2WU1A

Glucosamine-6-phosphate deaminase complexed with the allosteric activator n-acetyl-glucoamine-6-phosphate both in the active and allosteric sites.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glucosamine-6-Phosphate Deaminase Mechanism: The Substrate Piranosic Ring Opening
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords GLUCOSAMINE-6-PHOSPHATE DEAMINASE
total genus 93
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2wu1A00
1FS6A 1HOTA 4M8LA 1FS5A 3ENWA 4OQPA 2GNPA 4L50A 3BXFA 3NZEA 3ENVA 3EFBA 4L51A 4TM7A 1LK5A 3E15A 2WU1A 3UW1A 3KWMA 1LK7A 1DEAA 1CD5A 2F8MA 3NWPA 3IXQA 3BXEA 3L7OA 4L5JA 3E7FA 4R7TA 1VL1A 1UJ4A 2RI0A 4NMLA 4X84A 4R9NA 2J0EA 3ICOA 3LWDA 3CH7A 4L4YA 3KV1A 3LHIA 3HN6A 2O0MA 3EB9A 1XTZA 1O8BA 1Y89A 2R5FA 3BXHA 1FQOA 1LKZA 2BKXA 1UJ6A 3CSSA 3TX2A 1NE7A 4TM8A 4GO1A 1JT9A 4L5IA 3U7JA 4IO1A 2OKGA 2RI1A 1HORA 2W48A 1FSFA 1PBTA 3ENQA 1UJ5A 3OC6A 1FRZA 3HHEA 4GMKA 4L4ZA 2BKVA 3BXGA 1KS2A 4OQQA 1M0SA 5HJ5A
chains in the Genus database with same CATH superfamily
2EJUA 4NZZA 1IXZA 3N6XA 4LXXA 3ABQB 3W9YA 1OFIA 4MKZA 5JV5A 3CO5A 4JLAA 4M6WB 5FIUA 4IRUB 3FWNA 4EA6A 3HDHA 2BM0A 1FRNA 2V6GA 4EY8A 1EVLA 2QUAA 1RRCA 1SZPA 1G7SA 1Z6QA 4XYMA 2B8NA 3U2QA 3VR6D 1FXUA 2XT0A 5B7PA 5A0FA 1KZYC 3SJAA 1SM4A 621PA 3KXIA 4BX3A 3IBCA 1X1RA 1QOZA 2RHWA 3D1JA 2JJQA 4B74A 4XYBA 4BMPB 2IY9A 2PA3A 3G2MA 5A5DA 5IJZA 2VPTA 2FRDA 2XZTA 2QTVB 4OHUA 4UDOA 2J3EA 1DKNA 2G5GX 3P2EA 1I4LD 5D00A 2ZTLA 3GFTA 2V59A 4MV6A 4US0R 2JIBA 4JT8A 4AN0A 4ZAVA 4YMUA 3GPDG 2XXJA 3WLTA 1T5HX 4Q3KA 2Z1DA 3ZWOA 3ZU3A 3ND9A 1S6YA 3P71T 4UU1A 3PGXA 4RK5A 3MHPA 1G2IA 4WI1A 4YYEA 2RGRA 1VFPA 2AFIA 2WK1A 1X42A 2C54A 3V55A 2AMYA 1H9CA 5C3UA 1G0NA 4GI2A 4G67A 1VBMA 1FJ2A 3RUFA 3VO9A 4MYRA 1YVPA 1KVRA 3AHFA 2VI5A 2R11A 3DTVA 3JVUA 2G1PA 1YZTA 3ET4A 1Z0DA 3BHIA 3GQBB 2QRPA 4MVJF 5GONB 3TTUA 4A6PA 4FYWA 4ABTA 4OMCA 2FG6C 5J2TB 1ECLA 3VKGA 3NATA 5IVPA 3CVXA 1KI6B 4X95A 1NDUA 2NSLA 421PA 1HSZA 1KNQA 3F74A 3G0OA 4MW6A 2F17A 3ADCA 4P0QB 3LPCA 1KS2A 5H59A 3UYLA 4EEXA 2H1SA 4RWEA 4UQLA 2HF8A 2ZB4A 1QHYA 1RLOA 1L7RA 4QPJC 3OU7A 1U9ZA 3SCZA 2IX3A 1HX7A 4OYRA 2QZ9A 1LC3A 1VYTA 3ZPXA 3DNFA 4RVSA 2PDAA 5FTMA 4ENUA 5JAHA 4A2QA 5BQFA 3G2OA 1AXGA 3IPAA 3ULKA 4CMBA 4DA8A 1ZK3A 3OQMA 1E1LA 1L8OA 3BE6A 4FDMA 4OHMA 4UNNA 2ID4A 1J2RA 4RHYA 1UODA 3JPYA 2YNMA 3PNBA 5DXAA 1RWPA 4AJIA 3H1TA 1N2CE 1NNLA 1BD4A 3P4YA 5D8DA 3LQ2A 4LVUA 4V0ME 4IIXA 2DQ4A 1LQTA 4BNMA 1CP3A 1U02A 2G0NA 2OZLB 2PD4A 4LKRA 1WXWA 4YRFA 4F1KA 4Q15A 5KSWB 2GHRA 3RT1A 3N3BC 5MDHA 3M2TA 4I4NA 3ZCTA 4WNAA 2WUVA 3LC2O 5K4AA 1T2CA 3WIVA 4ENQA 3OPYB 4O2AA 1C0PA 4QDTA 1Z6TA 3TVTA 3KUKA 1GNLA 1P2DA 4E94A 1CJCA 4R4JA 1RI1A 2VP2A 4C4YA 4DCNA 1VIYA 4L28A 2VK2A 4XB6B 1T2EA 5AWFC 4RTLA 3ZWMA 5CLQA 4H59A 1EM8B 3FNBA 3Q12A 4TTAA 4AO7A 1JSLA 3QOYA 4Z0TA 4JLKA 5CCDA 3UCFA 3UFXA 2AI1A 3QKRA 4RGQA 3M3DA 1VCOA 1C30A 2AK3A 5JZSA 1KKUA 4PLZA 1L9KA 3CF2A 3WMEA 4OHPA 1J2YA 1W1IA 2XW6A 4QQNA 4YP9A 1T8UA 4MKHA 2ASEA 3PCTA 2FOXA 4TKVB 5HIIA 4BKUA 4UU8A 4HN9A 4L5YA 5ALTA 3WGOA 4B47A 3EIFA 7MDHA 3SM3A 4OV6B 1JE1A 3PTLA 2WG1A 4DL9A 2QTNA 3PGKA 1FQJA 3A1UA 3TE6A 4BLQA 1R8JA 1TA9A 1IPFA 1M6VA 1U9IC 3EGEA 5BR4A 2Y6VA 3CS3A 4YCMA 2GEDA 5BN4A 3K1TA 5KYTA 5H9VA 3TIIA 1M8FA 3JWIA 5F98A 1MHPA 2CUTA 1YKFA 1AZSC 4BVAA 4H7EA 1IOZA 5E1OA 3TLBA 4JLPA 3IS3A 2CLSA 3CIFA 4C0QC 4QT4A 4OIMA 1SEPA 3T4PA 3PGMA 3GVIA 2BCJQ 1FTSA 1QK3A 2IEYA 4PO9A 3PD1A 1ZCJA 4XWWA 1XRMA 3DBRA 3AK4A 2VXOA 1IZ0A 5EJFA 2B7CA 2DYKA 4PYNA 4CODB 2LVBA 1PV4A 3OQIA 1OI3A 3K0HA 1TPZA 3Q41A 1JTFA 3W4KA 3TRDA 3ZJTA 3DQZA 4BVJA 2R1VA 1DP4A 3K9BA 4TVKA 4GZ3A 1IM5A 3WKAA 1B8OA 4XJXA 4ALJA 3RC1A 3ZXYA 4ZJUA 4U9HS 4RYLA 3JYPA 4L0QA 1A98A 1I4WA 1ZGHA 2O6LA 2VBGA 3FVWA 3G23A 4WPGA 1OZFA 1AUPA 1M6WA 5L6MB 4LTNA 1HE4A 1NBAA 4L72A 3F4BA 1UQRA 1ZUIA 4IOJA 4R98A 1QYCA 1JYFA 1DZIA 4PAQA 3I2JA 1Z5NA 4BUJA 1ZOPA 3I6YA 3C39A 1VL5A 1R16A 2QGZA 1OREA 2B61A 2IZ1A 4PC7A 1HMPA 3IHTA 2B69A 4WECA 1Q20A 3IRUA 4KW7A 3IIIA 4RJKA 4YJ2B 4Z8XA 1CQIA 3PX3A 4NCJA 3WWDA 3OPNA 2IBTA 2I4NA 5L4SA 1ZN7A 4BMDA 1P9WA 4JXKA 2NO5A 4MQUA 1BDHA 4YJ3F 2G5PA 1RI4A 1VLJA 2JD0A 2R6GA 1THMA 1D4FA 5JJBA 1F5NA 1E1CA 5C4IA 1GNVA 2RHGB 1GR1A 4BVBA 5AKGA 3D4BA 1R4ZA 1F6BA 2W0MA 3A1SA 2VP5A 3B8HA 2R47A 4S1PA 2H4HA 4XR4A 5CTJA 4GR9A 3OPVA 2YOFA 2IYAA 4YROA 1D2RA 3ORRA 4G25A 1REQB 3WJ1A 2Z5VA 4QNNA 2VCHA 3EDQA 3SJ7A 1S3FA 4LXYA 2NO9A 4FDTA 1S96A 4GQAA 4QYIA 2O2SA 2QPLA 2FSVA 2H85A 3HM2A 3RVQA 3TVDA 4PTYA 4EMTA 3RF7A 4JBNA 4PANA 3DBIA 3K1YA 1VGRA 3FUVA 3B6KA 4Q9AA 4N6GA 1CRZA 1NMEA 4FZ3A 3NTUA 3PJEA 1SA0B 3PNLA 4LZZA 1QH9A 4PINA 2R62A 2ZDHA 4DLYA 4MQFA 2TMKA 3BTVA 3VO1A 3MUFA 4IIVA 4QQ8A 4G26A 4QE3A 1PG0A 4HGYA 3F90A 2AS0A 3TIXB 5AI6A 1GA6A 1OPRA 3DLHA 2G1KA 4KR6A 5DULA 3J81k 1ISHA 2YMPA 4ACBA 2CMFA 4GF5A 3FWKA 3WYDA 1GSAA 4ND2A 4FMCB 3WYBA 5CDSA 5EPUA 4ON9A 1Q12A 4QUKA 5KB3A 3PK0A 4MWTA 1PGJA 1GUFA 4ZO9A 5FOWA 2XMCA 3KXKA 1E89A 1RSZA 3CNQS 1XI2A 4RHTA 4OAQA 3F5QA 1P3DA 4S3MA 1GL7A 2FEOA 2AEFA 3L6UA 3GFOA 3LX6A 5DN9A 2PGJA 3TH5A 3PWSA 3U9LA 3FIUA 3T3NA 4CDMA 2W8BA 2OECA 1JW9B 4K3VA 1U2DC 3V4LA 4WY2A 3DV0B 1IWBB 1U8YA 2MMGA 1DCKA 2J5RA 3OO0A 3UW1A 2VNIA 3B9QA 2JDIA 2NT3A 2QI9F 4UBIA 1E4YA 3C43A 1ZH4A 4N7BA 2XEDA 4INPA 2JFHA 2V3VA 3P9NA 3KRTA 4ER6A 2LD4A 2XKKA 2FPIB 4DQKA 4BFYA 1DKUA 1VLVA 4NBTA 2G1AA 4X7RA 4D9FA 2RE8A 2CK3A 1BEUB 1XBTA 1TVKA 3ZEIA 1K27A 1V2HE 1ZDMA 1PJCA 1L5KA 3E3NA 5ADVA 1G64A 3ND5A 2RG7A 1WMFA 4NCAA 1UM8A 1CVIA 2E82A 1EHCA 4HLCA 1UKCA 3SGLA 4B79A 4AKHA 3D4OA 4KQ6A 1U65A 3F7NA 2Y93A 2IUFA 3K7EA 1YS6A 4MO9A 5M7EA 3HCEA 4PCVA 2HA7A 2H1LA 3DFKA 4ZQBA 5KYXB 2CV1A 1EVQA 2XSZA 3E9EA 4HFNA 2AC7A 2H17A 3LX5A 1WDTA 2BC9A 2XCUA 4RHCA 4E4YA 4RMHA 2CFTA 1CY4A 2FQYA 2Y67A 5CU7A 5T67A 3GQBA 4XD7A 2CT8A 5DHAA 5KQLA 2BEUB 4KPGA 1Z16A 2JJ2A 4AS2A 4CF3A 4U39A 3AFGA 5CVCA 3V4RA 3RIYA 3O83A 2IDZA 3RT9A 4RXMA 1PTJA 3F2VA 1JECA 3CBGA 3ZWCA 5DTQA 1BOFA 4C5CA 5DHSA 1OFUA 3Q40A 5F64A 4BNWA 3PX7A 2XMBA 4MW7A 3IT3A 3KOZA 3DZIA 5DJ5A 1G8GA 4BE9A 3TMKA 2WD9A 3ZI4A 3KKEA 1U2PA 1R3UA 4O4HB 4PHHA 4BTVA 3CPEA 4ENSA 2OHOA 5C18A 4OYYA 4I1SA 1S8AA 5EERA 1BXRA 2Q07A 3LQ4A 2WJ6A 3FPLA 4FN4A 3S2IA 3QJYA 3AP1A 1EESA 1M8GA 2QBYA 3G0HA 4WZBA 3EPLA 1GQRA 1TMGE 1L8QA 4CV0A 1B4DA 3HB0A 1H5NA 3CKMA 4IOMA 4W5OA 1KKLA 2ZUEA 3PRHA 2D2VA 1DC7A 1ISRA 1NDQA 4C5AA 2D59A 4IW3B 2AQHA 1M5UA 1V9SA 5DNWA 3LGXA 2OG2A 3ILXA 2BR3A 1K88A 4B32A 1RI2A 4CDNA 3IBTA 4OG2A 4P4SB 1Q7CA 2D3WA 4D9NA 3E05A 5ED0A 4NOJA 3SNKA 4MVJA 5FP0A 1V43A 2ZUCA 3PRYA 4ZTZB 5HOQA 1V5FA 4IIUA 3H5OA 1A76A 1XVAA 4UD6A 1MBZA 3U61B 3FPGA 4U7TB 1OLSB 3PFBA 4XX1A 3F8TA 3VKWA 3C6BA 3B3GA 5HKAA 2HA4A 4OB8A 3QLVA 1DOZA 2IY8A 4L2IB 1RPTA 4B0OA 3DT8A 1I0ZA 1GLNA 3REGA 3DEYX 4FKMA 3IULA 1J22A 2VO1A 3HWRA 4QECA 2XT9A 2PQ2A 4R51A 3I9NA 3O4GA 1LLCA 3NHRA 5LC1A 2IOFK 2XB9A 3E5HA 3W5UA 2P4HX 3ONDA 3ZUPA 4Q1CA 1IHXA 1IVYA 4S1TA 2G9UA 4KQIA 2PO5A 5CIYA 2IC5A 2W2OA 4DJAA 4LQDA 5GTDA 4XCVA 1IDN1 4IR7A 4C7OA 3T1QA 3CR3C 2JCBA 4C07A 4LHWA 3D7KA 2H16A 1KNXA 3DMHA 4O4JA 1W29A 1YS9A 2GPWA 4DQDA 1VI2A 4GKJB 4YJ3B 5A3JA 3HZOA 2CXXA 3BWBA 4IIEA 4B33A 1IOVA 1FP1D 1O54A 2I33A 1OIXA 3BG5A 3AFNA 4BFLA 2M2IA 2PMCA 6CHYA 3Q0IA 1PGNA 3P94A 4N5NA 2MR5A 1E7WA 2JAQA 5I9LA 1U0TA 4J7UA 5JY1A 2E85A 3BSFA 1QFJA 4TLMB 1UP4A 2JFXA 2NO0A 2R2AA 3N7UA 1EDZA 1T0HB 2HMTA 4NEHB 2H1FA 1GTRA 1LF0A 1QTRA 2WAOA 1E2EA 1GR0A 5CNJA 3NT4A 2QRVA 4RAQA 4B34A 4KWTA 5EJMA 2OCXA 3WK9A 2EF1A 4BL5A 1R6DA 4DCTA 1Z6PA 3DFMA 3DV9A 1M3SA 3Q5GA 5C7IO 5LIPA 1N6NA 4NAUA 2PGNA 2QVXX 3AZQA 5I47A 1YI8A 8AT1A 1QV9A 1PU2A 2JH3A 2OCBA 2OHFA 4P84A 4KN5A 2C9YA 4M60A 2P30A 1IXRC 2VT2A 5AI5A 5HJ7A 2PKCA 2QRQA 1NGSA 4MRMB 1JQLB 2E1RA 4GL2A 5C7LO 2OOKA 5DX1A 3A28A 3OQBA 4UUBA 4C6RA 3P9QA 2J9GA 1A5TA 4L9SA 1JG1A 4CV3A 3MT9A 1DB3A 3VZSA 3GC6A 3HVJA 3W9SA 4OUKX 3FTPA 3IPYA 1P2GA 1KO7A 1FVFA 1HI9A 4A6EA 1SULA 3RW9A 4BKOA 2P27A 2LGJA 1IYZA 4BWGA 1CUDA 1EXDA 2WC1A 1NF2A 1GN8A 2O59A 1NN3A 4RPGA 4WT7A 1ZXLA 2BMEA 2RKBA 4RIIA 3ETLA 5L7WA 3BSYA 3QYFA 2OV2A 1IMJA 2PSDA 1VE7A 1YZKA 4XB2A 1XDGA 3LLVA 3R3JA 4YUAA 1HF3A 1Z63A 3MTGA 1WIWA 2X1HA 1X1AA 3VPFA 3Q7TA 4OU5A 4ZU3A 1VC2A 2HA2A 1TM4E 4IL5A 3FBGA 1N2BA 1G41A 3E4DA 3H83A 1MX5A 1VE5A 4RPLA 1OOEA 2JD2A 2A3RA 3SR3A 1BWRA 2QLBA 1ONNA 1KMNA 5KYGA 3RWOA 4CE6A 1RRKA 1D7OA 1PT9A 3W5CA 2PO7A 3CJQA 1CW2B 3NOOA 4JY7A 3I3SR 1E4EB 1QHIA 1GPMA 2PUVA 1H2BA 4NBRA 4WXHA 1ZMRA 1Z88A 2GJKA 5IKOA 4BLUA 4DR1B 1LLQA 1RTKA 4D4MA 1XMVA 3FF1A 3PF9A 3NEPX 4JOCA 3K6RA 2WIKA 4LDNA 4TLLB 4IIBA 1N9ZA 2H51A 2NYUA 4O4IF 1DU4A 4IFEA 4UPVA 5HKKA 5JNVA 1ZJ4A 3NDPA 4ALLA 3U80A 3QVLA 1YZHA 3H8WA 3CEMA 2Q29A 5FYDA 3ONEA 3DVAA 4NP6A 5C9ZA 3ZU6A 2XAAA 1BE1A 1MA0A 3UXHA 1SO8A 5JVDF 2WLSA 1G21A 1ODJA 3TQFA 1OI4A 1SOVA 2CLIB 3GCWA 1JDPA 3O3OB 1LD3A 2UZ3A 2WG2A 1MP0A 3KPUA 2G1UA 4HX9A 3SC3A 3ZGLA 1KSJA 4YN3A 5DWVA 3IMCA 4F4FA 1WEHA 1VHWA 2HI0A 4K9PA 4X24A 2OD7A 1CUVA 2W5UA 4DBZA 2VIIA 5TGTA 2FSSA 5I7WA 3DEKA 2H63A 2ZTUA 3GV0A 3H5TA 1NUPA 4M88A 3NBZC 4C30A 1E5TA 1VBFA 4Y1RB 4ZMBA 3DUFB 2JHAA 1E4OA 1OXKB 2W11A 1F06A 1N78A 3LY7A 4MUIA 2P6RA 1O5IA 2W8BB 3BWCA 4AZ3A 1L4UA 5TC4A 3SG0A 4DMRA 2FZWA 1V8FA 2SKEA 3R6GA 1P4HA 2OO7A 3AFMA 4OK6A 4RTQA 4M1KA 4MWDA 4QHTA 8MHTA 4NS1A 5C81A 4RUKA 2KBFA 3JQCA 3TSAA 3PIDA 1Q0ZA 1GU7A 1GYQA 2CLOB 5JXGA 2ZBUA 1ZCZA 5TPZD 1OX6A 5CW1A 4FTWA 7REQA 4XUGB 1NUQA 1MAWA 4H6XA 2D1TA 3VHLB 1G3IA 1CHNA 3LA8A 3QVUA 2CFSA 2XUFA 1ZNWA 4KXXA 3R7SA 3AJEA 3WLIA 5LWHA 2UUCB 2GEKA 4MW5A 1ZM9A 1I94B 3ACCA 1YA6A 3T7RA 1YKSA 3H42B 3A3NA 3EYAA 5J59A 4UFPA 3K4QA 2H4WA 4HYTA 2PS1A 4RPCA 2IEBA 1OVMA 2OBNA 4BDTA 2CFCA 3NHBA 5GOZA 3VPDA 4E6PA 1PBTA 4KFSA 4AO6A 3FYUC 2BSXA 3KKQA 3EUEA 4TXJA 2VTBB 2OZVA 3OSUA 3GNTA 1FFYA 4PFQA 1U7OA 1VA5A 2BHRA 1LC0A 5A4DA 1ENZA 1GRCA 1KIFA 1LV7A 1DBQA 4XRGA 1LSSA 3PIRA 3FY4A 3L40A 3VU0A 4FLFA 4KQHA 4DA4A 3R4CA 3S2SA 2R8RA 2IP1A 3AESA 4OXIA 2E2WA 2FFAA 2N0SA 4Y2HA 5CXXA 1RHKA 3HU1A 1QQTA 3FPKA 4TYNA 1OSNA 1BDBA 1K5DA 2CC2A 2ZRNA 4I2NA 4AZTA 5IM4A 4GRIA 1FA9A 2OB2A 5HHTA 2P90A 4IFTA 2O4CA 1X74A 3B7WA 1ADBA 4IJUA 3HLTA 1US8B 3MTBA 3EC7A 1R2QA 4AP9A 2FPGA 5CHYA 4J4HA 4D41A 1SC1A 4Y9SA 4RFVA 1XTVA 1XRLA 2D5AA 2J0UA 3E9NA 2EW2A 4KOAA 4PFJA 2C0QA 3ITDA 1IZZA 3RSGA 3OKFA 4DSOA 1JFTA 4XGKA 3GB9A 3WLFA 1XPJA 4TMVA 4Y2SA 2W2PA 1R6BX 1UDBA 1G8FA 2XTNA 1AKTA 3GXOA 3ND6A 5DRTA 4FWTA 2ZIXA 3PXXA 2HPZA 2AYYA 3KS9A 1DQNA 2AW5A 5K03A 1BDJA 3JQGA 4V39A 1JZTA 1P5ZB 4G97A 1OQAA 5C8YF 2P11A 2O2ZA 3KC2A 2OV1A 4G56A 2F48A 1W44A 4JU8A 4KXVA 1BMFD 1M1YB 1Y4DE 3DO6A 3LPDA 4M49A 1G5PA 3TBFA 2MSKA 4DPLA 3JRXA 3W6NA 3MGGA 1P9OA 5JTTA 4DF3A 4XOIA 1ZMTA 4GBED 1QLJA 1XLVA 2QZZA 4IQ4A 4PQGA 4X20A 1IBLB 3UTCA 2ONCA 3LBIA 4ARZB 4RH0A 4W7IA 2E87A 1RXVA 5CH8A 1QO0A 2R48A 1ISSA 1LH0A 3RC9A 1X1SA 3OOWA 1HT3A 4HDNB 2QW1A 3AXSA 3GJ4A 3H1EA 3FI0A 2R8XA 4YK7A 3DDUA 4IJKA 1TLTA 3FNHA 4L5JA 5A6VA 4AG5A 3I6MA 2JC3A 2E4VA 3H0CA 3JQAD 4NZOA 4H3SA 2IQIA 2NUAA 3BRWD 3KQQA 4EY5A 4NHOA 2V6MA 4ZOEA 5H68A 4B80A 3AVUA 1D1SA 2HNKA 2ZUDA 1VPTA 3CZRA 5BORA 1XDSA 1CFJA 2QXYA 2W71A 1QKKA 2XKBA 4LRYA 4LX0A 5F4ZA 4ZGWA 1QZUA 2Q2NA 1AQ6A 1SC9A 5JD5A 3SDSA 1XXHE 3CUEF 4QDJA 3VR1A 1HA3A 5EE9A 3ZHCA 5K99A 4GZ5A 2XI4A 4CM9D 1XZ8A 5CYPA 1FPQA 2BKUA 1AZWA 2X2PA 3P4UA 4HNQA 5TQ0A 1IB6A 1EGHA 1H65A 4KDEA 5H4GA 1RWKA 4TN5A 1BMTA 1HZJA 3OCVA 1JLMA 2AZDA 5FXMA 4XPIB 3JQ8B 4WINA 1NTOA 4LKOA 4C7MA 5CCEA 2HFJA 1DIRA 4FOTA 3C98A 2EFJA 3GYGA 4YLEA 2XECA 3G5MA 1RBMA 3KKLA 4A9AA 2DHRA 2PXAA 4PO1A 3D6AA 4XQ0A 4DJFC 5BURA 5GIOE 3THXB 2AMJA 4G86A 2RHCA 3HJBA 1OY1A 5ALZA 5C1IA 3U26A 1BX1A 1PEKE 1SC6A 2X40A 4BX2A 3EC1A 3HN7A 4BJ6A 2A30A 3OD5A 4BDSA 5CA1F 1PI3A 3W5DA 2UYGA 2HFKA 1EGQA 2Q3JA 1A77A 4EI8A 3KQUA 3BX1A 1YS2X 3RR2A 2UUOA 4UAUA 1JHAA 1R5OA 5BXQC 2VDUE 3K15A 1NBEA 2ZR9A 2VQ3A 2QN2A 4RVHA 3VJLA 2CXRA 1Z0UA 1WDWB 2ZZMA 3RANA 1UF9A 3I8XA 2ORIA 5CT9A 4IQGA 4JJ4A 2J45A 1OILA 4LY6A 5LXTF 2MIIA 2XCSB 4Z8YA 1GGEA 3GOHA 4O4IB 5LA6A 1MJGM 5CM8B 1U1CA 3EXIA 3MTIA 3VH4A 2I5PO 5L6LB 4W5RA 1ZX1A 3AF5A 4XWOA 2WTUA 4FBMA 2RD2A 4DKJA 2LKCA 1ZAKA 2ZIFA 1HDGO 3PWTA 3QWFA 2ZRJA 5IW8A 3S68A 2Z2YA 3MWGA 3QBVA 1NF3A 1QE3A 1T43A 2NNWB 4NEGA 1MXHA 1H0HA 3V7UA 2ON6A 2GM3A 1VJGA 3AI1A 1CQWA 3I1FA 1FMTA 5G2OA 5LBIA 4BO5A 4JDPA 3GLIA 4B44A 2OGWA 2G6BA 3LNCA 4CCYB 5IF3A 1R9JA 5DO9A 1ML3A 3EZLA 3PKJA 4BVKA 1UKAA 2OP1A 2MSNA 1ABFA 1DJQA 1R9GA 1M1NB 1VKOA 2D0DA 2G4CA 4LY9A 4TLEA 2GN8A 4XIIA 1JHVA 2HZ7A 3B6EA 4CM5A 2FHPA 5T8KC 2CF6A 3TTYA 2BMDA 3HCAA 2HK6A 4ADSG 2LWIA 2VXCA 1GT91 4YAEA 4JC8A 5DBHX 4FEAA 5HCNA 3TD2A 1E20A 4Q66C 2VFAA 9ATCA 3BDIA 4HB3A 4JEIA 5J5AA 2JRLA 3EMVA 3EIXA 2RCYA 5I3CA 3V2IA 1JKJA 2JZNA 4JP8A 1KIAA 3OZIA 1PT6A 4NECA 1KC3A 4P34A 8GPBA 5IT0A 3NJ4A 3P96A 4RPHA 2F1OA 2FEXA 2J7PD 2P65A 2ZG6A 3N3AC 3OQPA 3PD7A 4MGYR 3RD5A 1YAHA 1DRVA 2XE6A 4MS1B 5EHNA 2PKRA 3VUFA 2OSVA 4QGSA 1P60A 3EWIA 3RTBA 3HO6A 2EFCB 5TDHA 3KVOA 2C3UA 5F4BA 5AKIA 3H0KA 3BRSA 2WE8A 4RY2A 3S2ZA 5K8VA 5K3FA 5IKEA 4R40A 1FTQA 2DM6A 2YWDA 5HDBB 3W4JA 5LOVA 4L57A 1SQ5A 1X7YB 3A6GA 4B2IA 3GRFA 5DDIP 4XWYA 4ZMSA 3U4MA 4NJMA 4E5KA 3HUFA 3KT8A 4FYXA 1VPVA 2D54A 2PLRA 2D5LA 2OHGA 3AR3A 3AI3A 2ZR7A 3UAXA 4PPFA 3UA4A 2FMFA 3QP9A 3OTGA 2V5UA 4GRDA 2DCUA 3KYDA 4QOHA 4D0SA 3GF4A 3LI2A 1L1QA 1QK4A 1UBRS 1T9GS 1XAIA 2INGX 2P6UA 2X5KO 3GVCA 4FMPA 1NVDA 3OF2A 4Q3CA 1SPBS 5KQMA 3ITNA 4Q7JB 5ALDA 1PJRA 4XGRA 4JJZA 4B9EA 4C3OB 1W36B 2E89A 1PO7A 2R1VB 1ZGBA 4LWPA 2OGTA 3AH8A 1ZGGA 4B17A 2CWWA 3ANXA 3SZRA 5KPJA 2O14A 2ACWA 4IIYA 4DEXA 1ZOIA 1TEZA 3FGNA 5EGSA 2C92A 2J85A 3BHNA 4C7JA 5BVHA 3IUSA 1K9VF 5CFQA 3JARA 5LMNB 4JBWA 3LQKA 2NP7A 2WTXA 5T7BA 3IQHX 3GRYA 3D7LA 1QVWA 1V4NA 2Z8ZA 3DEZA 1YWGO 1JJBA 5DGCA 5A04A 3KZOA 4HS9A 5EVJA 3IUMA 3JVVA 3T61A 4KPEC 2XQKA 3KUCA 2K87A 3PQ7A 3WLOA 4HNVA 5BW4A 2G72A 1LY1A 4I5GA 4N18A 5TS2A 1UR5A 5DBIA 4JMLA 2ILVA 1J4AA 4NYIR 4OQ4A 1CUIA 4QAQA 3OLWA 3RKRA 1A1SA 3I1YA 4QUGA 1IJKA 3H1PA 4HX5A 4XFJA 1PYOA 3LVBA 2Q1TA 3AM4A 1C3XA 2AOTA 1X1EA 1ZMOA 2JGEA 4U7DA 2IXDA 1A1VA 1Q1AA 2A33A 2ZJYA 4KWEA 2NADA 5CK5A 1NXQA 1JTEA 3M1YA 1ZN8A 2YJGA 2CDCA 4QD3A 3PFGA 5D85A 5JAQA 2L0XA 3V1LA 4BO0A 3TXXA 2F8TA 3ED5A 1ZI6A 5MGNA 2PBLA 3D8TA 2UVPB 4IXTA 1P81A 2M6RA 4KH0A 4U8GA 5CNKA 4E1AA 3U56A 3CRW1 4C9BA 2C96A 2B0CA 4IM7A 4J7CA 3IIEA 5H3HA 4DCGA 2VQSA 3EZ2A 1JJFA 4I3GA 3AX6A 4MJXA 4CTOA 3WP1B 1KKMA 5C7OO 1XRRA 1Q7RA 1L6IA 1A9RA 2G5TA 1C7QA 2DKNA 2NU6B 3VOTA 2MSWA 2F3TA 5AVOA 4MKFA 1ZOLA 2ZB3A 1MX3A 3W05A 2GF9A 4LCEA 2H18A 2UU9B 1SUCA 3I23A 2BWJA 3K9HA 4MS3A 4U7GA 2XBMA 4J8PA 1XF1A 2HHCA 2RB5A 2WM8A 1PR3A 3FSJX 2GFIA 4TL9A 4TUYB 1ZD8A 4B6EA 4D4LA 4XVCA 1M1YA 4ENWA 2AE2A 3JQ8A 2HYDA 2EJCA 2J6HA 3OFJA 4HDCA 4UDXX 2DB3A 4WDRA 5EZYA 5CDUA 2ERCA 2ZWIA 3SIWA 1WZIA 3IEVA 3KWJA 3GP5A 1YZLA 4BFZA 5FBQB 1Z35A 5DLPA 3PIIA 1GTG1 5AVWA 3KEOA 3N6RA 2QTTA 4NCIA 3QG5A 3U60B 5FORA 1IZ8A 4V0MA 5JS2A 3B6IA 1J1ZA 5C8XA 3MAAC 3DE6X 3LUFA 3LS2A 5BV8A 4L6IA 4XAQA 2GN4A 1VYUA 4HGOA 1V4BA 2VK1A 3COZA 2E1PA 1Q1EA 4RZUA 4RE5A 3ZK8A 4BFWA 1NW4A 1EJBA 1F8YA 2ZB8A 2VK8A 1LX7A 3G8AA 1XJ5A 3SR4A 3GP8A 4E2WA 3ETEA 4N0EA 5B1EA 5JW6A 1Z5GA 4MMZB 3E84A 1WE2A 2XVAA 5EXTA 3I04M 2XQIA 3NH9A 1UXOA 4MYCA 3VFDA 3P9RA 4EG5A 4BGEA 2W6PA 4ZHQA 4BY9E 1X9GA 1IH8A 1PNVA 3CGWA 2R1UA 1DUSA 1UJNA 3GGGA 2QR2A 5KMGB 2R6HA 5ALNA 1KK2A 4D6XA 6Q21A 1B74A 4OAOA 5AQEA 5ABPA 3TECE 1UPAA 4HEHA 3M89A 4PLYA 5FUXA 2FWRA 1UT6A 5DMHA 4TKMA 4FCTA 3B51X 2ZBQA 1PS8A 2FPOA 2QIOA 3I9KA 4NRDA 2OV4A 4AZWA 5I7SA 3WYGA 4FSXA 2A35A 6REQB 4RK6A 4A7PA 4X45A 1CTQA 5EFZA 3SYTA 1CEQA 5ER6A 2NZ2A 4BYMA 2QDKA 4O4JF 5H80A 1ZMXA 4ENTA 3D3WB 4H2DA 1O94C 2NSDA 3L0SA 1Y82A 3TJMA 1G8MA 4PLFA 1K2WA 5E6SB 1NKTA 5J4HA 4FFRA 1Y3BE 1ADGA 1BHJA 1NATA 1Q2XA 1R0LA 3WBBA 4RGYA 5ETJA 3R09A 2GHTA 4RVCA 3THRA 4JBHA 2SKCA 3ENVA 3ZWPA 1FZTA 1LZKA 4TRMA 1HZZA 1P1JA 5CH5A 3WRXC 3PKIA 1SXJE 5F2NA 2X8JA 1KVSA 4M1YA 4KUHA 1N6LA 4KQJA 4PEVA 3P0FA 3VDRA 2V9PA 3VH3A 2EWVA 3Q8MA 3JD3A 1NC3A 1X1QA 3TW0A 5ILQA 3SYKA 1SXGA 1ULBA 3R3SA 3TRHA 3BL5A 4RHUA 4AT1A 4DJJA 2A3NA 2AIRA 1VE9A 4KVFA 3NHYA 5LB2A 3R0IA 1IHOA 2WFLB 2R7MA 1D2AA 4ZOLA 5F7XA 5ITZB 1V41E 4B5KA 1L5YA 2WVGA 3HRIA 1I7NA 2IU4A 5BSVA 4EKIA 4XVHA 1ABBA 4AQDA 1KSHA 4F85A 3QWIA 4DNXA 5CXUA 1M1XB 4GOMD 5JTUA 2FTKE 4IIJB 3FZYA 4RETA 4Z7NB 4UDYX 1P4RA 2QSJA 1QUFA 3FYHA 3NUGA 3KXLA 2WP0A 2HPHA 3T7CA 4UFNA 1EUDB 3IB6A 4KTVE 3F4KA 5IJ9B 2R25B 3RTDA 1JMKC 2TMGA 1IIRA 2VNAA 5JPCA 3GA0A 4GICA 2Z43A 5K3EA 3T5AA 1GL3A 1ZU5A 1ZY2A 1LSJA 3PLRA 4HDSA 1LNZA 4JEHA 4BRSA 1D03A 3OIUA 3UK7A 5KYUB 4TXHA 1AQYA 3ORFA 5FTWA 2COUA 4PYKA 3ROXA 2Q3EA 1EM8A 5JSKA 1LK0A 2WJZB 4G1CA 1GPH1 2QRUA 3SXJA 1U3CA 1JEDA 3HHEA 3F6BX 3U1TA 3OF3A 2RGYA 3I92A 5BN5A 4L0CA 4WEOA 1KMQA 3PQ5A 2ZVQX 3LWZA 2OKCA 3WHPA 4HNSA 5E7IA 5L3QA 3WL5A 3PHJA 2C3OA 5LDDC 4NZYA 5JZBA 5CCXA 1RXCA 4R6WA 4DR3B 3JVDA 2F90A 1PJ3A 2NUTB 3K8ZA 3IOCA 2Q41A 1TYAE 2CNNA 2ZDQA 1B14A 1TC2A 2V8BA 3H4MA 3JWEA 2GCIA 5J43A 1RZUA 2JJMA 1JAIA 1VB5A 1XXHA 2X5NA 1TL7C 4MI1A 4AMZA 5JS6A 3A11A 5LZ7A 4Q9DA 3SQOA 4EPYA 3WSVA 4HEA6 5LD2B 4CU5A 1FXWF 1AS2A 4D42A 1S2OA 3U7QB 4PGHA 3LBYA 3E1SA 2J9FB 3BAFA 2COKA 3CVJA 2X2OA 4NJMB 2YQ4A 4FIZA 4L76A 5T41A 2O52A 2EZ8A 1Z13A 2R1TA 2QNBA 1PK9A 1S8FA 2M6SA 4JX8A 4DCJA 1QLHA 3OC0A 1TE2A 4KDFA 2BELA 2GKSA 2VYNA 2W0SA 4ZI7A 4ZP1A 5KOYA 1Z6XA 4MYDA 1RQGA 1TJYA 2PYDA 1EDOA 4B71A 2LCIA 1RCUA 3T4XA 2C9BA 3C7KA 1DAKA 1I6KA 1T24A 3EW7A 3PPYA 3RAEC 3K09C 3VNVA 4L4UA 4G1BA 1I30A 2GZMA 2WABA 1CULC 2EGUA 1VDZA 3CZPA 1AX9A 3HCDA 5I7AA 4E2XA 5AQ1A 4R69A 5FWAA 3HYNA 5KTYA 1BQ4A 1XAGA 3SFTA 1XDBA 5FNVF 1V7ZA 3L7MA 4ETIA 5DW3A 4CG0A 2ZFUA 3OLQA 2X3YA 4HXGA 3BCSA 3LXMA 2BEVB 2VRBA 2WPDD 3L5KA 3NV7A 3QVSA 4FJ0A 4OHVA 2XNDD 1JEOA 4YP6A 2CUZA 1ONSA 3NTXA 3B9RA 3SI7A 4HMQA 4NARA 5AK3A 4PQFA 1J9EA 3GBPA 5EP3A 4V0KA 3HABA 3I62A 4RVNA 4BJHB 3B78A 3OCUA 1EWKA 1TO1E 1SBTA 3IQZA 4N12A 3ZE6A 3BJMA 4RA9A 1NDHA 2G0TA 4JJIA 1FBNA 2C7PA 4KWHA 2GEUA 1IN6A 4CMIA 4BB6A 3N8DA 5FJJA 1W46A 1WBDA 4BWFB 1IBKB 1M72A 4XARA 5I9MA 3PDIA 1L5GB 4EPVA 5LKRA 4W5TA 3H4VA 3TQOA 1R50A 3FX2A 1SXJA 2IK8A 1YU9A 1I80A 2QLTA 2Y2VA 4IXNA 5EWMA 3PC6A 3CINA 1QE0A 3REOA 2J9XB 3MBIA 1I8TA 3CLRD 4MPJA 2XZOA 4C4AA 1J0EA 1XQ9A 2GTHA 2AOTB 1E3SA 3KR1A 4NDAA 5CJJA 4ZO7A 4F97A 4YPOA 1N5IA 2GFHA 1E9DA 1Z36A 1ZVQA 4HS4A 1UANA 1UOOA 4ZT3A 3ZY3A 1EK6A 5A3SA 5FAXA 4Z4QA 4GYJA 2C57A 4QATA 5LZ2A 4ZMRA 3LIIA 1JIVA 2JLBA 1C1DB 1G17A 2XB8A 3A04A 2JLSA 2VQFB 5AW2A 1AUOA 2NZYA 5EXSA 4AXBA 2YMLA 2WF6A 1BOOA 5IC6A 5IJ9A 3NUZA 3S28A 1TM5E 3F8WA 1ZSVA 2HBQA 2QLLA 3MERA 4YCDA 4KNWA 3HYLA 1PWZA 4M8KA 1GADO 3D7SA 3AY0A 4ZCQA 2P2GA 3ZNOA 1M0TA 3QG1A 2FEMA 1GGJA 2P9EA 4M36A 3NEAA 1EVEA 1AQLA 2I8LA 4I1OA 4L08A 1EFAA 3Q8WA 2IWRA 1T8PA 1II8A 3ANLA 2QAGA 2Q1SA 5I7RA 1FS5A 2REQA 1C3LA 1JSZA 3D2BA 3KOOA 4LV8B 3DL0A 3DT9A 4GPAA 1QIMA 3E3LA 4CLRB 2HBYA 3NGMA 3R5JA 3WZ2A 2BLNA 3MGBA 1F7UA 4LNUA 1MAHA 5F9MA 3HZZA 4Y0AA 1NUTA 1SOAA 5AI0A 2YJTD 4KIUA 4MWSA 2QZ4A 1KBOA 2PLFA 4BQPA 2I1VB 1V2GA 3ZVLA 4G5QA 1GOTA 4R9UC 1ZD3A 3DXXA 4A0HA 3QUCA 3RFFA 1WR8A 2AEMA 2BI7A 2C2OA 2P2CA 4PX2A 4CLXA 5JO0A 4Q3BA 3R75A 1U7UA 4ZQGA 5KSZA 3VC3A 2D74A 1WOYA 4MWOA 4Q1DA 1DSSG 1SCNE 1WU8A 2H2IA 2HIAA 2PGOA 3ENWA 2QMUA 4YAJA 5HSGA 4ZTBA 3C1UA 3TLAA 3IIKA 4QLBA 4HEQA 4MZDA 1SUSA 1KYYA 3T1YB 5A9SB 3DF7A 4LS3A 1V3TA 3D5QA 4H35A 4OJMX 5EESA 1DC8A 4AJ9A 4ENPA 3FAZA 4ZVOA 5I01A 2Y9MB 5CB6A 2AZMA 1Q19A 3EQ7A 1KY3A 4OLJA 2ZIVB 2D1QA 3NB0A 2KX7A 4C6HA 3L93A 2OZEA 4LJ9A 2GCNA 2GI4A 4IZOA 1XVTA 2XUPA 2ESRA 3DGEC 4DSUA 1GQSA 1EUQA 1NE7A 3CZ5A 1IG0A 4ISCA 4XZ3A 2I3GA 1G4AE 1SCAA 2QRMA 1UBNA 2QWXA 3LZ6A 4LEIA 4PM4A 1GGFA 4QYXA 1Z4IA 2O8FB 1RIIA 1YR7A 3GX1A 3IDZA 3NV9A 1UKEA 1UZNA 1XLTC 2ZAOA 4Q4AB 3X44A 3U5ZB 4KE6A 5ENDA 1DBVO 1G4UR 5G1PA 1ORIA 4BBPA 3IQGX 4JR2A 3KU4A 4B3HA 1YNOA 2P91A 2JGDB 4F8EA 4PZLA 4WLOA 2G08A 3H18A 3WLRA 2D8MA 3B60A 1ZVKA 2A9OA 4X8LA 2O7QA 5BOVA 3ZLTA 2YC4C 4BNGA 4D82A 4EPRA 4YCSA 1CWUA 2DJIA 4H60A 4F04A 4B09A 3C7CB 1OBFO 4DZTA 4WFQA 4GGOA 3IESA 2J8ZA 3EVCA 4UTRA 1Y89A 2XUOA 4HH4A 5JYCA 4MR9B 2COEA 2GTIA 2VZLA 5FULA 3CF4G 5IBPA 1HDYA 3VPAA 2IH4A 3QQ5A 2FK8A 2JS7A 2JZOA 3VYSB 1RVDA 1H1LB 4TWJA 2QXUA 4NE7A 2Q3LA 1Q0SA 1MNQA 2L17A 3MT7A 3QITA 4FGSA 4JOQA 3HVHA 1SXQA 1UMCA 5TV2A 1WSAA 1AV6A 1MPTA 3UGJA 4LECA 4I1PA 1BH6A 1J09A 3NM6B 4FFBA 5TVKA 4BNUA 4JGBA 1N8SA 4NZMA 4X41A 4ERXA 4O2RA 1TVCA 4B73A 2I3DA 4NAHA 2QHXA 3T7IA 3ZWNA 4G0UA 5E7MA 3AERB 3H97A 4FLEA 1J06A 1ZL0A 4FQ5A 4B40A 5BWMA 4DILA 1BXRB 4IXWA 4RD3A 4BQSA 4NE2A 1CNMA 1CUBA 2YCBA 2ZREA 2HSDA 3AB8A 4FD2A 4U7FA 5EE0A 1L7OA 1N5RA 1NLUA 3KR0A 3KLOA 1GZ6A 4S2UA 2P35A 3ZH9B 1R4NA 2FPLA 4I1VA 4OGFA 1KQPA 3N07A 1Y6FA 2QQEA 4URXR 2Q5FA 1PQYA 1JHPA 2J9FA 1OKKA 1RWBA 2IOQA 4ZQEA 2ECQA 3H11A 3NRBA 3LUPA 1C9JA 4QGBA 4B3IA 1LVHA 3ZCXA 2VDNB 3LTEA 3OECA 4M0DA 5J4KA 1J8QA 5FBZA 1KFKB 1RACA 1AK9A 3DKPA 4J16C 4P4SA 3ZKWA 1Q15A 1QX4A 2IUYA 1D0VA 2PZGA 3GT7A 4ZJZA 1YF3A 1IBRA 3LW8A 3UV7A 2ZYVX 5JALA 1AK1A 5KTKA 3LF1A 3ESDA 1TM1E 1QO0D 4BQIA 1TUEA 2O0LA 1M34B 1PW7A 2QMQA 5E2AA 3U7RA 3GLTA 3VYWA 2BD0A 4EYSA 4E2ZA 1JEYA 4KACA 4FONA 5D1HA 5EMKA 1CJTC 5KNDH 2HDHA 4K87A 4LYYA 4Q7EA 5A4KA 3K0AB 3AHJA 4ER7A 4PPYA 1QFMA 3GUYA 5JHGB 1VBNA 2ZZNA 2J07A 3INGA 2HBRA 1NNSA 2HV9A 3Q9UA 2PIDA 5U4QA 4JQOA 1KAGA 2AR0A 2CLHB 4FCCA 4S35A 5EXPA 4BB0A 2CHUA 3A6LA 4M1EA 2RKWA 3L41A 2QT9A 1DWUA 1NHGA 4RKWA 1Y5MA 3H75A 4U2KA 3GLKA 4URFA 4XJVA 2IYZA 4EDFA 4NJEA 3SZMA 2MWMA 2QT0A 3FCOA 1U0LA 2PR7A 4L07A 5H70A 3PFFA 4B4KA 5LL6P 3AVWA 1TUBA 1W6RA 1PR6A 2FPUA 2Q3DA 3OPMA 5IYZF 3S70A 2PUJA 1Z15A 3G7NA 4EM6A 1DVRA 1SVOA 2N47A 3KD3A 3LQQA 2YFHA 3NORA 1DCTA 1UDCA 3RS0A 1ORTA 3OIVA 2JPDA 3JD0A 1H2HA 4CUKA 2PAFA 1UK7A 3MRXA 4GC9A 3W8DA 3OAAA 3WDLA 1OBCA 4TM7A 4EWLA 1KTIA 4XTCS 5BMVA 1WUIS 1GDTA 4E5VA 5ELMA 2Q5OA 2NSYA 4RTJA 4TS1A 4RADA 1Z25A 3NHFA 5DE3A 1PHPA 5TMBA 1T0PA 4GNKA 2B34A 3TNFA 4DFDA 5ALOA 5JPIA 2Q5CA 3ABIA 3BM5A 3U39A 1YR1A 2WKPA 3FHLA 3WRYA 4E09A 1C1DA 2VPYA 2G9RA 2OQVA 4WKPA 4O8CA 4N54A 4MP3A 2Z6VA 3ORHA 4Z99A 3NHZA 2H0AA 3C15C 4JYCA 1AKUA 1JALA 1PJLA 4JP2A 3FPAA 4AO8A 1Z4QA 1U3TA 4TMWA 4UJ3A 4QQFA 3ZWKA 5EPEA 1UC8A 1YDEA 4EG0A 3ZDCA 1MW8X 1VIVA 2APJA 5JXIA 4WLUA 3HYRA 2BFDB 2XADA 4L4RA 4UTOA 1EVIA 2BM9A 1QTIA 5LA6B 3UGQA 3EXIB 5KPDA 3DEJA 1JWLA 2YVKA 1G2OA 2FLWA 2Q6KA 3NP7A 2C82A 4R9NA 4TVBA 1BH2A 4AY5A 3T0IA 1JLRA 2ODPA 1H2FA 4RF3A 4RFSA 3OZUA 4OLFA 2X76A 4IUYA 2QGNA 3JY6A 2Y1LA 3BD9A 3FHJA 5BPHA 3G8CA 4PNZA 2HF2A 3ZI0A 1SQ6A 3DE1X 3W77A 4QTYA 5LR6A 2GJSA 1O96A 3O38A 5D84A 1KDVA 4PN7A 3FYUB 1W35A 2X1MA 1MUUA 2AB0A 1Q1QA 3SLRA 4Q12A 2GERA 2W2MA 2GPBA 4HLQB 4K9LA 3UT5A 1NQXA 1QGAA 1ZXBA 1YCGA 2FN8A 4N01A 3CTPA 2OPBA 1ZEJA 1VL0A 2CEKA 4LY0A 3MA0A 5FA8A 1Q22A 1QHEA 3JZIA 5HBGA 2ZYTX 2FF5A 1PGPA 1UPBA 4Y6PA 1MOZA 4GPZA 3PXEA 4UTNA 1GAQA 5L7TA 1O94A 4OHXA 1H3FA 3JZDA 2PVCA 4D79A 5FPYA 5TE9A 5HRCA 3I73A 3V1KA 1IEWA 4WCFB 4FMDF 2VKQA 3AVPA 3FFTA 4UMFA 3Q7RA 3SK0A 4D99A 1DBRA 3M6MD 2XF8A 3CFYA 3L7BA 4LWQA 4PX5A 2CNOA 4X6UA 3SD7A 3KJFA 3WTCA 1U3UA 4ITRC 2ZANA 4BPBA 3PYMA 3Q3GE 2Q62A 1TA4A 3K0CA 1O6ZA 2I6GA 2GAAA 2GF0A 2OK8A 4GHWA 3ABOB 5WRFA 4EKGA 4NYJQ 2XUKA 3WWZA 3L43A 3EXHA 2KQUA 1KJIA 2QOEA 3UXYA 3IUEA 3PXAA 1NYTA 5FB3A 2EARA 2Z9DA 3EN0A 4P35A 3WYCA 4FSDA 1X94A 4EUFA 3Q6IA 3DS8A 2QK4A 1NC1A 4O6VA 4NABA 4TKLA 3ZXUB 5HFNA 1WXHA 2C5GA 1JJIA 3VZDA 3RQSA 3JAWB 5IZ4A 5K5EA 3LT2A 3R5FA 5JE8A 4HK4A 3T0GA 2ZIWB 4DMGA 1KPHA 1O87A 1EB9A 2QQ0A 1BU8A 4J75A 5GONA 1G1AA 4D3FA 2IYTA 1HC7A 3KYCA 1FVHA 3LVQE 3HN2A 4ZJPA 1HL3A 1KBQA 5CVDA 4OM7A 3OFVA 1XDDA 4GE0A 4P2GA 2DP4E 2VT6A 3N2IA 4LSZA 3QYPA 2AJDA 1T3LA 4RBNA 3R3HA 4GMXA 3K72B 4O4LA 3MELA 5EJAA 3V7FA 1U3GA 5EPOA 3AJAA 1OH6A 1GKYA 3KSAC 4IP0A 1P4JA 1CK4A 1FLAA 2NLOA 1ENPA 2OESA 3I30X 2VHJA 1E61A 1MIOB 1RAEA 1DRUA 2IHZA 4L8LA 5K7SA 2DUJA 2L69A 1V25A 4JNKA 4JC5A 1IAVA 4YRLA 5F7JA 5G40A 3TCXB 5KHLB 2CV2A 1D8AA 4U9UA 4F71A 5JAMA 5M2QA 1QGYA 3DVSX 1MDBA 4ZHQF 2LIVA 2PG3A 2G9ZA 2F1RA 1ARZA 4U02A 3ZHTA 2EG5A 4CLDA 4FDLA 4ID9A 4UVGA 5TJHA 3ETHA 3JR3A 3FSGA 3PDUA 3PNSA 4YBRA 4WX2B 2CFRA 1RXSA 1WUYA 4L3OA 3R74A 1Y48E 3INTA 4EVSA 1D4OA 3L8GA 3IXLA 3TOZA 1VLZA 2ZB2A 3GAFA 2BTQB 1QH8A 2HJVA 4TSRA 1MABB 1DPGA 1H69A 1XTZA 1WUJS 2IEDA 2FN3A 1YQQA 4INOA 3AESB 5EJ8A 2C2BA 1JSXA 3Q10A 3BH7A 4IEFB 4QNMA 3UV6A 2QD4A 2C7GA 3QY9A 1FK8A 3HB5X 2OHJA 3LPLA 4IDPA 4KMRA 1XCLA 1PT8A 1QWSA 1OXVA 3DM9B 4PQRA 1VJ1A 3TW4A 4JP3A 3KEFA 3PYXA 1CZUA 1LWNA 3KQLA 1DDOA 3K0AA 1WQ3A 3T3HA 1HKUA 1R4MA 3LG2A 4COOA 1Z28A 3FNGA 1S8NA 3HKCB 4OFBA 1TT7A 3AU8A 3EFHA 2PT7A 3M1IA 3W5IA 1A69A 2A9JA 1PX0A 1T36A 1L5OA 2X4GA 1WDLA 1H5QA 1Z68A 2Z98A 3IKJA 2CFIA 1SKBA 2A9RA 3OUZA 1RXEA 4B82A 3HUEA 5AVVA 4BJ1A 3EQ6A 3R0ZA 1X3LA 1UM9B 2R6JA 4LMAA 1IQPA 2KHZA 4Y2YA 3WL8A 1TKBA 3GBVA 1HG0A 4UW9A 1EXMA 4CU2A 5LNK6 2O8EB 3V8VA 1Y1TA 2GK6A 4ERNA 1OMOA 1YVRA 3C3XA 2C8KA 3I9V6 4K1XA 1FYFA 2FWNA 2BBWA 1C9DB 4MGZR 5JJLA 3H11B 2UUPA 1C3EA 1CQZA 5DXJA 3OEHA 1OA0A 3VH2A 3ZHQA 2X0EA 2KBEA 4RTOA 3F6EX 4Z7QB 5CK4A 3U09A 1KYIA 4P82A 1OI7A 4QGGA 1QS0B 5BMVB 5JASA 1QVAA 4Y7CA 3Q7IA 4PRLA 3D64A 1BQEA 1J07A 5F3DA 1S5PA 4XIGS 2HQBA 5F33A 3VNAA 4ABYA 5M04A 2W6ZA 4Z6KA 4F12A 1QAMA 3DA8A 4N40A 4G24A 5E4TA 2X19A 2EVWX 3JQ7B 4U2DA 3WWYA 5BUQA 1TIKA 1OXBB 3U4QA 2FMTA 1EWYA 1S02A 3D6JA 4Q7MB 3ZDBA 4ARAA 2NUTA 3PNOA 3BWEA 2W93A 3O91A 3FDXA 3PPWA 1ABEA 4MV5A 3SEZA 5L3SA 5DGHA 3GIWA 4O08A 1W87A 1W85B 3AF0A 1GUZA 4C4ZA 4GBMA 1U3DA 2XHEA 3ZCQA 4G23A 4GG1A 1EAMA 1G5TA 3T35A 4JUIA 2NYVA 3ILYA 3TPZA 3OQ1A 3ODGA 2DHQA 2ZT8A 3H9QA 4MYHA 2NN3C 4ZD6A 3AHCA 3ORSA 3TKAA 2IS4A 1J23A 2Z5FA 2E48A 2G7MC 4C7BA 2AZTA 2ZCJA 3HUUA 1IN4A 3TFQA 2XZDA 3AUKA 3DFUA 3V8QA 3LYAA 3U3JA 2IZOA 2J3MA 3GU3A 2PWZA 2W2LD 5E4FA 3RTGA 2YWRA 1P0QA 3U7JA 1O95A 2OPHA 2PSEA 2IPXA 3N05A 3OHPA 1IATA 2ZBFA 3SLKA 5KKNB 3K5HA 2BH2A 1IL0A 3DDNA 3F5DA 3OZTA 3W6PA 4MROA 1R27A 5E3HA 4CKZA 3UATA 5CLGA 3PPIA 4DLXA 5HQ3A 2DUNA 3S3TA 2DKOA 3W79A 4YP5A 2GESA 2BBTA 3C3EA 2IS1A 1GTL1 3ZVMA 1TQDA 4CQNA 9ABPA 1F2TA 4W1RA 2OCPA 3E53A 4QTUB 4J1NA 3WGVA 1E2KA 1UFQA 4BNIA 4OX9B 2QEQA 4RIFA 3CRMA 4WASA 4AIRA 2BZ0A 1T1SA 3G2QA 1USUA 3MFQA 3QGMA 4KIFA 1YFKA 1L5LA 5EJ7A 3S6JA 1K4KA 1S2MA 4H9GA 4PIVA 3FWZA 1MAAA 4TGLA 4XLTA 3EOBI 4IEIA 4AMBA 1A9YA 1KO5A 2Q6IA 1JFSA 2YWHA 3QVKA 4FYVA 1HO3A 1HLFA 2FWIA 2R96A 2CCGA 2CLFB 2R5NA 4MMYB 1M0SA 5IVHA 1D2MA 1GAJA 4FQ7A 3T5BA 4HNAA 1RWXA 2GZ3A 1PVVA 3H1AA 4KXUA 1I3KA 4AJ1A 2I6TA 3VAAA 2QN1A 4MR7A 2GWRA 4ME6A 4P31A 4CKCB 3V7NA 4K05A 2I8AA 2XQJA 3TZQA 4BBJA 3HBLA 5GMOA 1JR6A 3NRJA 3T3DA 1CJSA 5CFRA 3KKPA 4I4TB 4OXRA 2OGSA 1QC5B 3FOAA 1BDIA 3B1YA 4EYGA 3D8UA 1CPYA 2GRAA 3MTQA 1QB7A 2FVYA 1SU6A 2C4NA 4KE9A 3ZK7A 4BHTA 3M34A 3WQHA 1DWOA 1GKIA 4J0EA 4K9MA 2IL1A 4MYSA 4FNMA 1SKUA 4MVJI 2QTCA 4R1LA 4CRWB 3TX2A 1TTTA 1NBME 3NOXA 4QTZA 3GT3A 3AKDA 3KX2A 3U7HB 1IU9A 4A36A 4R31A 3IEIA 1CCWA 3EZ6A 1AKQA 3REQB 5K4GA 2YMMA 4YFYA 4ZAZA 3VPBA 4B6QA 2ZYUX 1NQWA 1VIDA 3DFZA 1R15A 2HOQA 4K86A 5F78A 1PR0A 4H6VA 5FPQA 3TE7A 1PRYA 4UM8B 4Y9DA 5AOBA 2Z9CA 5DLEA 2WG0A 4G4GA 2EGHA 2WWHA 5CNIA 5C53B 4KIGA 2EDAA 4L27A 5AXDA 3AV3A 3VTZA 3CCFA 4A6XA 1JNYA 2C83A 2MMCA 4IHJF 1K98A 2ATXA 1OT5A 3N8GA 3AETA 1ZH6A 5LBUA 3LBFA 2C98A 4OMFG 2QAGB 1CEXA 1QYRA 4V1CB 1T9DA 2DSNA 4RQAA 1F0KA 1Z7YA 5HTOA 1KDOA 3BF7A 5LP6B 3MRVA 1E9FA 3GHYA 1TXGA 1PS9A 1FDRA 3OE1A 2JFPA 4XLZA 1ODLA 4FWIB 2JFBA 4JI1B 3DZHA 4ZAYA 1K68A 1QX3A 4YBZA 2EZTA 3AHDA 2MSCB 1XYGA 4FT4A 3LUHA 1AO3A 2R6FA 1G20B 1R6TA 2CXPA 4LSWA 4YPVA 1N8KA 5AHXA 5KYXA 1C3JA 3TK1A 3GLIE 3OIGA 3QLTA 3MLBA 1D2GA 1YA4A 2PGIA 3HH8A 1V71A 4WK4B 5FLKA 2IRWA 4B6FA 4CDGA 1NXTA 3R5KA 1K0UA 1WW3A 3C4VA 3KG2A 1LRJA 4RMJA 1U0OC 1SC4A 1YQXA 3O93A 2HPAA 1NAIA 1Q57A 3OC6A 1VCHA 4N9QA 5JBIA 5JYDA 4KR7A 1KI6A 1DKQA 2Z4SA 4RCZA 2AFHA 4CIVA 5DI3A 1NFFA 3EMKA 1K89A 4KN8A 3ZEAA 5BSWA 2NV0A 2XF2A 2VYFA 1K3FA 5K3BA 3N7AA 3NTVA 1T9ZA 4PC2A 1F7VA 4IY1A 1NSFA 1CJBA 1DV2A 3S2FA 3KLMX 2YASA 5DT2A 1YQUA 4ZANA 4DHEA 1LPMA 4GX0A 1YQWA 4YUVA 3NAZA 2QVYX 1NY5A 1XD2A 3B5EA 3BQ9A 3DOHA 1WP9A 4V0QA 1RT9A 2G7ZA 4PSDA 3ZVRA 1F4LA 5U1PA 2HGSA 2I6UA 1E9RA 4OFZA 1GAWA 2H2WA 4B3GA 3AF6A 5JC8A 2YKGA 2WIAA 3DWIA 2PXXA 1CC1S 1PDWA 1NPTO 2W6CX 5LUBA 3JALB 4QDUA 4UNIA 3GCDA 3NIFB 3D8RA 4IS2A 4NFLA 5LMZA 5IUJC 2O8VA 3L6RA 4TL8A 5C3MA 1N7GA 4H1VA 4ZICA 3MCAA 4K2HA 1HDEA 2FUG1 3V4PB 4ZGGA 1FDTA 6NULA 1DLJA 3IMFA 3RVMA 5CB0A 3HGQA 4TKUB 4QJ4A 3UBMA 1QFZA 1TEHA 2QMEA 3VJMA 3VR6H 5DBFA 3AFIA 3ZTYA 3VVCA 4MEJA 4U9IS 2ZS8A 3K70B 4X1OA 2JGLA 3LL7A 3ORQA 1QH1B 2AVDA 1ZUWA 3MJEA 2DR3A 4DLBA 1RAHA 2HH9A 2J31A 2XV1A 4WLFA 3T3IA 5KYYB 5K09A 2C7RA 3B7PA 4MRVA 1KRXA 2XVXA 1LSOA 3RVPA 1O57A 2HK7A 1K66A 2PRIA 2WE7A 3U0BA 2BF4A 5AI4A 3L8FA 3L1HA 4L8VA 4WKCA 3LY8A 4L2IA 5FV7A 5C31A 1VP9A 4ZAXA 3SZGA 1W36D 3LRTA 1Z2CA 4EQ6B 1WB9A 5EJ5A 3KJGA 3O3CA 2FZVA 2H08A 2ZIAA 3PWKA 4MW1A 2FDXA 4U6SA 2WUFA 3M6VA 4QDOA 1BJKA 1RW4A 1VRVA 4LCJA 2XA9A 4QO8A 3RJ9A 5HYVA 1SUBA 3W90A 1G6KA 4PRZA 2CJFA 4BLOA 4PZ0A 4C4XA 5KQPA 1JQAA 4IBOA 1JYEA 2QQFA 3H5RA 2DWOA 2CHGA 2PPLA 4OMDA 3H9JA 1CS0A 2PSJA 3UJBA 3OTHA 5KTTA 4W8HA 1YMUA 3AY6A 1KY2A 1QYVA 3ESBA 4TRJA 1JB1A 3MD9A 5CDFA 3TXYA 2N1MA 4B4OA 3CKKA 3E9QA 3R6LA 1MQSA 1PUJA 2IYFA 3I37X 4KFUA 5FX2A 5JFTA 3AEZA 1GLVA 1DX6A 1V16B 3MTDA 1JH8A 5JAUA 2OHXA 2CYAA 3C6MA 5TMDA 4XW2A 4XTRA 1CIVA 4LPKA 3SHWA 3ZBPA 4D3ZA 5JH7A 1TVMA 3WNQA 1RLJA 3IUQA 1TCAA 5JJ5A 7MHTA 4EECA 1M2KA 4DNFA 3EXG2 1G8JA 1U8CB 2QRVB 3DCIA 5GV8A 3RSOA 1ZSNA 2BGMA 4GOJA 5CM9C 1UC9A 4N8SA 4INZA 2AR7A 4NBWA 4OD0A 2AN3A 5DTEA 1PEAA 3ANTA 5JVDB 2H92A 2HXYA 4Z0NA 3AR9A 4B7XA 1AQIA 1EK0A 2ORWA 2XQGA 1T1GA 5E0OA 4BU1A 4BUCA 3KSZO 4B7AA 4D9EA 1Z5UA 2VOEA 4WBNA 1D4AA 4AJLA 4LDJA 3N76A 3QVMA 5KNBA 3VDMA 4EG1A 3OE4A 4F3KA 3BUSA 3UOAB 1ISGA 4Y2GA 3EGXB 5AKJA 4AXXA 4JHXA 4B1FA 1GPWB 4G5FA 3EGDA 4EUKA 2Q6TA 3HB1A 3DYVA 3HRKA 3HP7A 3PUKA 2XCTB 3GEBA 3IE2A 3QE4A 1Y1LA 1UXGA 3I5AA 2VVTA 2JVKA 4V0LA 2A94A 1WB5A 1E6UA 1P1KA 1KVTA 2CXHA 1G3QA 2XYPA 3RK0A 3SXPA 2DTDA 3ZWXA 4JL6A 3BXOA 1USKA 4X5OA 1KI3A 2A78A 2QT1A 3N58A 3ENNA 3DLAA 3DD1A 3HBAA 3KVVA 5DHTA 4PSUA 7GPBA 1RWOA 1EFKA 2HL6A 3GGOA 3KKZA 4PVCA 3QLUC 4FLMA 1ZA2A 3OQNA 1FEZA 1LCIA 3EASA 2KB0A 3TL6A 5CIQA 2X42A 4OQDA 3HDQA 2VAMA 4Y8VA 3TNYA 1BHO1 3SZUA 3OZRA 1NVKA 3E7DA 5AW7A 2BRUC 1Y0BA 3IT0A 5AKYA 4XIFA 4P8RA 4P53A 3DZDA 2E5WA 3DR5A 3I28A 4MV0A 3SS9X 4C4PA 5JBQA 2HD4A 5J2TA 3BERA 2H4JA 3KQMA 5KVAA 3CUSA 4B3MB 1N33B 5FA5A 3DMFA 1UEIA 1VPLA 3AZOA 3EBPA 4K6GA 5LJIA 4A82A 1KEUA 3DDOA 1EEXB 4AX8A 4MA4A 3SFVA 3U3DA 1KH3A 1OLXB 1JIJA 4NY1A 1FYDA 1OXSC 2BFOA 2B8EA 2DPXA 2IXFA 5D3QA 3CLTD 4RO0A 2EIXA 1SGWA 4XM1A 4BLSA 3CPSA 4NPHA 4DNQA 3A37A 3WB2A 1FFHA 4ZVPA 3IVXA 4J2OA 1GV1A 5EIAA 4YRZA 2ZRDA 4IH4A 4YHHB 1GZDA 3M6WA 4ZJYA 1G5QA 1SOWA 3KB1A 3IALA 3N0RA 4LDRA 3C87A 5I8PA 1U7ZA 4ZKDA 1TMOA 2NTVA 3SPXA 1BVYF 2O1SA 1YR8A 1M6NA 3K0FA 3RQIA 2FCAA 5F23A 5KTMA 5C0OE 2YW9A 1J25A 3BWVA 4X1YA 1DAPA 4HVCA 2NZXA 2HLPA 3QMWA 4CR8A 5JYEA 4AG6A 2Y4NA 1YQEA 1MORA 1NURA 4RABA 1SXPA 3IP9A 4DIOA 5D3KA 3ELWA 2Y77A 4HCJA 1KQNA 4RENA 5CIWA 3ET5A 1GNTA 4RS4A 3SFZA 3CX3A 3WRVA 3K70C 5CG1A 1QYWA 3WYAA 3PUWA 2PPVA 1E96A 5G02A 2Q7XA 2C4VA 2FP4A 3T7EA 1EFTA 5DXFA 5FCDA 3RTEA 1M34A 4F60A 3R9IA 1MRNA 2G0AA 1SK9A 3GP3A 4WDQA 1IEVA 3W78A 2QPAA 4PAGA 1KYZA 3EF0A 4I50A 4YFVA 3N2KB 4NZ9A 3BGSA 4PW0A 4MJ3A 2D5BA 1I33A 4U7WA 1IVNA 1E1QA 5B4VA 1L4KA 4NDZA 4Y2XA 3VDQA 4B35A 1I2AA 5LP6A 2Q2WA 3CVYA 3DNPA 3TCNA 2AFRA 4PAWA 4F96A 3CSDA 1BKSB 3GLGA 1QUEA 1DAMA 4OL0A 5F1KA 2G70A 4HSGA 3X3HA 2WAYA 1E5VA 3WOHA 1ZR4A 3P9SA 3I9OA 1BU5A 1YHNA 3ZY5A 1ZGZA 3ZDAA 2AF4C 3EQZA 3GK3A 1AB6A 2XUGA 3A6FA 4CBVA 4KCGA 4EPWA 1HTTA 3QW4B 3FI9A 3NOVA 3UPUA 1NFQA 4JCCA 2JHGA 9LDTA 4HQ0A 1AKMA 3WADA 2YIDA 4D45A 5LD2C 2RBGA 3E18A 3RWMB 2A4MA 2RHTA 1YJXA 3G89A 5DIFA 1Z0KA 2XOKA 1MJFA 4FR5A 1G6HA 2C5BA 3C5HA 2BEWB 4PS0A 2Q1XA 2YBEA 1GQOA 4PTLA 4ZI7B 5BNZA 3AUJB 2DAPA 1Y9DA 2I34A 4K6KA 1EUYA 1U2GC 4CUZA 4J0QA 4L9AA 5EVCA 2MTBA 2ZRPA 3OTOB 2FHSA 2Y0DA 3KQYA 4ZFNA 1BRTA 1MFPA 3GUVA 2FYTA 2NUPB 4MR8A 4NBSA 4HGNA 2C59A 4YYZA 2BEJA 1Y3FE 4RU1A 4BO7A 4M9XA 2BT4A 4PGMA 1U8TA 1CQJA 2IGBA 3UZUA 1US8A 2A0WA 4GKBA 2PZLA 4LRUA 2AMVA 1G3RA 1P9NA 3C6XA 1P2TA 1TU0A 3EOZA 3OZCA 1PEYA 2ZSBA 3FJYA 3WGGA 3T95A 1W8DA 2J3JA 1Z4JA 3I5UA 3NS7A 3VR3D 4D8TA 1LVGA 2CF5A 1ZIYA 1IEQA 4EMSA 1KJZA 3KOXA 2BFCA 3WGIA 1MO5A 3CKYA 4PPQA 2ZWOA 3WDSA 4I9NA 4JYAB 1K6MA 4HBZA 2ZYIA 1ZI8A 4Y6RA 4RFLA 2OYSA 3D0OA 1ULTA 1Q21A 4RA9B 3KDPA 2YMQA 2GD6A 3IQXA 1N5DA 2VBFA 5DX0A 3GD5A 4JL5A 4KSBA 5FEMA 2BMFA 1B6GA 4AKGA 2WT9A 1PN3A 4OTZA 3T1TA 3LE8A 5FBRB 1FE8A 3ISTA 4RNDB 4OQLA 4FE4A 5EWMB 3TVYA 1B1AA 2IELA 4WMLA 5B1DA 2I2FA 5YASA 3S8MA 4DQ0A 1QU2A 2C1ZA 5ALWA 3OJEA 3I34X 1EGMB 1NVMB 1BJTA 1YE3A 4XYGA 1E1YA 3ZNNA 1SU4A 4HWGA 4FM9A 2DFKB 4LCBA 4DZRA 1DT5A 2OHVA 3E5MA 1OU4A 1NFRA 3DMRA 2BLLA 1RE1A 4YRJA 1FLDA 5F35A 1E9AA 3PNVA 4TTPA 4DIUA 4F2GA 3OZGA 2GTPA 3C3MA 2XAUA 1DELA 1AN9A 4PIMA 4RZQA 2DY0A 3RWBA 6LDHA 3B53X 1I0LA 4EABA 5B4TA 3A2LA 3EDRA 1BD3A 5I7OA 3OICA 3SVTA 4YDQA 2AFIE 4GSKA 4DRZA 3QUSA 3DFIA 3BILA 2RB4A 3LV8A 1KXJA 1N2OA 4TYQA 2JG3A 4QAJA 3NJ8A 1U9CA 5COAA 4EVQA 3FHTA 5GONF 1TCBA 4YAUA 4J7XA 1T1JA 3OJWA 4OIFA 1UBFA 1W1WA 3NPAA 4AS1A 5JJKA 1F1JA 2NVBA 1MVOA 5EIFA 4CLEA 3M5WA 3VO2A 4G1VA 1ZZGA 2P9GA 5GJWC 3QHPA 3UJ7A 1E3IA 2QLJA 3IVRA 4LNUB 2HW8A 1Q1GA 2GKGA 4E7OA 3H2JA 3PA8A 2VUIB 3X2EA 2W2KA 3EODA 2JI4A 4BMOB 4MKGA 4DTCA 4M21A 4ZI5A 4ZYZA 2I2AA 5DHPA 2AG5A 2PANA 3N75A 4DLPA 5FWNA 3ZLUA 2WPNA 1W9HA 3V6LA 3PQ2A 2ZSEA 3O0TA 2ZUUA 1AZLA 4Q4JB 1VKJA 3L7IA 2XDYA 2ZVJA 4MCJA 4EHKA 1SVWA 2RFLA 3UWPA 3FKSD 1II0A 1QKJA 1J2EA 2LW7A 2ZAYA 3B1FA 1GEGA 3P9IA 3PCXA 5EY5B 4K8OA 2XRMA 3OZDA 1VKZA 1E7SA 1JTVA 3H3XA 2VPPA 1F48A 3VR2D 4DZZA 1Y6JA 4F3TA 4ZVUA 1QRTA 5DKFA 2WSYB 1MRSA 3V9AA 4Q03A 1EFLA 4C14A 4Q9IA 3K8YA 1YRYE 4CMEC 3I2IA 4BBZA 1IWPB 2PX0A 1RJ9A 1U0GA 3ILVA 2HWKA 2PQ6A 3MYYA 3RI3A 5IWCA 4BP8A 4OO3A 3IURA 4HDRA 2GZ1A 3IKTA 3RHZA 3AKCA 4HC4A 1YKGA 2QRZA 1N6KA 3KLNA 1RR6A 4MWCA 5ALHA 3ZJVA 2JHFA 2XX3A 4P81A 5BSGA 1RYNA 2JZCA 2WOJA 4RDHA 1HK7A 4L4XA 1PFUA 3I9MA 4MVXA 4NC9A 3V4VB 4YY3B 2PT6A 3V6MA 4MJLA 3MPOA 1SIWA 1E7MA 1CY0A 2XRFA 3FCEA 1MMFB 2OBFA 1PGOA 2HWWA 5FJIA 5JD4A 1QIFA 1IIBA 2CD7A 3QJGA 3IVMA 4HL6A 2FPXA 2AUNA 2RGAA 4HNUA 2ATEA 3Q8XB 1KJNA 5KOHA 1TKCA 5FBKA 2K5UA 3T06B 3L92A 3RPEA 3WQSB 3LD9A 3MCTA 1R0ZA 3N5KA 2R8PA 3KWLA 3QVGB 4AJPA 1YBMA 2V5VA 3PPVA 2H00A 4TS9A 4AU1A 1DAFA 5FOTA 4DJEC 1HDZA 4RV5A 1WZ2A 1SU8A 1CY8A 1LEHA 1BFKA 3RB8A 4HNAB 2DPLA 1GUBA 2GYYA 2ZTSA 4NENB 2JCVA 1EGAA 2B2CA 3O8NA 3KBOA 3PT5A 2FA9A 4NV3A 4PCAA 4LOJA 5AJZA 3G2KA 3S2UA 4PE5B 4L85A 2BSAA 1PW5A 3HKCA 1UPTA 3WNVA 5LU9A 4BQQA 1QPZA 3MT0A 4EF5A 2YZKA 2J87A 4EFMA 3H2ZA 4IDAA 2P2NA 1K7FB 2CNDA 3CZAA 4JBLA 4WK0B 1DPFA 3KELA 5C5IA 3A6ZA 5K3FB 4D5GA 3NYQA 2VSXA 3AEKA 4C2TA 3QV1A 3ISJA 2QW8A 2YZ7A 5IDVA 4U3JA 3B36A 4D4KA 1IONA 1UPCA 2ZIUB 3GMIA 2B5VA 4OB7A 5EAIA 1YR6A 2QD5A 3REQA 4D5EA 1ZKDA 2P2DA 2QTAA 4JZKA 1PYGA 3U81A 3HWSA 2GVZC 3HWWA 4RGVA 2C7QA 1IY9A 1RS0A 2ZPTX 4WQMA 3QTTA 2R4UA 4UOZA 3RDPA 4M1WA 1Z2AA 4UZEA 2JK0A 1FNCA 1P2SA 5D7BA 9MHTA 2VHEA 1BIFA 4C1BA 1VMKA 3UWOA 1Z75A 4G8CA 1BGWA 4RORA 2I62A 3FFAA 3IEKA 3KZNA 3UCEA 4ZYLA 2NUPA 3LQFA 4DPMA 2TMYA 3UB4A 1J70A 5EJ6A 3WA7A 3ZXSA 4YJFA 1LJ8A 3MCZA 1RJDA 5EJ9A 1UINA 2WR8A 4QG7A 1D1PA 3AF1A 1UJBA 2BDTA 3OT4A 1G55A 1B00A 2QN8A 3KQHA 1GTJ1 3G82C 1GITA 4LHSA 4XIJA 5EHGA 3RSZA 4EGFA 4Q6BA 3T3OA 4DA6A 4AP5A 1Z5VA 3EX7C 2JA1A 3EHEA 3LCVB 1ZO8A 5LQCA 4GS5A 3LBAA 4FW8A 4HVTA 2FE4A 5JI3E 5KYWA 1M7BA 2Z6AA 4JELA 1Y8RA 2AYXA 1G5HA 2A1UA 3FPJA 1M6VB 1R0WA 2EDCA 5HKBA 2HYIC 2C0CA 4UJ5A 1N77A 1YCDA 1DHTA 1NTRA 4ZRNA 1U9IA 1JSCA 2EYQA 1YGYA 1F2UB 2WBLC 4Q3LA 3ZWDA 4II7A 5BQPA 9GPBA 3I83A 2ZRLA 4FFSA 3VZQA 3RSSA 2X4LA 2O1EA 4IZ6A 2VWHA 3NDBB 3G7SA 3M6XA 3WISA 3W3AH 4BO4A 4DR2B 4IXMA 2ZJBA 5BOSB 1YH3A 1YRBA 5IASA 4OY3A 1Y5IA 2Z08A 5NULA 2H4FA 2HEIA 3GRPA 3ZG6A 4ZWNA 4Z9XA 1TEVA 1GRNA 4GAEA 2FW6A 5DNVA 5A7GA 5ICMA 4MB2A 2VATA 3QBEA 1W52X 2P9JA 4PYRA 1AMOA 2XUIA 3TBHA 1QF6A 4LXIA 2DHDA 3AHIA 1RFLA 4K9QA 5IAGA 2UVPA 2Q5JA 2VP9A 1T1IA 3N5CA 1GSOA 1U7WA 2OY0A 3CLVA 2Y1DA 3N7TA 3W6OA 1KI1A 1I4OA 4G4IA 1RKQA 4JYMA 4JCOA 3BYZA 3CNHA 4WOJA 4A92A 5HWSA 3JQ9A 2IEAA 2IH2A 2AQIA 3QE0A 1UFVA 4XSHA 2A1TS 4KMOA 2W2TA 1R6VA 4BO2A 1EJ0A 2XEXA 3R3UA 4XM0A 2JB9A 5ESXA 4BKPA 1NP6A 1NQ5A 2WFAA 4RL6A 3T7SA 2PHZA 3FUUA 4DM4A 4MRMA 1UQTA 4OBBA 4MS3B 2NAPA 1D2CA 1CZNA 3V46A 4RNCA 2XNCA 3QJ5A 5D5HA 3VNSA 1B0AA 2PNFA 2XMGA 3HSYA 4LE0A 4AJNA 5IZCA 2IDJA 2HMYB 4IZIA 4X6XA 1YRWA 4Z7OB 5JISA 2IZ0A 3GW8A 3IDQA 3C3JA 3AL0C 3IGFA 1L5HA 1SAYA 2PH5A 1N3YA 4GGMX 2L42A 2PEYA 1LV8A 4HQOA 2XUZA 4H0NA 1KP2A 4PYJA 5IHPA 5K0BA 1KZGB 2XOKD 4DA9A 3LYHA 2D1RA 4YXFA 4M1QA 5COQA 5AKXA 5KYYA 3EQ9A 1TADA 3EAGA 1PQ4A 2EATA 2PQ0A 3L0BA 3QZUA 4M1OA 2XCIA 3JQQA 1PS0A 4KKVA 1B3RA 3GLFE 2G3YA 4OMUA 1WZUA 2HDOA 2HLHA 4JQZA 2QYOA 1ZD2P 3FYUA 3UJ3X 3IEMA 1J49A 3K3PA 1NI3A 5IVKA 4L5AA 1FNBA 4IPTA 3U5TA 4UHFA 4HKTA 1Y63A 2F6RA 4RW0A 4IJ5A 1BX3A 4L5IA 2H1WA 4BFTA 3WGUA 1H6CA 2XXAB 221PA 4A23A 1ZCBA 4JFRA 2WU8A 3M83A 2IQ5A 3B38A 3OQVA 5ITSA 1QF7A 1SCKA 3HB9A 5DTIA 1E4VA 4UTPA 1YASA 4S1NA 2CW5A 3FGZA 4RMIA 1PZNA 4E2YA 4YLGA 3OQHA 3ZW7A 1D04A 1SHUX 2C3PA 3WE7A 3EFOB 2IJGX 3KYJB 1ORRA 2CN1A 4ZAWA 3SKVA 1FB5A 1HRDA 1X7WB 2ARKA 1I7QB 3U37A 3W2GA 3FRHA 2V98A 3FDFA 3KM0A 3SN6A 4WXPA 3QLEA 3VYTB 4JSYA 1E6EA 1LS6A 3QOFA 4RGBA 4M9UA 3V33A 3VXKA 4DC0A 4Z4HA 4N7MA 2FWMX 3L49A 2Z3WA 3F3YA 4DWJA 5JADA 2HIGA 4KC0A 3WY9A 3OVMA 1RPZA 4MK4A 1QOPB 3LGSA 2EWWA 4GWLA 2IYEA 2HHJA 4EO4A 1U0EA 1NU8A 1A50B 3BMCB 3N2GB 4YXWA 3CLKA 2DETA 1J2TA 3GAZA 1XNHA 4R1SA 3AFOA 1XKQA 2HU8A 3ZU2A 4HDNA 4BX0A 1L7XA 3G9XA 1TGYA 1VXRA 3WZMA 3ORYA 1J9ZA 1U1EA 1VSUA 5EA2A 4TZ0A 1B0UA 3BWYA 3B1KA 4FKZA 1T4DA 2D06A 3DEAA 5CAEB 5CGQB 1JH9A 4FYPA 2YXEA 4G41A 2PX8A 2O19A 3UUFA 1L3CA 2GMWA 4MEAA 2OLJA 1E2HA 1HE1C 5EKTA 4FB4A 1WXEA 4MCHA 4UQOA 2HUPA 721PA 4UTZA 1JEQA 1YUNA 3G17A 4R68A 1XNQB 1XJQA 4YRTA 2XXBA 3O2SB 1N5MA 2YR0A 3KQTA 1ZU4A 4HZUA 5EEGA 4C87A 1EM6A 3LU1A 2I78A 5JWOA 4CMCA 3GFQA 4KX5A 3UPDA 2QUJA 2BPOA 2AMLA 1Y8QB 2PD6A 3FVVA 3FPFA 3K9LA 3LQ1A 4UVEA 1PR9A 1CNFA 3PTAA 4FDUA 1U2RA 4XPIA 3PEWA 1X7GA 1VPDA 1NNEA 4KYIB 3KPYA 4FI3C 3V2GA 3WIUA 2ZJ3A 3ELDA 3IE1A 2OM6A 3N8HA 1BROA 3Q98A 3L0CA 4L7VA 4LQ4A 3I2YX 2O6HA 3R0JA 5EHQA 2YFQA 3RS5A 3CVVA 4Q02A 3NC4A 1GY8A 2QN9A 5G3ZA 1KI7A 1FFAA 3VBCA 3W5HA 2C2KA 1SCJA 4MWEA 4DIDA 4F7WA 1OBHA 3WAJA 2I03A 4CT4B 1XZKA 4KXQA 2HKIA 4DARA 1CZKA 4KQWA 4YNBA 5BW8A 5K0LA 2OBXA 1QHXA 4MVJD 1DMSA 3R24A 5LDGA 2BKAA 3GFRA 1Z8DA 3Q11A 1M73E 1HSOA 5K8CA 4ZC8A 2JH9A 4HAWA 1CB7A 3C85A 4Y9RA 2RK3A 3GFVA 3OMWA 3C3DA 1CD5A 3MSCA 3TNLA 4FUTA 2VRWA 5K01A 3P0EA 4O5AA 4JSRA 1O1YA 1B26A 3PEUA 3FFWA 4I9HA 3HJRA 2YYSA 3AOEC 3HA7A 4OBWA 5KNLA 1D2NA 1CETA 1FSPA 3MM4A 5LQUA 4HQRA 2FPMA 1ORVA 2FMHA 2F43B 5CXQA 2B30A 1NQOA 4MGKR 3VU1A 2F59A 2BBSA 4PICA 4R81A 3ZHVA 3U6BA 1FDOA 4PX3A 5HBRA 5AP9A 4B8ZA 1QRSA 2OMKA 4KQXA 5I9TA 1VI5A 4K1LA 1IEXA 1VJCA 2GCGA 4M0UA 4CKWB 1NOKA 1P77A 4MQMA 1YRHA 4JVLA 4F4UA 1E3MA 5F9HA 1N3LA 1GQYA 1NXXA 2V7BA 3FFBA 3IA2A 1FMCA 2AFHE 3ZIDA 4RZHA 1X7YA 2BZGA 2ZS7A 4QUBA 3QA9A 3E7PA 2GKOA 4PONA 5HCUA 4TXLA 4F2PA 4QOSA 2PUWA 2GETA 3L1IA 5LQNA 3X1DA 1MJ5A 4OOFA 3T5DA 4ISBA 4BNLA 3BD6A 3DVQX 5G4LA 1LLDA 1M1NA 1HM5A 4D26A 5JBNA 4MRAA 2DHEA 2GHQA 3WMRA 1RCFA 2YHSA 4REOA 3D1LA 1FQOA 1RKBA 4HXEB 2O2EA 4CG1A 4EGJA 1JG7A 3BKXA 1KDZA 4S0XA 4D80A 5KOJB 3EK2A 4OQQA 1VSVA 2CJWA 1ZSYA 2IIBA 2R7NA 3MS4A 5CNMA 3PRKE 3CEPB 3WHLA 4CQLB 2C5EA 1GFIA 3C74A 1VKRA 3V2UA 4GLJA 1PZHA 2HAEA 2Q50A 3NBYC 5IANA 1QQAA 2IYYA 4I50B 5IFLA 1CERA 1DEHA 2IPOA 3K1AB 5JSHA 4EY4A 1IN7A 2RJ3A 2WAXA 4C7VA 2VDMB 2C5FA 5JMPA 3RIMA 3U1VA 2PMWB 1K3UB 2W83A 3WHKA 1XLTA 5HFJA 4L4YA 5IC5A 3N0WA 3EA0A 4OSPA 3ETGA 4Q93A 1JBQA 1QP0A 1I5OA 2C5AA 4BZQA 3C97A 4W99A 5KEIA 5KNBD 1ISPA 1NAHA 1ZXXA 4GO1A 3MXOA 4BQNA 1AKEA 5PGMA 3TLGB 2JLYA 4DCPA 1K7CA 2C07A 2HDWA 2ENWA 1GTMA 3EGXA 2OOSA 1MT3A 2ORVA 4LBZA 5G53C 3JYLA 3F1LA 4S04A 1HL7A 3FKSA 4QDKA 3QFCA 1EX1A 5K1ZA 1CT9A 2AK2A 3TRKA 2CYBA 4D8XA 3A2NA 2WF5A 3HGTA 3KHTA 1L9XA 1E6KA 5FH9A 1SIUA 3C3CA 1L5FA 4YJGA 5A7FA 4RDXA 1U63A 1Z7GA 2GPSA 3DR3A 3E3AA 4HD8A 4OPMA 3ONNA 1TDJA 2AX3A 1WB4A 1A4UA 3KKNA 3R23A 4YEDA 3AEQA 1XPRA 1ATIA 2O8CB 2QENA 4JT4A 1ZNQO 3PHIA 3IELA 3NVAA 2BY4A 3AONB 4KEAA 1Y3IA 2AHOA 4O1MA 3OY2A 2DXIA 1Y7IA 1YRLA 2PKQP 2FFBA 1TD9A 4Y3UA 3K96A 3NVKI 1UKYA 2BOVA 3L06A 5F9FA 3LBNA 5ALKA 4C76A 3WLKX 4HDOB 3C1AA 3SOZA 4BVEA 3FYTA 2QTVA 4X92A 5AUOB 3KB8A 3WLAA 4BWYA 4NV0A