2WU5B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the E. Coli Succinate:Quinone Oxidoreductase (Sqr) Sdhd His71met Mutant
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 65
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wu5B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wu5B01
3NS1A 1EWYC 2CU3A 4JX1C 1XLQA 2W54A 3HUIA 2WU5B 3NVYA 1VLBA 3VRBB 3HVZA 2FBWB 1SF0A 3WCQA 3AE5B 1JQ4A 2WDQB 1RYJA 2BS3B 3ZYYX 1NEKB 2DBYA 4YTNB 4HRSA 2WS3B 1GAQB 1SB3C 1WXQA 1FFUA 3NRZA 2KAJA 3AEEB 4ZOHC 3SR6A 2QJLA 1KF6B 2B76B 2W3SA 3AV8A 4HROA 3AE6B 2WDVB 1H7XA 1QLBB 3SFEB 4LTUA 2L52A 2PIAA 3P4RB 4C7ZA 2MH7A 1DOIA 1JROA 2MJEA 4ZHOA 4JWSC 1AYFA 1IUEA 1AWDA 1TYGB 3L4PA 2W3RA 2DWQA 2BS2B 5C3JB 1L5PA 1PFDA 1KFYB 1RM6C 2CJNA 4YT0B 1XO3A 1N63A 4KX6B 4YTPB 2M56B 3B9JA 2Y5CA 5EE9A 1TKEA 2WLBA 1N62A 1NENB 2N0SB 1XLPA 3P4QB 3P63A 2WDRB 1OQQA 2H89B 1TJEA 2JX5A 5H8YE 3RPFC 2K22A 1JWBD 3FAHA 1F0ZA 4N6EB 5MPOA 1QOGA 1JWAD 1WRIA 2KMMA 2Q5WD 3CWIA 1WWTA 2M19A 3ETRA 4US8A 1E7PB 4YXDB 1QOFA 1T3QA 3AEAB 2LEKA 2QIEB 1L0VB 1ZUD2 3AEDB 1N5XA 1N5WA 3B2GA 1DGJA 1ZXIA 3AE2B 1NVID 1TKYA 1GT8A 1WYGA 4WWMA 1J7BA 2L83A 5GXGB 1E6EB 4WQMA 3AEGB 2HTME 4YSZB 4JWUC 1FRDA 2WQYB 2MJ3A 1NYQA 5AUIA 3VR8B 4N59A 1PUTA 3PO0A 5C2TB 1WGKA 3AMZA 3P4SB 1FIQA 5AUKA 3VRAB 1FFVA 4A9AA 1FXAA 3W5UB 1E0ZA 2OHFA 3AE4B 3VR9B 1QT9A 5G5HA 1B9RA 1L6UA 3AEBB 3AECB 3CF4A 1OQRA 4US9A 2K9XA 5G5GA 2G1EA 1ZP0B 1V8CA 4ITKA 1QOBA 1FMAD 4ZHPA 1E9MA 1DOYA 2ACZB 1OFFA 1CZPA 1FM0D 1VDVA 1YJJA 1YJIA 2CJOA 3FC4A 3AE9B 3AE1B 1I7HA 1JW9D 3NVWA 1N60A 1ROEA 2PVGC 1J7CA 5H92C 1YQ3B 4USAA 3AB5A 2BS4B 1FO4A 3AE8B 1NI3A 4FXCA 1QF6A 1TKGA 3NVVA 5EE1A 1JRPA 5EE0A 2PKOA 2H88B 1DOXA 2EKIA 1V97A 3P1MA 1FXIA 1GTHA 1N61A 1QOAA 2JQRB 2W55A 3AN1A 1JALA 2BT6A 3BIID 4C80A 1E10A 3SFDB 4N58A 1KRHA 4P6VF 1YQ4B 2K5PA 4IDIA 3DWGC 3AH7A 3AE7B 5EE3A 3AEFB 1PDXA 1VJKA 4YSYB 2WP9B 1H7WA 4YTMB 1J7AA 3B2FA 3LXFA 3W5VB 4C7YA 1CJEA 1GPXA 1GTEA 1SIJA 3AM9A 3LB8C 1L6VA 2AX5A 1XLNA 1XLOA 1A70A 3P4PB 3KWLA 3DWMA 2WU2B 1R7SA 4YSXB 2PVOD 3EUB2 1NYRA 1RWSA 3AE3B 3CIRB 3HRDD 3NVZA 1FRRA 3ABVB 1RFKA 1ZOYB 3W9CB 1UWMA 2E3TA 2MJDA
chains in the Genus database with same CATH superfamily
2PPHA 2KQ4X 2KJRA 2AYOB 5CHVC 4HPPA 3AE5B 4E74A 1WGGA 1TS3A 1FPYA 2XK5B 3AE6B 2KQSA 3DBHB 4JLCA 4PYZA 3O65B 1E8XA 3N32A 1TYGB 2MBOA 3ML9A 4ICVA 5IAAC 4I6NB 2QDFA 2V3PA 2DWQA 2DAJA 5C3JB 4L2YA 1I42A 2EMTA 3UINB 1D3ZA 4A55A 1TJEA 2JX5A 3QC8B 5MPOA 3ZJVA 1C4CA 4ANXA 2FUHB 3T3NA 4QAYA 3ZW3A 3KW5B 2KC1A 3EFUA 1F52A 2K0PA 2K6DB 3RCZA 5FR3A 3KH0A 1T0QC 5GXGB 1GC7A 3WA0A 1EU4A 2KC2A 2BVCA 1VZ6A 5C2TB 2D3AA 3ZUNA 3W1SC 1ZW7A 1FXAA 2HJ1A 3EECA 2LHDA 4HPLB 2EMSA 4RFBA 3UIOB 5DPWA 1AARA 2KD0A 2WXQA 4AP4C 4FHJA 3A1QB 2KOXA 4DXFA 2PW9A 2C60A 4DHZE 3VH3B 3IT6B 2INNE 2MBEA 4RF1A 5HG2A 4C56C 1F77A 1OGWA 2K8HA 4OZCA 3ZGZA 5CHFA 1V49A 1WZ3A 1WZ0A 2KMCA 3Q3JA 2KHWB 3DWMA 4GSWA 1R4MB 1PYWD 4NJ7A 2CU3A 4HKZE 4JX1C 3V62A 4MGYE 4JIOU 3B08A 4GOCA 3Q3OC 2D5GA 2BS3B 4E71A 4CYEA 4ARCA 1P7FA 1FFUA 3N1XC 2KAJA 1WSPA 2B76B 2YEPB 3ZDMC 4W9KA 2C7HA 2L52A 2IYDB 2BYTA 4ANUA 1AWDA 2V4IB 1PFDA 2KWVB 1N63A 2VZKD 5JXVA 1Q10A 4RF0A 2V3NA 1HZ5A 2RDHA 3CF6E 1IBXA 1C1YB 5AZHA 3R3MA 4PT5A 1E7PB 3R2TA 4RGMA 3URYA 2GI9A 3MJWA 2LEKA 2R61A 2RGFA 2AQ1B 1YX6B 1QQRA 5E6JA 4LJOB 2BTEA 4JWUC 2IDYA 1XD3B 2KLCA 3TEZA 4K7WA 3AMZA 3IVFA 1FIQA 1WXMA 1WY8A 4K3BA 4KKIA 1ZXHA 4GDLB 5TR5A 3HM6X 1QT9A 2JXTA 4TMAB 3V05A 4MSMB 2N4FA 4B6WA 1FM0D 3E56A 1I7HA 1JW9D 3L10B 2GBJA 4RM9A 1ET6A 1VD2A 1QF6A 1JRPA 3R8BA 1DOXA 2O2VB 2BW2A 3L0WB 1KLGD 2NMQA 1GC6A 1L0YB 3VUXA 2G3QB 4MJSA 2WYQA 4MDKE 4HWIB 4YSYB 1H7WA 3FILA 2MCNB 3J9CA 3AM9A 2KTRA 1I4XA 3BVGA 1FD6A 2W9NA 2LHEA 1XXGA 3D32A 3HUIA 2LZ6A 1T0RC 1WM3A 2WDTB 4HCPB 3PREA 1WXQA 1SB3C 4ZOHC 4CO7A 4OW0A 1WX8A 5IO9A 4E3CA 1LO5D 1WYWB 4WJNA 5IP4D 3B9JA 4GDLA 1JWSD 4MH0E 2LGXA 4NQKE 1R4MI 4RH6A 5H8YE 3A9KB 4D2KA 4W9FA 4RMAA 3KYDD 3AI5A 2JU6X 3DBLI 3GS2A 4BKGA 1J7BA 3WAOA 2K6QA 4MEMA 2KJ6A 4XGAB 3R7RA 2MQJA 1HA5A 2BKRB 3ZNHB 5AUKA 2RPQA 2DENB 2QMTA 4HVBA 1DYQA 4LCDE 3PGEA 3DPDA 5C23A 1V8CA 1WXAA 2KDIA 1OFFA 2KO3A 2FAZA 2EELA 2G45B 4IW0A 3NZUA 3NVWA 1ZPSA 3AE8B 4TV3A 5EE1A 3BYTB 4GU2A 5KHQA 4OVVA 5AZFA 4JE3B 3DCGA 2L0FA 2LVPA 4W9IA 3HHMA 3AU4A 2IY0B 1YQ4B 2FCQA 2L76A 2KVRA 3W5VB 4K1RB 4GDKB 1EF1A 1R7SA 3IAS1 3X23A 3PLVA 2J7QB 2DZJA 1RAXA 2JPHA 1K8RB 1X1MA 1E90A 4KIKA 2JT4B 4OZBA 2A5UA 4REZA 4YTNB 5BYSA 1GAQB 1D5MC 2X8XX 2IJ0A 3A1QA 4HROA 4YL8A 2WDVB 3H1UA 1JMLA 3R2IA 1V80A 1IGDA 5T8IA 4JWSC 5J17A 4WURA 2TSSA 2GBNA 3DVGY 1GUAB 4LNFA 2L7RA 3P63A 2KX0A 2H89B 2UYZB 4R3DA 2NTSA 3RI7C 1JWAD 1UF0A 2PJHA 1F1HA 2KDMA 2NS5A 1SJED 4KIKB 3ZQ4A 4JQWC 2YLMA 3ONSA 3ZJTA 2JZZA 3KUDB 4WAFA 3PO0A 4A90A 2K1FA 3T8MA 2O6VD 1WF9A 4JPSA 3VRAB 2XN9C 3VR9B 1SXTA 2HTHA 3AECB 2N7JA 2J53A 1T0YA 5CX3A 4MACA 3HK0A 2ZPYA 3N1YC 3FC4A 5E6NA 1FXTB 3QK0A 2ZVOA 3WANA 2LGYA 1CK1A 1WX9A 3QARA 1QOAA 4ZRIA 5BO4B 2GMIC 2GOWA 4GLSC 3AE7B 4W9HA 2WXHA 3Q2AC 1NI2A 3PV1A 4LJPB 1LFDA 1R4NB 3L17A 3I9V1 1XLNA 2KK8A 2KQ7A 2NBWB 2GLSA 1SE9A 2HDEA 4Q2JA 3NOBA 1UD7A 2MW5A 1LQBA 3OLMD 3BZDB 2WU5B 1BT0A 3VH4B 3AULA 2KX3A 1Y56A 2DZKA 3A4SC 1XCTL 2W3SA 2KDFB 4IC7B 3RNGC 2HE7A 3V6EB 4GN1A 2DZIA 3N9YC 4GIVA 2BS2B 3JW0X 1L5PA 1HQRD 3IT4B 3ZRCA 3VTUA 2BYEA 5IA7A 2JVCA 2WNMA 2D10A 2LXCA 2RD0A 3RPFC 2C9WB 1F0ZA 1GB4A 4MGIE 3Q3NC 2OJRA 2KTFA 2IZVB 1K51A 2IGDA 2MWSB 2LUMA 3PRPB 5LXHA 2LGSA 4K7UA 2L05A 2O6VB 2ZW0A 2ZNVC 3OJ3A 3K9OB 4G0NB 5BMIA 2JZ3B 1NYQA 2BYVE 4HEA1 4JL9A 2KYWA 3Q8FA 2K8CA 4BKSD 2J42A 2OOBB 2MP2B 1BUIC 3A4RA 4TQ1A 5D7GA 2ACZB 1CZPA 2G4DB 1AW7A 2VZKB 3TSSA 5LNK1 1TS4A 3BK2A 4M00A 3ZNID 3P2BA 1NI3A 2AL6A 5EDSA 1J0GA 3DHIC 3IAM1 3RT3B 1GB1A 2KANA 2HJ8A 1V1PA 2K5PA 3UF8A 5EE3A 1PDXA 2M4NA 3BYYB 1CJEA 1TS5A 1STEA 3S2AA 5FR6A 4IUMB 4LK0M 1ZOYB 2KWDA 4AUQC 3PRMB 1KTKA 3PRZA 3UIPB 1N6ZA 3AEEB 1IBXB 2LD9A 1KF6B 4GDKA 3Q6BA 1HE8A 2I38A 2LI5A 2IY1B 2MJEA 1IUEA 4RGTA 3TBLD 1R4NI 2XNAC 3RZFA 1C4PA 4DHJD 5CHWA 2GBMA 2K22A 4K81A 3PTFC 1UH6A 4NQLB 2FNJB 2Z0EB 3RZWC 3VTWA 1MJDA 2MLBA 4IM0A 2AEHA 1UUPA 5D6JB 3BINA 2AQ2B 4GXBA 5AUIA 4TUUA 1M94A 1F9JA 2D3GA 3W5UB 2QC8A 2V0GA 4J6IA 4XYCA 1OQRA 4BKTA 4ZHPA 4NNJB 3AE1B 2INPE 2KTRB 1ROEA 2CHWA 2MP2A 3PHXB 1C78A 2RR9A 5BMHA 5C1ZA 1ET9A 3JVZX 2KWCA 1GTHA 2BB6A 3MC0B 4P16A 4M0WA 3RMKC 4X57B 5IOIA 3V61A 3VQIA 4IDIA 2PE6B 3OAWA 3Q3MC 4IOIE 3LB8C 4EZKA 3H8HA 2B3AA 3HRDD 3Q8BA 2I1KA 4XX5A 2ZVNA 5BMGA 3KUCB 1TS2A 4II3B 1NDDA 5G55A 2M8SA 4IWPA 3KUZA 1ZKHA 3QX1A 3ZJUA 1M4VA 1VRAB 1HZ6A 2NCNA 4ARIA 3NUHB 2M17A 3PVLA 1K53A 3ZNGC 2WXKA 1XO3A 4PS8A 4WAAA 1HEZE 1GOZA 1TZOA 1GJZA 1N62A 2D11A 2JXXA 1VCBA 1WJ6A 1U4AA 2NVUI 1EUVB 3RFZB 2Q5WD 2M19A 2WHIA 4NZLB 1S3SG 1V81A 1TBEA 2WGSA 2Y3AA 3A33B 3SDLC 1KH0A 4AOFA 3GP7A 1WYGA 1PGAA 3WAPA 4J3OD 3ZXVA 4HK2A 1BMLC 4KGTA 3LJ3A 2FIFA 3OG5A 2M0XA 2J4XA 1WE6A 1FCLA 3M63B 3IXSA 1FMAD 1V5TA 1E9MA 4XWWA 5GMVA 3AE9B 2WXFA 1K52A 4WWNA 3T3OA 4MH8A 2D2QA 1B1ZA 3VXWA 1TKGA 2ICIA 3KQ4A 1VR9A 3PSEB 4GMVA 3MTNB 3P1MA 2INDC 2CHZA 5JH5C 2YVCA 4ANVA 3UQAA 2RDBC 4HDOA 4S17A 4B95A 4M01A 3U2SC 4YSXB 5BYQA 3AE3B 1H8CA 1FRRA 2R2OA 4DWFA 2E3TA 1EWYC 2L32A 2FBWB 5JHBA 2ZCCA 2N9KA 3WAMA 3AXCA 4W9LA 4WWPA 1KLUD 2FIDA 3DBSA 3P4RB 1G6JA 3LYYA 3ML8A 3L4PA 4M8NA 4ZRQA 1JWMD 2BGFA 3GB1A 1TKEA 5L83A 1EO6A 4F8CB 1WGDA 2LMCA 3QAQA 3CSTA 4MELA 1P98A 3CSFA 1WRIA 3UQBA 1D6EC 1K50A 3KWVA 4L23A 3AEDB 3U30A 1RLFA 2I1JA 3PS6A 1H4RA 2K8BA 2WXOA 1YD8U 3L54A 4EKUA 2WXPA 3Q14C 3EA6A 1MG8A 4WJQA 3BY4B 4ZDVA 2JYEA 1E7VA 3V3XA 4FADA 2ZW1A 4MGZE 4US9A 4AWJA 4ITKA 2BF8B 2L3ZA 2REXA 3Q69A 1N60A 1BXTA 3DVGX 1ZE3D 3VUWA 3EFCA 3Q8EA 1LGRA 4LDTD 2Y5PA 4WH4A 5DPSA 5EE0A 4PK1A 3EC8A 2LGIA 3VVWB 3R66C 4C80A 5CTRC 4GGQA 1V86A 1LXDA 2N1WA 3GE8C 2MBHA 1WGRA 3M3JA 1L6VA 4BOZB 2MHJA 2LUEA 2XK5A 2JRIB 4TSSA 3NG0A 3DBRB 3TMPB 1SIFA 4EZJA 1LM8B 2N9PC 4NJ6A 4II2B 1WRDB 3HVZA 3Q8AA 1WFYA 2WDQB 1NEKB 1MHXA 1UBIA 3GZNB 2C5LC 2KMAA 4OVZA 3TEYA 1F2RI 4FA6A 3SFEB 2FCSA 4ZHOA 2NBUA 4A8XC 1KFYB 4MM3B 2Y5CA 2BWES 1V6EA 3NZ3A 4G11A 2UU7A 3UGBB 5D94A 4KDLB 2KMMA 1MHHE 4IKGA 5AEKB 2QIEB 2IPKD 1ZUD2 3B2GA 1NVID 1WE7A 2QCZA 3AEGB 1HTQA 5G2NA 2WQYB 4OHJA 3VR8B 1KM7A 4XC2A 1V2YA 3RULA 5JZEB 4A9AA 1L0XB 2N9LA 2BQQA 2JY6A 2BB5A 1B9RA 3AEBB 1L2NA 3DOWA 1C79A 1ZP0B 2ZCBA 1T6BX 4EFOA 1XF5L 1YQBA 1VDVA 4KZCA 1J7CA 4DXGA 2NBVB 3K9PB 3Q8CA 2FE8A 1CMXB 3KLSX 4NAWB 3N20C 1E10A 4WJOA 1E5WA 2IGHA 4RGNA 3DWGC 4ZYNA 3ZVVA 2WP9B 4PS7A 1J7AA 4TKNA 3APFA 3QWZB 4KSLC 1QZEA 2KFKA 1NYRA 2LJIA 1I4RA 2ZEQA 1E7UA 1VLBA 3L08A 2DZMA 5FK9C 2W82A 1JQ4A 1EU3A 1UNSA 2DBYA 1V1PB 1UGJA 3M95A 4W9EA 1YN4A 1H7XA 4YWGG 2HD5B 2WX0A 3OWEB 1JROA 1Z5SB 2IO2B 3U7DA 2JWUA 5JHAA 2ZNVB 3R7QA 4EEWA 2BBCA 2N9EB 4YTPB 1MFWA 2DYOA 2ON8A 4BFRA 4N6EB 2NR2A 2JWZA 3QJZA 4CQNA 2CKHB 4XE0A 1DGJA 1ZXIA 1GT8A 1OQYA 1PGBA 4JGHB 4HDQA 4YSZB 2Z8LA 2KVZA 1ISNA 3IBEA 1L7YA 1YN5A 3NZSA 3RYTA 2MX2A 3H7PB 2JRHA 5G5HA 1TGZB 2D3BA 5G5GA 2KACA 1C3TA 1NBFC 1VZ8A 3A9JA 2ZZPB 1PQSA 1ENFA 1ACCA 4USAA 2L1AA 1P7EA 3MC8A 1E8YA 3RD2A 2JQRB 1N61A 3WALA 2CHXA 4UDUC 4LNOA 2V9HA 3QIJA 4RM8A 4RGOS 3DBLB 3HVDA 4W9GA 4BVUC 3DDCB 3ECIA 2PE9A 5IKCM 3LXFA 1I35A 2DNFA 4GB9A 4MT5A 3IG3A 3PLUA 4K7SA 3VTVA 2PVOD 3NVZA 3AN1A 1J8CA 2MJDA 3WCQA 2KXJA 4BKSA 3ZKJC 3LDZE 3ZYYX 3SEBA 4WIPA 2WXIA 2BPSA 3WIMA 1OEYA 3AV8A 3PZ8A 3RNAC 1YX5B 2ASQA 1DOIA 2JZPA 2CS4A 3TJPA 2W3RA 5DPRA 3UI3A 2RDGA 1NENB 3P4QB 3FAHA 1SSNA 2N1VA 3CWIA 1XEEA 2BYFA 4WJPA 2C7MB 2K25A 4US8A 1WH3A 2D07B 1P0RA 1N5XA 3AE2B 2HTME 4A3OA 4EZLA 3BVZA 3NJTA 2MSED 3NY5A 1YMHE 2XEWA 1HTOA 1E8WA 2KN4A 3CF4A 1WXVA 3QCAA 2LXAA 2LVOA 3GZNI 2CJOA 2L00B 4MM3A 2V4LA 1I4QA 3AB5A 2H88B 2RPVA 3A9JB 4FLHA 2KLGA 1JALA 1SE4A 2QHOA 1EM7A 3ZIMA 3E9SA 3ZO5B 2Z0DB 4C4VB 4FHKA 3ALBA 4B9KA 4RCOA 3TL5A 1L4DB 4W9DA 3ABVB 2IGGA 1RFKA 3DBHI 3TEXA 1WJUA 4BOSC 2JUOA 3PZ7A 4NAWA 1SF0A 4XDCA 1C77A 3DHHC 3L16A 1RYJA 4DHJB 4KGSA 2LWPA 4I6LB 4PS3A 3VUYA 4G50A 4NY0A 4DK5A 2XBBC 2MH7A 4LNKA 2WXLA 1TY2A 2YEPF 3SD5A 3B1LX 2M56B 3V6CB 2BWFA 1MPEA 3DBRI 2N0SB 3PZDA 5J18A 4FN2A 3W1YA 1QKZA 4ASWC 1WWTA 1EF5A 2KDEB 4YXDB 1EWCA 2K39A 4BBNC 1QOFA 2BKFA 1GNUA 4XZ4A 4BAXA 3ZTCA 1A5RA 4F1SA 2ZJDA 4IWOA 3U7ZA 3CMMB 1FRDA 4KKJA 1IPGA 4PYUA 1JCKB 1AN8A 4MSQB 4L1BA 4C4VA 2RSUA 3APDA 1L6UA 3U52E 3A9KA 2KJHB 1WMHB 4ACFA 1Q0WB 2CR5A 1YJJA 1YOVB 2KFJA 1I4GA 4A20A 1ZDVA 5H92C 3DVNV 4OVUA 4M0WB 1VZ7A 2NPTB 5FKAC 1WR1A 5E6OA 1WI0A 4DXAB 2WWZA 1UGMA 1UZXB 5BYRA 5J2RA 4NPNA 3BVMA 2MRPA 2LRUA 1PGXA 1IYFA 2I2YA 4F7ZA 2ONQA 3B2FA 4AQ7A 2LJ5A 1XLOA 4C00A 3ZTDA 1UWMA 1OEYJ 1UBQA 1J19A 3NVYA 3MP9A 4ZRPA 2OJWA 2WS3B 4MJSB 1T0SC 1YJ1A 2DYBA 4A6QA 3RNCC 3MJ5A 1WM2A 4DQOC 3U4EG 2KNBA 1XCQL 1RFAA 4HJKA 3BWUD 1FCCC 4KX6B 2WXJA 2PEAA 2MA9B 2FUG1 2QILA 1FEHA 4WWOA 1OQQA 3C19A 1JWBD 5AZGA 3M62B 5IN7A 3GOEA 4LNNA 1WIAA 3H6NA 5L95C 1L0VB 3V60A 2J52A 5TSSA 1TKYA 2L83A 1E6EB 2M0AA 3X0WA 4KDIC 4G3XB 4N59A 2N9XA 3HM3A 1CQVA 3AU5A 1E0ZA 2OHFA 4M8MA 2LASA 2SEBD 4N9F4 1YJIA 2KT7A 4FULA 1SBBB 2BS4B 3H7PA 3SHQA 1ESFA 4NJCA 1C9FA 1YNTE 2BT6A 1TTNA 4ZYSA 1UWXA 2LVQA 2LRWA 3AH7A 4ANWA 3TEWA 2ZPNA 4DBGA 1GPXA 2O2VA 1SIJA 2Y5BB 4EUTA 2AX5A 2WU2B 3EUB2 3MFGA 2DHZA 1TT5B 2C7NB 1D5XC 2L0TA 3QQ8B 3IHPC 1SEBD 5LXIB 3ZXRA 1KLVA 3VFKA 3N1ZC 4XWTA 4LLGM 2QJLA 2UWQA 3DQVA 3I5JC 2MBBB 1QLBB 2PIAA 4C7ZA 1D5ZC 1AYFA 1T5XD 2V3SA 3I3TB 2CU1A 2G9HD 2CJNA 4WQOB 3VHTC 1RRBA 2PLPA 2EKEC 3ETRA 2IO0B 3PT2B 2WXNA 2PTLA 1P9DU 3O13A 4WQMA 3APCA 1F2RC 2L8JA 1E8ZA 2MBQA 3W1SA 1YN3A 3P4SB 1C76A 4IM3A 2GBKA 4HPMB 1Q1OA 2IO3B 3N3KB 2MEKA 4BZAA 4ZRJA 3T9LA 3SU8X 2VRRB 4FJYA 1C4AA 2G1EA 2Z59B 3FILB 1SE2A 3VAWA 4IWQA 2GRIA 2PVGC 1YQ3B 4KZ0A 1FO4A 3U8ZA 4FXCA 2QEJC 1WJNA 2J0KA 1V97A 1WR6E 1V9JA 2GB1A 1V5OA 3SFDB 4KSKC 1VJKA 2VH1A 4DDID 3ENEA 1GTEA 2N7EA 3ZNZB 3ZDTA 3KWLA 2JSVX 3P4PB 5D3IB 3CIRB 4B0EA 5KHOA 2JYTA 3W9CB 1XQQA 3N30A 3QHTA 5HKHA 3BK1A 3NS1A 4XDDA 3VRBB 2KWUB 4OZAA 1WMHA 3I57A 2AWTA 3KVFB 3MC9A 3NRZA 1XT9B 1KOTA 2K3UA 3H9DA 4ICUA 2FCNA 2N7DA 3TCAA 4AJWA 3RNFC 4LTUA 4W9CA 3NHEB 1MG4A 4BBNF 3RNEC 3VDZA 3RN9C 2J0MA 1FNWA 2RMMA 5EE9A 1KJTA 2LGDA 2WLBA 3W2DA 4HLEA 4FJZA 1P3QU 2J0JA 4HXDA 4DDGD 2DLBA 2R2QA 2DYMA 1T3QA 1FNVA 1SE3A 3AEAB 1Y8RC 2DAFA 3HIZA 4KGRA 3NS8A 5I4DA 1WGYA 1GG3A 2MJ3A 3MHZA 4EOYA 2INCC 2PMVA 3AE4B 2LFIA 2GBRA 2E6XA 1IP9A 2K9XA 4KVGB 1QILA 1YIWA 4MGKE 2O6VA 3EHVA 3NVVA 3TUOA 3DVNU 2WXMA 2OEDA 2PKOA 3JYUA 5HI1A 2VH2A 1FXIA 4W9JA 2NTTA 1FNUA 4N58A 2SAKA 4P1CC 1TY0A 3H7SA 4P6VF 2FCMA 2AL3A 2KFKB 3AEFB 2G4SA 3L13A 5D3DA 2KDBA 3PPAA 1D4BA 1MI0A 4FBJB 3ZLZA 3RNBC 3KYCD 1RWSA 2IO1B 3B0AA 1WGHA 3Q3FA 1SJHD 3OJ4B 4S0RA 1XLQA 2W54A 1JWUD 1MVKA 5HFYA 4B0MA 2KKCA 5D2MB 3I63C 2KZRA 3TIXA 1SGHA 1HXYD 1ZGUB 1I4HA 4HRSA 3SR6A 1TIFA 2IBIB 4EE2A 2AQ3B 3MHSD 4HCNB 4AS1A 2M1MA 4LNIA 3QA8A 3RUIB 2QSDA 2D3CA 3DHGC 1RM6C 2KN5A 4YT0B 5HHDG 3JSVB 4AJYB 5E6PA 4CHKA 2JF5A 1XLPA 2WDRB 3GE3C 1P1AA 2NPTA 3FKYA 1QOGA 4M02A 4DHZB 1V1OA 2A4ZA 4KV2A 3IFWB 4IG7B 4HKQA 4P1BC 4LDTB 2WXRA 4I6PA 1N5WA 3JSVA 4WWMA 5DCNA 4FJVB 4TQ0A 3C0RB 3ZRFA 1WX7A 1S1QB 1PUTA 1WGKA 4HJGE 1FFVA 1WJ4A 4IM2A 1I4PA 4ZRKA 2WXGA 1QOBA 1DOYA 2WX1A 4A3PA 1TZ1A 4URKA 4NAMA 2X38A 1UELA 1WXSA 5LLIA 1Q5WB 2DX5B 2EKIA 2W55A 4H2AA 3BIID 1Z2MA 3EGRA 1KRHA 2V1YA 1OTRB 3C8YA 1L4ZB 4YTMB 4RNAA 4O1NA 4C7YA 1ZDXA 1A70A 1JRUA 1IGCA 3P42A 5DPTA 4P7IA 3PHWB 4K3CA
chains in the Genus database with same CATH topology
2KQ4X 3BZDB 3NVYA 2WU5B 3MP9A 3HVZA 3Q8AA 3AE5B 4ZRPA 2WDQB 1NEKB 2WS3B 1Y56A 1MHXA 1TS3A 4OVZA 1XCTL 2W3SA 3TEYA 1F2RI 3AE6B 4A6QA 3SFEB 3MJ5A 4ZHOA 1TYGB 3N9YC 4DQOC 2V3PA 2DWQA 2BS2B 3U4EG 4A8XC 5C3JB 1L5PA 1HQRD 1KFYB 1XCQL 3IT4B 4MM3B 3BWUD 1FCCC 4KX6B 2Y5CA 4L2YA 2WXJA 2WNMA 2FUG1 3NZ3A 2QILA 1FEHA 1OQQA 4A55A 1TJEA 2JX5A 3RPFC 1JWBD 1F0ZA 1GB4A 5MPOA 3ZJVA 1C4CA 2KMMA 1MHHE 3T3NA 1K51A 2IGDA 4IKGA 2LUMA 2K0PA 2QIEB 2IPKD 1L0VB 1ZUD2 5FR3A 3B2GA 2J52A 1NVID 5GXGB 1TKYA 5TSSA 2L83A 2ZW0A 1EU4A 1E6EB 3AEGB 2M0AA 5BMIA 2WQYB 1NYQA 1VZ6A 3VR8B 4OHJA 4N59A 4HEA1 5C2TB 3Q8FA 1CQVA 4A9AA 1FXAA 1L0XB 1E0ZA 2OHFA 2J42A 2N9LA 2LHDA 4RFBA 2BB5A 1BUIC 1B9RA 3AEBB 1C79A 4TQ1A 1ZP0B 1T6BX 5D7GA 1XF5L 2ACZB 1CZPA 2SEBD 1VDVA 2WXQA 1YJIA 1AW7A 2VZKB 3TSSA 5LNK1 1TS4A 3BK2A 1J7CA 1SBBB 4DXFA 2BS4B 4DXGA 1NI3A 1ESFA 3Q8CA 4NJCA 2PW9A 1C9FA 1YNTE 2FE8A 3KLSX 4NAWB 3IAM1 3IT6B 1GB1A 2INNE 2BT6A 1E10A 2IGHA 4RF1A 5HG2A 4C56C 1F77A 4RGNA 4ZYSA 1V1PA 1UWXA 2K5PA 4OZCA 3DWGC 3AH7A 5EE3A 3ZGZA 1PDXA 3BYYB 2WP9B 1J7AA 3TEWA 1CJEA 1GPXA 1SIJA 1TS5A 1STEA 2AX5A 3DWMA 2WU2B 3EUB2 1NYRA 3MFGA 1PYWD 2LJIA 1D5XC 1I4RA 4LK0M 1ZOYB 2KWDA 2CU3A 4HKZE 4JX1C 1VLBA 1SEBD 1KTKA 5FK9C 2W82A 1JQ4A 1EU3A 2BS3B 2D5GA 1UNSA 2DBYA 4ARCA 1V1PB 1P7FA 1FFUA 4XWTA 4LLGM 2KAJA 3AEEB 1WSPA 2QJLA 1IBXB 1UGJA 1KF6B 2B76B 1YN4A 2YEPB 1H7XA 1QLBB 4YWGG 2I38A 2L52A 2PIAA 4C7ZA 1D5ZC 2MJEA 1JROA 3OWEB 2BYTA 1AYFA 1IUEA 1AWDA 1T5XD 4RGTA 2G9HD 2JWUA 2V4IB 1PFDA 2CJNA 2BBCA 2XNAC 1N63A 4YTPB 2VZKD 1C4PA 5JXVA 1Q10A 2DYOA 2ON8A 2K22A 2PLPA 4RF0A 2V3NA 4N6EB 1HZ5A 2RDHA 1IBXA 4CQNA 3ETRA 4PT5A 1E7PB 3R2TA 4RGMA 3URYA 2WXNA 2GI9A 2LEKA 2PTLA 2R61A 1UUPA 4XE0A 1DGJA 1ZXIA 1GT8A 2AQ1B 3O13A 1PGBA 1QQRA 4WQMA 2AQ2B 5E6JA 2BTEA 4YSZB 4JWUC 2Z8LA 2IDYA 1F2RC 5AUIA 3TEZA 3W1SA 3AMZA 1YN3A 3P4SB 1C76A 1FIQA 1YN5A 1ZXHA 4KKIA 3W5UB 4GDLB 2V0GA 2MEKA 1QT9A 5G5HA 1OQRA 1C4AA 2JXTA 4TMAB 2G1EA 5G5GA 3V05A 2KACA 4ZHPA 3FILB 1FM0D 1VZ8A 1SE2A 3E56A 3AE1B 2INPE 1I7HA 1ENFA 1JW9D 1ACCA 1ROEA 2GRIA 2PVGC 1YQ3B 4USAA 2L1AA 1FO4A 1P7EA 1ET6A 4FXCA 1QF6A 1C78A 1JRPA 5BMHA 3R8BA 1ET9A 2QEJC 1DOXA 1V97A 2JQRB 1GTHA 1N61A 2BB6A 2GB1A 3MC0B 4UDUC 2BW2A 4P16A 1KLGD 2NMQA 1L0YB 4M0WA 3SFDB 4RGOS 3HVDA 3VQIA 4IDIA 1VJKA 4YSYB 1H7WA 3FILA 3J9CA 3LXFA 4IOIE 1GTEA 3AM9A 3LB8C 4MT5A 3H8HA 2JSVX 3KWLA 3P4PB 1I4XA 3HRDD 2PVOD 3Q8BA 3NVZA 3BVGA 5D3IB 3CIRB 4B0EA 2JYTA 3W9CB 2LHEA 3AN1A 5BMGA 2MJDA 3BK1A 1TS2A 3NS1A 1XXGA 4XDDA 3HUIA 3WCQA 3VRBB 4OZAA 3ZJUA 3I57A 3ZYYX 1M4VA 1VRAB 3SEBA 4WIPA 1WXQA 1SB3C 2WXIA 3NRZA 4ZOHC 1HZ6A 2K3UA 3AV8A 4OW0A 3PZ8A 4ARIA 1LO5D 4LTUA 1DOIA 2JZPA 3NUHB 2W3RA 1K53A 1FNWA 2RMMA 2RDGA 2WXKA 3UI3A 1XO3A 5EE9A 3B9JA 1HEZE 1JWSD 1GOZA 2WLBA 1TZOA 3W2DA 1N62A 1NENB 3P4QB 4RH6A 5H8YE 3FAHA 4D2KA 1SSNA 3RFZB 2Q5WD 3CWIA 1XEEA 4US8A 2M19A 4NZLB 2DLBA 2DYMA 1T3QA 1FNVA 2JU6X 1SE3A 3AEAB 2Y3AA 1N5XA 1KH0A 3AE2B 1WYGA 1PGAA 3GP7A 3GS2A 1J7BA 4J3OD 4KGRA 2HTME 1BMLC 5I4DA 3BVZA 4KGTA 2MJ3A 3MHZA 1HA5A 1YMHE 5AUKA 2J4XA 2PMVA 3AE4B 2KN4A 2QMTA 1FCLA 1DYQA 2LFIA 2E6XA 3CF4A 2K9XA 3IXSA 1V8CA 1FMAD 1E9MA 1OFFA 1QILA 2CJOA 4XWWA 3AE9B 2EELA 2WXFA 1K52A 3NVWA 1ZPSA 3T3OA 4MH8A 1I4QA 3AB5A 3AE8B 1B1ZA 1TKGA 3NVVA 5EE1A 3BYTB 2ICIA 2WXMA 3TUOA 2OEDA 2PKOA 2H88B 3KQ4A 5HI1A 1VR9A 2RPVA 3P1MA 1FXIA 4JE3B 2NTTA 1JALA 1FNUA 1SE4A 4N58A 2SAKA 1EM7A 1TY0A 3E9SA 4P6VF 1YQ4B 5D3DA 3AEFB 3W5VB 4RCOA 1D4BA 1MI0A 4GDKB 3U2SC 1R7SA 4YSXB 3IAS1 5BYQA 1L4DB 3AE3B 1RWSA 1FRRA 3ABVB 2IGGA 1SJHD 1RFKA 2E3TA 3TEXA 1EWYC 1XLQA 2W54A 1JWUD 1MVKA 5HFYA 4B0MA 3PZ7A 2L32A 2FBWB 1SF0A 4XDCA 1C77A 4OZBA 2N9KA 1HXYD 1RYJA 1I4HA 4REZA 4YTNB 4HRSA 1GAQB 5BYSA 1D5MC 3SR6A 2IJ0A 4KGSA 4EE2A 1KLUD 4HROA 2AQ3B 2WDVB 4AS1A 1JMLA 3R2IA 1IGDA 5T8IA 3P4RB 2MH7A 4JWSC 3LYYA 4WURA 3L4PA 2WXLA 4ZRQA 2QSDA 1TY2A 2YEPF 2TSSA 1RM6C 4YT0B 1JWMD 2M56B 3GB1A 5HHDG 1MPEA 1TKEA 2N0SB 1XLPA 2LMCA 3P63A 2WDRB 2H89B 4R3DA 2NTSA 1QOGA 1JWAD 1WRIA 1QKZA 1WWTA 1V1OA 1D6EC 4YXDB 1EWCA 2KDMA 1K50A 4HKQA 1QOFA 3KWVA 4L23A 2WXRA 1SJED 3AEDB 3ZQ4A 1N5WA 4WWMA 3U7ZA 2WXOA 3ZJTA 2WXPA 1FRDA 4KKJA 4TQ0A 3EA6A 4WAFA 1PUTA 3PO0A 1WGKA 4A90A 4HJGE 4JPSA 3VRAB 2XN9C 1FFVA 1JCKB 2JYEA 1AN8A 4L1BA 3V3XA 2ZW1A 3VR9B 1I4PA 1SXTA 1L6UA 3AECB 2N7JA 3U52E 4US9A 2J53A 2WXGA 4ITKA 1QOBA 1DOYA 4MACA 1YJJA 4NAMA 3FC4A 1I4GA 2X38A 1N60A 1BXTA 3Q69A 1ZDVA 5H92C 1ZE3D 3Q8EA 4WH4A 2Y5PA 5EE0A 1CK1A 1VZ7A 5FKAC 2EKIA 2W55A 1QOAA 2LGIA 4H2AA 3BIID 4C80A 5BYRA 3EGRA 1KRHA 3BVMA 1PGXA 4GLSC 3AE7B 2WXHA 2I2YA 3C8YA 1L4ZB 4YTMB 4RNAA 2ONQA 3B2FA 4O1NA 4C7YA 4AQ7A 1ZDXA 1L6VA 3I9V1 1XLNA 1XLOA 1A70A 4TSSA 2HDEA 4Q2JA 1IGCA 3P42A 1UWMA 1FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NS1 A;  1EWY C;  2CU3 A;  4JX1 C;  1XLQ A;  2W54 A;  3HUI A;  2WU5 B;  3NVY A;  1VLB A;  3VRB B;  3HVZ A;  2FBW B;  1SF0 A;  3WCQ A;  3AE5 B;  1JQ4 A;  2WDQ B;  1RYJ A;  2BS3 B;  3ZYY X;  1NEK B;  2DBY A;  4YTN B;  4HRS A;  2WS3 B;  1GAQ B;  1SB3 C;  1WXQ A;  1FFU A;  3NRZ A;  2KAJ A;  3AEE B;  4ZOH C;  3SR6 A;  2QJL A;  1KF6 B;  2B76 B;  2W3S A;  3AV8 A;  4HRO A;  3AE6 B;  2WDV B;  1H7X A;  1QLB B;  3SFE B;  4LTU A;  2L52 A;  2PIA A;  3P4R B;  4C7Z A;  2MH7 A;  1DOI A;  1JRO A;  2MJE A;  4ZHO A;  4JWS C;  1AYF A;  1IUE A;  1AWD A;  1TYG B;  3L4P A;  2W3R A;  2DWQ A;  2BS2 B;  5C3J B;  1L5P A;  1PFD A;  1KFY B;  1RM6 C;  2CJN A;  4YT0 B;  1XO3 A;  1N63 A;  4KX6 B;  4YTP B;  2M56 B;  3B9J A;  2Y5C A;  5EE9 A;  1TKE A;  2WLB A;  1N62 A;  1NEN B;  2N0S B;  1XLP A;  3P4Q B;  3P63 A;  2WDR B;  1OQQ A;  2H89 B;  1TJE A;  2JX5 A;  5H8Y E;  3RPF C;  2K22 A;  1JWB D;  3FAH A;  1F0Z A;  4N6E B;  5MPO A;  1QOG A;  1JWA D;  1WRI A;  2KMM A;  2Q5W D;  3CWI A;  1WWT A;  2M19 A;  3ETR A;  4US8 A;  1E7P B;  4YXD B;  1QOF A;  1T3Q A;  3AEA B;  2LEK A;  2QIE B;  1L0V B;  1ZUD 2;  3AED B;  1N5X A;  1N5W A;  3B2G A;  1DGJ A;  1ZXI A;  3AE2 B;  1NVI D;  1TKY A;  1GT8 A;  1WYG A;  4WWM A;  1J7B A;  2L83 A;  5GXG B;  1E6E B;  4WQM A;  3AEG B;  2HTM E;  4YSZ B;  4JWU C;  1FRD A;  2WQY B;  2MJ3 A;  1NYQ A;  5AUI A;  3VR8 B;  4N59 A;  1PUT A;  3PO0 A;  5C2T B;  1WGK A;  3AMZ A;  3P4S B;  1FIQ A;  5AUK A;  3VRA B;  1FFV A;  4A9A A;  1FXA A;  3W5U B;  1E0Z A;  2OHF A;  3AE4 B;  3VR9 B;  1QT9 A;  5G5H A;  1B9R A;  1L6U A;  3AEB B;  3AEC B;  3CF4 A;  1OQR A;  4US9 A;  2K9X A;  5G5G A;  2G1E A;  1ZP0 B;  1V8C A;  4ITK A;  1QOB A;  1FMA D;  4ZHP A;  1E9M A;  1DOY A;  2ACZ B;  1OFF A;  1CZP A;  1FM0 D;  1VDV A;  1YJJ A;  1YJI A;  2CJO A;  3FC4 A;  3AE9 B;  3AE1 B;  1I7H A;  1JW9 D;  3NVW A;  1N60 A;  1ROE A;  2PVG C;  1J7C A;  5H92 C;  1YQ3 B;  4USA A;  3AB5 A;  2BS4 B;  1FO4 A;  3AE8 B;  1NI3 A;  4FXC A;  1QF6 A;  1TKG A;  3NVV A;  5EE1 A;  1JRP A;  5EE0 A;  2PKO A;  2H88 B;  1DOX A;  2EKI A;  1V97 A;  3P1M A;  1FXI A;  1GTH A;  1N61 A;  1QOA A;  2JQR B;  2W55 A;  3AN1 A;  1JAL A;  2BT6 A;  3BII D;  4C80 A;  1E10 A;  3SFD B;  4N58 A;  1KRH A;  4P6V F;  1YQ4 B;  2K5P A;  4IDI A;  3DWG C;  3AH7 A;  3AE7 B;  5EE3 A;  3AEF B;  1PDX A;  1VJK A;  4YSY B;  2WP9 B;  1H7W A;  4YTM B;  1J7A A;  3B2F A;  3LXF A;  3W5V B;  4C7Y A;  1CJE A;  1GPX A;  1GTE A;  1SIJ A;  3AM9 A;  3LB8 C;  1L6V A;  2AX5 A;  1XLN A;  1XLO A;  1A70 A;  3P4P B;  3KWL A;  3DWM A;  2WU2 B;  1R7S A;  4YSX B;  2PVO D;  3EUB 2;  1NYR A;  1RWS A;  3AE3 B;  3CIR B;  3HRD D;  3NVZ A;  1FRR A;  3ABV B;  1RFK A;  1ZOY B;  3W9C B;  1UWM A;  2E3T A;  2MJD A; 
#chains in the Genus database with same CATH topology
 2PPH A;  2KQ4 X;  2KJR A;  2AYO B;  5CHV C;  4HPP A;  3AE5 B;  4E74 A;  1WGG A;  1TS3 A;  1FPY A;  2XK5 B;  3AE6 B;  2KQS A;  3DBH B;  4JLC A;  4PYZ A;  3O65 B;  1E8X A;  3N32 A;  1TYG B;  2MBO A;  3ML9 A;  4ICV A;  5IAA C;  4I6N B;  2QDF A;  2V3P A;  2DWQ A;  2DAJ A;  5C3J B;  4L2Y A;  1I42 A;  2EMT A;  3UIN B;  1D3Z A;  4A55 A;  1TJE A;  2JX5 A;  3QC8 B;  5MPO A;  3ZJV A;  1C4C A;  4ANX A;  2FUH B;  3T3N A;  4QAY A;  3ZW3 A;  3KW5 B;  2KC1 A;  3EFU A;  1F52 A;  2K0P A;  2K6D B;  3RCZ A;  5FR3 A;  3KH0 A;  1T0Q C;  5GXG B;  1GC7 A;  3WA0 A;  1EU4 A;  2KC2 A;  2BVC A;  1VZ6 A;  5C2T B;  2D3A A;  3ZUN A;  3W1S C;  1ZW7 A;  1FXA A;  2HJ1 A;  3EEC A;  2LHD A;  4HPL B;  2EMS A;  4RFB A;  3UIO B;  5DPW A;  1AAR A;  2KD0 A;  2WXQ A;  4AP4 C;  4FHJ A;  3A1Q B;  2KOX A;  4DXF A;  2PW9 A;  2C60 A;  4DHZ E;  3VH3 B;  3IT6 B;  2INN E;  2MBE A;  4RF1 A;  5HG2 A;  4C56 C;  1F77 A;  1OGW A;  2K8H A;  4OZC A;  3ZGZ A;  5CHF A;  1V49 A;  1WZ3 A;  1WZ0 A;  2KMC A;  3Q3J A;  2KHW B;  3DWM A;  4GSW A;  1R4M B;  1PYW D;  4NJ7 A;  2CU3 A;  4HKZ E;  4JX1 C;  3V62 A;  4MGY E;  4JIO U;  3B08 A;  4GOC A;  3Q3O C;  2D5G A;  2BS3 B;  4E71 A;  4CYE A;  4ARC A;  1P7F A;  1FFU A;  3N1X C;  2KAJ A;  1WSP A;  2B76 B;  2YEP B;  3ZDM C;  4W9K A;  2C7H A;  2L52 A;  2IYD B;  2BYT A;  4ANU A;  1AWD A;  2V4I B;  1PFD A;  2KWV B;  1N63 A;  2VZK D;  5JXV A;  1Q10 A;  4RF0 A;  2V3N A;  1HZ5 A;  2RDH A;  3CF6 E;  1IBX A;  1C1Y B;  5AZH A;  3R3M A;  4PT5 A;  1E7P B;  3R2T A;  4RGM A;  3URY A;  2GI9 A;  3MJW A;  2LEK A;  2R61 A;  2RGF A;  2AQ1 B;  1YX6 B;  1QQR A;  5E6J A;  4LJO B;  2BTE A;  4JWU C;  2IDY A;  1XD3 B;  2KLC A;  3TEZ A;  4K7W A;  3AMZ A;  3IVF A;  1FIQ A;  1WXM A;  1WY8 A;  4K3B A;  4KKI A;  1ZXH A;  4GDL B;  5TR5 A;  3HM6 X;  1QT9 A;  2JXT A;  4TMA B;  3V05 A;  4MSM B;  2N4F A;  4B6W A;  1FM0 D;  3E56 A;  1I7H A;  1JW9 D;  3L10 B;  2GBJ A;  4RM9 A;  1ET6 A;  1VD2 A;  1QF6 A;  1JRP A;  3R8B A;  1DOX A;  2O2V B;  2BW2 A;  3L0W B;  1KLG D;  2NMQ A;  1GC6 A;  1L0Y B;  3VUX A;  2G3Q B;  4MJS A;  2WYQ A;  4MDK E;  4HWI B;  4YSY B;  1H7W A;  3FIL A;  2MCN B;  3J9C A;  3AM9 A;  2KTR A;  1I4X A;  3BVG A;  1FD6 A;  2W9N A;  2LHE A;  1XXG A;  3D32 A;  3HUI A;  2LZ6 A;  1T0R C;  1WM3 A;  2WDT B;  4HCP B;  3PRE A;  1WXQ A;  1SB3 C;  4ZOH C;  4CO7 A;  4OW0 A;  1WX8 A;  5IO9 A;  4E3C A;  1LO5 D;  1WYW B;  4WJN A;  5IP4 D;  3B9J A;  4GDL A;  1JWS D;  4MH0 E;  2LGX A;  4NQK E;  1R4M I;  4RH6 A;  5H8Y E;  3A9K B;  4D2K A;  4W9F A;  4RMA A;  3KYD D;  3AI5 A;  2JU6 X;  3DBL I;  3GS2 A;  4BKG A;  1J7B A;  3WAO A;  2K6Q A;  4MEM A;  2KJ6 A;  4XGA B;  3R7R A;  2MQJ A;  1HA5 A;  2BKR B;  3ZNH B;  5AUK A;  2RPQ A;  2DEN B;  2QMT A;  4HVB A;  1DYQ A;  4LCD E;  3PGE A;  3DPD A;  5C23 A;  1V8C A;  1WXA A;  2KDI A;  1OFF A;  2KO3 A;  2FAZ A;  2EEL A;  2G45 B;  4IW0 A;  3NZU A;  3NVW A;  1ZPS A;  3AE8 B;  4TV3 A;  5EE1 A;  3BYT B;  4GU2 A;  5KHQ A;  4OVV A;  5AZF A;  4JE3 B;  3DCG A;  2L0F A;  2LVP A;  4W9I A;  3HHM A;  3AU4 A;  2IY0 B;  1YQ4 B;  2FCQ A;  2L76 A;  2KVR A;  3W5V B;  4K1R B;  4GDK B;  1EF1 A;  1R7S A;  3IAS 1;  3X23 A;  3PLV A;  2J7Q B;  2DZJ A;  1RAX A;  2JPH A;  1K8R B;  1X1M A;  1E90 A;  4KIK A;  2JT4 B;  4OZB A;  2A5U A;  4REZ A;  4YTN B;  5BYS A;  1GAQ B;  1D5M C;  2X8X X;  2IJ0 A;  3A1Q A;  4HRO A;  4YL8 A;  2WDV B;  3H1U A;  1JML A;  3R2I A;  1V80 A;  1IGD A;  5T8I A;  4JWS C;  5J17 A;  4WUR A;  2TSS A;  2GBN A;  3DVG Y;  1GUA B;  4LNF A;  2L7R A;  3P63 A;  2KX0 A;  2H89 B;  2UYZ B;  4R3D A;  2NTS A;  3RI7 C;  1JWA D;  1UF0 A;  2PJH A;  1F1H A;  2KDM A;  2NS5 A;  1SJE D;  4KIK B;  3ZQ4 A;  4JQW C;  2YLM A;  3ONS A;  3ZJT A;  2JZZ A;  3KUD B;  4WAF A;  3PO0 A;  4A90 A;  2K1F A;  3T8M A;  2O6V D;  1WF9 A;  4JPS A;  3VRA B;  2XN9 C;  3VR9 B;  1SXT A;  2HTH A;  3AEC B;  2N7J A;  2J53 A;  1T0Y A;  5CX3 A;  4MAC A;  3HK0 A;  2ZPY A;  3N1Y C;  3FC4 A;  5E6N A;  1FXT B;  3QK0 A;  2ZVO A;  3WAN A;  2LGY A;  1CK1 A;  1WX9 A;  3QAR A;  1QOA A;  4ZRI A;  5BO4 B;  2GMI C;  2GOW A;  4GLS C;  3AE7 B;  4W9H A;  2WXH A;  3Q2A C;  1NI2 A;  3PV1 A;  4LJP B;  1LFD A;  1R4N B;  3L17 A;  3I9V 1;  1XLN A;  2KK8 A;  2KQ7 A;  2NBW B;  2GLS A;  1SE9 A;  2HDE A;  4Q2J A;  3NOB A;  1UD7 A;  2MW5 A;  1LQB A;  3OLM D;  3BZD B;  2WU5 B;  1BT0 A;  3VH4 B;  3AUL A;  2KX3 A;  1Y56 A;  2DZK A;  3A4S C;  1XCT L;  2W3S A;  2KDF B;  4IC7 B;  3RNG C;  2HE7 A;  3V6E B;  4GN1 A;  2DZI A;  3N9Y C;  4GIV A;  2BS2 B;  3JW0 X;  1L5P A;  1HQR D;  3IT4 B;  3ZRC A;  3VTU A;  2BYE A;  5IA7 A;  2JVC A;  2WNM A;  2D10 A;  2LXC A;  2RD0 A;  3RPF C;  2C9W B;  1F0Z A;  1GB4 A;  4MGI E;  3Q3N C;  2OJR A;  2KTF A;  2IZV B;  1K51 A;  2IGD A;  2MWS B;  2LUM A;  3PRP B;  5LXH A;  2LGS A;  4K7U A;  2L05 A;  2O6V B;  2ZW0 A;  2ZNV C;  3OJ3 A;  3K9O B;  4G0N B;  5BMI A;  2JZ3 B;  1NYQ A;  2BYV E;  4HEA 1;  4JL9 A;  2KYW A;  3Q8F A;  2K8C A;  4BKS D;  2J42 A;  2OOB B;  2MP2 B;  1BUI C;  3A4R A;  4TQ1 A;  5D7G A;  2ACZ B;  1CZP A;  2G4D B;  1AW7 A;  2VZK B;  3TSS A;  5LNK 1;  1TS4 A;  3BK2 A;  4M00 A;  3ZNI D;  3P2B A;  1NI3 A;  2AL6 A;  5EDS A;  1J0G A;  3DHI C;  3IAM 1;  3RT3 B;  1GB1 A;  2KAN A;  2HJ8 A;  1V1P A;  2K5P A;  3UF8 A;  5EE3 A;  1PDX A;  2M4N A;  3BYY B;  1CJE A;  1TS5 A;  1STE A;  3S2A A;  5FR6 A;  4IUM B;  4LK0 M;  1ZOY B;  2KWD A;  4AUQ C;  3PRM B;  1KTK A;  3PRZ A;  3UIP B;  1N6Z A;  3AEE B;  1IBX B;  2LD9 A;  1KF6 B;  4GDK A;  3Q6B A;  1HE8 A;  2I38 A;  2LI5 A;  2IY1 B;  2MJE A;  1IUE A;  4RGT A;  3TBL D;  1R4N I;  2XNA C;  3RZF A;  1C4P A;  4DHJ D;  5CHW A;  2GBM A;  2K22 A;  4K81 A;  3PTF C;  1UH6 A;  4NQL B;  2FNJ B;  2Z0E B;  3RZW C;  3VTW A;  1MJD A;  2MLB A;  4IM0 A;  2AEH A;  1UUP A;  5D6J B;  3BIN A;  2AQ2 B;  4GXB A;  5AUI A;  4TUU A;  1M94 A;  1F9J A;  2D3G A;  3W5U B;  2QC8 A;  2V0G A;  4J6I A;  4XYC A;  1OQR A;  4BKT A;  4ZHP A;  4NNJ B;  3AE1 B;  2INP E;  2KTR B;  1ROE A;  2CHW A;  2MP2 A;  3PHX B;  1C78 A;  2RR9 A;  5BMH A;  5C1Z A;  1ET9 A;  3JVZ X;  2KWC A;  1GTH A;  2BB6 A;  3MC0 B;  4P16 A;  4M0W A;  3RMK C;  4X57 B;  5IOI A;  3V61 A;  3VQI A;  4IDI A;  2PE6 B;  3OAW A;  3Q3M C;  4IOI E;  3LB8 C;  4EZK A;  3H8H A;  2B3A A;  3HRD D;  3Q8B A;  2I1K A;  4XX5 A;  2ZVN A;  5BMG A;  3KUC B;  1TS2 A;  4II3 B;  1NDD A;  5G55 A;  2M8S A;  4IWP A;  3KUZ A;  1ZKH A;  3QX1 A;  3ZJU A;  1M4V A;  1VRA B;  1HZ6 A;  2NCN A;  4ARI A;  3NUH B;  2M17 A;  3PVL A;  1K53 A;  3ZNG C;  2WXK A;  1XO3 A;  4PS8 A;  4WAA A;  1HEZ E;  1GOZ A;  1TZO A;  1GJZ A;  1N62 A;  2D11 A;  2JXX A;  1VCB A;  1WJ6 A;  1U4A A;  2NVU I;  1EUV B;  3RFZ B;  2Q5W D;  2M19 A;  2WHI A;  4NZL B;  1S3S G;  1V81 A;  1TBE A;  2WGS A;  2Y3A A;  3A33 B;  3SDL C;  1KH0 A;  4AOF A;  3GP7 A;  1WYG A;  1PGA A;  3WAP A;  4J3O D;  3ZXV A;  4HK2 A;  1BML C;  4KGT A;  3LJ3 A;  2FIF A;  3OG5 A;  2M0X A;  2J4X A;  1WE6 A;  1FCL A;  3M63 B;  3IXS A;  1FMA D;  1V5T A;  1E9M A;  4XWW A;  5GMV A;  3AE9 B;  2WXF A;  1K52 A;  4WWN A;  3T3O A;  4MH8 A;  2D2Q A;  1B1Z A;  3VXW A;  1TKG A;  2ICI A;  3KQ4 A;  1VR9 A;  3PSE B;  4GMV A;  3MTN B;  3P1M A;  2IND C;  2CHZ A;  5JH5 C;  2YVC A;  4ANV A;  3UQA A;  2RDB C;  4HDO A;  4S17 A;  4B95 A;  4M01 A;  3U2S C;  4YSX B;  5BYQ A;  3AE3 B;  1H8C A;  1FRR A;  2R2O A;  4DWF A;  2E3T A;  1EWY C;  2L32 A;  2FBW B;  5JHB A;  2ZCC A;  2N9K A;  3WAM A;  3AXC A;  4W9L A;  4WWP A;  1KLU D;  2FID A;  3DBS A;  3P4R B;  1G6J A;  3LYY A;  3ML8 A;  3L4P A;  4M8N A;  4ZRQ A;  1JWM D;  2BGF A;  3GB1 A;  1TKE A;  5L83 A;  1EO6 A;  4F8C B;  1WGD A;  2LMC A;  3QAQ A;  3CST A;  4MEL A;  1P98 A;  3CSF A;  1WRI A;  3UQB A;  1D6E C;  1K50 A;  3KWV A;  4L23 A;  3AED B;  3U30 A;  1RLF A;  2I1J A;  3PS6 A;  1H4R A;  2K8B A;  2WXO A;  1YD8 U;  3L54 A;  4EKU A;  2WXP A;  3Q14 C;  3EA6 A;  1MG8 A;  4WJQ A;  3BY4 B;  4ZDV A;  2JYE A;  1E7V A;  3V3X A;  4FAD A;  2ZW1 A;  4MGZ E;  4US9 A;  4AWJ A;  4ITK A;  2BF8 B;  2L3Z A;  2REX A;  3Q69 A;  1N60 A;  1BXT A;  3DVG X;  1ZE3 D;  3VUW A;  3EFC A;  3Q8E A;  1LGR A;  4LDT D;  2Y5P A;  4WH4 A;  5DPS A;  5EE0 A;  4PK1 A;  3EC8 A;  2LGI A;  3VVW B;  3R66 C;  4C80 A;  5CTR C;  4GGQ A;  1V86 A;  1LXD A;  2N1W A;  3GE8 C;  2MBH A;  1WGR A;  3M3J A;  1L6V A;  4BOZ B;  2MHJ A;  2LUE A;  2XK5 A;  2JRI B;  4TSS A;  3NG0 A;  3DBR B;  3TMP B;  1SIF A;  4EZJ A;  1LM8 B;  2N9P C;  4NJ6 A;  4II2 B;  1WRD B;  3HVZ A;  3Q8A A;  1WFY A;  2WDQ B;  1NEK B;  1MHX A;  1UBI A;  3GZN B;  2C5L C;  2KMA A;  4OVZ A;  3TEY A;  1F2R I;  4FA6 A;  3SFE B;  2FCS A;  4ZHO A;  2NBU A;  4A8X C;  1KFY B;  4MM3 B;  2Y5C A;  2BWE S;  1V6E A;  3NZ3 A;  4G11 A;  2UU7 A;  3UGB B;  5D94 A;  4KDL B;  2KMM A;  1MHH E;  4IKG A;  5AEK B;  2QIE B;  2IPK D;  1ZUD 2;  3B2G A;  1NVI D;  1WE7 A;  2QCZ A;  3AEG B;  1HTQ A;  5G2N A;  2WQY B;  4OHJ A;  3VR8 B;  1KM7 A;  4XC2 A;  1V2Y A;  3RUL A;  5JZE B;  4A9A A;  1L0X B;  2N9L A;  2BQQ A;  2JY6 A;  2BB5 A;  1B9R A;  3AEB B;  1L2N A;  3DOW A;  1C79 A;  1ZP0 B;  2ZCB A;  1T6B X;  4EFO A;  1XF5 L;  1YQB A;  1VDV A;  4KZC A;  1J7C A;  4DXG A;  2NBV B;  3K9P B;  3Q8C A;  2FE8 A;  1CMX B;  3KLS X;  4NAW B;  3N20 C;  1E10 A;  4WJO A;  1E5W A;  2IGH A;  4RGN A;  3DWG C;  4ZYN A;  3ZVV A;  2WP9 B;  4PS7 A;  1J7A A;  4TKN A;  3APF A;  3QWZ B;  4KSL C;  1QZE A;  2KFK A;  1NYR A;  2LJI A;  1I4R A;  2ZEQ A;  1E7U A;  1VLB A;  3L08 A;  2DZM A;  5FK9 C;  2W82 A;  1JQ4 A;  1EU3 A;  1UNS A;  2DBY A;  1V1P B;  1UGJ A;  3M95 A;  4W9E A;  1YN4 A;  1H7X A;  4YWG G;  2HD5 B;  2WX0 A;  3OWE B;  1JRO A;  1Z5S B;  2IO2 B;  3U7D A;  2JWU A;  5JHA A;  2ZNV B;  3R7Q A;  4EEW A;  2BBC A;  2N9E B;  4YTP B;  1MFW A;  2DYO A;  2ON8 A;  4BFR A;  4N6E B;  2NR2 A;  2JWZ A;  3QJZ A;  4CQN A;  2CKH B;  4XE0 A;  1DGJ A;  1ZXI A;  1GT8 A;  1OQY A;  1PGB A;  4JGH B;  4HDQ A;  4YSZ B;  2Z8L A;  2KVZ A;  1ISN A;  3IBE A;  1L7Y A;  1YN5 A;  3NZS A;  3RYT A;  2MX2 A;  3H7P B;  2JRH A;  5G5H A;  1TGZ B;  2D3B A;  5G5G A;  2KAC A;  1C3T A;  1NBF C;  1VZ8 A;  3A9J A;  2ZZP B;  1PQS A;  1ENF A;  1ACC A;  4USA A;  2L1A A;  1P7E A;  3MC8 A;  1E8Y A;  3RD2 A;  2JQR B;  1N61 A;  3WAL A;  2CHX A;  4UDU C;  4LNO A;  2V9H A;  3QIJ A;  4RM8 A;  4RGO S;  3DBL B;  3HVD A;  4W9G A;  4BVU C;  3DDC B;  3ECI A;  2PE9 A;  5IKC M;  3LXF A;  1I35 A;  2DNF A;  4GB9 A;  4MT5 A;  3IG3 A;  3PLU A;  4K7S A;  3VTV A;  2PVO D;  3NVZ A;  3AN1 A;  1J8C A;  2MJD A;  3WCQ A;  2KXJ A;  4BKS A;  3ZKJ C;  3LDZ E;  3ZYY X;  3SEB A;  4WIP A;  2WXI A;  2BPS A;  3WIM A;  1OEY A;  3AV8 A;  3PZ8 A;  3RNA C;  1YX5 B;  2ASQ A;  1DOI A;  2JZP A;  2CS4 A;  3TJP A;  2W3R A;  5DPR A;  3UI3 A;  2RDG A;  1NEN B;  3P4Q B;  3FAH A;  1SSN A;  2N1V A;  3CWI A;  1XEE A;  2BYF A;  4WJP A;  2C7M B;  2K25 A;  4US8 A;  1WH3 A;  2D07 B;  1P0R A;  1N5X A;  3AE2 B;  2HTM E;  4A3O A;  4EZL A;  3BVZ A;  3NJT A;  2MSE D;  3NY5 A;  1YMH E;  2XEW A;  1HTO A;  1E8W A;  2KN4 A;  3CF4 A;  1WXV A;  3QCA A;  2LXA A;  2LVO A;  3GZN I;  2CJO A;  2L00 B;  4MM3 A;  2V4L A;  1I4Q A;  3AB5 A;  2H88 B;  2RPV A;  3A9J B;  4FLH A;  2KLG A;  1JAL A;  1SE4 A;  2QHO A;  1EM7 A;  3ZIM A;  3E9S A;  3ZO5 B;  2Z0D B;  4C4V B;  4FHK A;  3ALB A;  4B9K A;  4RCO A;  3TL5 A;  1L4D B;  4W9D A;  3ABV B;  2IGG A;  1RFK A;  3DBH I;  3TEX A;  1WJU A;  4BOS C;  2JUO A;  3PZ7 A;  4NAW A;  1SF0 A;  4XDC A;  1C77 A;  3DHH C;  3L16 A;  1RYJ A;  4DHJ B;  4KGS A;  2LWP A;  4I6L B;  4PS3 A;  3VUY A;  4G50 A;  4NY0 A;  4DK5 A;  2XBB C;  2MH7 A;  4LNK A;  2WXL A;  1TY2 A;  2YEP F;  3SD5 A;  3B1L X;  2M56 B;  3V6C B;  2BWF A;  1MPE A;  3DBR I;  2N0S B;  3PZD A;  5J18 A;  4FN2 A;  3W1Y A;  1QKZ A;  4ASW C;  1WWT A;  1EF5 A;  2KDE B;  4YXD B;  1EWC A;  2K39 A;  4BBN C;  1QOF A;  2BKF A;  1GNU A;  4XZ4 A;  4BAX A;  3ZTC A;  1A5R A;  4F1S A;  2ZJD A;  4IWO A;  3U7Z A;  3CMM B;  1FRD A;  4KKJ A;  1IPG A;  4PYU A;  1JCK B;  1AN8 A;  4MSQ B;  4L1B A;  4C4V A;  2RSU A;  3APD A;  1L6U A;  3U52 E;  3A9K A;  2KJH B;  1WMH B;  4ACF A;  1Q0W B;  2CR5 A;  1YJJ A;  1YOV B;  2KFJ A;  1I4G A;  4A20 A;  1ZDV A;  5H92 C;  3DVN V;  4OVU A;  4M0W B;  1VZ7 A;  2NPT B;  5FKA C;  1WR1 A;  5E6O A;  1WI0 A;  4DXA B;  2WWZ A;  1UGM A;  1UZX B;  5BYR A;  5J2R A;  4NPN A;  3BVM A;  2MRP A;  2LRU A;  1PGX A;  1IYF A;  2I2Y A;  4F7Z A;  2ONQ A;  3B2F A;  4AQ7 A;  2LJ5 A;  1XLO A;  4C00 A;  3ZTD A;  1UWM A;  1OEY J;  1UBQ A;  1J19 A;  3NVY A;  3MP9 A;  4ZRP A;  2OJW A;  2WS3 B;  4MJS B;  1T0S C;  1YJ1 A;  2DYB A;  4A6Q A;  3RNC C;  3MJ5 A;  1WM2 A;  4DQO C;  3U4E G;  2KNB A;  1XCQ L;  1RFA A;  4HJK A;  3BWU D;  1FCC C;  4KX6 B;  2WXJ A;  2PEA A;  2MA9 B;  2FUG 1;  2QIL A;  1FEH A;  4WWO A;  1OQQ A;  3C19 A;  1JWB D;  5AZG A;  3M62 B;  5IN7 A;  3GOE A;  4LNN A;  1WIA A;  3H6N A;  5L95 C;  1L0V B;  3V60 A;  2J52 A;  5TSS A;  1TKY A;  2L83 A;  1E6E B;  2M0A A;  3X0W A;  4KDI C;  4G3X B;  4N59 A;  2N9X A;  3HM3 A;  1CQV A;  3AU5 A;  1E0Z A;  2OHF A;  4M8M A;  2LAS A;  2SEB D;  4N9F 4;  1YJI A;  2KT7 A;  4FUL A;  1SBB B;  2BS4 B;  3H7P A;  3SHQ A;  1ESF A;  4NJC A;  1C9F A;  1YNT E;  2BT6 A;  1TTN A;  4ZYS A;  1UWX A;  2LVQ A;  2LRW A;  3AH7 A;  4ANW A;  3TEW A;  2ZPN A;  4DBG A;  1GPX A;  2O2V A;  1SIJ A;  2Y5B B;  4EUT A;  2AX5 A;  2WU2 B;  3EUB 2;  3MFG A;  2DHZ A;  1TT5 B;  2C7N B;  1D5X C;  2L0T A;  3QQ8 B;  3IHP C;  1SEB D;  5LXI B;  3ZXR A;  1KLV A;  3VFK A;  3N1Z C;  4XWT A;  4LLG M;  2QJL A;  2UWQ A;  3DQV A;  3I5J C;  2MBB B;  1QLB B;  2PIA A;  4C7Z A;  1D5Z C;  1AYF A;  1T5X D;  2V3S A;  3I3T B;  2CU1 A;  2G9H D;  2CJN A;  4WQO B;  3VHT C;  1RRB A;  2PLP A;  2EKE C;  3ETR A;  2IO0 B;  3PT2 B;  2WXN A;  2PTL A;  1P9D U;  3O13 A;  4WQM A;  3APC A;  1F2R C;  2L8J A;  1E8Z A;  2MBQ A;  3W1S A;  1YN3 A;  3P4S B;  1C76 A;  4IM3 A;  2GBK A;  4HPM B;  1Q1O A;  2IO3 B;  3N3K B;  2MEK A;  4BZA A;  4ZRJ A;  3T9L A;  3SU8 X;  2VRR B;  4FJY A;  1C4A A;  2G1E A;  2Z59 B;  3FIL B;  1SE2 A;  3VAW A;  4IWQ A;  2GRI A;  2PVG C;  1YQ3 B;  4KZ0 A;  1FO4 A;  3U8Z A;  4FXC A;  2QEJ C;  1WJN A;  2J0K A;  1V97 A;  1WR6 E;  1V9J A;  2GB1 A;  1V5O A;  3SFD B;  4KSK C;  1VJK A;  2VH1 A;  4DDI D;  3ENE A;  1GTE A;  2N7E A;  3ZNZ B;  3ZDT A;  3KWL A;  2JSV X;  3P4P B;  5D3I B;  3CIR B;  4B0E A;  5KHO A;  2JYT A;  3W9C B;  1XQQ A;  3N30 A;  3QHT A;  5HKH A;  3BK1 A;  3NS1 A;  4XDD A;  3VRB B;  2KWU B;  4OZA A;  1WMH A;  3I57 A;  2AWT A;  3KVF B;  3MC9 A;  3NRZ A;  1XT9 B;  1KOT A;  2K3U A;  3H9D A;  4ICU A;  2FCN A;  2N7D A;  3TCA A;  4AJW A;  3RNF C;  4LTU A;  4W9C A;  3NHE B;  1MG4 A;  4BBN F;  3RNE C;  3VDZ A;  3RN9 C;  2J0M A;  1FNW A;  2RMM A;  5EE9 A;  1KJT A;  2LGD A;  2WLB A;  3W2D A;  4HLE A;  4FJZ A;  1P3Q U;  2J0J A;  4HXD A;  4DDG D;  2DLB A;  2R2Q A;  2DYM A;  1T3Q A;  1FNV A;  1SE3 A;  3AEA B;  1Y8R C;  2DAF A;  3HIZ A;  4KGR A;  3NS8 A;  5I4D A;  1WGY A;  1GG3 A;  2MJ3 A;  3MHZ A;  4EOY A;  2INC C;  2PMV A;  3AE4 B;  2LFI A;  2GBR A;  2E6X A;  1IP9 A;  2K9X A;  4KVG B;  1QIL A;  1YIW A;  4MGK E;  2O6V A;  3EHV A;  3NVV A;  3TUO A;  3DVN U;  2WXM A;  2OED A;  2PKO A;  3JYU A;  5HI1 A;  2VH2 A;  1FXI A;  4W9J A;  2NTT A;  1FNU A;  4N58 A;  2SAK A;  4P1C C;  1TY0 A;  3H7S A;  4P6V F;  2FCM A;  2AL3 A;  2KFK B;  3AEF B;  2G4S A;  3L13 A;  5D3D A;  2KDB A;  3PPA A;  1D4B A;  1MI0 A;  4FBJ B;  3ZLZ A;  3RNB C;  3KYC D;  1RWS A;  2IO1 B;  3B0A A;  1WGH A;  3Q3F A;  1SJH D;  3OJ4 B;  4S0R A;  1XLQ A;  2W54 A;  1JWU D;  1MVK A;  5HFY A;  4B0M A;  2KKC A;  5D2M B;  3I63 C;  2KZR A;  3TIX A;  1SGH A;  1HXY D;  1ZGU B;  1I4H A;  4HRS A;  3SR6 A;  1TIF A;  2IBI B;  4EE2 A;  2AQ3 B;  3MHS D;  4HCN B;  4AS1 A;  2M1M A;  4LNI A;  3QA8 A;  3RUI B;  2QSD A;  2D3C A;  3DHG C;  1RM6 C;  2KN5 A;  4YT0 B;  5HHD G;  3JSV B;  4AJY B;  5E6P A;  4CHK A;  2JF5 A;  1XLP A;  2WDR B;  3GE3 C;  1P1A A;  2NPT A;  3FKY A;  1QOG A;  4M02 A;  4DHZ B;  1V1O A;  2A4Z A;  4KV2 A;  3IFW B;  4IG7 B;  4HKQ A;  4P1B C;  4LDT B;  2WXR A;  4I6P A;  1N5W A;  3JSV A;  4WWM A;  5DCN A;  4FJV B;  4TQ0 A;  3C0R B;  3ZRF A;  1WX7 A;  1S1Q B;  1PUT A;  1WGK A;  4HJG E;  1FFV A;  1WJ4 A;  4IM2 A;  1I4P A;  4ZRK A;  2WXG A;  1QOB A;  1DOY A;  2WX1 A;  4A3P A;  1TZ1 A;  4URK A;  4NAM A;  2X38 A;  1UEL A;  1WXS A;  5LLI A;  1Q5W B;  2DX5 B;  2EKI A;  2W55 A;  4H2A A;  3BII D;  1Z2M A;  3EGR A;  1KRH A;  2V1Y A;  1OTR B;  3C8Y A;  1L4Z B;  4YTM B;  4RNA A;  4O1N A;  4C7Y A;  1ZDX A;  1A70 A;  1JRU A;  1IGC A;  3P42 A;  5DPT A;  4P7I A;  3PHW B;  4K3C A; 
#chains in the Genus database with same CATH homology
 2KQ4 X;  3BZD B;  3NVY A;  2WU5 B;  3MP9 A;  3HVZ A;  3Q8A A;  3AE5 B;  4ZRP A;  2WDQ B;  1NEK B;  2WS3 B;  1Y56 A;  1MHX A;  1TS3 A;  4OVZ A;  1XCT L;  2W3S A;  3TEY A;  1F2R I;  3AE6 B;  4A6Q A;  3SFE B;  3MJ5 A;  4ZHO A;  1TYG B;  3N9Y C;  4DQO C;  2V3P A;  2DWQ A;  2BS2 B;  3U4E G;  4A8X C;  5C3J B;  1L5P A;  1HQR D;  1KFY B;  1XCQ L;  3IT4 B;  4MM3 B;  3BWU D;  1FCC C;  4KX6 B;  2Y5C A;  4L2Y A;  2WXJ A;  2WNM A;  2FUG 1;  3NZ3 A;  2QIL A;  1FEH A;  1OQQ A;  4A55 A;  1TJE A;  2JX5 A;  3RPF C;  1JWB D;  1F0Z A;  1GB4 A;  5MPO A;  3ZJV A;  1C4C A;  2KMM A;  1MHH E;  3T3N A;  1K51 A;  2IGD A;  4IKG A;  2LUM A;  2K0P A;  2QIE B;  2IPK D;  1L0V B;  1ZUD 2;  5FR3 A;  3B2G A;  2J52 A;  1NVI D;  5GXG B;  1TKY A;  5TSS A;  2L83 A;  2ZW0 A;  1EU4 A;  1E6E B;  3AEG B;  2M0A A;  5BMI A;  2WQY B;  1NYQ A;  1VZ6 A;  3VR8 B;  4OHJ A;  4N59 A;  4HEA 1;  5C2T B;  3Q8F A;  1CQV A;  4A9A A;  1FXA A;  1L0X B;  1E0Z A;  2OHF A;  2J42 A;  2N9L A;  2LHD A;  4RFB A;  2BB5 A;  1BUI C;  1B9R A;  3AEB B;  1C79 A;  4TQ1 A;  1ZP0 B;  1T6B X;  5D7G A;  1XF5 L;  2ACZ B;  1CZP A;  2SEB D;  1VDV A;  2WXQ A;  1YJI A;  1AW7 A;  2VZK B;  3TSS A;  5LNK 1;  1TS4 A;  3BK2 A;  1J7C A;  1SBB B;  4DXF A;  2BS4 B;  4DXG A;  1NI3 A;  1ESF A;  3Q8C A;  4NJC A;  2PW9 A;  1C9F A;  1YNT E;  2FE8 A;  3KLS X;  4NAW B;  3IAM 1;  3IT6 B;  1GB1 A;  2INN E;  2BT6 A;  1E10 A;  2IGH A;  4RF1 A;  5HG2 A;  4C56 C;  1F77 A;  4RGN A;  4ZYS A;  1V1P A;  1UWX A;  2K5P A;  4OZC A;  3DWG C;  3AH7 A;  5EE3 A;  3ZGZ A;  1PDX A;  3BYY B;  2WP9 B;  1J7A A;  3TEW A;  1CJE A;  1GPX A;  1SIJ A;  1TS5 A;  1STE A;  2AX5 A;  3DWM A;  2WU2 B;  3EUB 2;  1NYR A;  3MFG A;  1PYW D;  2LJI A;  1D5X C;  1I4R A;  4LK0 M;  1ZOY B;  2KWD A;  2CU3 A;  4HKZ E;  4JX1 C;  1VLB A;  1SEB D;  1KTK A;  5FK9 C;  2W82 A;  1JQ4 A;  1EU3 A;  2BS3 B;  2D5G A;  1UNS A;  2DBY A;  4ARC A;  1V1P B;  1P7F A;  1FFU A;  4XWT A;  4LLG M;  2KAJ A;  3AEE B;  1WSP A;  2QJL A;  1IBX B;  1UGJ A;  1KF6 B;  2B76 B;  1YN4 A;  2YEP B;  1H7X A;  1QLB B;  4YWG G;  2I38 A;  2L52 A;  2PIA A;  4C7Z A;  1D5Z C;  2MJE A;  1JRO A;  3OWE B;  2BYT A;  1AYF A;  1IUE A;  1AWD A;  1T5X D;  4RGT A;  2G9H D;  2JWU A;  2V4I B;  1PFD A;  2CJN A;  2BBC A;  2XNA C;  1N63 A;  4YTP B;  2VZK D;  1C4P A;  5JXV A;  1Q10 A;  2DYO A;  2ON8 A;  2K22 A;  2PLP A;  4RF0 A;  2V3N A;  4N6E B;  1HZ5 A;  2RDH A;  1IBX A;  4CQN A;  3ETR A;  4PT5 A;  1E7P B;  3R2T A;  4RGM A;  3URY A;  2WXN A;  2GI9 A;  2LEK A;  2PTL A;  2R61 A;  1UUP A;  4XE0 A;  1DGJ A;  1ZXI A;  1GT8 A;  2AQ1 B;  3O13 A;  1PGB A;  1QQR A;  4WQM A;  2AQ2 B;  5E6J A;  2BTE A;  4YSZ B;  4JWU C;  2Z8L A;  2IDY A;  1F2R C;  5AUI A;  3TEZ A;  3W1S A;  3AMZ A;  1YN3 A;  3P4S B;  1C76 A;  1FIQ A;  1YN5 A;  1ZXH A;  4KKI A;  3W5U B;  4GDL B;  2V0G A;  2MEK A;  1QT9 A;  5G5H A;  1OQR A;  1C4A A;  2JXT A;  4TMA B;  2G1E A;  5G5G A;  3V05 A;  2KAC A;  4ZHP A;  3FIL B;  1FM0 D;  1VZ8 A;  1SE2 A;  3E56 A;  3AE1 B;  2INP E;  1I7H A;  1ENF A;  1JW9 D;  1ACC A;  1ROE A;  2GRI A;  2PVG C;  1YQ3 B;  4USA A;  2L1A A;  1FO4 A;  1P7E A;  1ET6 A;  4FXC A;  1QF6 A;  1C78 A;  1JRP A;  5BMH A;  3R8B A;  1ET9 A;  2QEJ C;  1DOX A;  1V97 A;  2JQR B;  1GTH A;  1N61 A;  2BB6 A;  2GB1 A;  3MC0 B;  4UDU C;  2BW2 A;  4P16 A;  1KLG D;  2NMQ A;  1L0Y B;  4M0W A;  3SFD B;  4RGO S;  3HVD A;  3VQI A;  4IDI A;  1VJK A;  4YSY B;  1H7W A;  3FIL A;  3J9C A;  3LXF A;  4IOI E;  1GTE A;  3AM9 A;  3LB8 C;  4MT5 A;  3H8H A;  2JSV X;  3KWL A;  3P4P B;  1I4X A;  3HRD D;  2PVO D;  3Q8B A;  3NVZ A;  3BVG A;  5D3I B;  3CIR B;  4B0E A;  2JYT A;  3W9C B;  2LHE A;  3AN1 A;  5BMG A;  2MJD A;  3BK1 A;  1TS2 A;  3NS1 A;  1XXG A;  4XDD A;  3HUI A;  3WCQ A;  3VRB B;  4OZA A;  3ZJU A;  3I57 A;  3ZYY X;  1M4V A;  1VRA B;  3SEB A;  4WIP A;  1WXQ A;  1SB3 C;  2WXI A;  3NRZ A;  4ZOH C;  1HZ6 A;  2K3U A;  3AV8 A;  4OW0 A;  3PZ8 A;  4ARI A;  1LO5 D;  4LTU A;  1DOI A;  2JZP A;  3NUH B;  2W3R A;  1K53 A;  1FNW A;  2RMM A;  2RDG A;  2WXK A;  3UI3 A;  1XO3 A;  5EE9 A;  3B9J A;  1HEZ E;  1JWS D;  1GOZ A;  2WLB A;  1TZO A;  3W2D A;  1N62 A;  1NEN B;  3P4Q B;  4RH6 A;  5H8Y E;  3FAH A;  4D2K A;  1SSN A;  3RFZ B;  2Q5W D;  3CWI A;  1XEE A;  4US8 A;  2M19 A;  4NZL B;  2DLB A;  2DYM A;  1T3Q A;  1FNV A;  2JU6 X;  1SE3 A;  3AEA B;  2Y3A A;  1N5X A;  1KH0 A;  3AE2 B;  1WYG A;  1PGA A;  3GP7 A;  3GS2 A;  1J7B A;  4J3O D;  4KGR A;  2HTM E;  1BML C;  5I4D A;  3BVZ A;  4KGT A;  2MJ3 A;  3MHZ A;  1HA5 A;  1YMH E;  5AUK A;  2J4X A;  2PMV A;  3AE4 B;  2KN4 A;  2QMT A;  1FCL A;  1DYQ A;  2LFI A;  2E6X A;  3CF4 A;  2K9X A;  3IXS A;  1V8C A;  1FMA D;  1E9M A;  1OFF A;  1QIL A;  2CJO A;  4XWW A;  3AE9 B;  2EEL A;  2WXF A;  1K52 A;  3NVW A;  1ZPS A;  3T3O A;  4MH8 A;  1I4Q A;  3AB5 A;  3AE8 B;  1B1Z A;  1TKG A;  3NVV A;  5EE1 A;  3BYT B;  2ICI A;  2WXM A;  3TUO A;  2OED A;  2PKO A;  2H88 B;  3KQ4 A;  5HI1 A;  1VR9 A;  2RPV A;  3P1M A;  1FXI A;  4JE3 B;  2NTT A;  1JAL A;  1FNU A;  1SE4 A;  4N58 A;  2SAK A;  1EM7 A;  1TY0 A;  3E9S A;  4P6V F;  1YQ4 B;  5D3D A;  3AEF B;  3W5V B;  4RCO A;  1D4B A;  1MI0 A;  4GDK B;  3U2S C;  1R7S A;  4YSX B;  3IAS 1;  5BYQ A;  1L4D B;  3AE3 B;  1RWS A;  1FRR A;  3ABV B;  2IGG A;  1SJH D;  1RFK A;  2E3T A;  3TEX A;  1EWY C;  1XLQ A;  2W54 A;  1JWU D;  1MVK A;  5HFY A;  4B0M A;  3PZ7 A;  2L32 A;  2FBW B;  1SF0 A;  4XDC A;  1C77 A;  4OZB A;  2N9K A;  1HXY D;  1RYJ A;  1I4H A;  4REZ A;  4YTN B;  4HRS A;  1GAQ B;  5BYS A;  1D5M C;  3SR6 A;  2IJ0 A;  4KGS A;  4EE2 A;  1KLU D;  4HRO A;  2AQ3 B;  2WDV B;  4AS1 A;  1JML A;  3R2I A;  1IGD A;  5T8I A;  3P4R B;  2MH7 A;  4JWS C;  3LYY A;  4WUR A;  3L4P A;  2WXL A;  4ZRQ A;  2QSD A;  1TY2 A;  2YEP F;  2TSS A;  1RM6 C;  4YT0 B;  1JWM D;  2M56 B;  3GB1 A;  5HHD G;  1MPE A;  1TKE A;  2N0S B;  1XLP A;  2LMC A;  3P63 A;  2WDR B;  2H89 B;  4R3D A;  2NTS A;  1QOG A;  1JWA D;  1WRI A;  1QKZ A;  1WWT A;  1V1O A;  1D6E C;  4YXD B;  1EWC A;  2KDM A;  1K50 A;  4HKQ A;  1QOF A;  3KWV A;  4L23 A;  2WXR A;  1SJE D;  3AED B;  3ZQ4 A;  1N5W A;  4WWM A;  3U7Z A;  2WXO A;  3ZJT A;  2WXP A;  1FRD A;  4KKJ A;  4TQ0 A;  3EA6 A;  4WAF A;  1PUT A;  3PO0 A;  1WGK A;  4A90 A;  4HJG E;  4JPS A;  3VRA B;  2XN9 C;  1FFV A;  1JCK B;  2JYE A;  1AN8 A;  4L1B A;  3V3X A;  2ZW1 A;  3VR9 B;  1I4P A;  1SXT A;  1L6U A;  3AEC B;  2N7J A;  3U52 E;  4US9 A;  2J53 A;  2WXG A;  4ITK A;  1QOB A;  1DOY A;  4MAC A;  1YJJ A;  4NAM A;  3FC4 A;  1I4G A;  2X38 A;  1N60 A;  1BXT A;  3Q69 A;  1ZDV A;  5H92 C;  1ZE3 D;  3Q8E A;  4WH4 A;  2Y5P A;  5EE0 A;  1CK1 A;  1VZ7 A;  5FKA C;  2EKI A;  2W55 A;  1QOA A;  2LGI A;  4H2A A;  3BII D;  4C80 A;  5BYR A;  3EGR A;  1KRH A;  3BVM A;  1PGX A;  4GLS C;  3AE7 B;  2WXH A;  2I2Y A;  3C8Y A;  1L4Z B;  4YTM B;  4RNA A;  2ONQ A;  3B2F A;  4O1N A;  4C7Y A;  4AQ7 A;  1ZDX A;  1L6V A;  3I9V 1;  1XLN A;  1XLO A;  1A70 A;  4TSS A;  2HDE A;  4Q2J A;  1IGC A;  3P42 A;  1UWM A;  1FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...