3A 1PR2A 1USGA 4XSGA 1JDTA 5JS1A 3WTCA 1WLSA 2JEZA 2XCUA 4G0NA 2IYUA 3UJAA 2QW8A 3KVRA 3NHKA 3ML1A 3BHNA 4BFZA 4E07A 2JAOA 5JPIA 1GTVA 1YOVA 5T4EA 1NN3A 2GQ0A 3G23A 4PXSA 4F9GA 4YXFA 2AF4C 1XP5A 2WWWA 1F0KA 3CO5A 1IN6A 2RHMA 3ETDA 1RM0A 2RK3A 5AM4A 5F98A 2AZXA 3S8MA 1IXZA 5KS2A 1KJQA 3L77A 1FSFA 2K87A 1BDMA 2PVCA 4BL5A 1NXTA 1M1NB 1T5LA 1NLZA 4P3KA 1W5BA 1D0IA 2NOAA 5ALRA 4EGSA 5JWRA 4IOJA 1VL5A 4NYMR 2ZJ1A 1H4SA 3TO5A 1G38A 3LV8A 4LJ6A 4I8IA 4RE6A 4MQBA 5FBZA 5IBRA 3ZS9A 3WJ7A 4F60A 2YFYA 4C01A 1L5LA 1RNLA 4CV1A 1KJ8A 1XA4A 2E1RA 4RH3A 2YZKA 3EVEA 2JAXA 2OZLA 4BMZA 4RA9A 1MX3A 1KBQA 4QA9A 1B8UA 1AF7A 2C20A 2WYHA 3P0EA 5DNUA 4JXZA 2DX7A 3A2NA 4E2FA 1XROA 3D6FA 4U6QA 5JLAA 4EHJA 1JV2B 4ZHSA 3OO1A 2JPDA 3FHJA 3LL7A 3LPAA 3MJ4A 4RWZA 1GGVA 3DVQX 1USUA 3BXOA 1V16A 2RKBA 2C57A 2XCRB 2P5YA 4JC4A 4M0EA 2WTBA 1B15A 3R5SA 3RARA 2IW3A 5P21A 1CFJA 1TM1E 4FJ1A 1S89A 2GESA 3RI3A 2Y27A 3G0DA 1DU4A 4WCFC 4CEJA 2ID8A 4L51A 3EXFB 2Q1SA 4HAVA 2PZAA 3VTAA 1YE3A 3HUFA 5IAGA 3NWJA 3M70A 2WW8A 4IDDA 3X1DA 1KRWA 4YN3A 1R0RE 3F67A 2P2GA 1PLJA 5AJWA 3RC1A 1H3FA 3ABSB 5DMHA 1CJKC 2JI8A 3L0DA 3QBDA 3BMCA 5CM8B 2H16A 3IAS1 5KNDA 1P0MA 5CJ2A 4ZCLA 4BY9E 1UBCA 3DT9A 3EPRA 3PNMA 2QRVA 3IHLA 3H9UA 5A9SA 4O0LA 1YBMA 1R4NA 2G9RA 2V6IA 1T5TA 1XL1A 2QZ4A 1VMIA 4PTYA 5NULA 2ZWMA 4ZI2A 4AS1A 1M2VB 1ZW1A 2A86A 3HVHA 3HO8A 3NEAA 4O4JF 4RK6A 5FL7A 1QB7A 2IRWA 4DCGA 1DBQA 3CPJB 1ODIA 2YQ4A 2JH9A 3FTQA 5HK8A 3UOWA 3IH5A 2EV9A 3P9NA 1RADA 1A9XB 4JITA 1BFKA 1Q7GA 2PUHA 3KKLA 4FFVA 2WABA 4D0LB 3N7TA 4JXKA 2WTXA 2OG2A 2ZIGA 2OHGA 4PFKA 2IUFA 1PJLA 2R6R1 3AH8A 3M1YA 5AK3A 3S1AA 2IHNA 4LN1A 4RYLA 2HA6A 2FR8C 5I47A 2NU8A 4MWDA 2HT6A 3AERB 3TKYA 3SZLA 3LUJA 4J1TC 2ZQ5A 2ZULA 3NHYA 1RAFA 4UVDA 4RVGA 3VGPA 4GZ5A 1SD2A 4WUTA 3ZD7A 3F2VA 5AIBA 3QE0A 5HNKA 4MQUA 2YL2A 4ZOLA 1N8KA 3JALA 1VA5A 3A4IA 4GOKA 2NO6A 3S2ZA 3F6BX 3CC8A 3SF8A 3TE7A 5IX8A 5HMLA 4JP2A 5CJPA 4FLMA 1JMKC 3V32A 4MKFA 1G7TA 1DWPA 3PWZA 1JWAB 2WA1A 3FSGA 4I5DA 2UUBB 5K3DA 1RBQA 2IUUA 3OOJA 5C31A 4A3SA 5JZOA 3L4BC 3EVAA 3HADA 1L8AA 1T1IA 4KBGA 3E84A 2ZREA 3LLUA 3ZTTA 4O5AA 4CMEA 1XK7A 2AN3A 2GDZA 3HCAA 1N6PA 3E7FA 2XODA 3ZXUB 4C14A 1S3GA 1T8TA 4RVDA 3GMSA 4BQFA 1AUXA 3KQWA 1ONSA 4FYYA 4TMXA 5A05A 5BUCA 1XFAA 4QOSA 4KIUA 4LMAA 4D99A 3UYKA 5LCXA 4LS3A 3GY0A 3NHWA 4B87A 5CX4A 2WDPA 3DFUA 1CNEA 4BYGA 4LF7B 1EB8A 4G8DA 3FFWA 5DGCA 1B23P 1L4HA 2FZWA 4MSUA 3BKXA 4RFVA 3SVLA 3FNRA 2WHRA 2IXDA 1CR2A 3ZU4A 2FP4A 2P5TB 2PY6A 3S0JA 4LRXA 3G2PA 3F4BA 4X1KA 4JELA 4RFLA 1P1HA 2CNLA 1IIBA 3GMIA 3PC8A 3QHQA 4FHEA 4KFSA 5H81A 4GC9A 8MHTA 2P9EA 1ZNWA 1LB1B 5KSYA 1L4NA 1NAHA 2QY9A 2JJ1D 2CV2A 5EKUA 3BD7A 3TVYA 1B41A 1CLEA 5C5CA 5B1SA 4GFDA 2W6NA 1DRKA 1Z13A 4B76A 3KSDO 3ZD9A 1RWXA 3BM5A 3BA6A 3N05A 2ZRCA 1JE1A 3B3QA 4IVPA 4U02A 1Q1QA 4DDTA 4O5OA 4OLBA 4FMDB 1MW8X 1V25A 3WJAA 4BCDA 3NBKA 1GDDA 1IJBA 1GY8A 2NWQA 1EDBA 1P4GA 4GPEA 1TUGA 1WCXA 3FWNA 4K9MA 1ORRA 4M22A 4X84A 4XD7A 5LP6F 2Z2ZA 2I6GA 2GBLC 4L1KA 5JS6A 2NADA 3KKOA 3P26A 2B1JA 4KWCA 2WUWE 3LO5A 2X0RA 3MMZA 1TMOA 3NKVA 1XCBA 4BAGA 5I4BA 4JLWA 5JAHA 1HG1A 5CGZA 1GGNA 3K8QA 1AV7A 5EFZA 3W1VA 4DA8A 1E5XA 4JJEA 4DR2B 4DNPA 1NZDA 4DXHA 1HFWA 3SSAA 3OEEA 1VHWA 2DSNA 1K86A 3DG9A 2EKPA 3AF5A 4YYEA 5DLYA 5J5AA 5JS2A 4J0FA 4KRGA 4J6EA 1PYOA 1VA4A 4PZPA 2D7CA 4U7PB 3PRJA 1LQ2A 2EW2A 1IHXA 1CE8B 1U2ZA 2ZIWB 3UPDA 4D02A 4DSOA 1MC1A 3FGOA 3LX4A 1RRGA 4GBMA 3P0FA 4HBGA 2G07A 4I81A 4KXNA 5BSGA 2JCYA 4P3OA 3RYCB 2UUCB 3BB1A 2YIJA 5TB5A 2I80A 2Y1CA 2JAPA 2MOKA 1H05A 2E4VA 3K9GA 4RFSB 2W6JD 1DKRA 2I4TA 4IF6A 2JGLA 1JPJA 3QF7A 4L73A 4URXR 1GPMA 1NXPA 2V0CA 2V6GA 2VJBA 1PNVA 2NM0A 3PTAA 5J40A 2OOKA 4IG9A 4GYYA 1NIPA 4LV6A 2WVJA 4D6YA 2V9PA 2E6KA 5DI9A 3LSTA 3UZUA 3G82C 4QO7A 4DLNA 2VPQA 3PGXA 3QOFA 4FNMA 3ACBA 3E61A 4B43A 4GMDA 3DLPX 3EFOB 3TRFA 1YWGO 2UZ0A 4Y0NA 1M10A 1PJ3A 2EOAA 3O21A 2AJTA 3VC2A 5KU7A 5KYXA 1HNWB 1B6TA 1ZM2A 1NW7A 4J2OA 2JI6A 3DZ8A 3RWOA 3UVEA 1J09A 4IQ0A 4Z0PA 2G6TA 3HKDB 4W5JA 3E70C 5U1PA 3X3HA 4BLWA 3S28A 2AMVA 1MB0A 3OCXA 5TC4A 3FFAA 4CKXA 3UK1A 1X13A 3ZU6A 1JKFA 2H11A 2Q27A 1E1LA 5GGYA 1MAHA 1X86B 3D6UA 1C9MA 3GG2A 2LRHA 2R8BA 1R0CA 2GM5A 3VSBA 1BX1A 1UDWA 3DCNA 4PG4A 4QHSA 2OA0A 1XP8A 4RS3A 1MFZA 4R1QA 1YU9A 1T25A 1DTSA 3V46A 1K0UA 1VZ3A 1KZ4A 3RVNA 2V7VA 3WAGA 3I1FA 4C2AA 2AZTA 5JCZA 4FNAA 3HRKA 2C5AA 2J0UA 2O7VA 2IZ5A 1UC4B 3REQA 1WB4A 3S1SA 5IZCA 4WJKB 5JT1A 2IKQA 2D6FA 3DF9A 1YQXA 3CIFA 3K0HA 3EJ6A 4KLRA 2HZ7A 4HWGA 2WAYA 2C95A 3RUPA 2GEFA 3H1EA 5EE5B 1VGRA 2QL5A 4L5AA 4MP3A 3AWDA 5AHWA 4BYMA 4QWMA 4D4IA 3DLTA 4B7XA 1LLDA 1PBTA 1N9GA 1XCJA 3KALA 4FDLA 1SELA 4LVNA 4BRUA 2QTHA 2WTNA 1KQFA 2YY5A 3EXHB 1KBOA 4AROA 4YRQA 2X9GA 4PG7A 4L8GA 3SZUA 1U31A 1B76A 2UYYA 3E35A 3PQ4A 1KAQA 1LZKA 3QSGA 4S1PA 4OUDB 4TVOA 4RXTA 2CZCA 2X14A 2W2TA 1NRIA 3NEJA 3L43A 4O2BA 4YRBA 5CT9A 1AT1A 4HDKB 3FVVA 3ZJ4A 4FC7A 4B31A 4ME6A 3WLEA 4XGNA 4KUHA 5LZ7A 4UTVA 5K0LA 1MKYA 3ZQJA 4HLNA 4UAGA 1XNHA 5AXBA 3EISA 3JTEA 3LLCA 1PVVA 1AF4A 4BNMA 4WDQA 3ITNA 3WLNA 5HIJA 2JK1A 4TSFD 3QYPA 1Z6QA 4HF7A 4QUDA 4LUCA 3WWEA 1CJVC 2XCSB 1TLFA 1JHRA 2J3QA 4B4DA 821PA 1C9KA 3FCCA 1BMFA 4QTTB 4R68A 2GO1A 5HF8A 3UJHA 2C4NA 3ZVLA 1Y9EA 3K09A 5F12A 1DC4A 2BN4A 1LJLA 3EDRA 4TMFA 5EP2A 3QQ5A 2KS6A 3DBHA 1KRXA 1TRHA 1OZGA 1M9NA 3DL4A 1TYDE 5BVGB 1E5DA 3G9XA 4M86A 4R31A 1QLHA 2HY7A 4LV8B 2BZ1A 1XQXA 1O8BA 1F6DA 1GKYA 2BTQA 2FW7A 3EW9A 3O03A 3IV7A 4QQNA 1WR8A 5GV8A 1AA6A 2REBA 4TTPA 4AQYB 2WNHA 2PM8A 4BNLA 3WLPA 3C4VA 3FOEC 5LU8A 1ESMA 3DTTA 4PC3A 2FQQA 1EKXA 1CZOA 4R3NA 1LDYA 3L0BA 4YP5A 4ZT2A 5BRNA 2AXEA 1K8RA 1ZCAA 2AK3A 2RI0A 2X1VA 1EEXB 2D0DA 3NDRA 4IMJB 1JEQB 4FFWA 2HCRA 1TK2A 3I9NA 4ODIA 4XASA 1PSWA 3D2BA 3DLCA 1WHTA 3KOYA 2AZMA 2GVDC 3RWMB 1YACA 1JXQA 2HA7A 4ARAA 1GGEA 3ZDCA 5GIOE 1LWNA 2H08A 3R76A 2JEYA 5CHYA 1Y80A 2QMOA 4H3HB 5AJYA 4EVSA 4EI8A 5CBKA 1ZBQA 4CV3A 3DTVD 4BE9A 2GA8A 2I8CA 4AN1A 1U5BA 2WFLA 4A26A 3C3MA 5FPTA 4TXMA 1VMAA 5FOWA 3GI1A 1ZQ9A 1A76A 1W1IA 4FGJA 4EO9A 5A5EA 8ATCA 4RMNA 3KEFA 3LSYA 2AOTB 4BIIA 4V0KA 5DLPA 1Z15A 2EBUA 4HUTA 2XY4A 1P0IA 1SB9A 4MQFB 4Y1GA 1K97A 1O0SA 3T0GA 1KO5A 5P8WA 3B9PA 3MTGA 3IPLA 3CW2A 3DNFA 3WNDA 2UYHA 2F64A 3RC9A 5LJIA 2ONYA 1JIUA 3OIUA 4OHBA 2QRGA 1E1CB 3DE1X 3L8DA 3R5HA 4KI0A 4QUAA 5DTMA 2UUPA 3WYAA 3VTFA 3DKKA 2XNDD 1J06A 1X8JA 2I6XA 4I55A 2DETA 4J9UE 1APBA 5CPBA 4Q9NA 2PT6A 3AZPA 4JU8A 3FX2A 2JFVA 4QYSA 4BX2A 2GXAA 1U2DC 3AI7A 2NAFA 3BWMA 1YHYA 3RJTA 3ISVA 1EVYA 3FLAA 3F6EX 4HWKA 4LPSA 1B6RA 4UXHA 2CFOA 1V35A 2CHVA 3UK0A 4A8JC 1WD7A 2ZBEA 2JIDA 4BMSA 4A6DA 5HPYB 2X9NA 2C61A 2OV6A 4Z4IA 4HTFA 4J4BA 1OI3A 5D3QA 3FCUB 2HJ9A 2BMVA 1EWKA 2XXAB 1IBLB 2H9IA 4Q3AA 3OQ6A 1DWOA 4Q3KA 3ETGA 2CHQA 2G7ZA 4DPLA 5K4HA 2YWHA 3M49A 3NR2A 3QWBA 4M0MA 3UFBA 4PHTA 2QX9A 3I73A 3A4MA 3DZHA 1LC3A 4TMTA 5ICGA 2NUBA 1V6SA 2FEOA 3K0FB 3L2OB 3L41A 4Y9UA 4D5GA 2WUFA 1M2FA 3L02A 1WMAA 1AS0A 1JLHA 2GRUA 2XVYA 1KEWA 2ZRNA 3RBVA 4CBVA 4DLPA 4CMBA 2ZB3A 2GN9A 1HYGA 3M6MD 1KOLA 3TVDA 4HFMA 3SBEA 5DBGA 2IYZA 5JRDS 3DR3A 4OJQA 1KRHA 4DBZA 3LUGA 1FFHA 1UKVY 2GKGA 4FMCB 1LU9A 3FR7A 4MOWA 3BXZA 4YHBA 2VDQB 1NVDA 4PQGA 1KDYA 2HRDA 2XTZA 4JSRA 3TJRA 4XIIA 1TGVA 2GPWA 5KHOC 5KZMB 4GAEA 1BS2A 3PXCX 4PONA 1U8UA 3C43A 3I42A 2RHLA 3B70A 4YYZA 2XQFA 3F49S 4DVJA 1UBKS 2IHTA 3PT5A 1PCXA 3ZU2A 5E9JA 4AZ3A 2PGOA 2ZI3A 4B3DA 4E1AA 4RJLA 2O1SA 3UXHA 2CKDA 3UWSA 5H9WA 1B00A 2XOKA 1K8YB 3VI3B 2QSUA 2JGDB 3F6YA 3JQ9C 4G67A 4PO1A 2VNSA 3Q6MA 5LDGA 3H5IA 4UNRA 1GSAA 3T3EA 3UPUA 3GUVA 2VP5A 1Z5OA 2JI9A 3KV1A 1SQFA 4X1IB 4KGZA 3VSDA 3H04A 2VRCD 5A4IS 3SEZA 1MO3A 3HRIA 5I7EA 3ICQB 2O8CB 1NW3A 4UNNA 5EOVA 2EKBA 1ETUA 3DEKA 2WWIA 1T2CA 1MDFA 1TRKA 1II0A 2DTDA 1NQXA 1Z0ZA 3CR8A 1TA0A 2J31A 3I09A 1KSGA 3WGQA 5KO2A 1R8YA 2J33A 3RABA 4JLPA 1V1MB 5HW0A 5TLSA 5TEVA 2WDZA 1XVAA 5EYPB 3V3KA 1BDHA 1PWXA 5CAEB 3A6DA 4G07A 3DW3X 3HKBB 4CN8A 3WQBA 4PLWA 4CI9A 4CT4B 3CZMA 4CM7A 1XQ6A 1NMYA 3UMYA 3IEPA 1F5SA 2J59A 3Q8XB 1BEEA 2F9LA 2QVGA 2CDCA 4LOJA 1E7MA 2IZ1A 4LMRA 4AYTA 4X91A 3KZOA 5K0SA 1DMSA 4A5SA 1E2JA 4AMVA 2F62A 5DX0A 4I1SA 2WF5A 2ZI6A 4UU7A 3SXPA 1WPRA 3S7TA 4HUQA 1I7DA 1EQAA 5G3ZA 2PKWA 4HZGA 4RA6B 3L9WA 5EESA 2V0GA 1BTOA 3VU3A 3D31A 5CYGA 3BGSA 1W2WB 4EGCB 1UFQA 1I3OA 1OROA 2J6HA 1NZFA 1DAHA 1R9JA 1Z83A 2EARA 3L92A 2VJKA 4FBMA 4LKOA 2H17A 2JDIA 4OKNA 3PQ8A 4XRRA 2GN6A 4DG9A 1S2NA 2OVBA 2ZWIA 3GCDA 3NYRA 4QU5A 3V4SA 4MTCA 5E6UA 3MRTA 3HYRA 1IXRC 2ZXEA 4MVJF 4X8MA 3T3MB 4ZI7B 5KWJA 3J7AC 3VPCA 4UJ3A 2WWGA 3A3PA 4BAUA 4M49A 2GWHA 1E0SA 1N2XA 4OL9A 4OQPA 4YP6A 1BN6A 3F9IA 3OQOA 5KTPA 3ZW9A 1J8FA 4ZGWA 1YS7A 3QMVA 5EXTA 3V80A 4DSAA 1E1KA 4ENVA 2J32A 1THMA 3P19A 3SFTA 4I46A 2ZJ6A 3JQ6A 2RBEA 3EXFA 3JQDA 4QNMA 3CVVA 4NZYA 3UT6A 1XPUA 2VLIA 3FUWA 3EVDA 1ACJA 1Y3AA 5BSKA 4PZLA 3WRXC 3RRFA 1Z06A 3TQQA 5DP1A 2FCAA 2FPKA 2VJMB 2I2AA 3W5DA 4P2BA 1DPGA 1X87A 1VE5A 2FPRA 1NV9A 2NW6A 2Y0EA 3AF2A 5DXFA 9GPBA 4RTKA 3IKTA 4G25A 4H7FA 1QRSA 1QM5A 5CR9A 2C3UA 8GPBA 1J22A 1KY4A 1ZCFA 2AVDA 3KXKA 1S7CA 5EQFA 1PGQA 3WLAA 2CV0A 1XRNA 2OAP1 3B1YA 4CKCA 3BFVA 4RCZA 3IUEA 3EZ9A 3E4DA 3VHRA 2M1XA 3GLGB 3NI2A 3ZG6A 1SVIA 3S2GA 4AO6A 1U98A 5I7AA 5KOIA 3DEFA 3O2JA 1XI2A 3AUFA 4LWOA 2H1HA 3IMGA 1A9XA 2I2FA 1PR9A 2WIAA 2NO7A 1CEEA 4WQMA 1IJKA 2F3UA 3CVYA 1LSOA 1WBDA 2BGTA 4ALNA 3GU3A 4J4HA 4B33A 1DKQA 1Z4OA 3BXGA 2BFDB 1Y6JA 3L79A 2C0PA 3N2KA 3I53A 3PR2B 2IXFA 1U1DA 4BZWA 3PXBA 1RBYA 2P78A 1G8HA 1AQUA 3MQ2A 4UATA 3H3FA 3PFGA 5CIYA 3ZYCA 2GHRA 2KX7A 1QB8A 4BE7B 5B58C 3CF0A 1JVBA 2HRRA 1DWUA 1JHAA 1QMGA 2ADOA 2YUTA 5ALXA 1WA5A 3PENA 5IJWA 3TGLA 4NHEA 1NF9A 2WAAA 3ZK9A 3VOAA 1Y34E 2ZJ7A 4I5IA 2J0QA 3HBLA 5H8WA 1YR8A 4YJ3F 1FZTA 2EDCA 3O9VA 4BRSA 1CKEA 4ZDWA 4KO8A 1HYQA 3B3FA 1WXQA 1VECA 1U2GA 1QG0A 4JH0A 1QE3A 4UBOA 2QRLA 2PX6A 3CNEA 3FNHA 1FTQA 2NUTA 1U6JA 2QTMA 4GR9A 4Q7KA 1Q0TA 1U0JA 3MHPA 5A06A 3VYSB 1X7WA 2EIXA 4UFNA 1NG9A 3ZDDA 4DHWA 1GXSB 4LCBA 1V2HE 3QY9A 1KU6A 2WUVA 4FGUA 2V8OA 1GQSA 1FYXA 4LDNA 3T1QA 5JYEA 2E5FA 2C4VA 2OFWA 5JYBA 3UEOA 5J9FA 5FX2A 4D4MA 2DE0X 4H27A 4NG5A 4XM0A 1IN4A 5I7FA 3K1AB 1DQZA 5M29A 2H5EA 1XXHB 2AYZA 3DP7A 5KQPA 1NV8A 3KR9A 4KAJA 4QQKA 1X8XA 5AW0A 1Q1AA 3M4ZA 5EMHA 3PYLA 2DM6A 1F8YA 3E9MA 3W3AH 4NCAA 2ERYA 3W4IA 1C3OB 3LY8A 5EMJA 3D3EA 5I9SA 2X1HA 1LDMA 1PT9A 3O0DA 2QN8A 1A8QA 4R83A 3IODA 4XJXA 3MSXA 1LUAA 3TGPA 1DDIA 2PPVA 4I1PA 3RNOA 4J76A 1KFCB 3WIOA 1ZMXA 3U31A 1JT9A 2OY0A 3GOQA 2MR6A 4PSUA 4WY5A 3GGOA 5AK4A 4BLUA 4C0JA 3S55A 2WIJA 1C1YA 3E81A 4N12A 2Y1WA 1VLVA 3NT2A 1C0KA 2EX0A 1KZYC 5JOQA 1W93A 3HCFA 1KY2A 3B48A 4GBED 4N0MA 1NWHA 4WEQA 2ONZA 3B1WA 3VZDA 1XWFA 2JFBA 3AVOA 3QZUA 3ZCXA 1XZJA 3HY4A 3H1GA 1MX5A 4IX9A 1Z5VA 4HCJA 3RSCA 1SHKA 4G4SO 3UTCA 1EE2A 1JYFA 2XV1A 3ASZA 1Z25A 3BQMB 5HK9A 3SBOA 4R81A 3RV3A 2EF0A 2FRXA 1JB1A 1W5FA 3AY7A 4ZJZA 1KP9A 1PK9A 2B1GA 3DSRA 5GQSA 2DWCA 2Y92A 1KDZA 4MGZR 4CQLB 5LBIA 4ZYVA 4ZKEA 1RXCA 1SBNE 1NR7A 2OC4A 4WNAB 4XJSA 4C0WA 1G4AE 2VYCA 1E69A 3EQ7A 1AUQA 1MA3A 3AESB 5BYAA 4KPYA 3M4XA 2FUNB 3OZSA 4TVBA 4FX5A 2FMFA 1JTVA 2GTIA 2CMKA 2ODBA 2R7NA 1E6MA 1YS1X 4OXRA 3UJ6A 1XPRA 2QYOA 4OHMA 4CKYA 1Z4LA 5KBYA 4C0LA 2VHVA 5LXTA 3IMKA 2FN8A 4IH1A 2P3SA 1V71A 1XR3A 2ZSBA 3RT9A 3OUZA 1QAOA 4UHCA 4BWFB 5ARCA 3WBJA 5L3ZA 4NYIQ 4TVSA 1H94A 4HP8A 1AKRA 5B58T 5EMKA 4EZBA 2JB9A 4M6WA 4BLRA 2E3JA 4FFSA 4RK1A 1KWGA 1USVA 3LUKA 2EKDA 1U4NA 4LYJA 1FF9A 3OJ0A 3T0IA 1JDZA 3AFGA 3WX0A 4OV6B 1RZUA 1VFPA 2R65A 2VCYA 3BRCA 4FX2A 3EFOA 4QIHA 1CBUA 2M98A 3ZVNA 2NMVA 3EMDA 4EG5A 3MGAA 2A0FA 3K2IA 1F8UA 3CRRA 3LW8A 1FUYB 2I6UA 2W11A 3TTSA 3Q8WA 3QX3A 5ITZA 3TPCA 1G6OA 3AWIA 3QKRB 2IHBA 1RCTE 3UHAA 2R7MA 5JTTA 2OXTA 4OQEA 1PF7E 2HLDA 4P86A 3ZVKA 2P65A 2MYUA 4NU5A 1AHNA 1W5SA 2R44A 3CZ4A 1AURA 2TMGA 3HFRA 4ZHQF 1P0CA 1W35A 4COKA 1I6KA 2I3GA 1WUYA 3JQFC 4AZSA 2GCNA 1W85B 4FTWA 1XRMA 4QC2A 1ZI8A 1KEZA 3C6QA 3KKQA 5E4YA 5EP4A 3GBPA 3WP1B 4GL4A 4X3CA 1CDZA 5CW1A 1P3DA 1DEXA 4ZAYA 1AGRA 2FJPA 4URFA 3V2UA 1HDOA 4UREA 3V7WA 4IR7A 2NUAB 4Q7QA 3ZC3A 4I66A 4PHCA 3HBAA 1O58A 5KJ6A 4ZYUA 4DIFA 1NUSA 2OK8A 4AP5A 3KBBA 3TTUA 4LMPA 1LRLA 2EDAA 4H60A 2Y1XA 3D8BA 4GICA 4IQ8A 1PWEA 2YV5A 3OLQA 3NB0A 2OHIA 3VHLB 2VZ9A 1GITA 3D4IA 5LLSA 4ZIRB 4Y2TA 1O0CA 1E1RA 4JUBA 2H31A 2NYAA 4QJIA 1M34B 2QSYA 3O4GA 2ZYWX 4LSGA 4PG5A 2A67A 5DLQC 2WG2A 4ETNA 4MQMA 3RYIB 5C3UA 3ZKWB 5JQGB 3KWMA 4LE0A 2EL7A 1Y3DE 4HDKA 2DT5A 4F6RB 1H3NA 1QV6A 1GSOA 4TMYA 5MGNA 3AR7A 2Q5LA 3SXUB 1I7SB 4RZUA 4DMCA 2JVJA 3U4CA 2JLUA 2WZQA 2W2LA 1JH8A 2CVPA 3QPDA 2R84A 1OYVA 3TVTA 4CQNA 1R4AA 3QTBA 1QGZA 2WSLA 1VG1A 1PQ4A 4JL8A 5B36A 1H5UA 4HJRA 2VJDA 3E9QA 3TXYA 4NI5A 2O4CA 2CXRA 1RYFA 1P5FA 2J3LA 1UMDA 2X77A 3B1JA 1VGQA 4HLUA 3BGOS 4P8RA 2GRJA 3O38A 5AKJA 4ZVNA 1KO7A 3QXJA 1EP9A 4DLUA 3KAPA 5A1TA 1CERA 1TVCA 4DYDA 4EUNA 4DREA 1KQOA 1XAIA 1L7EA 2IYOA 3D2LA 4GX5A 3Q0EA 4Q7LA 4RIHA 5IVIA 2Z1MA 4HYYA 1NF2A 2NUPA 1V5IA 3CRNA 4LVOA 4MINA 4D3DA 4OHXA 4HDSB 4ZMRA 5KTSA 3DCJA 2RHJA 3PD7A 4GOXA 4KX5A 2B8NA 2DPMA 3ZQ4A 3CU5A 4NLLA 4Y6SA 5TGZA 4Z4GA 2PX0A 1XTKA 2R6ZA 1BD4A 3TJZA 1TYAE 5TVGA 5F3RA 3BH6A 3HBJA 4OSEA 3WV4A 1HRDA 4EJSA 4D9FA 3OT5A 3DXYA 3RS5A 4CLDA 1Z08A 1B2LA 1LS6A 2QTCA 1ZO8A 3A9VA 3JZFA 4FKMA 4FZRA 4GGMX 1JDBB 5KTTA 3AF6A 1FNCA 1RZRA 1UBNA 1PZEA 2J6BA 3H42B 4U7TB 4UE3S 2ZFUA 5DISB 2P9YA 1NT2A 5KNCD 4AJKA 1I3CA 1F4PA 2JGMA 3KKKA 2C2WA 1SBIA 3L01A 3W5IA 3AY6A 4TMWA 1SIOA 3NTRA 3H2ZA 4M37A 1C9JA 1EE9A 2B25A 2XZDA 2YDXA 3KL2A 3L4EA 3B78A 3H5OA 1G6Q1 3TPZA 2HCTA 3YASA 1L8QA 1P7PA 4BZZA 2HJHA 2W5UA 2ZLBA 3DBLB 4M99A 4M3NA 1H1LB 3SD7A 2ZDHA 2BL4A 4DR5B 4X8OA 1ZNXA 2PUDA 2RGBA 3HV2A 5F1PA 3H1TA 2HBYA 1WMBA 5T64A 3QPVA 3FDJA 3PDCA 1HZJA 3HJTA 3BVPA 3NJ4A 1DEOA 1UZMA 4ARZB 1IONA 1SXPA 1E9EA 2X7HA 4HEA1 2IU4A 2ZS9A 1NNLA 1GYRA 3RW9A 1N5JA 3IP6A 1VE7A 3T9FA 5B4VA 3D8RA 3IR7A 3BWVA 1MF7A 2C54A 1L3IA 1OLOA 4G8JA 2OPHA 5IJ0B 4QVIA 1KJYA 1V26A 1VPDA 1X8LA 1S1CA 1IZ9A 2ACWA 2NO4A 2LE0A 3K92A 5F23A 3P2JA 5T6MA 1GKUB 2DBZA 1D5WA 4BNIA 3GFBA 1EI9A 1NA5A 2GZRA 3K30A 1KPHA 5EUCA 1ZDMA 1MEOA 4MPTA 5KNBH 2H85A 1R6DA 3NQ41 4S24A 4TXNA 5T57A 4RSGA 3JU3A 5DBEX 3FOFC 3OKCA 4LF4B 1TUIA 3MILA 3MCWA 4MQ4A 4WOCA 3AV3A 1RM5A 3USES 3B53X 2H4XA 3PWTA 4EYSA 3ER8A 1ZKMA 1SHUX 5AVWA 1A0OA 3HXQA 3QU4A 4PC7A 3T9CA 4FNOA 1E9VA 1FYEA 1X7ZB 3LLVA 5I4IA 5IJ9B 4GR5A 4PNZA 4ENPA 4PBTA 1IVYA 1FB5A 2Q5HA 4W5WA 3WNCA 2DZDA 1PT7A 4UHFA 2CVZA 4LRQA 3OD1A 5CTAA 3DMRA 4U7WA 4BP3A 1IZYA 1KH1A 1WTCA 1IHYA 4IIJF 4B9AA 1DKNA 2PR7A 3FD8A 3I1YA 3WBFA 1MNQA 4P58A 3OJOA 1L7MA 3COSA 1JFLA 3N7UA 4CM8B 4B3HA 3U4QA 3PVSA 2HW8A 2BSAA 1EWYA 3NOOA 1J56A 2SBTA 3GEEA 3IEKA 2R7LA 4PQFA 1XC7A 3UT0A 3OTHA 4C7XA 1PZNA 3RROA 3ZE7A 1DWQA 1ODKA 3T1TA 1MO2A 4NBTA 4UUPA 4WEOA 3Q0IA 1DPFA 3OLWA 4FGSA 4DRZA 4JROA 4RK0A 2C58A 1CR0A 2GM9A 3DDOA 2W98A 1LPBB 3QMWA 4MYRA 1EAMA 3U4HA 3AL2A 4MK4A 3TOSA 2WWYA 2V4ZA 2KE5A 1LFAA 3MJCA 3RU3A 3M6FA 3PK0A 2AWNA 4ARCA 4CF4A 3GDHA 4Y18A 1NLFA 4B6SA 1SCKA 1T2DA 1AY0A 4XFJA 1FUKA 3T5MA 1OI2A 3NNDA 4I7EA 4JBWA 4RKQA 4BPBA 1PEYA 4NDNE 4LV5B 1PEDA 2Q4DA 2QD3A 1JEYB 3HMQA 2X42A 3LQ1A 4ZQGA 3QV2A 3RU9A 2I99A 7ABPA 1D4AA 3HLKA 3DHVA 3HYCA 3K7EA 5BN4B 3DAGA 1UMBB 3VKWA 1ZH4A 2JKYA 1ZM4A 1T1EA 1U0GA 2N1MA 3O8QA 1JKJB 5CA1B 3UMVA 2VF4X 2OVFA 4ALIA 1RLUA 2UKDA 2OHXA 2O8CA 5IKXA 4NFSA 4GR4A 1UJNA 4X54A 1BROA 1KFJB 4B6FA 3BWEA 4G37A 2H4ZA 2Z0MA 1GPAA 1IBCA 4ENWA 3GNQA 5K3FB 4AD8A 5KVCA 2FWRA 2Z08A 2AQKA 3W3AA 3SYMA 9ATCA 5A5GA 1CLUA 1ZIXA 3BAZA 3FSJX 1HE2A 3BQ9A 2OCXA 4EG8A 3SBDA 3K70C 5T7BA 3HKBA 1G3UA 1I14A 3RANA 1KSHA 4BV8A 2ERCA 1E1QA 3HA7A 1CUUA 3MEQA 2C96A 1GPUA 4DPKA 4WNIA 4DIDA 4W9MC 1T9BA 1ZVMA 2IYSA 4PLZA 1YJBA 4NEQA 5CNIA 3W34A 2JGAA 2FFJA 1JZTA 1R74A 4GRIA 1I6LA 4WN9B 4WZBE 3WK4A 1H1DA 5FTKA 3ZDFA 4ZZ1A 1CRQA 4I4CA 4CHGA 1P5RA 4YRZA 1I1NA 2C2XA 1H8ED 2ZVPX 1AKNA 4B79A 3G9TA 4KR0A 1PT5A 5LQKA 4QE3A 4LRSB 5D1NA 3NLLA 3P45A 5LZ9A 3L6EA 4JI2B 4BXOA 5K4AA 2Q1TA 3HBFA 2G40A 1YRHA 1FFEA 2VDRB 4Q9AA 2IHJA 3BXEA 4S1OA 3UY4A 1CUGA 5KWVA 3DZJA 3L7AA 3SI7A 4DY6A 1K75A 4EARA 1W4AA 1A9OA 2FDCA 2HREA 4RE5A 2BBWA 4ZAVA 3VR1A 1FA9A 2CJWA 3WWDA 2Q1XA 2VPWA 3LHSA 2B9EA 3O3NB 3S4YA 3I6MA 3GDGA 4DS3A 4F4CA 4DRXA 4J0GA 4EAQA 4U6SA 3I0NA 1TZBA 3GVCA 4X92A 1L3CA 1KH2A 1ST2A 4PE5B 3DDUA 3L7OA 3D43A 3TLGB 5B6IA 5JH7A 1S2OA 3RVOA 3NIGB 3R0IA 3X1WA 5B4UA 1GQYA 3F73A 2LR0A 2QOEA 1JIQA 3K2BA 3K2EA 3NAGA 1PT6A 2I34A 1QANA 2VJMA 2WMOB 3W8FA 2KSQA 3UUFA 1SWWA 2QRKA 2ORYA 1G8JA 3AGPA 3LF1A 3GVHA 2CZGA 1QRRA 1GTMA 2X0JA 5TJ9A 4JZYA 3ZDXB 3WLTA 5A4DA 1KZ1A 2BHLA 1EHCA 1PZMA 2GBFA 3MWLA 4JCOA 1MB9A 2PMEA 1HE5A 2YFKA 1I9CA 1NYTA 2X0FA 1G2PA 4D57A 3GLFE 1INLA 3UH0A 2A9FA 1G0OA 2XCLA 1QIMA 4PWZA 4KK4A 5CLHA 1X19A 4LQ4A 1ZK1A 1D07A 4NATA 4PZAA 3RIGA 5JJCA 2HRZA 2R00A 3ADDA 1M7GA 4BTLA 3R9XA 5F1YA 3ZJTA 2HWWA 4BFXA 4BV2A 1KI4A 4B47A 5KHLB 2EATA 2F1KA 3BHJA 5FTMA 4EPTA 3EPPA 3KPWA 4DLAA 2VDVE 4BU1A 1RXSA 2ZT7A 5HZKA 2INGX 5CM9C 3H0CA 4AF8A 3QYJA 3DOUA 4PRYA 3KE8A 2IU0A 4EPRA 2WQ7A 2WJPA 2ZSIA 3BCRA 1JA1A 1RAIA 2MSCB 4WCDA 3WSVA 3OQ1A 4AYWA 3NX4A 2YRWA 4TWBA 1ZMTA 4O2BF 2P4EA 1KZGB 1ISHA 2ANCA 3MS4A 3L7IA 5DTIA 4Y9TA 2C84A 2XUJA 3CF4A 3MTBA 5KYTA 4NP6A 1G20A 3V4RA 3QVGB 3EHDA 2HBZA 2QN7A 2FEMA 3K6SB 4Y1RA 2CMDA 4A73A 4XYEA 4HAZA 3FBGA 2WEKA 4DR1B 1AGXA 1OAAA 3DZDA 3JQCA 1LKZA 5DCUA 1DT5A 4WBNA 1UC5B 3INTA 4BDTA 1NP3A 5CFRA 2CLHB 5ALHA 1M3SA 5JCOC 3RS2A 1Z2PX 5JSZB 4Z0NA 3PXUA 4HQLA 4RZIA 2QZJA 5EEHA 1ZKDA 4LY6A 4LJ5A 4LYGA 5AVKA 1SRRA 2DUUA 4JI3B 3UAGA 2VYQA 2CUKA 1SXQA 1L4LA 3QEBZ 1RWPA 2EL9A 5JIBA 3G1TA 1FDIA 1WW8A 2HCJB 2FSGA 3OZDA 4H16A 1D2CA 2WPDA 4U00A 121PA 2Q7DA 3GJ8A 4IG4A 1GLVA 3O8NA 3BHIA 5KTOA 4CU2A 1EJ0A 2ZW9A 2B6HA 3EWIA 3NOXA 3P9XA 4LNUB 4XRGA 5AW8A 2VHWA 1U2TA 3GJ3A 5KC8A 2ZBVA 3N86A 1QQ5A 4RSMA 3S40A 4Q4CA 5BW4A 1XXHA 3BEDA 3H11B 5C1BA 3EXEB 5FTLA 3TQRA 1RC8A 3OFJA 4QRHA 1V11A 3ZBPA 3FPGA 2IPXA 3QBVA 4LJLA 2HCFA 1XN4A 4U0KA 3R5TA 1U0TA 4NR0A 4JI5B 3WK6A 4ALKA 3LC2O 5J4VA 3AJAA 2EJTA 5B7NA 3D2CA 1C3OA 1THTA 2YZGA 2G28A 3D6VA 3EEFA 1ZD5A 2VP4A 3IJRA 3N07A 4OQXA 4IHQA 1EMDA 4ZQHA 2XNHA 3WNQA 1VPTA 1HEUA 3MT0A 1WOMA 3N8HA 4TRRA 5U9CA 3FKJA 4JCCA 2ORIA 2QM3A 4HXFB 4YP1A 3UUWA 1I51A 1QFJA 2RI1A 3L82B 2OFXA 1CS4C 4HH0A 3VSCA 4XCVA 3WBKA 3GVXA 2WINI 2XDYA 4TKUA 1KE1A 1QLWA 4AIIA 4HNTA 3HPQA 1E18A 1PZFA 5KVQA 4KTTE 5KC9A 4F2PA 1IAQA 4ZN6A 3DLIA 4GT1A 1PV1A 3LF2A 2W90A 2HA3A 3A31A 4H1VA 4MB0A 1THZA 1NI5A 1P3JA 4Z2YA 4MWBA 1ADBA 4IKOA 3FWZA 3HZOA 2JFYA 5JO9A 1K88A 1B0PA 3FZEA 4Y6PA 5AHKA 1IZ8A 1RCFA 1IXKA 2YV2A 4R16A 5B3KA 5GZ3A 2JW5A 1ZN9A 4YQEA 3F1LA 1ZRSA 1PAUA 4K26A 5E6RB 4MXDA 4NU0A 4O1IA 1CQPA 3CRVA 4UCWA 5EVJA 4P82A 3BIXA 4IDOA 3OBBA 5DNEA 4RLQA 4I55F 1KOFA 4GQIA 1HQKA 2PZMA 4QDOA 1GL6A 5LA6F 1ULBA 3AESA 4J2TA 2BTOA 4NBKA 3UOGA 1HKHA 3DFIA 3O4HA 4WFQA 7MDHA 1YFKA 2GZHA 1C3XA 5AKHA 2PXAA 3KRTA 4ZZ2A 1VHDA 1T3TA 4BO7A 1PZGA 1TZKA 3CZCA 1G6KA 1LJUA 1SPBS 4ERNA 5KUTA 2Q2QA 3L8MA 5CNKA 1PBNA 2CHUA 5H70A 1T1SA 4UHKA 5ECYA 5J2TB 3M8KA 5D2CA 2OV2A 2ZRHA 1HSOA 5EUBA 2HU5A 3GZNA 2JAWA 1A7AA 1GL7A 4I0WB 1M8GA 1AS2A 2WFMA 2YV1A 3I2GA 3DD5A 3OVMA 4WNCA 2C8VA 2IQ5A 5CX1A 4ANFA 1GUFA 2ZUVA 2I71A 4F71A 4G86A 4PTLA 2PD3A 5SY6A 3QEAZ 3DMTA 5LQAA 4A2QA 3RM3A 1IRIA 2YZ2A 3IXMA 4Z99A 3WC4A 5G41A 3PDUA 1ZVJA 4RVSA 5FWYB 5A4MS 5KNBA 4D3YA 5K0JA 1A2KC 3QKRA 4HDQB 1YB7A 5CCXA 2Z5LA 3ZCVA 2ET6A 1XHFA 3ZWXA 1R50A 1VGVA 2J9GA 3DO6A 1AGNA 5AKXA 5F7ZA 2PH5A 4IILA 2BF4A 2V54A 2XVMA 3IAAA 1XRSB 1CRLA 2DFLA 1QH1B 2J3MA 4K9DA 2J6CA 4QPZA 4DLZA 5BNWA 4JP8A 2PMFA 4YJ2A 13PKA 2JKZA 2R6HA 5HKLA 2Q9CA 2A9QA 3FYUB 1TM3E 4N65A 4Q39A 1XTTA 2W6MA 4XX1A 1VKHA 4NMLA 3OQNA 1EQUA 1K92A 4YO8A 5HUHA 3MTQA 3RC2A 1ZJYA 1W34A 4KQCA 1EDZA 4UUMA 3BL5A 4IGKA 3KQMA 4LOIA 4TTAA 3WMXA 5AUQA 1N5IA 2XXJA 3GT3A 4WGGA 5JDIC 1R0BA 5JALA 3KT3A 1G60A 1MB3A 1OOEA 4Q9HA 1X38A 5TXGA 5A62A 1GRCA 2D0IA 3M33A 3JQ8A 4I4LA 1YI0A 1Z26A 2BFAA 1OLUB 3AEZA 5HJEA 2IEYA 2M2IA 1VE3A 2EZ4A 3PQ7A 3OZIA 4R51A 1KQGA 4TLAA 2ZUWA 3C3PA 2LIPA 3UHOA 4BV3A 4NZZA 1XEFA 1AN9A 1H1TA 2WP0A 1W0CA 1OLSA 2WUEA 1TQ4A 1QIIA 1YH3A 4M0DA 2C78A 4WLOA 3EZNA 3QW4B 4V0RA 3NUGA 1TT7A 4N5NA 2TMKA 3QU2A 4DR4B 3B6ZA 3ONDA 1H8HD 4B4KA 1T3GA 3O1HB 4UCQA 5TIIA 5JQGA 3IP8A 4CMJA 1NVAA 3V9AA 4PZ9A 4EMBA 4PAQA 1C9DB 3A6KA 3TOZA 3HI4A 2HADA 2IYFA 2H92A 4BNZA 3LXXA 4IW3B 4YRDA 2Z1NA 2Q41A 3TL6A 1Q50A 2PL3A 3CSSA 1HT1E 5E0KB 3VYTB 1SJ9A 4X6XA 3UMCA 1GPLA 3ZXSA 2AN4A 4EVRA 1Y81A 2G1AA 1ZN2A 4UOQA 2ZUFA 4P5DA 4TWJA 1Z47A 2D1QA 4OBEA 4ON9A 1EZZA 4CNBA 5BWOA 4CFYA 1ZITA 3I9JA 4U2GA 1E2UA 4DEXA 4MR8A 2PZ8A 5AVZA 1ZOIA 2G67A 2BMWA 4QYTA 4WKPA 4BLQA 2WSSA 2Z56A 3OTQA 1BGWA 3DB2A 1FIUA 3NUZA 2G1KA 2HDHA 1YONA 4GEGA 1QHHA 5AJZA 2PS0A 1P4HA 2UUAB 2C4MA 1NY6A 1L1QA 1EK5A 1UAYA 2H1FA 3PX2A 1SK9A 1KNQA 5HHTA 1E7WA 4FFOA 3UPTA 5AUPB 1K06A 1R5JA 2DPYA 2YDYA 5F5XA 4XB1A 1KNXA 1QS0A 2CXOA 1H2WA 3QX9A 2QL6A 4HDSA 8AT1A 1Y8CA 2PA3A 5DPMA 3RE1A 3C0KA 1FJXA 4D92A 3TSOA 3B12A 5LZ5A 2EWWA 5DLEA 3FAKA 3G3EA 1J5EB 2O8EA 3A1SA 1AXGA 1RC0A 1K8ZB 2OD7A 3IBGA 4GYWA 4E11A 4GMGA 2OV3A 4KAFA 1YGYA 4RF4A 1M1YA 2D3TA 4QU8A 1KYWA 4DYVA 2GF9A 2XCOA 2ZDGA 3EVTA 1TKAA 3WXMA 3PQ2A 2B1IA 3ANNA 4BDSA 5CDUA 4E09A 2FMKA 3H4TA 2II6A 4FDUA 1L5KA 3TMKA 1Z2OX 1SZCA 3CN9A 3LW7A 3HA3A 1NN1A 4KAXA 1SAYA 1PFGA 5HRCA 3E3NA 2QI9F 1VPEA 3ROQA 4RTSA 1GPDG 2QE6A 4MP8A 3CZ9A 3E6AA 5FUMA 5D86A 1H1LA 3JYHA 3LRXA 2FF5A 1JQBA 1L5MA 3O3OB 4GMFA 1HX7A 4QQ8A 2B78A 3CNLA 3SZMA 3WL7A 4B4UA 2Y1EA 2ZETA 5KAPA 4WXPA 1UC9A 2HSDA 1ZINA 5TMDA 1YZFA 1MXFA 1ZD3A 3P9PA 3OJLA 4E5KA 3KAQA 3R5JA 1ZRNA 5CB6A 4L0MA 3VR5A 3A10A 2ZCUA 1RKBA 4XM1A 5DM2A 6GPBA 2EBWA 2C07A 3V8BA 4EVQA 2HWUA 2QJTA 1FMFA 1JEJA 3MCZA 2ID9A 3KTDA 1Z7WA 2A3RA 1AXEA 2FPPB 3C7KA 4PZ0A 3ZX4A 1OJLA 1P77A 1C9NA 2BLLA 1A8SA 3H1FA 5K8CA 1W4CA 4MYUA 1U0NA 4TTVA 4BGVA 5HXAA 1JR6A 3HP7A 4EHKA 4KFRA 5T4HA 1WZ2A 5FYQA 4DDHA 1J39A 1N8NA 2XKJE 2ZU0C 2R8OA 3TZQA 1Q3TA 1WS6A 4OVKA 1MNAA 2OYCA 1H6DA 2BEKA 4KXVA 2JA2A 4JQOA 5DCYA 5EXSA 4EB6B 4EX7A 2Y2UA 4RIEA 1P4RA 5LN1A 5BW6B 1W581 3MRXA 2ZWOA 4JOSA 5LL6P 4UMFA 1CUXA 5HMMA 4RF2A 1D0VA 1YD7A 2V65A 2D7DA 2F9FA 3QELA 3PNPA 4B3TB 2ZRGA 2A1UB 4I4NA 1QU3A 1R64A 5FUXA 1N6OA 4UMEA 3UW3A 1O94C 2W2VA 3DTVB 4FFNA 2QLBA 4GMKA 3LP5A 2HCBA 3ZDBA 2QTGA 2HUNA 1K7EB 1KYZA 5ILOA 3JTMA 2EX4A 4C3UA 1VSQA 1ENZA 2CNBA 3WE7A 1OWLA 3NTUA 3OIVA 2NTVA 1KVUA 3EG9B 5BO5A 3GLHB 1V8ZA 5ISMA 1RCUA 3LRPA 1WXEA 1R8SA 3B8EA 2PSFA 4GPTA 3JWJA 2XKBA 2J46A 1JDPA 3ISTA 4B75A 3Q98A 1G2QA 2ZVJA 1IBMB 3VPHA 2XDAA 3BWYA 4X62B 5K8JB 3GDWA 3ZGXA 5K0BA 2AC2A 4PLGA 2P35A 3OT1A 4UHBA 5DWDA 3GJRA 3N76A 4FZVA 3CZPA 3QPAA 2CGEA 4WACA 5G1NA 3TBHA 3W79A 2F3TA 4PYRA 1MJGA 1WDTA 2QMEA 3OX2A 2YWBA 4P22A 1YMQA 2ALJA 5CCBA 4DF3A 1VB3A 1VLQA 5FWAA 5IFLA 3S5JA 1R6XA 4A8HA 4EFKA 4X41A 4XUGB 2XLCA 3AZOA 1QONA 4O4HB 1U11A 4ZAZA 4JVMA 1FP4B 3TI9A 3ONNA 5BUSA 4W5RA 3ZDRA 2GT1A 3KXDA 5G0SA 3L5OA 4TLBA 4LOLA 1IXSB 4EBBA 1C0IA 4R6XA 3WK5A 1UBMS 5FUWA 1X92A 2NV0A 4L16A 5LLDA 3Q7QA 2JZOA 3DKRA 5TEWA 1M74A 1DRWA 3HXPA 3PUIA 4IWXA 4EY3A 1IRXA 3K5PA 1Y3CE 4CODB 2XUDA 1TLLA 3B2EA 1JKJA 2ZRBA 1LSUA 5U4XA 4BCCA 1XD8A 4BBJA 1N33B 1VYTA 3LU1A 1O6CA 1N0IA 3C7CB 3ST7A 5KVSA 1YBVA 2SKDA 5K5EA 1DDOA 1CJBA 1E59A 5DCLA 1WUTA 2FDRA 2R8YA 3GVPA 3O1JC 3QA9A 5JNSA 3C3BA 3QLVC 1VJ0A 3N28A 5CMLA 3AJRA 5EJGA 1S3SA 5K3FA 4HZUB 3PRHA 4ZO8A 2ISCA 2VDWB 2E85A 2P1RA 2O7SA 4FHFA 4E7PA 3R3HA 2D00A 4XPIB 4YCCA 1FBTA 4EI2A 3ORFA 1EX9A 1GTG1 3C6KA 1NX9A 1RKQA 1UZNA 1LS1A 1Y7LA 3M2PA 4RY0A 3O7MA 3R0JA 2EP5A 1KKUA 2I3BA 4ZKDA 1WBJB 1NSYA 3I1JA 4IX1A 4PGFA 3VC3A 2CW5A 1FFYA 3TFQA 5K7SA 4KQKA 3KFLA 1XRPA 3I37X 1UZLA 3C3XA 4GPIB 1Y33E 2ZKIA 2YNMC 2PXHA 5LXTF 3WGGA 4EW6A 1W36C 3WICA 2QN3A 3U1VA 3G89A 4HGZA 1LI4A 5BOSA 3RUHA 4Z4QA 5REQB 3RIHA 3I62A 4GPZA 3KKEA 3ZVRA 3NP7A 1YC5A 4H59A 4IICA 3ZHVA 3QI7A 4N48A 1XRLA 1TM7E 3TOCA 1H4VB 1RYBA 3ABQB 3B2QA 3MAAC 4CNQA 2FMTA 5E4JA 2PIAA 1CXZA 4OHOA 5TQJA 2RGNA 1H4QA 3OAAA 1CNFA 4KNYA 2H1RA 3EVNA 2XMRA 3D5TA 3DF7A 1M54A 3GA7A 4PVDA 5BSHA 5I6DA 2C9DA 4C0XA 2FLKA 1L6IA 2HTFA 2G9ZA 2OBBA 2P9TA 3JVVA 5JVDB 1WHSB 2GPNA 3A4TA 4K46A 2LD4A 2F7SA 4CKWB 1MRSA 4B44A 4A2WA 4CMKA 5ED4A 3CKLA 4NZMA 4ARSA 2AX4A 2EERA 3ROMA 5T8KA 4RSRA 5BNFA 1ISMA 1QP8A 5LB2A 3H0EA 2IGBA 4QTUB 3TLGA 3PNYA 3PQCA 1ECCA 1UBHS 2DF8A 5TQ2B 4ZPJA 1EQ2A 2ISSD 1N9ZA 2AUMA 3L4SO 2CFRA 3LGAA 3NWEA 3OF2A 5ALMA 3UG6A 1DHRA 1WUJS 4F9EA 1SCAA 2C1EA 2IXGA 4M4SA 1MAVA 4BEJA 1OZHA 1D7OA 3EVGA 2Z58A 1OT5A 4O1HA 4OOFA 2OK7A 3PV0A 1SVOA 5DMXA 4ZT4A 3LH5A 1C7IA 1YDWA 2JHPA 3M1IA 3MGGA 4C7OA 1QGDA 1JHDA 2BEUA 1R4ZA 2FN9A 4CG2A 4EABA 1V8OA 4RJIA 2LWIA 2KM1A 3RU2A 2BKAA 3EGXB 1FL9A 3VV3A 4CMIB 3GEDA 3ZWAA 2FR0A 3HC7A 1VYVA 5IKOA 1NW5A 1WDKA 2Q7XA 3GQVA 2DRIA 2PRJA 1VIYA 5IC6A 3GP3A 4L6IA 4E88A 4F21A 1OVGA 2XSZA 5AOAA 4DZRA 5FP0A 1PE0A 3ZLVA 4GM4A 3KJZA 6AT1A 4OA5A 5EJ7A 5E3IA 4XLZA 4RF3A 2EKQA 2BHNA 2EG5A 3L8FA 3LBAA 5LB4A 1W49A 4AY2A 3AVYA 4DNXA 3KZKA 5F3DA 4XGQA 1UDXA 2X5NA 1UMCB 4IIDA 4MPPA 3QVKA 3E4CA 1SQGA 3G1UA 5GZ6A 5BR4A 1DXQA 4M8KA 4E2YA 5C5DA 3NKFA 4UE6A 5IF9A 2H29A 5LVAA 1AKWA 4ESVA 1OH5A 4J43A 2QG4A 5T3YA 2R6AA 1RHKA 3BFPA 2IH2A 4YGXB 1L8LA 1C29B 3JQBC 2MYTA 2PUJA 4LXYA 3WY9A 4PHHA 3WQSB 3CF6R 1PWHA 3DDCA 2JVIA 3DNMA 2AEEA 5DDIP 4A6EA 3U6KA 4AJOA 5JHGB 2O8BA 1VFNA 5IDQA 3JRWA 3KOXA 4KPUB 5AESA 4G97A 1KP2A 1BVRA 1Q2UA 1Q14A 3M4JA 2Q0HA 4MQ6A 2PLWA 3G2MA 4LX0A 4QRDA 5ER6A 3WV5A 5JAZA 2JLVA 5AM5A 2OGWA 4HFJA 5A4AA 4XDHA 3SQMA 3QXCA 5JSZA 4JMLA 3K9NA 3D3KA 1X7XA 1FNMA 2PVSA 3DHNA 3RFXA 9ABPA 3UKJA 5CFQA 5HCIA 4M38A 4MIEA 3NDBB 3PHBE 4UARA 3BD6A 4XWOA 2QSJA 2O5VA 4Y1FA 1N2CE 2ZEJA 5JSKA 3B7PA 5DF1A 6REQB 1RXYA 1Y42X 2HR1A 1L7BA 1WY5A 4JHLA 1P74A 3PFWO 2BHSA 3SJZA 5CH8A 4E5NA 1MV5A 4OMFG 3M9LA 5FOXA 4MROA 3P32A 3D64A 1A4RA 5DEIA 4HSGA 5ALOA 2IIVA 3HCEA 4I3HA 3SKYA 1E8MA 1YK1A 4KHPB 5JZVA 4ECEA 1IBSA 3OM1A 1V1RA 3CNQS 1A2QA 5TQ0B 3PDIB 3X44A 1YE8A 5JAPA 1OWOA 5C1DA 1ND6A 1IC6A 1TECE 2IV3A 3VPGA 2D54A 2BHRA 4JBXA 4Z0HO 5FXMA 2IEBA 2ZIUB 3F0TA 4UVGA 4W6ZA 2ZXUA 4PM4A 3K4HA 4RQAA 4EMUA 3I5UA 1FMTA 3HU2A 3IELA 2Y0BA 1L5GB 2OQVA 3G6WA 3WYEA 1QZZA 2E4UA 2NXWA 4KREA 1AJEA 3LY9A 1Q77A 4WK0B 3D9QX 4ASUD 3BWCA 5AW3A 1EFVA 2VWQA 3O4RA 3TDNA 4LXHA 2HK9A 1CB0A 4R7ZA 4V0LA 1W96A 1LLCA 2BKXA 2QLJA 3D02A 3TSWA 4CQMA 4KR6A 3P97A 2FN4A 3VR3D 5AR1A 4JFAA 3FYTA 3PFBA 5GOTA 4R1OA 3ZIAA 2B0JA 3EMBA 3RFUA 3SZRA 3ZZTA 4C7KA 1F5NA 2H0QA 3IEIA 2XITA 4GE0A 2EHJA 5DYGA 3ANLA 3IUYA 3U4IA 4E08A 2PSJA 3B3GA 4RZXA 1NQ5A 3PJDA 3VQTA 4AXXA 2MMGA 2GN0A 3DE5X 3AU9A 5DRTA 2QUZA 4LYEA 4DAEA 1DAMA 1D5CA 2WJ3A 3WHKA 1X9HA 3EDMA 4YIHA 3D6JA 5JXWA 5IH3A 2GEUA 4MQLA 4BVAA 5HUJA 2QLFA 4N8EA 4J3NA 1SBHA 3RREA 2JJ1A 4HSEA 2VBIA 4I6GA 2XZOA 1XD2A 2MYNA 4C5AA 5IKMA 2FR1A 3LPLA 2HPZA 3SYNA 1T8PA 3OX1A 4URVR 3Q3CA 2VDUE 5A5DA 1F2DA 3GLIA 2YVKA 3DCIA 4UXIA 1SR8A 4I9FA 4RIFA 4PX2A 1SUEA 3K1JA 1J07A 1LNQA 3HEBA 4Q1EA 4V02A 2QORA 3PUJA 4IF4A 5TNXA 4M54A 2CL7X 3K8YA 4MAMA 1XUOA 2PYDA 4YRGA 3MOSA 5JCPA 3HYTA 3EZYA 3HVJA 4C06A 3UF0A 3M5PA 5JYDA 3JAKB 3DZBA 1BH6A 2XUOA 2Z30A 1SU4A 4HDCA 1C7FA 1E7YA 4UPEA 3W06A 3STTA 2GZMA 4H77A 3UMMA 3I5MA 4FEEA 1QUEA 2WD7A 3O8LA 3BGDA 5EMMA 5LQUA 2QRPA 4JDUA 4B3SB 1K5HA 2OPBA 3L6DA 5DXAA 2JEOA 1UM9B 1H85A 2FJUA 3E5NA 3ETHA 1D1TA 3C3KA 3LT4A 1EUDB 2YJZA 3CNBA 3EZ7A 4LDPA 2D59A 4PG6A 4I5GA 2O6LA 1B0AA 1DRVA 1HTTA 1BJKA 2B99A 3QUAA 2BR4A 4FIDA 3IPXA 3Q3VA 4FI3F 4H7PA 4N40A 1N4AA 4ER0A 3H2GA 1NRJB 4Q4AB 4F3NA 1TFUA 4FMCF 1F4LA 2P7IA 2B92A 3WHLA 4OF4A 3DPSA 2HLHA 1CVRA 3OA0A 2ZZMA 1KDPA 2ZS7A 1DAGA 4J0IA 1NN5A 1ONPA 3CE9A 3OEHD 3IUMA 4X5OA 1R0SA 4RXMA 4ZT7A 3E5RA 2W0MA 1LSSA 3FYUA 4G4SP 1PJBA 1YS6A 2CCJA 4NBSA 3TOVA 1NU8A 1U7OA 3CCCA 5KX5A 1EZ1A 4GGOA 1ID8A 1P61B 1EFRD 2ZJFA 1XZKA 5I9MA 3SG0A 3TZCA 4A0HA 2OE2A 4UMVA 4N7BA 5KI6A 5IN4A 4NOMA 1XRQA 3EDCA 4MW0A 1N2OA 3PHLA 1GHTA 4MRMB 4BV9A 3R8FA 2F8SA 3G6KA 4Y2HA 4CG1A 2AQIA 3CZQA 2DWUA 3DKPA 5DGXA 5K8IA 3IA2A 5GINE 2JLYA 2WTMA 1T2VA 3HP1A 1K8XB 4KIWA 5I4CA 1NE7A 1FXUA 1NVGA 3HUUA 4P4NA 1OLUA 4M1SA 3DPIA 2HEIA 2GEJA 3C8MA 4BJ6A 1N0VC 1ZI6A 3H9CA 2CLCX 4MIOA 1HO3A 5AOBA 1IIRA 6YASA 2KPOA 4ARBA 1RXIA 4GOND 1ZC3A 1IMOA 4FN4A 1GZSA 4CM9D 1YTLA 2VA8A 5FHQA 4C08A 4CJXA 1AX9A 5SYAA 1FFGA 3KKPA 4BNTA 3HS3A 2C3OA 3JRNA 3KLMX 1M6VB 1F51E 2QQ5A 4G2NA 5DCWA 3SLRA 4EY8A 5CLJA 3ZE6A 2EIHA 3S2SA 3RUAA 1YL6A 2Z4SA 2ORWA 3COVA 5AD1A 4GSLA 4H7KA 1LPPA 2XYHA 2E89A 1ULUA 1R27A 3A3NA 3VX3A 4YLYA 3JATB 4OHFA 3BJMA 1F3LA 4G4JA 2RGCA 4H17A 2O57A 3UICA 5F21A 5A3VA 5KCZA 1NULA 4EITA 2CHFA 4NNOA 2AI3A 1RW4A 1VMKA 4PZEA 4WX2B 4DZTA 4BLVA 4KKVA 2NVBA 1Z0JA 2OGTA 4OK3A 3ZWMA 4Z7QB 3IOYA 3P2EA 4HQNA 4RHEA 4Y6GB 3N2GA 2VUIB 4S1WA 3C74A 2QS9A 2WB2A 4YQZA 2O59A 4MDHA 1EGMB 1E99A 2C9YA 2HHLA 5K45A 1DXHA 1X70A 2PSHA 1XKXA 2CXQA 2VDNB 4FMBB 4XCQA 3U7EB 3V7YA 3HJFA 2W8ZA 2Z8ZA 1KI6B 2O8VA 4WCFB 1XDBA 3C6XA 4ZI7F 3MBIA 4OQYA 5SY9A 1FQWA 4NFYA 2IV7A 1NQVA 1WV1A 1BOOA 4BO6A 1UPFA 1VL2A 4N54A 2CF6A 5EWJA 3O1LA 3A8TA 1GEGA 3QA3E 4XM2A 5DJ5A 5KB3A 3QKIA 4R05A 1I2CA 4F45A 1BXRA 4OA8A 5I7UA 3RKSA 2XQIA 3AI3A 2G6BA 3IDZA 4N5LA 2CNWA 3FETA 3G0CA 1L7RA 5BQ3A 1A5TA 4CIDA 1MT0A 3GMDA 1ECFA 1COWA 1GUDA 2R2GA 3GA5A 1V8BA 5LR6A 4CKBB 2B7CA 2PZFA 2G77B 5BV2P 2P27A 4JEHA 4PR0A 2B8JA 4CQJA 4MO2A 5PGMA 1ZH8A 3TI7A 1RLTA 3L7YA 1K0FA 4KZPA 1A69A 1XEWX 2PPLA 1FDRA 2Q3HA 4X45A 1ISJA 5I01A 4MS1A 3QY0A 4U2DA 2ES4A 3QPBA 4RQBA 1B73A 1L7AA 3KZVA 4JLNA 5JW6A 1RM4A 4TSFA 4KC0A 4DILA 3S6JA 1Z4PX 3SJCA 1KJ9A 3D1VA 3ZDEA 4S04A 2DP4E 5JRJA 2FAXA 3MGCA 3IXQA 2V58A 3D3QA 1G8MA 1TPYA 1UPUA 3RVDA