2WU5B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystal Structure of the E. Coli Succinate:Quinone Oxidoreductase (Sqr) Sdhd His71met Mutant
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wu5B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wu5B01
1EWYC 1YQ4B 5G5HA 3AV8A 4JWUC 5C2TB 1QOAA 1YQ3B 4HROA 1ZXIA 5GXGB 1FMAD 3LB8C 2WLBA 5EE9A 4IDIA 1T3QA 1KF6B 1L0VB 2KAJA 1QOFA 4ZHOA 1PDXA 4YSXB 3CWIA 2W3RA 1ZP0B 1WWTA 2MJ3A 3FC4A 3PO0A 4JX1C 1JRPA 1N5XA 2K22A 1WYGA 1F0ZA 4JWSC 1NYQA 2FBWB 1FM0D 1N61A 2MH7A 2W54A 3NS1A 5H8YE 5H92C 1J7CA 3VRBB 4ZHPA 3AE7B 2WDQB 2DBYA 3KWLA 2CJOA 1N5WA 1ROEA 2H89B 2PIAA 2WS3B 2MJEA 3SR6A 3AECB 2OHFA 2WDRB 3CIRB 4C7YA 2LEKA 3AEAB 1QT9A 2QJLA 3AE9B 1FRDA 3ETRA 3NVVA 4ITKA 5EE3A 1TJEA 1RM6C 2L52A 4US8A 3HRDD 1E9MA 4US9A 5AUKA 1RFKA 2CJNA 1PUTA 1QOBA 1FXIA 3AE8B 5C3JB 2HTME 1WRIA 2JX5A 1SF0A 2AX5A 3DWGC 3AN1A 3AH7A 1N62A 4C7ZA 1FO4A 2E3TA 3AEDB 4YTPB 1SIJA 4N58A 4WQMA 2KMMA 4KX6B 3BIID 2ACZB 4HRSA 4N59A 1GAQB 2BS3B 5EE1A 3NVZA 3AMZA 4YTMB 4YXDB 1WGKA 2QIEB 2Y5CA 3SFEB 1V8CA 1B9RA 1N63A 3AB5A 2WQYB 3AE1B 1FRRA 1R7SA 4WWMA 1RWSA 3VR8B 2WU5B 1FIQA 1L6VA 1RYJA 4USAA 1H7XA 1UWMA 1DOIA 1WXQA 3EUB2 1ZOYB 1FXAA 1QOGA 4YSZB 1TKEA 3VR9B 2WP9B 1JWAD 1OFFA 1XLNA 3DWMA 3NVWA 3RPFC 3AE5B 3AE2B 3W5UB 3P4RB 1YJIA 1KRHA 1OQRA 1OQQA 1L5PA 1QF6A 2BT6A 2MJDA 1DOXA 2W55A 1IUEA 2L83A 3HVZA 1DGJA 1ZUD2 5AUIA 1XO3A 2BS2B 3B9JA 3ZYYX 1TKGA 1NENB 1XLQA 2JQRB 1GTEA 2K5PA 1XLPA 1V97A 1E6EB 2BS4B 3AEGB 1A70A 3LXFA 3L4PA 3SFDB 1NYRA 4C80A 3NVYA 4YT0B 1GTHA 2Q5WD 1L6UA 1SB3C 1E7PB 1QLBB 2PKOA 2WU2B 1VLBA 1E10A 2M19A 3B2GA 3NRZA 1VJKA 1JWBD 2M56B 3AEEB 1TYGB 1YJJA 2B76B 1AYFA 1CJEA 3AE6B 2G1EA 1PFDA 2PVOD 3P4SB 1NI3A 1DOYA 4A9AA 2WDVB 1N60A 3P1MA 4N6EB 3AM9A 1AWDA 2H88B 4FXCA 5MPOA 3W5VB 1JALA 3CF4A 3ABVB 2PVGC 1J7BA 5EE0A 3VRAB 1TKYA 2K9XA 1H7WA 4P6VF 1CZPA 3B2FA 2N0SB 5G5GA 1NEKB 1VDVA 1I7HA 1GPXA 3AE4B 4ZOHC 3WCQA 1KFYB 3P63A 3HUIA 1JQ4A 2W3SA 1NVID 1JROA 3AE3B 1FFUA 4LTUA 1XLOA 1E0ZA 2DWQA 4YTNB 1GT8A 3AEBB 1J7AA 3P4QB 1JW9D 2EKIA 2CU3A 4YSYB 3FAHA 3AEFB 3W9CB 1FFVA 3P4PB
chains in the Genus database with same CATH superfamily
3OWEB 1L4DB 1ZXIA 1SGHA 2BWFA 2KAJA 3R3MA 2MQJA 1UH6A 2ZEQA 1E90A 4JLCA 3TUOA 2C7MB 3EFUA 1FD6A 2DBYA 1UGMA 2QMTA 1ACCA 3RZWC 3CIRB 3KLSX 4US9A 3WA0A 1C76A 4FADA 4NPNA 2HTME 1EF5A 2CHZA 3U2SC 3R7QA 3WALA 4P1CC 4EZJA 2K8HA 4IWOA 3E9SA 4BKSD 4GLSC 1R7SA 4WH4A 3VR8B 4WWNA 1WY8A 5J18A 2QEJC 4AUQC 3V60A 3U7DA 2INNE 2WX1A 2KK8A 1YJIA 1Z5SB 1PYWD 1XF5L 4G11A 4AP4C 5TR5A 1VD2A 2KWDA 3L4PA 2Q5WD 5LLIA 2M56B 1YJJA 1TYGB 1CJEA 2G1EA 3CSFA 3NHEB 4NAMA 3V05A 5J2RA 1NBFC 1BUIC 4WQOB 4A55A 1YD8U 2BB5A 3UINB 2MBEA 3ZRCA 1LQBA 2AQ1B 1JWMD 4W9KA 5BO4B 1GOZA 3HK0A 3BINA 3PHXB 2V0GA 4GMVA 3APFA 2OJWA 2C5LC 4LNIA 3Q6BA 4JL9A 1GC7A 2KMAA 4M8NA 4OVUA 2ZCCA 2MX2A 3A1QA 1E8YA 4IG7B 4MJSA 1VZ7A 2O6VB 2EKEC 1SE3A 3H7PA 4IM0A 5D94A 3PGEA 2JXTA 2DHZA 3ZO5B 1V2YA 1FM0D 5CX3A 1MI0A 3ML8A 1SBBB 4G50A 2O6VD 4HCNB 3AEAB 2N9LA 1GNUA 5EE3A 5IKCM 5AUKA 2L76A 4JGHB 3AEDB 2BKFA 3SD5A 3BIID 3VH4B 2CHWA 4NY0A 4II3B 4NAWA 2KANA 2FCSA 2JRIB 3PRZA 2D10A 1DOIA 5HKHA 1UNSA 2DLBA 2N9PC 1MVKA 4XDDA 3GE3C 1I4XA 3WAPA 4L2YA 4XWTA 5AUIA 2BYEA 4JE3B 2IO2B 3VUYA 1XLPA 1IYFA 2KLCA 4TQ1A 2X38A 2QCZA 2WHIA 2FAZA 3JSVB 2G4SA 2I1JA 2LI5A 2GOWA 1PFDA 2D3BA 1SIFA 1XD3B 3UGBB 4N6EB 4FXCA 2LGYA 2VH1A 3EFCA 3JW0X 3TEXA 1UELA 1C1YB 3HM3A 1TKYA 3GZNB 3IAS1 3RNCC 4P6VF 3L08A 4DHZB 3BVZA 3U52E 1VDVA 5DCNA 1NI2A 1WJNA 3AU5A 1TZOA 2WXGA 2W3SA 4DDID 2JF5A 1J7AA 3A9KA 4TUUA 4GIVA 4REZA 4ICUA 1FFVA 3P4PB 2K0PA 4LDTD 4JWUC 3BVMA 3NZSA 2DZKA 3WAOA 4EEWA 4BKSA 3HHMA 4EKUA 1N5XA 2N7DA 2W54A 4MSQB 3BK1A 1N6ZA 2WDQB 4ZRIA 5BYQA 1R4NB 2WXRA 2MJEA 3OG5A 3TL5A 4US8A 1R4MI 3HRDD 4KV2A 2KTRA 1WRIA 3NUHB 3R2IA 3ZKJC 1F2RC 2ACZB 3DDCB 1TZ1A 5E6NA 5HI1A 3IG3A 1WJUA 1YQBA 3AB5A 3APDA 2WQYB 2INCC 4GSWA 1MPEA 3N9YC 3ML9A 1ZGUB 1NDDA 1C4CA 3BVGA 3X23A 1TBEA 2DZJA 5E6JA 3B9JA 1JMLA 4KSKC 1D5ZC 2Y5PA 2FIFA 2DENB 4W9LA 2L0FA 4NQKE 4HXDA 2NR2A 5G55A 2BW2A 4MEMA 2WYQA 3MC9A 5L95C 1AYFA 1N60A 1EU3A 1PGAA 1P1AA 4KDLB 1P0RA 2JXXA 4RF0A 2PVGC 2X8XX 2N1WA 2V1YA 3UI3A 3VQIA 2JZ3B 1WGYA 1LXDA 3AE3B 2WXOA 1E0ZA 2BYTA 2G9HD 3AEFB 4HROA 2WXHA 5FK9C 1QOAA 1YQ3B 1OEYA 1EWCA 3LB8C 5EE9A 4IDIA 2NPTA 1KF6B 2MJ3A 4W9JA 3DQVA 2WXPA 3ZUNA 1T0QC 5D6JB 1AARA 4BBNF 2LGXA 3PS6A 1OEYJ 1WX7A 2QJLA 3PLUA 1L2NA 3MJWA 3TSSA 2NS5A 1RM6C 3RNBC 4NJCA 2KFKB 4IOIE 4WJQA 4FA6A 3AE8B 1KLVA 1VZ8A 2ZW0A 3CSTA 1Q10A 5D2MB 2RDBC 4XC2A 2M0XA 3FILB 1ZDXA 3Q3JA 3TMPB 1J0GA 1XLNA 2ASQA 4BBNC 1YIWA 2RMMA 4ANWA 1ESFA 2AWTA 3HVZA 4KGRA 1TIFA 1ZXHA 3PZ8A 2NCNA 1E6EB 4KDIC 1NYRA 1HTQA 1GTHA 1E7PB 1P9DU 4OZCA 3N20C 2Z0DB 1ZPSA 4P16A 2PW9A 1H8CA 3Q8FA 1IPGA 4HPPA 4RGOS 2AL3A 5MPOA 3RT3B 2BWES 4LK0M 1YX6B 5IOIA 1MJDA 2V3PA 4K1RB 4A3OA 2N4FA 2J0KA 3X0WA 3Q3MC 2CR5A 2BVCA 5JHAA 3ZNHB 2Z0EB 3P4QB 3W1SA 1TS3A 3LJ3A 4W9DA 2RPVA 3RN9C 2KDEB 2KWCA 4NZLB 4A8XC 4O1NA 3GE8C 3BK2A 4HPMB 2N1VA 2ONQA 4ZHPA 1ROEA 4F7ZA 5JXVA 4AJWA 1FRDA 2V9HA 2CJNA 1PUTA 1QOBA 3V6CB 3DPDA 1FO4A 4ZYNA 3AH7A 3UIPB 2OEDA 1WIAA 1I4HA 2HE7A 1V8CA 1FRRA 3RZFA 1HQRD 1HTOA 3GB1A 4CQNA 1WXQA 2M1MA 2BF8B 3A1QB 2IGHA 4MJSB 1IGDA 3RUIB 3NVWA 2LRWA 4DDGD 2RGFA 4TKNA 1VRAB 3ENEA 4W9HA 2KJRA 1XLQA 3Q14C 4WJPA 2D3CA 4IWQA 4BZAA 4YT0B 1L6UA 4KSLC 2O2VA 3M63B 3RNGC 2L1AA 2PKOA 1EF1A 4L1BA 3Q3FA 4L23A 2NVUI 2LVQA 4WJNA 4YL8A 3Q2AC 1H4RA 1FNWA 3CF4A 1IBXA 3UQBA 2BYFA 3VRAB 2KO3A 3ZIMA 4JPSA 2GBMA 2BKRB 2LXAA 3NOBA 2J4XA 4A6QA 2DZMA 2EMTA 1B1ZA 2MA9B 4BAXA 4H2AA 1AN8A 3ZQ4A 4YSYB 2KQ7A 5G5HA 3ZDTA 5C2TB 2JYTA 1SXTA 1C78A 3MJ5A 5I4DA 3NG0A 4IM2A 5D3DA 2LFIA 5JH5C 1NYQA 1J7CA 1SE2A 1UBIA 1F1HA 2KACA 5DPRA 1F9JA 3Q8AA 1Q5WB 3U7ZA 3UIOB 1KOTA 2NTSA 2VH2A 1HE8A 3FILA 5C3JB 4HJKA 4CHKA 2FIDA 2KQ4X 1TS2A 1IGCA 2ZNVC 1R4MB 3M95A 1UF0A 4OHJA 3OJ4B 2K25A 1KM7A 3QK0A 2BS3B 3A9KB 2JY6A 3Q69A 3SFEB 4GDKA 2DAJA 5AZFA 1XCTL 3BY4B 4BOSC 2SAKA 3AE5B 2JZPA 3QARA 2LZ6A 4TQ0A 1I42A 1MHHE 1WRDB 5JZEB 2IY1B 2BS2B 1FPYA 3SFDB 4C80A 4EUTA 3W1YA 2NMQA 4EZKA 1V1PA 1XCQL 5BMGA 2KTRB 2JYEA 4P7IA 3ZJUA 3I57A 5C1ZA 5T8IA 3W5VB 1ET9A 5HFYA 3QIJA 4PYZA 3PT2B 4ZRKA 2WXQA 1XEEA 3ZLZA 1I7HA 4MGZE 4ZRJA 1JQ4A 3Q3OC 2MBHA 2FNJB 3M62B 3T9LA 4HVBA 1TY2A 2ON8A 1ET6A 4FHJA 1WWTA 3FC4A 1E5WA 3PV1A 4JWSC 1ZKHA 2J52A 3TCAA 2CJOA 1WH3A 2SEBD 2ZVOA 2KX3A 1YN5A 2XBBC 1M4VA 4C7ZA 3RFZB 3PRPB 4ZDVA 4MH8A 1WF9A 4N59A 1GAQB 2KC2A 2QIEB 3BWUD 2ZPNA 3MFGA 3APCA 4USAA 4AWJA 3O65B 3C0RB 2GBNA 3PZDA 2XNAC 1WGDA 1ZOYB 2NPTB 2M4NA 4BOZB 2KN5A 2IBIB 4K3BA 2LJIA 2A5UA 2KNBA 2KVRA 4ZRPA 4NQLB 2WNMA 1VZ6A 2LVPA 2CU1A 1SJHD 1LM8B 1ZDVA 1T0YA 3PVLA 3VUXA 3C19A 4C56C 2KDMA 2NBUA 4A90A 3I5JC 2B76B 1D5MC 2BPSA 4B6WA 1AWDA 3JYUA 4I6PA 1JWUD 2TSSA 3GP7A 3NZ3A 4UDUC 1J7BA 1GB4A 4ARIA 3NY5A 2N0SB 1GPXA 5LXIB 4D2KA 1T0RC 1ZW7A 1HZ6A 2MSED 1SSNA 1ZE3D 4M00A 5IO9A 1GJZA 1EWYC 5JHBA 4MGKE 4W9CA 1WJ4A 3VFKA 1L0VB 2XEWA 2MBOA 2IO3B 4YSXB 2MEKA 4LDTB 2PTLA 2WWZA 1F0ZA 2PE6B 2L32A 2INDC 5H8YE 2V4LA 3V62A 2GLSA 2A4ZA 3PREA 2LHDA 2WS3B 1WMHA 2KDIA 2OHFA 3ZNZB 1SJED 4PT5A 3L0WB 2MW5A 1D3ZA 2L52A 3I3TB 2K8BA 1RFKA 2PEAA 2L3ZA 4KGSA 3DVNV 3NS8A 3EGRA 4HEA1 2RPQA 2E6XA 3AMZA 1N63A 4OW0A 3T3NA 1X1MA 3R7RA 5L83A 3EUB2 4MSMB 2D3GA 1JWAD 1C3TA 3P4RB 2N7EA 1KRHA 2XK5B 4BKGA 5FKAC 2IO0B 2UYZB 2J42A 3AEGB 2WXNA 4B0EA 1GUAB 2LVOA 2MWSB 1YN4A 4WAAA 1FEHA 2IY0B 3NRZA 3DCGA 3I9V1 2LJ5A 1T6BX 1RLFA 2K6QA 4CYEA 1P3QU 3PPAA 1UWXA 1GG3A 4LJPB 5AEKB 5IAAC 3AE4B 2KN4A 5BMHA 3PSEB 2KQSA 1BMLC 1E7UA 1JROA 3ECIA 1XLOA 4BFRA 1MFWA 2FCQA 1YMHE 3OJ3A 3AV8A 3QQ8B 3VHTC 1FMAD 2EELA 2O2VB 4ZHOA 3V61A 3ZJTA 1CMXB 1ZP0B 3AULA 2K22A 3H8HA 1N61A 4MGIE 4K3CA 2J0JA 3M3JA 1IBXB 3R2TA 4WURA 2V3NA 1L7YA 2WXIA 3MC0B 1RRBA 2WXFA 3EC8A 1FCCC 3OAWA 5DPWA 4MH0E 1S3SG 2E3TA 4F1SA 4HRSA 1K8RB 3MP9A 2B3AA 2ZCBA 2J7QB 4ZYSA 3W1SC 3QA8A 1M94A 5E6OA 4WJOA 3VR9B 1I4QA 1V5OA 1ENFA 2BT6A 1WM3A 2W55A 3IXSA 4M01A 1EU4A 1GTEA 4ANVA 2FUHB 4R3DA 1HA5A 4XX5A 2MBQA 4ARCA 4GU2A 4RFBA 3IBEA 2FUG1 1KLUD 4GXBA 3RI7C 2D11A 2IDYA 4FJYA 2V4IB 3ZW3A 1L0XB 1NI3A 1DOYA 3AM9A 1C4AA 1OGWA 2N9KA 3ABVB 3VXWA 2FCMA 4GDKB 1WR6E 2CS4A 4RH6A 4J3OD 2LGDA 3B0AA 3UQAA 2JPHA 1P7EA 5FR3A 1UD7A 2MLBA 3TEZA 3L13A 3HUIA 5EDSA 1WI0A 4RGNA 1F2RI 2DWQA 3H7SA 4C4VB 2BGFA 4S0RA 2M0AA 1KJTA 2ZZPB 5J17A 4DXFA 5IN7A 2CHXA 1V1PB 2KFJA 2ZPYA 2NBVB 2ZVNA 4N9F4 4GDLA 2M8SA 1WYWB 2LGSA 2PIAA 2QSDA 4ANUA 3SHQA 1S1QB 4C7YA 3ETRA 3AE9B 3NVVA 4KZ0A 1JWSD 3VTUA 4ASWC 3WANA 4WQMA 2W82A 1IP9A 2KMMA 3E56A 2ICIA 3N1XC 2DYOA 4YXDB 2LUMA 4XWWA 2XK5A 1TTNA 2WXMA 2YVCA 2YEPB 4WWMA 1RWSA 4NJ6A 2FE8A 2Y3AA 3A33B 5DPSA 3L54A 2KOXA 2KTFA 3DWMA 1STEA 2GI9A 4OZAA 3BZDB 3VUWA 3T3OA 1TS5A 1VCBA 2Y5BB 2K5PA 3VVWB 3LXFA 3FKYA 4HDOA 2M17A 5LNK1 3Q8BA 1QLBB 3MC8A 2WXLA 4RM8A 3B2GA 2BBCA 3KUCB 3A9JB 2WDVB 3VTWA 1HEZE 3P1MA 2H88B 1BT0A 4JQWC 4TV3A 1RFAA 1V49A 3DVNU 5KHOA 4M02A 4FHKA 2K9XA 1H7WA 2KC1A 3B2FA 5G5GA 5BYSA 2PPHA 1FCLA 4HDQA 1K50A 2KYWA 4TSSA 3ZXRA 3IT6B 2GBJA 2VZKD 2KD0A 3KVFB 1KTKA 1YQ4B 2WXJA 3K9PB 3KYCD 3ONSA 1GB1A 3MTNB 2IGGA 1JRUA 1T3QA 4DQOC 4FJVB 1PDXA 1OTRB 4P1BC 3NS1A 1EO6A 2VRRB 3AU4A 3S2AA 3AECB 3URYA 2KT7A 1C79A 4MGYE 2IZVB 2MHJA 1QQRA 3ZRFA 3MHSD 2UWQA 4FN2A 3DWGC 1N62A 3AI5A 1SIJA 1WZ3A 4LNKA 4WAFA 4DHZE 5CTRC 3AE1B 2G4DB 3LDZE 3SU8X 4HLEA 1G6JA 2WP9B 4K7WA 2MCNB 3W5UB 1V81A 4M0WB 4MDKE 1L5PA 1QF6A 1LFDA 3HM6X 3EHVA 2D07B 4GGQA 5E6PA 3Q8CA 2AL6A 2JUOA 1XO3A 4EOYA 2D5GA 2JQRB 3DBLI 1MG4A 2KKCA 3RULA 1RAXA 2KJ6A 1FNUA 1WMHB 5IA7A 2GRIA 3CF6E 2R2QA 3DHHC 2NTTA 3B1LX 4RGTA 3RNFC 2AEHA 1V80A 4C4VA 4X57B 3DBRI 4RMAA 1CZPA 4OVVA 3ZTCA 2DAFA 3VH3B 1OQYA 2LUEA 4W9EA 4LJOB 1FFUA 1D6EC 4HPLB 1WX9A 2L00B 3HIZA 3Q3NC 5AZGA 3EECA 5FR6A 2QDFA 3VTVA 3RMKC 4AQ7A 1LGRA 2J53A 4DK5A 4HCPB 4AOFA 3PHWB 4HK2A 2MH7A 2FBWB 1KH0A 1FXTB 2HD5B 4DBGA 3R66C 3AE7B 2H89B 2HJ1A 4MM3A 1V9JA 1TJEA 4IM3A 1E9MA 5LXHA 3KH0A 2AX5A 3CMMB 3IAM1 3DHGC 4FJZA 4IKGA 5TSSA 4YWGG 4C00A 4YTMB 2JVCA 2DNFA 2KMCA 1DYQA 1L6VA 4PK1A 1HXYD 3V6EB 3KYDD 3PTFC 3SR6A 1YJ1A 2KZRA 1OQRA 4RNAA 2K1FA 2KJHB 2MJDA 2KHWB 1J19A 2FCNA 1IUEA 3A9JA 4EZLA 1NENB 1V86A 4E74A 1V97A 4K7UA 4PS8A 1TS4A 1Y56A 1SB3C 4LCDE 3VDZA 4DHJB 1VLBA 2M19A 3C8YA 4EE2A 2G3QB 4QAYA 2PVOD 3AE6B 4KVGB 4MACA 1QILA 2K39A 2KX0A 2PMVA 2L0TA 2LHEA 3B08A 4DHJD 4KGTA 3L10B 2LWPA 4AS1A 1YOVB 1SEBD 3R8BA 1TGZB 4HWIB 4YTNB 2GB1A 1C9FA 1JW9D 2EKIA 1PQSA 4KKJA 3FAHA 3QWZB 4IWPA 5BMIA 4NJ7A 3U8ZA 1E8WA 2UU7A 4GOCA 1JRPA 2NBWB 4IC7B 1AW7A 1PGXA 2I1KA 3DBHI 1QZEA 3RNAC 3PLVA 4URKA 2BB6A 1QT9A 1UBQA 1WXMA 1WJ6A 2KWVB 1D5XC 2JX5A 3AN1A 4IW0A 2RD0A 2GBRA 5CHFA 2LRUA 4ANXA 2CKHB 2I38A 3QC8B 3Q8EA 4JIOU 4M0WA 2JSVX 1FNVA 1B9RA 4HJGE 5KHQA 2WU5B 3WIMA 1H7XA 4XE0A 2KWUB 1VR9A 3KWVA 1I4PA 2R61A 4KIKA 1XXGA 2AQ2B 2N9XA 3H9DA 3I63C 2Z8LA 3OLMD 3A4SC 1I35A 4GDLB 1TKGA 2BTEA 3LYYA 2JWZA 2KDFB 2AYOB 2XN9C 1WR1A 2Z59B 2KLGA 4XZ4A 4XYCA 1MG8A 4IUMB 4XDCA 4PS7A 1UZXB 2QHOA 3IT4B 3VAWA 3WAMA 3H1UA 1WXSA 1L0YB 4ICVA 1V6EA 1PGBA 3ZTDA 4PS3A 1EUVB 1GC6A 1E8ZA 1WGHA 1NEKB 2PE9A 4RM9A 2N7JA 1I4RA 4KKIA 2D3AA 4EFOA 5IP4D 2RDHA 4G3XB 4B9KA 3BYYB 1WGGA 2RDGA 1T5XD 1Y8RC 4J6IA 2WLBA 5CHVC 2JU6X 1QOFA 2PLPA 3CWIA 2W3RA 4JX1C 2K8CA 5CHWA 4I6NB 1WE7A 3T8MA 4B95A 4A3PA 1XQQA 3N1YC 3DOWA 1N5WA 2KVZA 3A4RA 4MELA 5GXGB 3GS2A 4HKQA 3TEWA 2N9EB 2I2YA 2W9NA 3N30A 2MP2B 2LXCA 3L17A 4BVUC 4TMAB 1WGKA 2DZIA 2MBBB 4KZCA 4HKZE 1YX5B 3ALBA 1FIQA 1D4BA 1UWMA 1EM7A 2V3SA 4LNFA 1FXAA 1TKEA 3KUDB 4YSZB 1HZ5A 3NJTA 3RPFC 1TY0A 1BXTA 1OQQA 5HG2A 4ACFA 1DOXA 1YNTE 2C60A 3SEBA 4WWOA 1V1OA 2MRPA 5BYRA 5AZHA 4Q2JA 2L05A 2JT4B 2IO1B 2O6VA 1V5TA 3DBLB 3DBSA 4OVZA 1JWBD 3AEEB 4FBJB 1WX8A 3RD2A 3PZ7A 1UGJA 2QC8A 3P42A 3P4SB 1ISNA 3U4EG 1WZ0A 2C9WB 2WGSA 1JALA 3KW5B 4CO7A 2JRHA 3MHZA 4FULA 3GOEA 4DXAB 2HDEA 1I4GA 1UUPA 1KFYB 3P63A 3DBRB 1Q0WB 5GMVA 2K6DB 2DYBA 1C4PA 2C7NB 1QKZA 4RF1A 3W9CB 1SE4A 1NVID 1WE6A 2HJ8A 1F77A 3PO0A 1F52A 1WYGA 4BKTA 1P7FA 3W2DA 2LGIA 3QX1A 1A5RA 2WDRB 4S17A 2LEKA 4ITKA 2QILA 4XGAB 1K52A 1T0SC 3ZNID 3JSVA 2L7RA 2IYDB 4N58A 2GMIC 1WM2A 1WFYA 2IGDA 1WSPA 3QHTA 2KDBA 3ZGZA 3TJPA 1E8XA 1QOGA 2OOBB 1OFFA 2DX5B 2BYVE 3EA6A 4E71A 2WXKA 4OZBA 4RCOA 5C23A 2HTHA 4LNOA 1ZUD2 2REXA 3ZYYX 3N1ZC 2BQQA 3ZVVA 2LD9A 3ZXVA 1CQVA 3IVFA 3NVYA 2AQ3B 4MM3B 3JVZX 2WX0A 4LLGM 2WU2B 1E10A 3ZNGC 1VJKA 3ZJVA 4PYUA 2OJRA 1TT5B 1J8CA 1CK1A 2IJ0A 3DVGY 3GZNI 5D3IB 3IHPC 1JCKB 2INPE 4ZOHC 3KQ4A 3DVGX 3HVDA 3ZDMC 4LTUA 4M8MA 3U30A 1GT8A 3AEBB 2D2QA 4K7SA 1Q1OA 4GB9A 1WXAA 2K3UA 2ZNVB 2C7HA 2JZZA 2R2OA 4MT5A 3RYTA 3UF8A 3IFWB 2ZJDA 2VZKB 4LNNA 1WXVA 3TIXA 4ZRQA 1R4NI 4I6LB 3J9CA 3QJZA 5H92C 4G0NB 4WIPA 1P98A 3VRBB 3RCZA 2MP2A 3KWLA 3QCAA 3PRMB 3H7PB 4NNJB 3DBHB 4II2B 5G2NA 1FXIA 3N3KB 1SF0A 2GBKA 4YTPB 2LASA 1U4AA 5D7GA 4KX6B 4K81A 2DYMA 2KXJA 3D32A 5EE1A 3NVZA 2L8JA 2Y5CA 3RNEC 2ZW1A 1XT9B 2YEPF 1RYJA 5DPTA 3V3XA 3NZUA 4E3CA 4WWPA 2PJHA 3L16A 1YN3A 2JWUA 3AE2B 4GN1A 3TEYA 2IPKD 4F8CB 4NAWB 5HHDG 1K51A 1LO5D 2L83A 2WDTB 3N32A 3TBLD 1DGJA 1KLGD 3P2BA 2BS4B 1A70A 2LMCA 3H6NA 3K9OB 3SDLC 4W9FA 1C77A 1K53A 4AJYB 1L4ZB 1Z2MA 4A9AA 4W9GA 3QAQA 1E7VA 4A20A 3DHIC 2RSUA 4B0MA 2G45B 2EMSA 5EE0A 3KUZA 1MHXA 4RGMA 2YLMA 2KFKA 3O13A 2J0MA 3AXCA 4W9IA 3WCQA 2RR9A 4KIKB 4DWFA 4DXGA 3BYTB 1WGRA 1SE9A 2CU3A 4FLHA
chains in the Genus database with same CATH topology
1YMHE 3OWEB 1L4DB 3AV8A 1ZXIA 1FMAD 2RPVA 2EELA 2KAJA 4ZHOA 4NZLB 4A8XC 3ZJTA 1ZP0B 4O1NA 1JRPA 3H8HA 2K22A 3BK2A 3TUOA 1AW7A 1N61A 2ONQA 4ZHPA 1PGXA 1FD6A 2DBYA 1ROEA 2QMTA 1IBXB 1ACCA 3R2TA 3CIRB 3KLSX 5JXVA 4WURA 2BB6A 1QT9A 2V3NA 1FRDA 2WXIA 4US9A 3MC0B 2CJNA 1D5XC 1PUTA 1QOBA 1C76A 2WXFA 1FCCC 2HTME 2JX5A 3AN1A 1FO4A 3AH7A 2E3TA 3U2SC 4HRSA 2I38A 3Q8EA 4M0WA 2JSVX 2OEDA 3MP9A 1I4HA 3E9SA 1FNVA 1V8CA 1B9RA 4HJGE 1FRRA 1R7SA 4GLSC 4WH4A 3VR8B 2WU5B 1HQRD 4ZYSA 3GB1A 2QEJC 4CQNA 1H7XA 1WXQA 4XE0A 2IGHA 1VR9A 3KWVA 2INNE 1IGDA 3VR9B 1I4PA 3NVWA 1I4QA 2R61A 1YJIA 1XXGA 2AQ2B 1PYWD 1ENFA 1XF5L 2BT6A 1VRAB 2Z8LA 2W55A 3IXSA 4GDLB 1EU4A 1TKGA 2BTEA 1XLQA 2KWDA 1GTEA 4R3DA 3L4PA 1HA5A 3LYYA 4YT0B 2Q5WD 4ARCA 1L6UA 2XN9C 4RFBA 2L1AA 2FUG1 2PKOA 1KLUD 4L1BA 4L23A 2IDYA 2M56B 1YJJA 1TYGB 1CJEA 2G1EA 2V4IB 4XDCA 1L0XB 4NAMA 1NI3A 3V05A 3IT4B 1DOYA 1BUIC 1C4AA 3AM9A 1FNWA 3CF4A 1L0YB 2N9KA 3ABVB 1IBXA 4A55A 1PGBA 2BB5A 4GDKB 4RH6A 2AQ1B 4J3OD 1JWMD 3VRAB 4JPSA 1GOZA 1P7EA 5FR3A 1NEKB 3TEZA 2V0GA 2N7JA 2J4XA 4A6QA 3HUIA 4RGNA 1F2RI 2DWQA 1B1ZA 1I4RA 4KKIA 4H2AA 2RDHA 1AN8A 3ZQ4A 4YSYB 3BYYB 2M0AA 2RDGA 5G5HA 5C2TB 2JYTA 1T5XD 1SXTA 1VZ7A 1C78A 2WLBA 3MJ5A 5I4DA 1SE3A 2JU6X 1QOFA 2PLPA 3CWIA 4DXFA 2W3RA 1V1PB 4JX1C 5D3DA 2LFIA 2JXTA 1NYQA 1FM0D 1J7CA 1SE2A 2KACA 1N5WA 2PIAA 3Q8AA 1MI0A 2QSDA 3U7ZA 1SBBB 4C7YA 3AEAB 2NTSA 3ETRA 3AE9B 2N9LA 3GS2A 3NVVA 5GXGB 5EE3A 5AUKA 4HKQA 3FILA 3TEWA 1JWSD 5C3JB 2I2YA 3AEDB 2KQ4X 1TS2A 4WQMA 2W82A 2KMMA 3E56A 3BIID 1IGCA 4OHJA 2ICIA 2BS3B 2DYOA 4YXDB 1WGKA 2LUMA 3Q69A 3SFEB 2WXMA 4TMAB 4XWWA 2YEPB 4HKZE 4WWMA 1RWSA 1FIQA 2FE8A 2Y3AA 1D4BA 1UWMA 1DOIA 1UNSA 1XCTL 1EM7A 2DLBA 1FXAA 1TKEA 4YSZB 1MVKA 2SAKA 1HZ5A 4XDDA 3DWMA 3RPFC 3AE5B 1TY0A 2JZPA 1I4XA 1BXTA 1OQQA 4L2YA 5HG2A 1STEA 2GI9A 4TQ0A 1MHHE 1DOXA 4OZAA 3BZDB 3T3OA 4XWTA 1TS5A 1YNTE 3SEBA 5AUIA 2BS2B 1V1OA 4JE3B 2K5PA 1XLPA 3LXFA 5BYRA 4TQ1A 3SFDB 4C80A 2X38A 4Q2JA 5LNK1 3Q8BA 2NMQA 1QLBB 2WXLA 3B2GA 1V1PA 1XCQL 1JWBD 4OVZA 5BMGA 3AEEB 2BBCA 2JYEA 1UGJA 1PFDA 3P42A 3P4SB 3PZ7A 3ZJUA 3I57A 2WDVB 3U4EG 1HEZE 3P1MA 4N6EB 2H88B 4FXCA 5T8IA 1JALA 1ET9A 3W5VB 5HFYA 3TEXA 1TKYA 2K9XA 1H7WA 2WXQA 1XEEA 3IAS1 3MHZA 4P6VF 3B2FA 3BVZA 5G5GA 3U52E 1VDVA 1I7HA 5BYSA 2HDEA 1I4GA 1TZOA 1UUPA 2WXGA 1FCLA 1KFYB 3P63A 1JQ4A 2W3SA 1K50A 4TSSA 3IT6B 1J7AA 1C4PA 1QKZA 4RF1A 4REZA 2VZKD 3W9CB 1FFVA 1SE4A 1NVID 3P4PB 1KTKA 2K0PA 1YQ4B 2WXJA 3BVMA 4JWUC 1GB1A 1TY2A 2ON8A 2IGGA 1T3QA 1ET6A 1F77A 4DQOC 1PDXA 1WWTA 3PO0A 3FC4A 1N5XA 1WYGA 4JWSC 2W54A 3NS1A 2J52A 3BK1A 2WDQB 1P7FA 5BYQA 2CJOA 3W2DA 2LGIA 2WXRA 2MJEA 2SEBD 3AECB 3URYA 2WDRB 2LEKA 1C79A 4ITKA 2QILA 4US8A 1QQRA 1K52A 1YN5A 3HRDD 1WRIA 3NUHB 3DWGC 4C7ZA 1M4VA 1N62A 3R2IA 1SIJA 4N58A 4WAFA 3RFZB 1F2RC 2ACZB 2IGDA 4MH8A 4N59A 5HI1A 1GAQB 2QIEB 3BWUD 1WSPA 3AB5A 2WQYB 3AE1B 3ZGZA 3MFGA 4USAA 1MPEA 2XNAC 1ZOYB 1QOGA 2WP9B 1OFFA 3N9YC 3W5UB 3EA6A 1C4CA 2WXKA 2LJIA 1L5PA 4OZBA 4RCOA 1QF6A 3BVGA 4ZRPA 3Q8CA 1ZUD2 2WNMA 5E6JA 1XO3A 3B9JA 1VZ6A 3ZYYX 1JMLA 2D5GA 1D5ZC 2JQRB 2Y5PA 1SJHD 1FNUA 1CQVA 1ZDVA 3NVYA 2AQ3B 4MM3B 4C56C 2BW2A 2KDMA 4LLGM 2WU2B 2GRIA 1E10A 4A90A 1VJKA 2B76B 1AYFA 3ZJVA 1D5MC 2NTTA 1CK1A 2IJ0A 1N60A 1EU3A 4RGTA 1PGAA 1AWDA 1JWUD 2TSSA 3GP7A 3NZ3A 4RF0A 4UDUC 2PVGC 1J7BA 5D3IB 1JCKB 1GB4A 2INPE 4ARIA 1CZPA 2N0SB 3UI3A 1GPXA 3VQIA 4ZOHC 3KQ4A 4D2KA 3HVDA 3AE3B 1FFUA 2WXOA 1D6EC 4LTUA 1E0ZA 1HZ6A 1GT8A 3AEBB 1SSNA 1ZE3D 2BYTA 2K3UA 2G9HD 3AEFB 4HROA 1EWYC 2WXHA 5FK9C 1QOAA 1YQ3B 1EWCA 4MT5A 3LB8C 5EE9A 4IDIA 4AQ7A 1KF6B 1L0VB 2VZKB 2J53A 4YSXB 2MEKA 2MJ3A 4ZRQA 2PTLA 3J9CA 2WXPA 1F0ZA 2MH7A 2FBWB 1KH0A 2L32A 5H92C 5H8YE 4WIPA 3VRBB 3AE7B 3KWLA 2H89B 2LHDA 2WS3B 2OHFA 1SJED 2QJLA 4PT5A 3TSSA 1TJEA 1RM6C 2L52A 4NJCA 1E9MA 4IOIE 1RFKA 1FXIA 3AE8B 4KGSA 1SF0A 2AX5A 3EGRA 4HEA1 3IAM1 4YTPB 1VZ8A 2ZW0A 5D7GA 4KX6B 4IKGA 1Q10A 5TSSA 2DYMA 2E6XA 4YWGG 5EE1A 3NVZA 3AMZA 4YTMB 2Y5CA 1N63A 4OW0A 2ZW1A 3T3NA 2YEPF 1DYQA 1L6VA 1RYJA 3V3XA 3FILB 1ZDXA 1HXYD 3EUB2 1XLNA 3SR6A 1YN3A 1JWAD 2JWUA 3AE2B 3P4RB 3TEYA 1KRHA 1OQRA 2IPKD 4RNAA 2RMMA 4NAWB 2MJDA 1ESFA 5HHDG 1K51A 3HVZA 1IUEA 1LO5D 2L83A 4KGRA 5FKAC 1DGJA 1KLGD 1ZXHA 3PZ8A 1NENB 2J42A 1V97A 1E6EB 2BS4B 3AEGB 1A70A 2LMCA 2WXNA 4B0EA 1NYRA 1TS4A 1GTHA 1YN4A 1Y56A 1SB3C 1E7PB 1FEHA 1C77A 1VLBA 4OZCA 1K53A 2M19A 3NRZA 1ZPSA 3C8YA 4EE2A 4P16A 2PVOD 3AE6B 1L4ZB 2PW9A 3I9V1 4A9AA 4MACA 3Q8FA 1QILA 1T6BX 4RGOS 5MPOA 4LK0M 2PMVA 2V3PA 1UWXA 2LHEA 4B0MA 5EE0A 1MHXA 4KGTA 4RGMA 3O13A 3AE4B 4AS1A 2KN4A 3WCQA 5BMHA 1SEBD 3R8BA 1BMLC 4DXGA 1JROA 3BYTB 1XLOA 4YTNB 3P4QB 2GB1A 1JW9D 1C9FA 2EKIA 2CU3A 3W1SA 4KKJA 1TS3A 3FAHA 5BMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWY C;  1YQ4 B;  5G5H A;  3AV8 A;  4JWU C;  5C2T B;  1QOA A;  1YQ3 B;  4HRO A;  1ZXI A;  5GXG B;  1FMA D;  3LB8 C;  2WLB A;  5EE9 A;  4IDI A;  1T3Q A;  1KF6 B;  1L0V B;  2KAJ A;  1QOF A;  4ZHO A;  1PDX A;  4YSX B;  3CWI A;  2W3R A;  1ZP0 B;  1WWT A;  2MJ3 A;  3FC4 A;  3PO0 A;  4JX1 C;  1JRP A;  1N5X A;  2K22 A;  1WYG A;  1F0Z A;  4JWS C;  1NYQ A;  2FBW B;  1FM0 D;  1N61 A;  2MH7 A;  2W54 A;  3NS1 A;  5H8Y E;  5H92 C;  1J7C A;  3VRB B;  4ZHP A;  3AE7 B;  2WDQ B;  2DBY A;  3KWL A;  2CJO A;  1N5W A;  1ROE A;  2H89 B;  2PIA A;  2WS3 B;  2MJE A;  3SR6 A;  3AEC B;  2OHF A;  2WDR B;  3CIR B;  4C7Y A;  2LEK A;  3AEA B;  1QT9 A;  2QJL A;  3AE9 B;  1FRD A;  3ETR A;  3NVV A;  4ITK A;  5EE3 A;  1TJE A;  1RM6 C;  2L52 A;  4US8 A;  3HRD D;  1E9M A;  4US9 A;  5AUK A;  1RFK A;  2CJN A;  1PUT A;  1QOB A;  1FXI A;  3AE8 B;  5C3J B;  2HTM E;  1WRI A;  2JX5 A;  1SF0 A;  2AX5 A;  3DWG C;  3AN1 A;  3AH7 A;  1N62 A;  4C7Z A;  1FO4 A;  2E3T A;  3AED B;  4YTP B;  1SIJ A;  4N58 A;  4WQM A;  2KMM A;  4KX6 B;  3BII D;  2ACZ B;  4HRS A;  4N59 A;  1GAQ B;  2BS3 B;  5EE1 A;  3NVZ A;  3AMZ A;  4YTM B;  4YXD B;  1WGK A;  2QIE B;  2Y5C A;  3SFE B;  1V8C A;  1B9R A;  1N63 A;  3AB5 A;  2WQY B;  3AE1 B;  1FRR A;  1R7S A;  4WWM A;  1RWS A;  3VR8 B;  2WU5 B;  1FIQ A;  1L6V A;  1RYJ A;  4USA A;  1H7X A;  1UWM A;  1DOI A;  1WXQ A;  3EUB 2;  1ZOY B;  1FXA A;  1QOG A;  4YSZ B;  1TKE A;  3VR9 B;  2WP9 B;  1JWA D;  1OFF A;  1XLN A;  3DWM A;  3NVW A;  3RPF C;  3AE5 B;  3AE2 B;  3W5U B;  3P4R B;  1YJI A;  1KRH A;  1OQR A;  1OQQ A;  1L5P A;  1QF6 A;  2BT6 A;  2MJD A;  1DOX A;  2W55 A;  1IUE A;  2L83 A;  3HVZ A;  1DGJ A;  1ZUD 2;  5AUI A;  1XO3 A;  2BS2 B;  3B9J A;  3ZYY X;  1TKG A;  1NEN B;  1XLQ A;  2JQR B;  1GTE A;  2K5P A;  1XLP A;  1V97 A;  1E6E B;  2BS4 B;  3AEG B;  1A70 A;  3LXF A;  3L4P A;  3SFD B;  1NYR A;  4C80 A;  3NVY A;  4YT0 B;  1GTH A;  2Q5W D;  1L6U A;  1SB3 C;  1E7P B;  1QLB B;  2PKO A;  2WU2 B;  1VLB A;  1E10 A;  2M19 A;  3B2G A;  3NRZ A;  1VJK A;  1JWB D;  2M56 B;  3AEE B;  1TYG B;  1YJJ A;  2B76 B;  1AYF A;  1CJE A;  3AE6 B;  2G1E A;  1PFD A;  2PVO D;  3P4S B;  1NI3 A;  1DOY A;  4A9A A;  2WDV B;  1N60 A;  3P1M A;  4N6E B;  3AM9 A;  1AWD A;  2H88 B;  4FXC A;  5MPO A;  3W5V B;  1JAL A;  3CF4 A;  3ABV B;  2PVG C;  1J7B A;  5EE0 A;  3VRA B;  1TKY A;  2K9X A;  1H7W A;  4P6V F;  1CZP A;  3B2F A;  2N0S B;  5G5G A;  1NEK B;  1VDV A;  1I7H A;  1GPX A;  3AE4 B;  4ZOH C;  3WCQ A;  1KFY B;  3P63 A;  3HUI A;  1JQ4 A;  2W3S A;  1NVI D;  1JRO A;  3AE3 B;  1FFU A;  4LTU A;  1XLO A;  1E0Z A;  2DWQ A;  4YTN B;  1GT8 A;  3AEB B;  1J7A A;  3P4Q B;  1JW9 D;  2EKI A;  2CU3 A;  4YSY B;  3FAH A;  3AEF B;  3W9C B;  1FFV A;  3P4P B; 
#chains in the Genus database with same CATH topology
 3OWE B;  1L4D B;  1ZXI A;  1SGH A;  2BWF A;  2KAJ A;  3R3M A;  2MQJ A;  1UH6 A;  2ZEQ A;  1E90 A;  4JLC A;  3TUO A;  2C7M B;  3EFU A;  1FD6 A;  2DBY A;  1UGM A;  2QMT A;  1ACC A;  3RZW C;  3CIR B;  3KLS X;  4US9 A;  3WA0 A;  1C76 A;  4FAD A;  4NPN A;  2HTM E;  1EF5 A;  2CHZ A;  3U2S C;  3R7Q A;  3WAL A;  4P1C C;  4EZJ A;  2K8H A;  4IWO A;  3E9S A;  4BKS D;  4GLS C;  1R7S A;  4WH4 A;  3VR8 B;  4WWN A;  1WY8 A;  5J18 A;  2QEJ C;  4AUQ C;  3V60 A;  3U7D A;  2INN E;  2WX1 A;  2KK8 A;  1YJI A;  1Z5S B;  1PYW D;  1XF5 L;  4G11 A;  4AP4 C;  5TR5 A;  1VD2 A;  2KWD A;  3L4P A;  2Q5W D;  5LLI A;  2M56 B;  1YJJ A;  1TYG B;  1CJE A;  2G1E A;  3CSF A;  3NHE B;  4NAM A;  3V05 A;  5J2R A;  1NBF C;  1BUI C;  4WQO B;  4A55 A;  1YD8 U;  2BB5 A;  3UIN B;  2MBE A;  3ZRC A;  1LQB A;  2AQ1 B;  1JWM D;  4W9K A;  5BO4 B;  1GOZ A;  3HK0 A;  3BIN A;  3PHX B;  2V0G A;  4GMV A;  3APF A;  2OJW A;  2C5L C;  4LNI A;  3Q6B A;  4JL9 A;  1GC7 A;  2KMA A;  4M8N A;  4OVU A;  2ZCC A;  2MX2 A;  3A1Q A;  1E8Y A;  4IG7 B;  4MJS A;  1VZ7 A;  2O6V B;  2EKE C;  1SE3 A;  3H7P A;  4IM0 A;  5D94 A;  3PGE A;  2JXT A;  2DHZ A;  3ZO5 B;  1V2Y A;  1FM0 D;  5CX3 A;  1MI0 A;  3ML8 A;  1SBB B;  4G50 A;  2O6V D;  4HCN B;  3AEA B;  2N9L A;  1GNU A;  5EE3 A;  5IKC M;  5AUK A;  2L76 A;  4JGH B;  3AED B;  2BKF A;  3SD5 A;  3BII D;  3VH4 B;  2CHW A;  4NY0 A;  4II3 B;  4NAW A;  2KAN A;  2FCS A;  2JRI B;  3PRZ A;  2D10 A;  1DOI A;  5HKH A;  1UNS A;  2DLB A;  2N9P C;  1MVK A;  4XDD A;  3GE3 C;  1I4X A;  3WAP A;  4L2Y A;  4XWT A;  5AUI A;  2BYE A;  4JE3 B;  2IO2 B;  3VUY A;  1XLP A;  1IYF A;  2KLC A;  4TQ1 A;  2X38 A;  2QCZ A;  2WHI A;  2FAZ A;  3JSV B;  2G4S A;  2I1J A;  2LI5 A;  2GOW A;  1PFD A;  2D3B A;  1SIF A;  1XD3 B;  3UGB B;  4N6E B;  4FXC A;  2LGY A;  2VH1 A;  3EFC A;  3JW0 X;  3TEX A;  1UEL A;  1C1Y B;  3HM3 A;  1TKY A;  3GZN B;  3IAS 1;  3RNC C;  4P6V F;  3L08 A;  4DHZ B;  3BVZ A;  3U52 E;  1VDV A;  5DCN A;  1NI2 A;  1WJN A;  3AU5 A;  1TZO A;  2WXG A;  2W3S A;  4DDI D;  2JF5 A;  1J7A A;  3A9K A;  4TUU A;  4GIV A;  4REZ A;  4ICU A;  1FFV A;  3P4P B;  2K0P A;  4LDT D;  4JWU C;  3BVM A;  3NZS A;  2DZK A;  3WAO A;  4EEW A;  4BKS A;  3HHM A;  4EKU A;  1N5X A;  2N7D A;  2W54 A;  4MSQ B;  3BK1 A;  1N6Z A;  2WDQ B;  4ZRI A;  5BYQ A;  1R4N B;  2WXR A;  2MJE A;  3OG5 A;  3TL5 A;  4US8 A;  1R4M I;  3HRD D;  4KV2 A;  2KTR A;  1WRI A;  3NUH B;  3R2I A;  3ZKJ C;  1F2R C;  2ACZ B;  3DDC B;  1TZ1 A;  5E6N A;  5HI1 A;  3IG3 A;  1WJU A;  1YQB A;  3AB5 A;  3APD A;  2WQY B;  2INC C;  4GSW A;  1MPE A;  3N9Y C;  3ML9 A;  1ZGU B;  1NDD A;  1C4C A;  3BVG A;  3X23 A;  1TBE A;  2DZJ A;  5E6J A;  3B9J A;  1JML A;  4KSK C;  1D5Z C;  2Y5P A;  2FIF A;  2DEN B;  4W9L A;  2L0F A;  4NQK E;  4HXD A;  2NR2 A;  5G55 A;  2BW2 A;  4MEM A;  2WYQ A;  3MC9 A;  5L95 C;  1AYF A;  1N60 A;  1EU3 A;  1PGA A;  1P1A A;  4KDL B;  1P0R A;  2JXX A;  4RF0 A;  2PVG C;  2X8X X;  2N1W A;  2V1Y A;  3UI3 A;  3VQI A;  2JZ3 B;  1WGY A;  1LXD A;  3AE3 B;  2WXO A;  1E0Z A;  2BYT A;  2G9H D;  3AEF B;  4HRO A;  2WXH A;  5FK9 C;  1QOA A;  1YQ3 B;  1OEY A;  1EWC A;  3LB8 C;  5EE9 A;  4IDI A;  2NPT A;  1KF6 B;  2MJ3 A;  4W9J A;  3DQV A;  2WXP A;  3ZUN A;  1T0Q C;  5D6J B;  1AAR A;  4BBN F;  2LGX A;  3PS6 A;  1OEY J;  1WX7 A;  2QJL A;  3PLU A;  1L2N A;  3MJW A;  3TSS A;  2NS5 A;  1RM6 C;  3RNB C;  4NJC A;  2KFK B;  4IOI E;  4WJQ A;  4FA6 A;  3AE8 B;  1KLV A;  1VZ8 A;  2ZW0 A;  3CST A;  1Q10 A;  5D2M B;  2RDB C;  4XC2 A;  2M0X A;  3FIL B;  1ZDX A;  3Q3J A;  3TMP B;  1J0G A;  1XLN A;  2ASQ A;  4BBN C;  1YIW A;  2RMM A;  4ANW A;  1ESF A;  2AWT A;  3HVZ A;  4KGR A;  1TIF A;  1ZXH A;  3PZ8 A;  2NCN A;  1E6E B;  4KDI C;  1NYR A;  1HTQ A;  1GTH A;  1E7P B;  1P9D U;  4OZC A;  3N20 C;  2Z0D B;  1ZPS A;  4P16 A;  2PW9 A;  1H8C A;  3Q8F A;  1IPG A;  4HPP A;  4RGO S;  2AL3 A;  5MPO A;  3RT3 B;  2BWE S;  4LK0 M;  1YX6 B;  5IOI A;  1MJD A;  2V3P A;  4K1R B;  4A3O A;  2N4F A;  2J0K A;  3X0W A;  3Q3M C;  2CR5 A;  2BVC A;  5JHA A;  3ZNH B;  2Z0E B;  3P4Q B;  3W1S A;  1TS3 A;  3LJ3 A;  4W9D A;  2RPV A;  3RN9 C;  2KDE B;  2KWC A;  4NZL B;  4A8X C;  4O1N A;  3GE8 C;  3BK2 A;  4HPM B;  2N1V A;  2ONQ A;  4ZHP A;  1ROE A;  4F7Z A;  5JXV A;  4AJW A;  1FRD A;  2V9H A;  2CJN A;  1PUT A;  1QOB A;  3V6C B;  3DPD A;  1FO4 A;  4ZYN A;  3AH7 A;  3UIP B;  2OED A;  1WIA A;  1I4H A;  2HE7 A;  1V8C A;  1FRR A;  3RZF A;  1HQR D;  1HTO A;  3GB1 A;  4CQN A;  1WXQ A;  2M1M A;  2BF8 B;  3A1Q B;  2IGH A;  4MJS B;  1IGD A;  3RUI B;  3NVW A;  2LRW A;  4DDG D;  2RGF A;  4TKN A;  1VRA B;  3ENE A;  4W9H A;  2KJR A;  1XLQ A;  3Q14 C;  4WJP A;  2D3C A;  4IWQ A;  4BZA A;  4YT0 B;  1L6U A;  4KSL C;  2O2V A;  3M63 B;  3RNG C;  2L1A A;  2PKO A;  1EF1 A;  4L1B A;  3Q3F A;  4L23 A;  2NVU I;  2LVQ A;  4WJN A;  4YL8 A;  3Q2A C;  1H4R A;  1FNW A;  3CF4 A;  1IBX A;  3UQB A;  2BYF A;  3VRA B;  2KO3 A;  3ZIM A;  4JPS A;  2GBM A;  2BKR B;  2LXA A;  3NOB A;  2J4X A;  4A6Q A;  2DZM A;  2EMT A;  1B1Z A;  2MA9 B;  4BAX A;  4H2A A;  1AN8 A;  3ZQ4 A;  4YSY B;  2KQ7 A;  5G5H A;  3ZDT A;  5C2T B;  2JYT A;  1SXT A;  1C78 A;  3MJ5 A;  5I4D A;  3NG0 A;  4IM2 A;  5D3D A;  2LFI A;  5JH5 C;  1NYQ A;  1J7C A;  1SE2 A;  1UBI A;  1F1H A;  2KAC A;  5DPR A;  1F9J A;  3Q8A A;  1Q5W B;  3U7Z A;  3UIO B;  1KOT A;  2NTS A;  2VH2 A;  1HE8 A;  3FIL A;  5C3J B;  4HJK A;  4CHK A;  2FID A;  2KQ4 X;  1TS2 A;  1IGC A;  2ZNV C;  1R4M B;  3M95 A;  1UF0 A;  4OHJ A;  3OJ4 B;  2K25 A;  1KM7 A;  3QK0 A;  2BS3 B;  3A9K B;  2JY6 A;  3Q69 A;  3SFE B;  4GDK A;  2DAJ A;  5AZF A;  1XCT L;  3BY4 B;  4BOS C;  2SAK A;  3AE5 B;  2JZP A;  3QAR A;  2LZ6 A;  4TQ0 A;  1I42 A;  1MHH E;  1WRD B;  5JZE B;  2IY1 B;  2BS2 B;  1FPY A;  3SFD B;  4C80 A;  4EUT A;  3W1Y A;  2NMQ A;  4EZK A;  1V1P A;  1XCQ L;  5BMG A;  2KTR B;  2JYE A;  4P7I A;  3ZJU A;  3I57 A;  5C1Z A;  5T8I A;  3W5V B;  1ET9 A;  5HFY A;  3QIJ A;  4PYZ A;  3PT2 B;  4ZRK A;  2WXQ A;  1XEE A;  3ZLZ A;  1I7H A;  4MGZ E;  4ZRJ A;  1JQ4 A;  3Q3O C;  2MBH A;  2FNJ B;  3M62 B;  3T9L A;  4HVB A;  1TY2 A;  2ON8 A;  1ET6 A;  4FHJ A;  1WWT A;  3FC4 A;  1E5W A;  3PV1 A;  4JWS C;  1ZKH A;  2J52 A;  3TCA A;  2CJO A;  1WH3 A;  2SEB D;  2ZVO A;  2KX3 A;  1YN5 A;  2XBB C;  1M4V A;  4C7Z A;  3RFZ B;  3PRP B;  4ZDV A;  4MH8 A;  1WF9 A;  4N59 A;  1GAQ B;  2KC2 A;  2QIE B;  3BWU D;  2ZPN A;  3MFG A;  3APC A;  4USA A;  4AWJ A;  3O65 B;  3C0R B;  2GBN A;  3PZD A;  2XNA C;  1WGD A;  1ZOY B;  2NPT B;  2M4N A;  4BOZ B;  2KN5 A;  2IBI B;  4K3B A;  2LJI A;  2A5U A;  2KNB A;  2KVR A;  4ZRP A;  4NQL B;  2WNM A;  1VZ6 A;  2LVP A;  2CU1 A;  1SJH D;  1LM8 B;  1ZDV A;  1T0Y A;  3PVL A;  3VUX A;  3C19 A;  4C56 C;  2KDM A;  2NBU A;  4A90 A;  3I5J C;  2B76 B;  1D5M C;  2BPS A;  4B6W A;  1AWD A;  3JYU A;  4I6P A;  1JWU D;  2TSS A;  3GP7 A;  3NZ3 A;  4UDU C;  1J7B A;  1GB4 A;  4ARI A;  3NY5 A;  2N0S B;  1GPX A;  5LXI B;  4D2K A;  1T0R C;  1ZW7 A;  1HZ6 A;  2MSE D;  1SSN A;  1ZE3 D;  4M00 A;  5IO9 A;  1GJZ A;  1EWY C;  5JHB A;  4MGK E;  4W9C A;  1WJ4 A;  3VFK A;  1L0V B;  2XEW A;  2MBO A;  2IO3 B;  4YSX B;  2MEK A;  4LDT B;  2PTL A;  2WWZ A;  1F0Z A;  2PE6 B;  2L32 A;  2IND C;  5H8Y E;  2V4L A;  3V62 A;  2GLS A;  2A4Z A;  3PRE A;  2LHD A;  2WS3 B;  1WMH A;  2KDI A;  2OHF A;  3ZNZ B;  1SJE D;  4PT5 A;  3L0W B;  2MW5 A;  1D3Z A;  2L52 A;  3I3T B;  2K8B A;  1RFK A;  2PEA A;  2L3Z A;  4KGS A;  3DVN V;  3NS8 A;  3EGR A;  4HEA 1;  2RPQ A;  2E6X A;  3AMZ A;  1N63 A;  4OW0 A;  3T3N A;  1X1M A;  3R7R A;  5L83 A;  3EUB 2;  4MSM B;  2D3G A;  1JWA D;  1C3T A;  3P4R B;  2N7E A;  1KRH A;  2XK5 B;  4BKG A;  5FKA C;  2IO0 B;  2UYZ B;  2J42 A;  3AEG B;  2WXN A;  4B0E A;  1GUA B;  2LVO A;  2MWS B;  1YN4 A;  4WAA A;  1FEH A;  2IY0 B;  3NRZ A;  3DCG A;  3I9V 1;  2LJ5 A;  1T6B X;  1RLF A;  2K6Q A;  4CYE A;  1P3Q U;  3PPA A;  1UWX A;  1GG3 A;  4LJP B;  5AEK B;  5IAA C;  3AE4 B;  2KN4 A;  5BMH A;  3PSE B;  2KQS A;  1BML C;  1E7U A;  1JRO A;  3ECI A;  1XLO A;  4BFR A;  1MFW A;  2FCQ A;  1YMH E;  3OJ3 A;  3AV8 A;  3QQ8 B;  3VHT C;  1FMA D;  2EEL A;  2O2V B;  4ZHO A;  3V61 A;  3ZJT A;  1CMX B;  1ZP0 B;  3AUL A;  2K22 A;  3H8H A;  1N61 A;  4MGI E;  4K3C A;  2J0J A;  3M3J A;  1IBX B;  3R2T A;  4WUR A;  2V3N A;  1L7Y A;  2WXI A;  3MC0 B;  1RRB A;  2WXF A;  3EC8 A;  1FCC C;  3OAW A;  5DPW A;  4MH0 E;  1S3S G;  2E3T A;  4F1S A;  4HRS A;  1K8R B;  3MP9 A;  2B3A A;  2ZCB A;  2J7Q B;  4ZYS A;  3W1S C;  3QA8 A;  1M94 A;  5E6O A;  4WJO A;  3VR9 B;  1I4Q A;  1V5O A;  1ENF A;  2BT6 A;  1WM3 A;  2W55 A;  3IXS A;  4M01 A;  1EU4 A;  1GTE A;  4ANV A;  2FUH B;  4R3D A;  1HA5 A;  4XX5 A;  2MBQ A;  4ARC A;  4GU2 A;  4RFB A;  3IBE A;  2FUG 1;  1KLU D;  4GXB A;  3RI7 C;  2D11 A;  2IDY A;  4FJY A;  2V4I B;  3ZW3 A;  1L0X B;  1NI3 A;  1DOY A;  3AM9 A;  1C4A A;  1OGW A;  2N9K A;  3ABV B;  3VXW A;  2FCM A;  4GDK B;  1WR6 E;  2CS4 A;  4RH6 A;  4J3O D;  2LGD A;  3B0A A;  3UQA A;  2JPH A;  1P7E A;  5FR3 A;  1UD7 A;  2MLB A;  3TEZ A;  3L13 A;  3HUI A;  5EDS A;  1WI0 A;  4RGN A;  1F2R I;  2DWQ A;  3H7S A;  4C4V B;  2BGF A;  4S0R A;  2M0A A;  1KJT A;  2ZZP B;  5J17 A;  4DXF A;  5IN7 A;  2CHX A;  1V1P B;  2KFJ A;  2ZPY A;  2NBV B;  2ZVN A;  4N9F 4;  4GDL A;  2M8S A;  1WYW B;  2LGS A;  2PIA A;  2QSD A;  4ANU A;  3SHQ A;  1S1Q B;  4C7Y A;  3ETR A;  3AE9 B;  3NVV A;  4KZ0 A;  1JWS D;  3VTU A;  4ASW C;  3WAN A;  4WQM A;  2W82 A;  1IP9 A;  2KMM A;  3E56 A;  2ICI A;  3N1X C;  2DYO A;  4YXD B;  2LUM A;  4XWW A;  2XK5 A;  1TTN A;  2WXM A;  2YVC A;  2YEP B;  4WWM A;  1RWS A;  4NJ6 A;  2FE8 A;  2Y3A A;  3A33 B;  5DPS A;  3L54 A;  2KOX A;  2KTF A;  3DWM A;  1STE A;  2GI9 A;  4OZA A;  3BZD B;  3VUW A;  3T3O A;  1TS5 A;  1VCB A;  2Y5B B;  2K5P A;  3VVW B;  3LXF A;  3FKY A;  4HDO A;  2M17 A;  5LNK 1;  3Q8B A;  1QLB B;  3MC8 A;  2WXL A;  4RM8 A;  3B2G A;  2BBC A;  3KUC B;  3A9J B;  2WDV B;  3VTW A;  1HEZ E;  3P1M A;  2H88 B;  1BT0 A;  4JQW C;  4TV3 A;  1RFA A;  1V49 A;  3DVN U;  5KHO A;  4M02 A;  4FHK A;  2K9X A;  1H7W A;  2KC1 A;  3B2F A;  5G5G A;  5BYS A;  2PPH A;  1FCL A;  4HDQ A;  1K50 A;  2KYW A;  4TSS A;  3ZXR A;  3IT6 B;  2GBJ A;  2VZK D;  2KD0 A;  3KVF B;  1KTK A;  1YQ4 B;  2WXJ A;  3K9P B;  3KYC D;  3ONS A;  1GB1 A;  3MTN B;  2IGG A;  1JRU A;  1T3Q A;  4DQO C;  4FJV B;  1PDX A;  1OTR B;  4P1B C;  3NS1 A;  1EO6 A;  2VRR B;  3AU4 A;  3S2A A;  3AEC B;  3URY A;  2KT7 A;  1C79 A;  4MGY E;  2IZV B;  2MHJ A;  1QQR A;  3ZRF A;  3MHS D;  2UWQ A;  4FN2 A;  3DWG C;  1N62 A;  3AI5 A;  1SIJ A;  1WZ3 A;  4LNK A;  4WAF A;  4DHZ E;  5CTR C;  3AE1 B;  2G4D B;  3LDZ E;  3SU8 X;  4HLE A;  1G6J A;  2WP9 B;  4K7W A;  2MCN B;  3W5U B;  1V81 A;  4M0W B;  4MDK E;  1L5P A;  1QF6 A;  1LFD A;  3HM6 X;  3EHV A;  2D07 B;  4GGQ A;  5E6P A;  3Q8C A;  2AL6 A;  2JUO A;  1XO3 A;  4EOY A;  2D5G A;  2JQR B;  3DBL I;  1MG4 A;  2KKC A;  3RUL A;  1RAX A;  2KJ6 A;  1FNU A;  1WMH B;  5IA7 A;  2GRI A;  3CF6 E;  2R2Q A;  3DHH C;  2NTT A;  3B1L X;  4RGT A;  3RNF C;  2AEH A;  1V80 A;  4C4V A;  4X57 B;  3DBR I;  4RMA A;  1CZP A;  4OVV A;  3ZTC A;  2DAF A;  3VH3 B;  1OQY A;  2LUE A;  4W9E A;  4LJO B;  1FFU A;  1D6E C;  4HPL B;  1WX9 A;  2L00 B;  3HIZ A;  3Q3N C;  5AZG A;  3EEC A;  5FR6 A;  2QDF A;  3VTV A;  3RMK C;  4AQ7 A;  1LGR A;  2J53 A;  4DK5 A;  4HCP B;  4AOF A;  3PHW B;  4HK2 A;  2MH7 A;  2FBW B;  1KH0 A;  1FXT B;  2HD5 B;  4DBG A;  3R66 C;  3AE7 B;  2H89 B;  2HJ1 A;  4MM3 A;  1V9J A;  1TJE A;  4IM3 A;  1E9M A;  5LXH A;  3KH0 A;  2AX5 A;  3CMM B;  3IAM 1;  3DHG C;  4FJZ A;  4IKG A;  5TSS A;  4YWG G;  4C00 A;  4YTM B;  2JVC A;  2DNF A;  2KMC A;  1DYQ A;  1L6V A;  4PK1 A;  1HXY D;  3V6E B;  3KYD D;  3PTF C;  3SR6 A;  1YJ1 A;  2KZR A;  1OQR A;  4RNA A;  2K1F A;  2KJH B;  2MJD A;  2KHW B;  1J19 A;  2FCN A;  1IUE A;  3A9J A;  4EZL A;  1NEN B;  1V86 A;  4E74 A;  1V97 A;  4K7U A;  4PS8 A;  1TS4 A;  1Y56 A;  1SB3 C;  4LCD E;  3VDZ A;  4DHJ B;  1VLB A;  2M19 A;  3C8Y A;  4EE2 A;  2G3Q B;  4QAY A;  2PVO D;  3AE6 B;  4KVG B;  4MAC A;  1QIL A;  2K39 A;  2KX0 A;  2PMV A;  2L0T A;  2LHE A;  3B08 A;  4DHJ D;  4KGT A;  3L10 B;  2LWP A;  4AS1 A;  1YOV B;  1SEB D;  3R8B A;  1TGZ B;  4HWI B;  4YTN B;  2GB1 A;  1C9F A;  1JW9 D;  2EKI A;  1PQS A;  4KKJ A;  3FAH A;  3QWZ B;  4IWP A;  5BMI A;  4NJ7 A;  3U8Z A;  1E8W A;  2UU7 A;  4GOC A;  1JRP A;  2NBW B;  4IC7 B;  1AW7 A;  1PGX A;  2I1K A;  3DBH I;  1QZE A;  3RNA C;  3PLV A;  4URK A;  2BB6 A;  1QT9 A;  1UBQ A;  1WXM A;  1WJ6 A;  2KWV B;  1D5X C;  2JX5 A;  3AN1 A;  4IW0 A;  2RD0 A;  2GBR A;  5CHF A;  2LRU A;  4ANX A;  2CKH B;  2I38 A;  3QC8 B;  3Q8E A;  4JIO U;  4M0W A;  2JSV X;  1FNV A;  1B9R A;  4HJG E;  5KHQ A;  2WU5 B;  3WIM A;  1H7X A;  4XE0 A;  2KWU B;  1VR9 A;  3KWV A;  1I4P A;  2R61 A;  4KIK A;  1XXG A;  2AQ2 B;  2N9X A;  3H9D A;  3I63 C;  2Z8L A;  3OLM D;  3A4S C;  1I35 A;  4GDL B;  1TKG A;  2BTE A;  3LYY A;  2JWZ A;  2KDF B;  2AYO B;  2XN9 C;  1WR1 A;  2Z59 B;  2KLG A;  4XZ4 A;  4XYC A;  1MG8 A;  4IUM B;  4XDC A;  4PS7 A;  1UZX B;  2QHO A;  3IT4 B;  3VAW A;  3WAM A;  3H1U A;  1WXS A;  1L0Y B;  4ICV A;  1V6E A;  1PGB A;  3ZTD A;  4PS3 A;  1EUV B;  1GC6 A;  1E8Z A;  1WGH A;  1NEK B;  2PE9 A;  4RM9 A;  2N7J A;  1I4R A;  4KKI A;  2D3A A;  4EFO A;  5IP4 D;  2RDH A;  4G3X B;  4B9K A;  3BYY B;  1WGG A;  2RDG A;  1T5X D;  1Y8R C;  4J6I A;  2WLB A;  5CHV C;  2JU6 X;  1QOF A;  2PLP A;  3CWI A;  2W3R A;  4JX1 C;  2K8C A;  5CHW A;  4I6N B;  1WE7 A;  3T8M A;  4B95 A;  4A3P A;  1XQQ A;  3N1Y C;  3DOW A;  1N5W A;  2KVZ A;  3A4R A;  4MEL A;  5GXG B;  3GS2 A;  4HKQ A;  3TEW A;  2N9E B;  2I2Y A;  2W9N A;  3N30 A;  2MP2 B;  2LXC A;  3L17 A;  4BVU C;  4TMA B;  1WGK A;  2DZI A;  2MBB B;  4KZC A;  4HKZ E;  1YX5 B;  3ALB A;  1FIQ A;  1D4B A;  1UWM A;  1EM7 A;  2V3S A;  4LNF A;  1FXA A;  1TKE A;  3KUD B;  4YSZ B;  1HZ5 A;  3NJT A;  3RPF C;  1TY0 A;  1BXT A;  1OQQ A;  5HG2 A;  4ACF A;  1DOX A;  1YNT E;  2C60 A;  3SEB A;  4WWO A;  1V1O A;  2MRP A;  5BYR A;  5AZH A;  4Q2J A;  2L05 A;  2JT4 B;  2IO1 B;  2O6V A;  1V5T A;  3DBL B;  3DBS A;  4OVZ A;  1JWB D;  3AEE B;  4FBJ B;  1WX8 A;  3RD2 A;  3PZ7 A;  1UGJ A;  2QC8 A;  3P42 A;  3P4S B;  1ISN A;  3U4E G;  1WZ0 A;  2C9W B;  2WGS A;  1JAL A;  3KW5 B;  4CO7 A;  2JRH A;  3MHZ A;  4FUL A;  3GOE A;  4DXA B;  2HDE A;  1I4G A;  1UUP A;  1KFY B;  3P63 A;  3DBR B;  1Q0W B;  5GMV A;  2K6D B;  2DYB A;  1C4P A;  2C7N B;  1QKZ A;  4RF1 A;  3W9C B;  1SE4 A;  1NVI D;  1WE6 A;  2HJ8 A;  1F77 A;  3PO0 A;  1F52 A;  1WYG A;  4BKT A;  1P7F A;  3W2D A;  2LGI A;  3QX1 A;  1A5R A;  2WDR B;  4S17 A;  2LEK A;  4ITK A;  2QIL A;  4XGA B;  1K52 A;  1T0S C;  3ZNI D;  3JSV A;  2L7R A;  2IYD B;  4N58 A;  2GMI C;  1WM2 A;  1WFY A;  2IGD A;  1WSP A;  3QHT A;  2KDB A;  3ZGZ A;  3TJP A;  1E8X A;  1QOG A;  2OOB B;  1OFF A;  2DX5 B;  2BYV E;  3EA6 A;  4E71 A;  2WXK A;  4OZB A;  4RCO A;  5C23 A;  2HTH A;  4LNO A;  1ZUD 2;  2REX A;  3ZYY X;  3N1Z C;  2BQQ A;  3ZVV A;  2LD9 A;  3ZXV A;  1CQV A;  3IVF A;  3NVY A;  2AQ3 B;  4MM3 B;  3JVZ X;  2WX0 A;  4LLG M;  2WU2 B;  1E10 A;  3ZNG C;  1VJK A;  3ZJV A;  4PYU A;  2OJR A;  1TT5 B;  1J8C A;  1CK1 A;  2IJ0 A;  3DVG Y;  3GZN I;  5D3I B;  3IHP C;  1JCK B;  2INP E;  4ZOH C;  3KQ4 A;  3DVG X;  3HVD A;  3ZDM C;  4LTU A;  4M8M A;  3U30 A;  1GT8 A;  3AEB B;  2D2Q A;  4K7S A;  1Q1O A;  4GB9 A;  1WXA A;  2K3U A;  2ZNV B;  2C7H A;  2JZZ A;  2R2O A;  4MT5 A;  3RYT A;  3UF8 A;  3IFW B;  2ZJD A;  2VZK B;  4LNN A;  1WXV A;  3TIX A;  4ZRQ A;  1R4N I;  4I6L B;  3J9C A;  3QJZ A;  5H92 C;  4G0N B;  4WIP A;  1P98 A;  3VRB B;  3RCZ A;  2MP2 A;  3KWL A;  3QCA A;  3PRM B;  3H7P B;  4NNJ B;  3DBH B;  4II2 B;  5G2N A;  1FXI A;  3N3K B;  1SF0 A;  2GBK A;  4YTP B;  2LAS A;  1U4A A;  5D7G A;  4KX6 B;  4K81 A;  2DYM A;  2KXJ A;  3D32 A;  5EE1 A;  3NVZ A;  2L8J A;  2Y5C A;  3RNE C;  2ZW1 A;  1XT9 B;  2YEP F;  1RYJ A;  5DPT A;  3V3X A;  3NZU A;  4E3C A;  4WWP A;  2PJH A;  3L16 A;  1YN3 A;  2JWU A;  3AE2 B;  4GN1 A;  3TEY A;  2IPK D;  4F8C B;  4NAW B;  5HHD G;  1K51 A;  1LO5 D;  2L83 A;  2WDT B;  3N32 A;  3TBL D;  1DGJ A;  1KLG D;  3P2B A;  2BS4 B;  1A70 A;  2LMC A;  3H6N A;  3K9O B;  3SDL C;  4W9F A;  1C77 A;  1K53 A;  4AJY B;  1L4Z B;  1Z2M A;  4A9A A;  4W9G A;  3QAQ A;  1E7V A;  4A20 A;  3DHI C;  2RSU A;  4B0M A;  2G45 B;  2EMS A;  5EE0 A;  3KUZ A;  1MHX A;  4RGM A;  2YLM A;  2KFK A;  3O13 A;  2J0M A;  3AXC A;  4W9I A;  3WCQ A;  2RR9 A;  4KIK B;  4DWF A;  4DXG A;  3BYT B;  1WGR A;  1SE9 A;  2CU3 A;  4FLH A; 
#chains in the Genus database with same CATH homology
 1YMH E;  3OWE B;  1L4D B;  3AV8 A;  1ZXI A;  1FMA D;  2RPV A;  2EEL A;  2KAJ A;  4ZHO A;  4NZL B;  4A8X C;  3ZJT A;  1ZP0 B;  4O1N A;  1JRP A;  3H8H A;  2K22 A;  3BK2 A;  3TUO A;  1AW7 A;  1N61 A;  2ONQ A;  4ZHP A;  1PGX A;  1FD6 A;  2DBY A;  1ROE A;  2QMT A;  1IBX B;  1ACC A;  3R2T A;  3CIR B;  3KLS X;  5JXV A;  4WUR A;  2BB6 A;  1QT9 A;  2V3N A;  1FRD A;  2WXI A;  4US9 A;  3MC0 B;  2CJN A;  1D5X C;  1PUT A;  1QOB A;  1C76 A;  2WXF A;  1FCC C;  2HTM E;  2JX5 A;  3AN1 A;  1FO4 A;  3AH7 A;  2E3T A;  3U2S C;  4HRS A;  2I38 A;  3Q8E A;  4M0W A;  2JSV X;  2OED A;  3MP9 A;  1I4H A;  3E9S A;  1FNV A;  1V8C A;  1B9R A;  4HJG E;  1FRR A;  1R7S A;  4GLS C;  4WH4 A;  3VR8 B;  2WU5 B;  1HQR D;  4ZYS A;  3GB1 A;  2QEJ C;  4CQN A;  1H7X A;  1WXQ A;  4XE0 A;  2IGH A;  1VR9 A;  3KWV A;  2INN E;  1IGD A;  3VR9 B;  1I4P A;  3NVW A;  1I4Q A;  2R61 A;  1YJI A;  1XXG A;  2AQ2 B;  1PYW D;  1ENF A;  1XF5 L;  2BT6 A;  1VRA B;  2Z8L A;  2W55 A;  3IXS A;  4GDL B;  1EU4 A;  1TKG A;  2BTE A;  1XLQ A;  2KWD A;  1GTE A;  4R3D A;  3L4P A;  1HA5 A;  3LYY A;  4YT0 B;  2Q5W D;  4ARC A;  1L6U A;  2XN9 C;  4RFB A;  2L1A A;  2FUG 1;  2PKO A;  1KLU D;  4L1B A;  4L23 A;  2IDY A;  2M56 B;  1YJJ A;  1TYG B;  1CJE A;  2G1E A;  2V4I B;  4XDC A;  1L0X B;  4NAM A;  1NI3 A;  3V05 A;  3IT4 B;  1DOY A;  1BUI C;  1C4A A;  3AM9 A;  1FNW A;  3CF4 A;  1L0Y B;  2N9K A;  3ABV B;  1IBX A;  4A55 A;  1PGB A;  2BB5 A;  4GDK B;  4RH6 A;  2AQ1 B;  4J3O D;  1JWM D;  3VRA B;  4JPS A;  1GOZ A;  1P7E A;  5FR3 A;  1NEK B;  3TEZ A;  2V0G A;  2N7J A;  2J4X A;  4A6Q A;  3HUI A;  4RGN A;  1F2R I;  2DWQ A;  1B1Z A;  1I4R A;  4KKI A;  4H2A A;  2RDH A;  1AN8 A;  3ZQ4 A;  4YSY B;  3BYY B;  2M0A A;  2RDG A;  5G5H A;  5C2T B;  2JYT A;  1T5X D;  1SXT A;  1VZ7 A;  1C78 A;  2WLB A;  3MJ5 A;  5I4D A;  1SE3 A;  2JU6 X;  1QOF A;  2PLP A;  3CWI A;  4DXF A;  2W3R A;  1V1P B;  4JX1 C;  5D3D A;  2LFI A;  2JXT A;  1NYQ A;  1FM0 D;  1J7C A;  1SE2 A;  2KAC A;  1N5W A;  2PIA A;  3Q8A A;  1MI0 A;  2QSD A;  3U7Z A;  1SBB B;  4C7Y A;  3AEA B;  2NTS A;  3ETR A;  3AE9 B;  2N9L A;  3GS2 A;  3NVV A;  5GXG B;  5EE3 A;  5AUK A;  4HKQ A;  3FIL A;  3TEW A;  1JWS D;  5C3J B;  2I2Y A;  3AED B;  2KQ4 X;  1TS2 A;  4WQM A;  2W82 A;  2KMM A;  3E56 A;  3BII D;  1IGC A;  4OHJ A;  2ICI A;  2BS3 B;  2DYO A;  4YXD B;  1WGK A;  2LUM A;  3Q69 A;  3SFE B;  2WXM A;  4TMA B;  4XWW A;  2YEP B;  4HKZ E;  4WWM A;  1RWS A;  1FIQ A;  2FE8 A;  2Y3A A;  1D4B A;  1UWM A;  1DOI A;  1UNS A;  1XCT L;  1EM7 A;  2DLB A;  1FXA A;  1TKE A;  4YSZ B;  1MVK A;  2SAK A;  1HZ5 A;  4XDD A;  3DWM A;  3RPF C;  3AE5 B;  1TY0 A;  2JZP A;  1I4X A;  1BXT A;  1OQQ A;  4L2Y A;  5HG2 A;  1STE A;  2GI9 A;  4TQ0 A;  1MHH E;  1DOX A;  4OZA A;  3BZD B;  3T3O A;  4XWT A;  1TS5 A;  1YNT E;  3SEB A;  5AUI A;  2BS2 B;  1V1O A;  4JE3 B;  2K5P A;  1XLP A;  3LXF A;  5BYR A;  4TQ1 A;  3SFD B;  4C80 A;  2X38 A;  4Q2J A;  5LNK 1;  3Q8B A;  2NMQ A;  1QLB B;  2WXL A;  3B2G A;  1V1P A;  1XCQ L;  1JWB D;  4OVZ A;  5BMG A;  3AEE B;  2BBC A;  2JYE A;  1UGJ A;  1PFD A;  3P42 A;  3P4S B;  3PZ7 A;  3ZJU A;  3I57 A;  2WDV B;  3U4E G;  1HEZ E;  3P1M A;  4N6E B;  2H88 B;  4FXC A;  5T8I A;  1JAL A;  1ET9 A;  3W5V B;  5HFY A;  3TEX A;  1TKY A;  2K9X A;  1H7W A;  2WXQ A;  1XEE A;  3IAS 1;  3MHZ A;  4P6V F;  3B2F A;  3BVZ A;  5G5G A;  3U52 E;  1VDV A;  1I7H A;  5BYS A;  2HDE A;  1I4G A;  1TZO A;  1UUP A;  2WXG A;  1FCL A;  1KFY B;  3P63 A;  1JQ4 A;  2W3S A;  1K50 A;  4TSS A;  3IT6 B;  1J7A A;  1C4P A;  1QKZ A;  4RF1 A;  4REZ A;  2VZK D;  3W9C B;  1FFV A;  1SE4 A;  1NVI D;  3P4P B;  1KTK A;  2K0P A;  1YQ4 B;  2WXJ A;  3BVM A;  4JWU C;  1GB1 A;  1TY2 A;  2ON8 A;  2IGG A;  1T3Q A;  1ET6 A;  1F77 A;  4DQO C;  1PDX A;  1WWT A;  3PO0 A;  3FC4 A;  1N5X A;  1WYG A;  4JWS C;  2W54 A;  3NS1 A;  2J52 A;  3BK1 A;  2WDQ B;  1P7F A;  5BYQ A;  2CJO A;  3W2D A;  2LGI A;  2WXR A;  2MJE A;  2SEB D;  3AEC B;  3URY A;  2WDR B;  2LEK A;  1C79 A;  4ITK A;  2QIL A;  4US8 A;  1QQR A;  1K52 A;  1YN5 A;  3HRD D;  1WRI A;  3NUH B;  3DWG C;  4C7Z A;  1M4V A;  1N62 A;  3R2I A;  1SIJ A;  4N58 A;  4WAF A;  3RFZ B;  1F2R C;  2ACZ B;  2IGD A;  4MH8 A;  4N59 A;  5HI1 A;  1GAQ B;  2QIE B;  3BWU D;  1WSP A;  3AB5 A;  2WQY B;  3AE1 B;  3ZGZ A;  3MFG A;  4USA A;  1MPE A;  2XNA C;  1ZOY B;  1QOG A;  2WP9 B;  1OFF A;  3N9Y C;  3W5U B;  3EA6 A;  1C4C A;  2WXK A;  2LJI A;  1L5P A;  4OZB A;  4RCO A;  1QF6 A;  3BVG A;  4ZRP A;  3Q8C A;  1ZUD 2;  2WNM A;  5E6J A;  1XO3 A;  3B9J A;  1VZ6 A;  3ZYY X;  1JML A;  2D5G A;  1D5Z C;  2JQR B;  2Y5P A;  1SJH D;  1FNU A;  1CQV A;  1ZDV A;  3NVY A;  2AQ3 B;  4MM3 B;  4C56 C;  2BW2 A;  2KDM A;  4LLG M;  2WU2 B;  2GRI A;  1E10 A;  4A90 A;  1VJK A;  2B76 B;  1AYF A;  3ZJV A;  1D5M C;  2NTT A;  1CK1 A;  2IJ0 A;  1N60 A;  1EU3 A;  4RGT A;  1PGA A;  1AWD A;  1JWU D;  2TSS A;  3GP7 A;  3NZ3 A;  4RF0 A;  4UDU C;  2PVG C;  1J7B A;  5D3I B;  1JCK B;  1GB4 A;  2INP E;  4ARI A;  1CZP A;  2N0S B;  3UI3 A;  1GPX A;  3VQI A;  4ZOH C;  3KQ4 A;  4D2K A;  3HVD A;  3AE3 B;  1FFU A;  2WXO A;  1D6E C;  4LTU A;  1E0Z A;  1HZ6 A;  1GT8 A;  3AEB B;  1SSN A;  1ZE3 D;  2BYT A;  2K3U A;  2G9H D;  3AEF B;  4HRO A;  1EWY C;  2WXH A;  5FK9 C;  1QOA A;  1YQ3 B;  1EWC A;  4MT5 A;  3LB8 C;  5EE9 A;  4IDI A;  4AQ7 A;  1KF6 B;  1L0V B;  2VZK B;  2J53 A;  4YSX B;  2MEK A;  2MJ3 A;  4ZRQ A;  2PTL A;  3J9C A;  2WXP A;  1F0Z A;  2MH7 A;  2FBW B;  1KH0 A;  2L32 A;  5H92 C;  5H8Y E;  4WIP A;  3VRB B;  3AE7 B;  3KWL A;  2H89 B;  2LHD A;  2WS3 B;  2OHF A;  1SJE D;  2QJL A;  4PT5 A;  3TSS A;  1TJE A;  1RM6 C;  2L52 A;  4NJC A;  1E9M A;  4IOI E;  1RFK A;  1FXI A;  3AE8 B;  4KGS A;  1SF0 A;  2AX5 A;  3EGR A;  4HEA 1;  3IAM 1;  4YTP B;  1VZ8 A;  2ZW0 A;  5D7G A;  4KX6 B;  4IKG A;  1Q10 A;  5TSS A;  2DYM A;  2E6X A;  4YWG G;  5EE1 A;  3NVZ A;  3AMZ A;  4YTM B;  2Y5C A;  1N63 A;  4OW0 A;  2ZW1 A;  3T3N A;  2YEP F;  1DYQ A;  1L6V A;  1RYJ A;  3V3X A;  3FIL B;  1ZDX A;  1HXY D;  3EUB 2;  1XLN A;  3SR6 A;  1YN3 A;  1JWA D;  2JWU A;  3AE2 B;  3P4R B;  3TEY A;  1KRH A;  1OQR A;  2IPK D;  4RNA A;  2RMM A;  4NAW B;  2MJD A;  1ESF A;  5HHD G;  1K51 A;  3HVZ A;  1IUE A;  1LO5 D;  2L83 A;  4KGR A;  5FKA C;  1DGJ A;  1KLG D;  1ZXH A;  3PZ8 A;  1NEN B;  2J42 A;  1V97 A;  1E6E B;  2BS4 B;  3AEG B;  1A70 A;  2LMC A;  2WXN A;  4B0E A;  1NYR A;  1TS4 A;  1GTH A;  1YN4 A;  1Y56 A;  1SB3 C;  1E7P B;  1FEH A;  1C77 A;  1VLB A;  4OZC A;  1K53 A;  2M19 A;  3NRZ A;  1ZPS A;  3C8Y A;  4EE2 A;  4P16 A;  2PVO D;  3AE6 B;  1L4Z B;  2PW9 A;  3I9V 1;  4A9A A;  4MAC A;  3Q8F A;  1QIL A;  1T6B X;  4RGO S;  5MPO A;  4LK0 M;  2PMV A;  2V3P A;  1UWX A;  2LHE A;  4B0M A;  5EE0 A;  1MHX A;  4KGT A;  4RGM A;  3O13 A;  3AE4 B;  4AS1 A;  2KN4 A;  3WCQ A;  5BMH A;  1SEB D;  3R8B A;  1BML C;  4DXG A;  1JRO A;  3BYT B;  1XLO A;  4YTN B;  3P4Q B;  2GB1 A;  1JW9 D;  1C9F A;  2EKI A;  2CU3 A;  3W1S A;  4KKJ A;  1TS3 A;  3FAH A;  5BMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...