2WUCA

Crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp and ac-kqlr-chloromethylketone
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
publication title Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wucA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wucA01
1AE8H 2BDBA 2ALVA 1T8LA 5ETXA 1MTUA 3SNBA 1SQTA 4KTSA 3PWCA 3W94A 1O36A 2G5NA 2OC0A 2J34A 3ZVGA 1PQ8A 2FOFA 1CBWB 2C3SA 3VXEH 1NS3A 2VIWA 1B7XB 2ZU4A 2SGPE 1MZDA 2ZHQH 1QJ7B 3A85A 4ZROA 5FHTA 3LDXH 2ZGHA 1N1LA 2GCTB 3RXLA 3RXDA 2BLQA 3TITA 3D62A 3UWIA 4FXGH 5DPAA 3ZVFA 2G52A 1TLDA 1C5YB 1QL9A 2F83A 2ZHFH 1V2WT 1LVOA 3M5LA 1SB1H 3MO3A 4UD9H 1UVSH 4YZUA 1OWIA 2SFAA 4H4FA 1DITH 5F03A 1GBAA 4ZH8A 1IHTH 2G81E 1GBFA 2GDEH 3A83A 3TH2H 3OTJE 2C8WB 2ZFPH 4O3UA 1TE0A 1OWDA 1O2UA 2OP9A 4NSYA 3KHVA 1U6QA 2BY7X 1SGYE 1YM0A 4U32A 3VB6A 4IS5A 1MAYA 3SUFA 1TALA 2C4FH 1V2QT 1AE5A 3VB4A 3TK6A 3TH4H 2P16A 1GGDC 1FQ3A 1TNJA 3NPSA 1XUGA 1JRSA 2BDCA 2QAAA 1HXEH 3VB3A 2GV7A 3SU0A 3T27A 3RXVA 5C5NA 4I33A 1QURH 2GX4A 5E0GA 1L2EA 6CHAC 2D2DA 1SVPA 5DO4H 2PKSB 3A87A 3LKWA 5HMAA 3JZ1B 1GCDA 1HIAA 1OSSA 2A4RA 4RKOB 4I8KA 2P93A 4BTUB 5F6MA 1ZJKA 3VXFH 3ZV9A 2CF9H 4D8NA 3UWJH 4ABDA 1HFDA 2BY8X 2RA3A 4LXBH 5DP7A 1ANDA 3RXGA 4OS4A 1XUJA 1HCGA 2Y5HA 4DJZB 2R3UA 3D65E 2BM2A 2G4UA 2HWLB 1Z7KA 3SQEE 1CA8B 2WYGA 2VGCC 3A8BA 1SPJA 1E0FD 2UUKB 1EAIA 1YP9A 4XBCA 1CQQA 1LMWB 3RXOA 1PPZA 2AH4X 1O3EA 1C1QA 2HVXA 4JZIA 4TY6A 2EEKA 1BTPA 1P11E 1AB9B 3U98H 1MD8A 4Y71A 5GJ4B 3T2NA 1SI5H 4B1TA 3RU4D 2F9NA 1C2DA 2OC7A 1O3DA 4ZMAH 3O8CA 3OSYA 1YPKH 2V0BA 2ZGBH 2J95A 1DSUA 4CBNA 1O2TA 1P2OA 5EG4A 4ABEA 1TNHA 1YPHE 2HNTE 1ZPZA 4GLYA 4IN2A 2TRMA 4D9QA 1C1TA 2OUAA 2XC5A 3P17H 1QRXA 1AUJA 3HATH 5ESTE 1XKAC 1W11U 1AD8H 1YLCA 3CENA 1Y3VA 3LH1A 4X6OA 1C4V2 4MTBA 2R3YA 2A7JA 3SNAA 5C20A 5C3NA 1C1PA 1K28D 1O30A 3SV9A 1C4Y2 3QZRA 2ZGJA 5DP6A 5EPYA 4FU7A 2FMJA 3RXJA 3QO6A 1SGEE 1O2KA 3RXRA 3DT0H 1XVMA 5EW2H 3BV9B 2FLBH 1ANEA 1G9IE 2PGBB 1QBVH 3H7TA 3Q3XA 2GKVE 1C5SA 4NA8A 5PTPA 5E2PA 2A4GA 3LGWA 5DP3A 1GBMA 2AFQB 3O8BA 3UQVA 4R0IA 1IQEA 1DANH 2G5VA 1ARBA 4CRGA 3H5CB 1O39A 1KY9A 5EPNA 5CE1A 4A7IB 2AGIX 2B9LA 3A7WA 4CRAA 4TY7A 1ELGA 4WXIA 1KYNA 1G36A 2TGDA 4GCHF 3NCLA 3S9AA 2Z3DA 3MFJA 1EOLA 3NWUA 2A7CA 3A7TA 1EATA 3BN9A 4Y7BA 1XVOA 3NXPA 4GSOA 1PJPA 3ATWA 1WQVH 2BDHA 3UIRA 4HI3A 3E6PH 5EGMA 4AFQA 5L2ZH 2ZDKA 3PWBA 1MKXH 1DOJA 3U8OH 1TQ7B 3SV6A 2XTTB 4JZDH 1P2KA 2H6MA 3JZ2B 3FP6E 2VIDA 1GBCA 2SGFE 2ZTYA 4K1SA 4Q2KA 5H4IB 1MQ5A 4VGCB 3QX5H 3PMJA 4X6PA 1ZSKA 3BTFE 3UTUH 1BMAA 4DT7B 4Y0YE 4JK5A 3V13A 1C5OH 1FDPA 5K0HA 3LGIA 2BQWB 1FMGA 1PQAA 5LGOA 3LGYA 3KL6A 1ZRBA 2PUQH 3A89A 4NA9H 2FLRH 2F9PA 4SGBE 2ZECA 2R2MB 3R3GB 4O9VA 1FY5A 1ID5H 2BOKA 1C5PA 3BF6H 1C1SA 2G8TA 2JH6D 4DVAU 1A4WH 4X6NA 4INKA 1PYTD 1Q3XA 3GYLB 2ZGXH 4BAQB 1ZYOA 1L4ZA 4NCYA 3QK1A 4NA7A 1C5UA 4X8SH 3ZZ3A 1TNLA 4ZKRU 2QY0B 3KN2A 1LCYA 1DWBH 3ZZAA 1XXDA 3F1SB 1MTNB 1OYTH 1FY8E 1ZJDA 1DXPA 3MTYA 5G4BA 1ZTLA 3ATKA 1NFYA 3QGJA 1T8NA 2B8OH 2AIPA 1MMJN 2ZTXA 1TBQH 4I8LA 4BAMB 5A8ZA 3EGKH 1UJ1A 1HAXB 2RDLA 1EJAA 4TWWA 1C1VH 1TX8A 2H2ZA 3PB1E 3NK8A 2FYQA 1AQ7A 3T29A 3GCTF 1GWAA 3PROA 1O3JA 3EAJA 1C1UH 1Z71A 2A5KA 1NRNH 1SGPE 4A6LA 4Q7YA 1K1JA 1HAPH 1RJXB 1D6RA 5SGAE 3UNRA 4PROA 1AHTH 3BEIB 3LOXA 1BITA 1CBWC 1HDTH 1KXDA 4Y8XA 2BMGB 4QT8C 3ZZCA 5FXLA 3B23B 1CHOG 1C5MD 2GV6A 2ZTZA 2QXGA 3RXHA 1VZQH 1GDQA 1VGCB 2GCTC 4FUEA 3T25A 5F8XA 3ZYDA 2ZDNA 3SI3H 2KAIB 5HYOA 1SQOA 3RM2H 3RXQA 1C1MA 1HV7A 3BTEE 1F0UA 3EE0B 1GL0E 1SGDE 2H9HA 3HGNA 1O3OA 1CHGA 3OX7U 5TCAA 4LZ1H 1O3NA 4ISHH 1NRQH 4BNRA 1GI0A 3KNXA 2CHAB 4IGDA 4JZEH 3UUZA 1EKBB 1Z6JH 2D8WA 2J94A 1QA0A 1F7ZA 1BIOA 1ORFA 1OOKB 1TABE 2F91A 2A32A 3QZQA 3MU8A 2ZDLA 4CHAB 3TU7H 1T32A 2WPMS 1UTPA 1SC8U 2IOTA 3M7UA 3GCHB 3SGAE 1ANCA 1O33A 1KTSB 3Q00A 1UTNA 1XKBC 2BD7A 3P95A 3I29A 2OINA 1HAZB 3A80A 3EDXB 2BZ6H 2CGAA 1P57B 1V2VT 1EQ9A 1QJ6B 4JK6A 1SGFA 4U2WA 3TVJB 5JBAS 3GCTG 1KDQB 1SGCA 3L6PA 3TIUA 4YOIA 4YM9A 2BQ6B 3G01A 4CRDA 8LPRA 1ESBA 2XBYA 2STBE 4UFEH 2C8YB 5FPSA 2VU8E 3SZNA 1ABIH 2AGEX 3ESTA 1XXFA 2XYAA 2PKSC 1RIWB 2CMYA 3P8GA 4DURA 3FANA 1ESTA 2ZPSA 1TPAE 2ZWLH 4U01A 4MPXA 1YPGH 3A7VA 4Q7XA 3TK9A 1GJ5H 2NU2E 1HJAB 4O03A 4NIVA 1GHAF 2XC4A 4BXSA 3RXTA 1P04A 3K65B 1GHZA 1MU8B 3MU4A 1ARCA 3BIVH 1E38B 1P0SH 1KXEA 1NY22 5TCCA 1KSNA 1YCPH 3E16B 4UE7H 5ESBA 1INCA 1DWEH 3IITA 2BVSH 2J38A 4XOJA 1Y3UA 2EC9H 3QWCH 1A0LA 4JYTA 4O3TA 2V3HH 1A3BH 2CXVA 1MU6B 1QCPA 1QNJA 3SV2H 3BTME 1IOEA 3PTBA 1O2IA 1SGNE 2J9NA 2PKAA 1O3IA 1TMBH 4JZ1A 1O3AA 2AGGX 1IQIA 4X8UH 4X2VA 1C2KA 4DIHH 1BTZA 1M9UA 1AFQB 2ZQ1A 1DDJA 4ZXXH 4AN7A 1D4PB 1AI8H 1GPZA 1K22H 1ZRKA 2CJIA 1BCUH 1TGNA 1AB9C 1EZUC 3RMNH 1KXCA 3UNQA 5J4SA 1ZTKA 3STJA 1ELBA 4CBOA 3SU3A 3ZVCA 2SNWA 3HPTB 2P59A 1UTMA 3PLKA 1OP2A 1YYY1 2UUYA 4E05H 1V2LT 2ZCKP 1GHYH 3E3TA 3LU9B 2H9TH 4K1TA 4BAHB 3DHKH 4Y6DA 1K1PA 3OU0A 4X2XA 2OBQA 3UPEA 1SGTA 5HM2A 3BIUH 1SMFE 3ZVEA 1TIOA 1DS2E 2J92A 1C2LA 1K9OE 5C1XA 2NU3E 2XCNA 1FN8A 2SGAA 1S6FA 2ZIQH 1GJCB 2HPPH 1J14A 2GZ7A 4WMDA 5F8ZA 1UTKA 2A4QA 1O2ZA 1QIXB 2PGQB 1P05A 3QTOH 2ZCLP 1AZ8A 2QC2A 1G3EA 1XX9A 4RN6A 3BSQA 1KTTB 1WBGB 1UVOA 2UUJB 2GVFA 3LGUA 1HAVA 1P09A 1S0RA 5HM9A 2FX4A 4X0WU 4GUXA 3UR6A 2HOBA 4YT7H 4CRCA 2FTMA 5GXPA 2BHGA 4I8HA 3FVFB 3SJ8A 1Z8RA 2ALPA 5E2OA 4ZAEA 4YTAA 3RXIA 1P3CA 1CVWH 4IMZA 4GPGA 1O2QA 4I31A 2M5TA 1S6HA 1NM6A 1DT2A 1O3BA 2QYIA 3RXFA 1N8OB 4WWYA 2UUFB 2A4OA 3ZZ9A 3NZIA 4A5TS 3NKKA 1NZQH 2ZF0H 1RGQA 2BTCE 1GG6B 3F9EA 1YPJH 1A5HA 5JB9S 2A45B 2VIOA 1TGTA 4FU9A 2XBWA 3KEEA 1S82A 2VVVA 1BTYA 4VGCC 3VEQB 4AYVB 3M5OA 3TLOA 5B6OA 2CV3A 1HJ9A 5K7RA 1WUNH 3GY5A 1S85A 3RXUA 4B73A 4DGJA 1SHYA 2HALA 1ZZZA 1QB1A 2VNTA 2WPJS 1GVLA 4H6SB 5EODA 1EZSC 1LPGB 1C1NA 1HYLA 1UK3A 3ITIA 1GHWH 1JRTA 2A7HA 1EUFA 1Z6EA 2WYJA 1DLKB 1GBDA 1EJMA 2ZCHP 1MTSA 2H5CA 3NUMA 2XBVA 4K2YA 1Y8TA 4BTIB 2ASUB 3HK6B 2F3CE 4WF8A 2PKAB 1MZAA 4AFSA 1KIGH 1JOUB 2UWPA 1F5LA 1EAUA 4A1XA 5T3HA 1OKXA 4ZHAA 2R0LA 1PPEE 2BDYA 1A0JA 1KXAA 1OXGA 2FX6A 2C90B 4ISNA 1TWXB 2VWOA 1DY8A 5BPEA 1GL1A 1DM4B 3AASA 4WMEA 1PQ5A 2VIQA 4CRFA 8GCHF 1RD3B 2P3TB 1O2XA 5JDUB 4A1TA 2OBOA 1FLEE 3A8AA 3QLPH 1XUIA 3SNDA 3TGJE 1TPPA 1UHBA 4BXWA 1MKWH 1WV7H 4KELA 4ABHA 4E06H 3BTKE 1YGCH 1B0FA 2QF0A 1YPMH 1P9SA 4B76A 2A2XH 2Y7ZA 4IC5A 1K1LA 4X1PU 2OTVA 1DXWA 4XFQA 2FESH 2BX3A 3P8FA 3B8JA 2Z3EA 1VGCC 4MDSA 2VWNA 2W3KA 1AGJA 4X2YA 2FOGA 5EW1H 2SGQE 3ZVDA 1T4UH 3F9FA 1IQFA 3GCOA 1HGTH 1BHXB 3A82A 1XUHA 3M61U 3EA8A 1NU7B 2PFEA 3KIDU 1NESE 1P3EA 2LPRA 1ELEE 1TRNA 1J9CH 1HAVB 1SLXB 1HBTH 4XDEA 2BD2A 1A5GH 3T62A 1LPKB 2CHAC 2FI3E 1GHBF 2BY5X 4CH2B 4UFDH 4ZKOU 3CP7A 1SQAA 1O2PA 4WH6A 1O34A 1O2OA 2C93B 1L1NA 2Z9IA 1PPHE 4CHAC 1LKAA 4K8YA 1SG8B 2ZGCA 3ENSB 3VB5A 3MI4A 3GCHC 4KP0A 1V2OT 3QTVH 2PSXA 1P2NA 1K2I1 3SJOA 3SGBE 1GI1A 5EU8A 1GMDF 4Z0KA 3U9AH 1FPHH 1TGBA 2ANYA 3MH7A 3M5NA 1SLUB 5GPIB 1BDAA 1E37B 5DP8A 3S0NA 1W0YH 2FS9A 5BRRE 5DG6A 1RTFB 1RIWC 2ZDMA 2ZFSA 1THPB 1MCTA 1FN6A 1Y3XA 2OLGA 4K3JA 2ANMH 1HJAC 1X7AC 1QQUA 3DFLA 3MU0A 1UVTH 5DK1A 1K21H 1BJUA 3TGKE 2Z6BD 1FIZA 2GT7A 1QB9A 3SUEA 3Q76A 1ELCA 4X8TH 1C5RA 4Y79A 1O5DH 2ILNA 1LHDH 4HZHA 1EZXC 4ISIH 1P06A 2OCVB 5DP5A 3M36A 3C27B 3QUMP 4DY7B 2QF3A 1DX5M 1BMLA 4IW4E 4GHQA 1GCTB 4B2CA 1O5CB 1Y3WA 2WPIS 1ZTJA 3RC6A 2FOBA 2KAIA 1AY6H 1AFQC 1P12E 2BZAA 1EASA 5FBIA 2OXSA 1BRAA 4F49A 1TNIA 2PW8H 1GMCF 2FDAA 4NGAH 1EX3A 2ANWA 2VH0A 3BTTE 1DSTA 3SU5A 2QXHA 1ETTH 1O2WA 1UHBB 1SFIA 1A7SA 4YT6H 1MAXA 2FO9A 2O8WA 4YOJA 1HAYB 4E7RG 2SGEE 1CGJE 3SHCH 4TWYA 1MKXK 2RG3A 6LPRA 1AIXH 1G3BA 3LJOA 1O38A 1FAKH 1RTKA 3VPKA 5JYIA 2G4TA 2Q1JA 3MHWU 1NN6A 2ZDAH 3SOSA 5AFZH 3GYMA 3M5MA 4AYYB 1QRWA 2GZ9A 2STAE 3FFGA 4RKJB 4XBBA 5CHAC 1ELVA 2Q6DA 2WPHS 1TRYA 1IQNA 1GDNA 1FJSA 4YO9A 4DG4A 1SGIB 3O8RA 4AGKA 3RMLH 1KDQA 3RXEA 1GI7B 1A3EH 1O5GH 3ZYEA 3U1JB 2ODYB 1LVMA 4LOYH 3ZZ5A 1TPOA 1BTUA 4CR9A 2Y81A 4Q80A 1DVAH 2W26A 1SOZA 2BY9X 5EXNA 2UWLA 3HKIB 4X2WA 1XUKA 3K6YA 5T6FA 1C4U2 1MTVA 1O2JA 4ZXYH 1HAGE 4R8TB 1ELDE 2FOCA 2ZZUH 4BANB 4ISOA 1Z8JB 3BTHE 3TJOA 1NFWA 1ELTA 2FOMB 1ZHRA 1GJ7B 2FYRA 1BQYA 1EB2A 1N8OC 4HTCH 1GMCG 1O3MA 1OP0A 3M35A 1WSSH 3P8OA 1WTGH 3T26A 1PQ7A 1GBHA 5A0CA 4Y8ZA 1GG6C 3LT3A 1IHSH 3M7TA 1W0ZU 3RU4E 1B0EA 3ELAH 1P9UA 1P10A 2H5DA 1BA8B 2FPZA 2DE8A 1IAUA 2BYAX 4AB9A 1EPTA 3RMMH 1W7GH 1PFXC 3OY6U 1QA7A 3K2UA 1GI4A 4GCHG 5I46H 2Z9GA 4FUJA 1HAOH 5C1YA 4ABAA 2ODQA 3LH3A 5TJXA 2ZKSA 1S0QA 1FY3A 4WMFA 5LH8A 1OYQA 1QGFA 1IQGA 1LPZB 5AHGH 4J1YA 5EXLA 1LQEA 1P8VC 3QDZB 4KTCA 1DFPA 1O2HA 3SUDA 1UTJA 4NFEA 1SFQB 1UCYH 2PSYA 1NRSH 1HRTH 4NFFA 3T5FH 3SV8A 4YLUA 1YPEH 4WVPE 3F9GA 1LKBA 1O3CA 3UY9A 1MTWA 2ZHEH 3SJIA 2A0QB 3BG4B 4HGCA 3R0FA 1UMAH 2XBXA 5L2YH 1QTFA 3A8CA 2BLVA 4MNXA 1HB0B 3P92A 1W7XH 4I8GA 3SV7A 3VGCB 2Z9JA 3EA7A 5L30H 1LHFH 1AKSB 1CGIE 2O9QA 2FEQH 3URDA 3O8DA 4OGXA 1ZSJA 4UDWH 1DLEA 2F9VA 1OS8A 3F9HA 1ETSH 4OGYA 4ABFA 1CO7E 2Y82A 1V2RT 1ELAA 1O32A 3F68H 2EI7A 4B71A 1EXFA 3KQCA 4Q7ZA 1TRMA 1FPCH 2FWWA 2P8OB 2TGPZ 2ULLA 4GHTA 1QY6A 3W95A 1ZR0A 1NTPA 1O2GH 1TX7A 3D23A 5FAHA 5C67A 1QL8A 4FUDA 2A1DB 1F92A 4AB8A 3SNCA 2GMTB 4WH8A 1YCPK 3E90B 3LC3A 5L6NH 1GBKA 1BHXF 3AW0A 3RXCA 4B2AA 4ABJA 2C8XB 3MNXA 7LPRA 1GJ6A 1TMUH 3UR9A 3K6ZA 4FUHA 1T8MA 4JCNA 1EP5A 1NT1A 1V2NT 2NU1E 8ESTE 2D1JA 3STIA 6GCHF 1QBOA 4CREA 3E91A 3SORA 2ZU3A 7ESTE 4X1RU 5FPYA 4DW2U 2VWMA 1W8BH 2A5IA 4NIXA 1HLTH 3S7HB 4IN1A 2FI5E 3TJUA 2BDIA 1BTHH 1VCQA 2Z3CA 1NRPH 2ZG0H 1TA6A 5A0AE 1C9TA 3K9XB 1EPTB 2HLCA 3M7QA 1W2KH 1C1OA 1QJ1B 1NU9A 3ZZ7A 3MMGA 2ZP0H 1J17T 4ABIA 2QXJA 2VH6A 3KF2A 5FX5A 3LGVA 4OS5A 2F9BH 3A7YA 1EJNA 1GMHF 3GY4A 1FY4A 1O3GA 1O2SA 1TAWA 1AFEH 1H9IE 2R9PA 1V2UT 8KME2 1S5SA 3M3TA 4ZKSU 1IQMA 1ZGVA 2D26C 4GVUA 2C8ZB 1ZPCA 4NG9H 1SGQE 3SHAH 2WUCA 2YNBA 1A5IA 1T4VH 4M7GA 1P03A 1ZPBA 1TBZH 1T7CA 4H42U 1GHAG 1GCTC 5EOKA 1FZZA 1YKTA 4BTTB 1J8AA 9ESTA 2TGAA 1YF4A 1AN1E 3ZVAA 2G00A 5A09A 2BXTH 1IQHA 2WPLS 5LPFA 1BMMH 4KKDA 1S84A 3GY8A 4BAKB 2H9EH 1Z8GA 5LPRA 1OP8A 1Q31A 3PLPA 4D9RA 2BLOA 3MH5A 1GJ8B 1CE5A 4CRBA 4ZKNU 2BDGA 1E35B 4Y7AA 2Z9LA 1KXBA 2O8UA 1TONA 3PYHA 3B9FH 2W7SA 2ZQ2A 4AFUA 5A0BA 1QBNA 4ZHLU 1DUEA 1RRKA 3PLBA 3SU2A 3ZZDA 3ZZBA 1JWTA 4NIYA 3I77A 1Y5UT 1W12U 4MVNA 1UK2A 3V0XA 1QFKH 5JBBS 3EQ0H 2ZEBA 3ATMA 3SI4H 1V3XA 3KQEA 1BBRH 3SN8A 7KMEH 3U69H 2FXRA 4ESTE 1C5NH 2AMPA 5DP9A 3PTNA 1CA0B 4WY3A 3PO1B 1VJ9U 1O3PB 5T6DA 2Y6TA 3QN7A 2XNIA 2NU4E 2O8LA 1HAHH 2OC8A 1WTHD 1C5QA 1F5KU 2BVRH 3PV4A 1MD7A 1WCZA 3V3MA 1AVXA 2V35A 1HJ8A 3DUXH 2UWOA 4YOGA 3AVZA 1PYTC 2ZA5A 1C1WH 4B75A 3U1IB 1QQ4A 3RMOH 2FZZA 4X1NU 3LONA 2B0FA 3RLWH 1P2QA 3SGQE 1V6DA 5FCRA 1ZMJA 3RXPA 2Y5FA 3V7TA 2GCHF 2NWNA 2YNAA 1VCWA 3RP2A 4OS2A 1C2IA 4ISLA 1GVZA 3Q3YA 1SLWB 1O2RA 1G37A 1O3KA 4INHA 1Z1IA 1C9PA 4Y11E 3PM3A 1H9HE 1GHVH 1AU8A 1MKWK 1MTNC 1FNIA 1SBWA 3E0PB 2AERH 3MNSA 4AFZA 3U8RH 2ZDVH 5EQRA 1D3DB 3M3SA 5F8TA 1RTLA 3SU6A 2PV9B 2TPIZ 2ZHDA 4UFGH 4GAWA 3P70B 4B74A 4E7NA 2YOLA 1G3DA 4FUGA 5T6GA 2BD9A 1JMOH 1C2FA 1O5BB 3S69A 1GVKB 4CH8B 1UO6A 1ZGIA 1LHCH 2SGDE 2IN2A 2J4IA 1PPGE 2OC1A 3MNBA 1ZMLA 4FUBA 1EP6A 4FVBA 5E0JA 2I6QA 3C1KA 3SUGA 3SW2B 4AGJA 3DD2H 1NPMA 1A1RA 4AG2A 2PUXB 1Y5BT 5IYTA 1TGSZ 3TGIE 2BD3A 3UOPA 4D76A 2QGRA 1HAIH 1LVBA 2W7UA 1UTLM 3A7ZA 4JMYA 1BRBE 1E36B 4NZLA 3FZZA 1K1IA 4ZUHA 3GISB 2QA9E 3GDSA 4MPWA 2EA3A 2WV5A 4ASHA 4FUCA 2P3FH 3UQOA 3OYPA 3SBKA 5E0HA 1A0HB 1C2MA 2IJOB 3BG4C 1QRZA 2GCHG 2TBSA 1EAXA 1JBUH 3DFJA 5HGGA 2FTLE 1J15A 1ACBE 1GJBB 1ZOMA 1OX1A 1LO6A 5DP4A 1MUEB 1ABJH 2BY6X 2PTNA 4RSPA 3RDZA 5HXFA 4YLQH 1MBQA 3VGCC 2IPHA 1D6WA 1TFXA 4MG3A 1D9IA 3KQBA 3ATIA 1Y59T 5EQSA 5JBCS 3P6ZB 3MO6A 2BD8A 1DUAA 1TOCB 2VIPA 1S83A 2P8OC 4JYVH 3URCA 2WUBA 1FONA 3T28A 1FXYA 8GCHG 5C1UA 1S81A 3L3TA 1SOTA 1UVUH 1L1JA 3MH6A 1O2NA 2CN0H 1VCPA 2GMTC 3UREA 1L4DA 4Z6AH 1BB0B 2V3OH 2TGTA 3SU1A 1QR3E 1C2EA 1O3FA 2JETB 1V2JT 3TPIZ 1V2KT 5AF9H 4XBDA 1GJDB 1C5XB 3A7XA 1KXFA 1UTOA 2TIOA 4ABBA 1NFUA 1OWHA 2ZFFH 2PWXA 1C2HA 9LPRA 3ZZ4A 1UK4A 4UFFH 1GJAB 1CT4E 4CR5A 1UTQA 1V2TT 1XM1A 1TX6A 4K69A 2ZNKH 3EA9A 1GBTA 2WINI 2BQ7B 5A8XA 3FP7E 2I6SA 5GIBA 3S9BA 5JPMH 4F4OC 2BOHB 1J16A 1DICA 3HKJB 2BVXH 4K60A 5JBTA 2QV1A 1GHBG 2BX4A 1UCYE 3GY7A 2XWAA 1EPTC 3Q77A 3SJKA 2ZU1A 2FP7B 2Z94A 4MNYA 3FAOA 1H4WA 3M37A 5J4QA 3BTWE 1GI3A 1O5AB 4D7GA 3Q3KA 5IDKA 3MU1A 1P2JA 1PPBH 2W3IA 3GY2A 1SHHB 1YLDA 1Z1JA 2EI8A 6ESTA 4X6MA 4OS6A 4JZFH 3E8LA 3EYDA 3RC4A 5FCKA 3LJJA 3GICB 1HPGA 1AKSA 3L33A 1ESAA 1GMDG 1DPOA 3DA9B 1KLJH 1H8IH 1O2YA 2PHBA 4FUIA 1K1NA 2ZPRA 3CS7A 4KGAA 1ZSLA 2A31A 1Z8IB 1F5RA 1LHGH 2F9UA 2Y80A 1ZLRA 5GWZA 2O8TA 4Y0ZE 1TQ0B 4B2BA 3RUOA 4OS1A 4I8JA 3ZV8A 2DE9A 2PTCE 2R0KA 1OWEA 1P2MA 1O5FH 2FOEA 2GGVB 1H1BA 1AWFH 1GBBA 4X1SU 2CF8H 2Z7FE 2GT8A 2ZPQA 1LVYA 1O2MA 1SL3A 4AOQA 5A8YA 1AO5A 3GDUA 5DGJA 1RS0A 5AFYH 4DIIH 3MWIU 3N7OA 3M3VA 1YC0A 3BTGE 4MPVA 5I25A 1C5TA 1TYNA 1GI5A 3RXAA 1JIMA 2XXLA 2G51A 4INLA 2XC0A 5A2MH 2WV4A 1CHOF 4A92A 2VINA 3ODFA 1F0RA 1NC6A 3QGNB 4H6TA 3TK5A 1HIAB 2ANKH 2FOHA 3AAVA 1TGCA 1GI2A 4K8BA 1WYKA 2PLXA 1T8OA 2P3UB 1A2CH 1CA0C 4AZ2B 2AEIH 1N6YA 1IQJA 2AS9A 3PO1C 1GBIA 1SLVB 2HPQH 1XMNB 3A86A 1AWHB 1V2ST 1AZZA 2BDAA 1G2LA 3SO3A 3TH3H 4YESB 1TMTH 3RC5A 2ZU5A 1V2MT 4LZ4B 2THFB 3BEUA 1YBWA 3LC5A 2QN5T 1GI8B 1EAWA 1Q2WA 1O37A 1SR5C 3AAUA 1BUIA 1RFNA 2BD4A 2Y7XA 3RXMA 2GDDA 1T31A 4TPIZ 1F2SE 3A88A 1CSOE 1UCYK 1VR1H 4OS7A 4XSKU 3UFAA 1BJVA 4Y76A 2JKHA 1A46H 2XWBI 4DOQA 1O35A 2OQUA 1C5ZB 2ZHWH 1BZXE 3E0NB 1BRUP 1KLIH 3LPRA 3GOVB 4MNWA 2V6NA 1DY9A 1Y5AT 2B7DH 3ATLA 4MLFB 5C5OA 2ZO3H 3UNSA 2FM2A 3MU5A 4AG1A 1YPHC 2HNTC 5E8EH 1WAYB 1AVWA 1KLTA 1FV9A 2BD5A 2ESTE 1BRCE 2SNVA 1JIRA 3RXSA 4TPYA 2VJ1A 4J2YB 1OWKA 4A1VA 3LIWA 1CT0E 1MBMA 2HNTF 1MCVA 1FY1A 3CS0A 1G2MA 1WQSA 3BTDE 1GGDB 4FVDA 2Z9KA 1C5VA 3RM0H 2P94A 1ZHMA 1N6XA 3MNCA 4SGAE 4DCDA 1VJAU 2AYWA 3KQDA 3VFEA 4FUFA 3MYWA 1TBRH 1QL7A 2FOAA 2A2QH 2W5EA 4MNVA 1P02A 1LQDB 2GZ8A 2F9OA 4BAOB 2OD3B 1FI8A 1G3CA 2XRCA 1YPLH 4AORA 1P01A 6CHAB 1GBLA 1SGFG 1EZQA 1P2IA 4BOHA 2OQ5A 1L0ZA 4X1QU 3ZZ6A 3TJVA 3S9CA 5DJ7A 3ZVBA 3D49H 1JXPA 2AMDA 1BBRE 1DE7H 3RU4T 3HK3B 3GY6A 4IBLH 1O31A 1XUFA 1D3PB 1IQKA 2ODPA 2RCEA 1FAXA 1L1GA 1TOMH 2XW9A 3BTQE 2EI6A 5FPTA 3RXBA 1ZMNA 3FP8E 1VITH 1ELFA 3F6UH 2Q6GA 3ZZ8A 5JB8S 4FU8A 2ZFQH 2AIQA 2FI4E 1MQ6A 2Q6FA 2VGCB 4D7FA 4THNH 2QCYA 1CU1A 4UONA 1VITF 1QB6A 4JYUH 1CGHA 1GJ9B 4NSVA 3AW1A 3GDVA 1THRH 4O97A 1OPHB 2ZC9H 1G32B 1LTOA 3PMAB 3A8DA 1OWJA 4Y10E 4X8VH 5GCHF 3MOCA 2FODA 2ZFTA 3E1XB 2GP9B 3GY3A 4IMQA 1O5EH 2ZFRH 2JH0D 5ABWA 4IC6A 4MPUA 1BOQA 1O2LA 1ANBA 1EOJA 2GTBA 3RLYH 1K1MA 2VIVA 3TNSA 3SU4A 1UVPA 1W3CA 1C1RA 2HRVA 3VB7A 1G30B 1AUTC 4ABGA 1O2VA 1K1OA 1FUJA 5FX6A 2AMQA 2JETC 2FS8A 1BMNH 4ZHMU 4WXVA 4XE4A 3LGTA 3UOUA 1IQLA 4WJG2 1BT7A 1YCPM 1V2PT 3MO9A 2QXIA 2NU0E 2QIQA 2RA0A 1TPSA 3V12A 1C2GA 1BTWA 1GHXH 4HFPB 1D3QB 1CT2E 1GJ4H 1WOFA 4KTUA 2R2WU 3S7KB 1LDTT 1O0DH 2J2UA 1GDUA 3SNEA 1TA2A 2VB0A 1LHEH 1RXPA 2G55A 2P95A 1B5GH 1DWDH 1GBEA 1H8DH 2BB4A 3OY5U 1NO9H 1W14U 2PR3A 3I78A 2JH5D 4UEHH 1NFXA 1VITG 4MQAA 2LNCA 2O8MA 4NIWA 3PMBB 3IG6B 1O3LA 3GCNA 6GCHG 1ETRH 2VVCA 1E34B 3TJNA 7GCHF 4LK4A 2BXUH 1TNKA 4I7YH 1W10U 5GCHG 1MH0A 2XCFA 1O3HA 5CHAB 1WU1A 1SSXA 5EQQA 1H9LB 2BLWA 3A81A 2GD4B 1BBRK 5AVDA 3SJ9A 1QHRB 2FIRH 4I32A 1Y3YA 3PMHB 1PPFE 4NWLA 1THSH 2VWLA 1FIWA 1NROH 1HUTH 1AVGH 5LPEA 4K1EA 2VVUA 3BG8A 3KCGH 2K1QA 3IWMA 5FBEA 5EXMA 4NZQA 1AMHA 1GMHG 2ZU2A 1A61H 2Y5GA 5GDSH 5C2ZA 1SGRE 1D3TB 1F0SA 1W13U 5DKMA 4K5ZA 2HGTH 3H7OA 4AX9H 1DWCH 1EB1H 3WY8A 4U30A 4TYDA 2WPKS 4Y8YA 3A84A 1GBJA 1ZHPA 3ODDA 1NRRH 2DUCA 1TB6H 3BEFB 4NWKA 1F0TA 1C5LH 3TNTA 3MH4A 1BTXA 1TNGA 1C5WB 1HXFH 1PPCE 3KGPA 3P8NA 1GI9B 2B5TB 1HNEE 3U8TH 7GCHG 2H1UA 3FZDA 3HGPA 1GI6A 1C2JA 2ZI2H 3SQHE 5CMXH 2A5AA 3RXKA
chains in the Genus database with same CATH superfamily
1E1QD 1AE8H 2BDBA 2ALVA 1T8LA 5ETXA 1MTUA 3SNBA 1SQTA 4KTSA 3PWCA 3W94A 1O36A 2G5NA 2OC0A 2J34A 3ZVGA 1PQ8A 2FOFA 1CBWB 2C3SA 3VXEH 1NS3A 2VIWA 1B7XB 2ZU4A 2SGPE 1MZDA 2ZHQH 1QJ7B 3A85A 4ZROA 5FHTA 3LDXH 2ZGHA 1N1LA 2GCTB 3RXLA 3RXDA 2BLQA 3TITA 3D62A 3UWIA 4FXGH 5DPAA 3ZVFA 2G52A 1TLDA 1C5YB 1QL9A 2F83A 2ZHFH 1V2WT 1LVOA 3M5LA 1SB1H 3MO3A 4UD9H 1UVSH 4YZUA 1OWIA 2SFAA 4H4FA 1DITH 5F03A 1GBAA 4ZH8A 1IHTH 2G81E 1GBFA 2GDEH 3A83A 3TH2H 3OTJE 2C8WB 2ZFPH 4O3UA 5DN6D 1TE0A 3H09A 1OWDA 1O2UA 2OP9A 2PP6A 3FN8A 4NSYA 4P02A 3KHVA 1U6QA 2BY7X 1SGYE 1YM0A 4U32A 3VB6A 4IS5A 1MAYA 3SUFA 1TALA 2C4FH 1V2QT 1AE5A 3VB4A 3TK6A 3TH4H 2P16A 1GGDC 1FQ3A 1TNJA 3NPSA 1XUGA 1JRSA 2BDCA 2QAAA 1HXEH 3VB3A 2GV7A 3SU0A 3T27A 3RXVA 5C5NA 4I33A 1QURH 2GX4A 5E0GA 1L2EA 6CHAC 2D2DA 1SVPA 5DO4H 2CK3D 2PKSB 3A87A 3LKWA 5HMAA 3JZ1B 1GCDA 3DSGA 1HIAA 5GNDA 1OSSA 3F2HA 2A4RA 4RKOB 4I8KA 2P93A 4BTUB 5F6MA 1ZJKA 3VXFH 3ZV9A 2CF9H 4D8NA 3UWJH 4ABDA 1HFDA 2BY8X 2RA3A 4LXBH 5DP7A 1ANDA 3RXGA 4OS4A 1SKYE 1XUJA 1HCGA 2Y5HA 4DJZB 2R3UA 3D65E 2BM2A 2G4UA 4DT4A 1YY3A 2HWLB 1Z7KA 3SQEE 1CA8B 2WYGA 2VGCC 3A8BA 3F0PA 1SPJA 1E0FD 2UUKB 1EAIA 1YP9A 4XBCA 1CQQA 1LMWB 3RXOA 1PPZA 2AH4X 1O3EA 1C1QA 2HVXA 4JZIA 4TY6A 2EEKA 1BTPA 1P11E 1AB9B 3U98H 1MD8A 4Y71A 5GJ4B 3T2NA 1SI5H 4B1TA 3RU4D 2F9NA 1C2DA 1YWUA 2OC7A 1O3DA 4ZMAH 3O8CA 3OSYA 1YPKH 2V0BA 2ZGBH 2J95A 1DSUA 4CBNA 1O2TA 1P2OA 5EG4A 4ABEA 1TNHA 1YPHE 2HNTE 1ZPZA 4GLYA 4IN2A 2TRMA 4D9QA 1C1TA 2OUAA 2XC5A 3P17H 1QRXA 1AUJA 3HATH 5ESTE 1XKAC 1W11U 1AD8H 1YLCA 3CENA 1Y3VA 3LH1A 4X6OA 1C4V2 4MTBA 2R3YA 2A7JA 3SNAA 5C20A 5C3NA 1C1PA 1K28D 1O30A 3SV9A 1C4Y2 3QZRA 2ZGJA 5DP6A 5EPYA 4FU7A 2FMJA 3RXJA 3QO6A 1SGEE 1O2KA 3RXRA 3DT0H 1XVMA 5EW2H 3BV9B 2FLBH 1ANEA 1G9IE 2PGBB 1QBVH 3H7TA 3Q3XA 2GKVE 1C5SA 4NA8A 5PTPA 5E2PA 2A4GA 3LGWA 5DP3A 1GBMA 2AFQB 3O8BA 3UQVA 4R0IA 1IQEA 2XNDD 3N7DA 1DANH 2G5VA 1ARBA 4CRGA 3H5CB 1O39A 1KY9A 5EPNA 5CE1A 4A7IB 2AGIX 2B9LA 3A7WA 4CRAA 4TY7A 1ELGA 4WXIA 1KYNA 1G36A 2TGDA 4GCHF 3NCLA 3S9AA 2Z3DA 3MFJA 1EOLA 3NWUA 2A7CA 2LELA 3A7TA 1EATA 3BN9A 4Y7BA 1XVOA 3NXPA 4GSOA 1PJPA 3ATWA 1WQVH 2BDHA 3UIRA 4HI3A 3E6PH 5EGMA 4AFQA 5L2ZH 2ZDKA 3PWBA 3GS9A 1MKXH 1DOJA 3U8OH 1TQ7B 3SV6A 2XTTB 3OEED 4JZDH 1P2KA 2H6MA 3JZ2B 3FP6E 2VIDA 1GBCA 2SGFE 2ZTYA 4K1SA 4Q2KA 5H4IB 1MQ5A 4VGCB 3QX5H 3PMJA 4X6PA 1ZSKA 3BTFE 3UTUH 1BMAA 4DT7B 4Y0YE 4JK5A 3V13A 1C5OH 1FDPA 5K0HA 3LGIA 2BQWB 1FMGA 1PQAA 5LGOA 3LGYA 3KL6A 1ZRBA 2PUQH 3A89A 4NA9H 3DCLA 2FLRH 2F9PA 4SGBE 2ZECA 2R2MB 3R3GB 4O9VA 1FY5A 1ID5H 2BOKA 1C5PA 3BF6H 1C1SA 2G8TA 2JH6D 4DVAU 1A4WH 4X6NA 4INKA 1PYTD 1Q3XA 3GYLB 2ZGXH 4BAQB 1ZYOA 1L4ZA 4NCYA 3QK1A 4NA7A 1C5UA 4X8SH 4RI0A 3ZZ3A 1TNLA 4ZKRU 2QY0B 3KN2A 1LCYA 1DWBH 3ZZAA 1XXDA 3F1SB 1MTNB 1OYTH 1FY8E 1BMFD 1ZJDA 1DXPA 3MTYA 5G4BA 1ZTLA 3ATKA 1NFYA 3QGJA 1T8NA 2B8OH 2AIPA 1MMJN 2ZTXA 1TBQH 4I8LA 4BAMB 5A8ZA 3EGKH 1UJ1A 1HAXB 2RDLA 1EJAA 4TWWA 1C1VH 1TX8A 2H2ZA 3PB1E 3NK8A 2FYQA 1AQ7A 3T29A 3GCTF 1GWAA 3PROA 1W0KD 1O3JA 3EAJA 1C1UH 1Z71A 2A5KA 1NRNH 1SGPE 4A6LA 4Q7YA 1K1JA 1HAPH 1RJXB 1D6RA 5SGAE 3UNRA 4PROA 1AHTH 3BEIB 3LOXA 1BITA 1CBWC 1HDTH 1KXDA 4Y8XA 2BMGB 4QT8C 3ZZCA 5FXLA 3B23B 1CHOG 1C5MD 2GV6A 2ZTZA 2QXGA 3RXHA 1FX0B 1S6LA 1VZQH 1GDQA 1VGCB 5C94A 2GCTC 4FUEA 2HLDD 3T25A 5F8XA 3ZYDA 4F55A 2ZDNA 3SI3H 2KAIB 3N7EA 5HYOA 1SQOA 3RM2H 3RXQA 1C1MA 1HV7A 3BTEE 1F0UA 3EE0B 1GL0E 1SGDE 2H9HA 3HGNA 1O3OA 1CHGA 3OX7U 5TCAA 4LZ1H 1O3NA 4ISHH 1NRQH 4BNRA 1GI0A 3KNXA 2CHAB 4IGDA 4JZEH 3UUZA 1EKBB 1Z6JH 2D8WA 2J94A 1QA0A 1F7ZA 1BIOA 1ORFA 1OOKB 1TABE 2F91A 2A32A 3QZQA 3F2FA 3MU8A 2ZDLA 4CHAB 3TU7H 1T32A 2WPMS 1UTPA 1SC8U 2IOTA 3M7UA 3GCHB 4RT0A 3SGAE 1ANCA 1O33A 1KTSB 3Q00A 1UTNA 1XKBC 2BD7A 3P95A 3I29A 2OINA 1HAZB 3A80A 3EDXB 2BZ6H 2CGAA 1P57B 1V2VT 1EQ9A 1QJ6B 4JK6A 1SGFA 4U2WA 3TVJB 5JBAS 3GCTG 1KDQB 1SGCA 3L6PA 3TIUA 4YOIA 4YM9A 2BQ6B 3G01A 4CRDA 8LPRA 4Q4LA 1ESBA 2XBYA 2STBE 4UFEH 2C8YB 5FPSA 2VU8E 3SZNA 1ABIH 2AGEX 3ESTA 1XXFA 2XYAA 2PKSC 1RIWB 2CMYA 3P8GA 4DURA 3FANA 1ESTA 2ZPSA 1TPAE 2ZWLH 4U01A 4MPXA 1YPGH 2KCYA 3A7VA 4Q7XA 3TK9A 1GJ5H 2NU2E 1HJAB 4O03A 4NIVA 1GHAF 2XC4A 4BXSA 3RXTA 1P04A 3K65B 1GHZA 1MU8B 3MU4A 1ARCA 3BIVH 1E38B 1P0SH 1KXEA 1NY22 5TCCA 1KSNA 1YCPH 3E16B 4UE7H 5ESBA 1INCA 1DWEH 3IITA 2BVSH 2J38A 3KYFA 4XOJA 1Y3UA 2EC9H 3QWCH 1A0LA 4JYTA 4O3TA 2V3HH 1A3BH 2CXVA 1MU6B 1QCPA 1QNJA 3SV2H 3BTME 1IOEA 3PTBA 1O2IA 1SGNE 2J9NA 2PKAA 1O3IA 1TMBH 4JZ1A 1O3AA 2AGGX 1IQIA 4X8UH 4X2VA 1C2KA 4DIHH 1BTZA 1M9UA 1AFQB 2ZQ1A 1DDJA 4ZXXH 4AN7A 1D4PB 1AI8H 1GPZA 1K22H 1ZRKA 2CJIA 1BCUH 1TGNA 1AB9C 1EZUC 3RMNH 1KXCA 3UNQA 5J4SA 1ZTKA 3STJA 1ELBA 4CBOA 3SU3A 3ZVCA 2SNWA 3HPTB 2P59A 1UTMA 5EJLA 3PLKA 1OP2A 1YYY1 2UUYA 4E05H 1V2LT 2ZCKP 1GHYH 3E3TA 4HG6A 3LU9B 2H9TH 4K1TA 2XOKD 3DHKH 4BAHB 1K0HA 4Y6DA 1K1PA 3OU0A 5EJ1A 4X2XA 2OBQA 3UPEA 1SGTA 5HM2A 3BIUH 1SMFE 3ZVEA 1TIOA 1DS2E 2J92A 1C2LA 1K9OE 5C1XA 1EFRD 2NU3E 2XCNA 1FN8A 2SGAA 1S6FA 2ZIQH 1GJCB 2HPPH 1J14A 2GZ7A 4WMDA 5F8ZA 4TSFD 1UTKA 2A4QA 1O2ZA 1QIXB 2PGQB 1P05A 3QTOH 2ZCLP 2JIZD 1AZ8A 2QC2A 1G3EA 1XX9A 4RN6A 3BSQA 1KTTB 1WBGB 1UVOA 2UUJB 2GVFA 3LGUA 1HAVA 1P09A 1S0RA 5HM9A 2FX4A 4X0WU 4GUXA 3UR6A 1OHHD 2HOBA 4YT7H 4CRCA 2FTMA 5GXPA 2BHGA 4I8HA 3FVFB 4AC9A 3SJ8A 3SYJA 1Z8RA 2ALPA 5E2OA 2VBCA 4ZAEA 4YTAA 3RXIA 1P3CA 1CVWH 4IMZA 5F53A 4GPGA 1O2QA 3PV5A 4I31A 2M5TA 1S6HA 1NM6A 1DT2A 2GJGA 1O3BA 2QYIA 3RXFA 1N8OB 4WWYA 2UUFB 2A4OA 3ZZ9A 3NZIA 4A5TS 3NKKA 1NZQH 2ZF0H 1RGQA 2BTCE 1GG6B 3F9EA 1YPJH 1A5HA 5JB9S 2J98A 2A45B 2VIOA 1TGTA 4FU9A 2XBWA 3KEEA 1S82A 2VVVA 1BTYA 2KCOA 4VGCC 3VEQB 4AYVB 3M5OA 3TLOA 5B6OA 2CV3A 1HJ9A 5K7RA 1WUNH 3GY5A 1S85A 3RXUA 4B73A 4DGJA 1SHYA 2HALA 1ZZZA 1QB1A 2VNTA 2WPJS 1GVLA 4H6SB 2M2AA 5EODA 1EZSC 2KCPA 1LPGB 1C1NA 1HYLA 1UK3A 3ITIA 4I86A 1GHWH 1JRTA 2A7HA 1EUFA 1Z6EA 2WYJA 1DLKB 1GBDA 1EJMA 2ZCHP 1MTSA 2H5CA 3NUMA 2XBVA 4K2YA 1Y8TA 4BTIB 2ASUB 3HK6B 1YLNA 5DSFA 2F3CE 4WF8A 2PKAB 1MZAA 3W1EA 1KIGH 4AFSA 1JOUB 2UWPA 1F5LA 1EAUA 4A1XA 3PRBA 5T3HA 1E79D 1OKXA 4ZHAA 2R0LA 1PPEE 2BDYA 1A0JA 5HIZA 1KXAA 1OXGA 2FX6A 2C90B 4ISNA 5CDFE 1TWXB 2VWOA 1DY8A 5BPEA 1GL1A 1DM4B 3AASA 4WMEA 1PQ5A 2VIQA 4CRFA 8GCHF 1RD3B 2P3TB 1O2XA 5JDUB 4A1TA 2OBOA 1FLEE 3A8AA 3QLPH 2K8IA 1XUIA 3SNDA 3TGJE 1TPPA 1UHBA 4BXWA 1MKWH 1WV7H 4KELA 4ABHA 4E06H 3BTKE 1YGCH 1B0FA 2QF0A 1YPMH 1P9SA 4B76A 2A2XH 2Y7ZA 4IC5A 1K1LA 1VKYA 4X1PU 2OTVA 1DXWA 4XFQA 2FESH 2BX3A 3P8FA 3B8JA 2Z3EA 1VGCC 4MDSA 2VWNA 2W3KA 1AGJA 4X2YA 2FOGA 5EW1H 1QZ8A 2SGQE 3ZVDA 1T4UH 3F3BA 3F9FA 1IQFA 3GCOA 1HGTH 1BHXB 3A82A 1XUHA 3M61U 3EA8A 1NU7B 5C0TA 2PFEA 3KIDU 1NESE 1P3EA 2LPRA 1ELEE 1TRNA 1J9CH 1HAVB 1SLXB 1HBTH 4XDEA 2BD2A 1A5GH 3T62A 1LPKB 2CHAC 2FI3E 1GHBF 2BY5X 4CH2B 2QF4A 4UFDH 4ZKOU 3CP7A 1SQAA 1O2PA 3ZIAD 2W6ID 1NBMD 4WH6A 1O34A 1O2OA 2C93B 1L1NA 2Z9IA 1PPHE 4CHAC 1LKAA 4K8YA 1SG8B 2ZGCA 3ENSB 3VB5A 3PV2A 2HVYB 1UW7A 3MI4A 3GCHC 4KP0A 1V2OT 3QTVH 2PSXA 1P2NA 1K2I1 3SJOA 3SGBE 1GI1A 5EU8A 1GMDF 4Z0KA 3U9AH 1FPHH 1TGBA 2J97A 2ANYA 2J98B 3MH7A 3M5NA 1SLUB 5GPIB 1BDAA 1E37B 5DP8A 3S0NA 1W0YH 2FS9A 5BRRE 5DG6A 1RTFB 1RIWC 2ZDMA 2ZFSA 1THPB 4TT3D 1MCTA 1FN6A 1Y3XA 2OLGA 4K3JA 2ANMH 1HJAC 1X7AC 1QQUA 3DFLA 3MU0A 1UVTH 5DK1A 1K21H 1BJUA 3TGKE 2Z6BD 2IJD1 1FIZA 2GT7A 1QB9A 3SUEA 3Q76A 1ELCA 4X8TH 1C5RA 4Y79A 1O5DH 2ILNA 1LHDH 4HZHA 1EZXC 4ISIH 1P06A 2OCVB 5DP5A 3M36A 3C27B 3QUMP 4DY7B 2QF3A 4B6EA 1DX5M 1BMLA 4IW4E 4GHQA 1GCTB 4B2CA 1O5CB 1Y3WA 2WPIS 1ZTJA 3RC6A 2FOBA 2KAIA 1AY6H 1AFQC 1P12E 2BZAA 1EASA 5FBIA 2V7QD 2OXSA 1BRAA 2WHXA 4F49A 1TNIA 2PW8H 1GMCF 2FDAA 4NGAH 1EX3A 2ANWA 2VH0A 1WXRA 3BTTE 1DSTA 3SU5A 2QXHA 1ETTH 4ZCNA 1O2WA 5IK2D 1UHBB 1SFIA 1A7SA 4F48B 4YT6H 1MAXA 2FO9A 2O8WA 4YOJA 1HAYB 4E7RG 2SGEE 1CGJE 3SHCH 4TWYA 1MKXK 2RG3A 6LPRA 1AIXH 1G3BA 3LJOA 1O38A 1FAKH 1RTKA 3VPKA 5JYIA 2G4TA 2Q1JA 3MHWU 1NN6A 2ZDAH 3SOSA 3FO8D 5AFZH 3GYMA 3M5MA 4AYYB 1QRWA 2GZ9A 2LP6A 2STAE 3FFGA 4RKJB 4XBBA 5CHAC 1ELVA 2Q6DA 2WPHS 1TRYA 1IQNA 1GDNA 1FJSA 4YO9A 4DG4A 1SGIB 3O8RA 4AGKA 3RMLH 1KDQA 3RXEA 1GI7B 1A3EH 1O5GH 3ZYEA 3U1JB 2ODYB 1LVMA 4LOYH 2JJ1D 3ZZ5A 1TPOA 1BTUA 4CR9A 2Y81A 4Q80A 1DVAH 2W26A 1SOZA 2BY9X 5EXNA 2UWLA 3HKIB 4X2WA 1XUKA 3K6YA 5T6FA 1C4U2 1MTVA 1O2JA 4ZXYH 1HAGE 4FETA 4R8TB 1ELDE 2L6OA 2FOCA 2ZZUH 4BANB 4ISOA 1Z8JB 3BTHE 3TJOA 1NFWA 1ELTA 2FOMB 1ZHRA 1GJ7B 2FYRA 1BQYA 1EB2A 1N8OC 4HTCH 1GMCG 1O3MA 1OP0A 3M35A 1WSSH 3P8OA 1WTGH 3T26A 1PQ7A 4Z1MD 1GBHA 5A0CA 3SZEA 4Y8ZA 1GG6C 3LT3A 1IHSH 3M7TA 1W0ZU 3RU4E 1B0EA 3ELAH 1P9UA 1P10A 2H5DA 1BA8B 2FPZA 2DE8A 1IAUA 2BYAX 4AB9A 1EPTA 3RMMH 1W7GH 1PFXC 3OY6U 1QA7A 3K2UA 1GI4A 4GCHG 5I46H 2Z9GA 4FUJA 1HAOH 5C1YA 4ABAA 2ODQA 3LH3A 5TJXA 2ZKSA 1S0QA 2JJ2D 5C17A 1FY3A 4WMFA 2KFWA 5EJZA 5LH8A 1OYQA 1QGFA 1IQGA 1LPZB 5AHGH 4J1YA 5EXLA 1LQEA 3F0OA 1P8VC 1COWD 3QDZB 4KTCA 1DFPA 1O2HA 3SUDA 1UTJA 4NFEA 1SFQB 1UCYH 2PSYA 1NRSH 1HRTH 3OEHD 4NFFA 3T5FH 3SV8A 4YLUA 1YPEH 4WVPE 3F9GA 1LKBA 1O3CA 3UY9A 1MTWA 2ZHEH 2RDEA 3SJIA 2A0QB 3BG4B 4HGCA 3R0FA 1UMAH 2XBXA 5L2YH 1QTFA 3A8CA 2BLVA 4MNXA 1HB0B 3P92A 1W7XH 4I8GA 2OK5A 3SV7A 3VGCB 2Z9JA 3EA7A 5L30H 1LHFH 1AKSB 1CGIE 2O9QA 2FEQH 3URDA 3O8DA 4OGXA 1ZSJA 4UDWH 1DLEA 2F9VA 1OS8A 3F9HA 1ETSH 4OGYA 4ABFA 1CO7E 2Y82A 1V2RT 1ELAA 1O32A 3F68H 2EI7A 4B71A 1EXFA 3KQCA 4Q7ZA 1TRMA 1FPCH 2FWWA 2WZQA 4YXWD 2P8OB 2TGPZ 2ULLA 4GHTA 1QY6A 3W95A 1ZR0A 1NTPA 1O2GH 1TX7A 3D23A 5FAHA 5C67A 1QL8A 4FUDA 2WV9A 2A1DB 1F92A 4AB8A 3SNCA 2GMTB 4WH8A 1YCPK 3E90B 3LC3A 5L6NH 1GBKA 1BHXF 3AW0A 3RXCA 4B2AA 4ABJA 2C8XB 3MNXA 7LPRA 1GJ6A 1TMUH 3UR9A 3K6ZA 4FUHA 1T8MA 4JCNA 1EP5A 1NT1A 1V2NT 1E1RD 2NU1E 8ESTE 2D1JA 3STIA 6GCHF 1QBOA 4CREA 3E91A 3SORA 2ZU3A 7ESTE 4X1RU 5FPYA 4DW2U 2VWMA 1W8BH 2A5IA 4NIXA 1HLTH 4XD7D 3S7HB 4IN1A 2FI5E 3TJUA 2BDIA 1BTHH 1VCQA 2Z3CA 1NRPH 2ZG0H 1TA6A 5A0AE 1C9TA 3K9XB 1EPTB 2HLCA 3M7QA 1H8ED 1W2KH 1C1OA 1QJ1B 1NU9A 3ZZ7A 3MMGA 2ZP0H 1J17T 4B6FA 5EIYA 4ABIA 2QXJA 2VH6A 3KF2A 5FX5A 3LGVA 4OS5A 2F9BH 3A7YA 1EJNA 1GMHF 3GY4A 2K0QA 1FY4A 1O3GA 1O2SA 1TAWA 1AFEH 1H9IE 2R9PA 1V2UT 4RT1A 8KME2 1S5SA 3M3TA 4ZKSU 1IQMA 1ZGVA 2D26C 4GVUA 2C8ZB 1ZPCA 4NG9H 5T1VA 1SGQE 3SHAH 2WUCA 2YNBA 1A5IA 1T4VH 4M7GA 1P03A 1ZPBA 1TBZH 1T7CA 4H42U 1GHAG 1GCTC 5EOKA 1FZZA 1YKTA 4BTTB 2JDID 1J8AA 9ESTA 2TGAA 1YF4A 1AN1E 3ZVAA 2G00A 5A09A 2BXTH 1IQHA 5KEDA 2WPLS 5LPFA 1BMMH 4KKDA 1S84A 3GY8A 4BAKB 2H9EH 1Z8GA 5LPRA 1OP8A 1Q31A 3PLPA 4D9RA 2BLOA 3MH5A 1GJ8B 1CE5A 4CRBA 4ZKNU 2BDGA 1E35B 4Y7AA 2Z9LA 1KXBA 2O8UA 1TONA 3PYHA 3B9FH 2W7SA 2ZQ2A 4AFUA 5A0BA 2RFKC 1QBNA 4ZHLU 1DUEA 1RRKA 3PLBA 3SU2A 3ZZDA 3ZZBA 1JWTA 4NIYA 3I77A 1Y5UT 1W12U 4MVNA 1UK2A 3V0XA 1QFKH 5JBBS 3EQ0H 2ZEBA 3ATMA 3SI4H 1V3XA 3KQEA 1BBRH 3SN8A 7KMEH 3U69H 2FXRA 4ESTE 1C5NH 2AMPA 5DP9A 3CNRA 1CA0B 3PTNA 4WY3A 3PO1B 1VJ9U 1O3PB 5T6DA 2Y6TA 3QN7A 2XNIA 2NU4E 2O8LA 1HAHH 2OC8A 1WTHD 1C5QA 1F5KU 2BVRH 3PV4A 1MD7A 1WCZA 3V3MA 1AVXA 2V35A 1HJ8A 3DUXH 2UWOA 4YOGA 3AVZA 1PYTC 2ZA5A 5FL7D 1C1WH 4B75A 3U1IB 1QQ4A 3RMOH 2FZZA 4XRNA 4X1NU 3LONA 2B0FA 3RLWH 1P2QA 3SGQE 1V6DA 5FCRA 1ZMJA 2V3MA 3RXPA 2Y5FA 3V7TA 2GCHF 2NWNA 2YNAA 1VCWA 3RP2A 4OS2A 1C2IA 4ISLA 1GVZA 3Q3YA 3OE7D 1SLWB 1O2RA 1G37A 1O3KA 4INHA 1Z1IA 1C9PA 4Y11E 3EE7A 3PM3A 1H9HE 1GHVH 1AU8A 1MKWK 1MTNC 1FNIA 1SBWA 3E0PB 2AERH 3MNSA 4AFZA 3U8RH 2ZDVH 5KGOA 5EQRA 1D3DB 3M3SA 5F8TA 1RTLA 3SU6A 2PV9B 2TPIZ 2ZHDA 4UFGH 4GAWA 3P70B 4B74A 4E7NA 2YOLA 1G3DA 4FUGA 5T6GA 2BD9A 4ASUD 1JMOH 1C2FA 1O5BB 3S69A 1GVKB 4CH8B 1UO6A 1ZGIA 1LHCH 2SGDE 2IN2A 2J4IA 1PPGE 2OC1A 3MNBA 1ZMLA 4FUBA 1EP6A 4FVBA 5E0JA 2I6QA 3C1KA 3SUGA 3SW2B 4AGJA 3DD2H 1NPMA 1A1RA 4AG2A 2PUXB 1Y5BT 5IYTA 1TGSZ 3AK5A 3TGIE 2BD3A 3UOPA 4D76A 2QGRA 1HAIH 1LVBA 2W7UA 1UTLM 3A7ZA 4JMYA 1BRBE 1E36B 4NZLA 1H8HD 3FZZA 1K1IA 3DSOA 3GISB 3OTPA 2QA9E 4ZUHA 3GDSA 4MPWA 3FKSD 3VG8A 2EA3A 2WV5A 4ASHA 4FUCA 2P3FH 3UQOA 3OYPA 3SBKA 5E0HA 1A0HB 1C2MA 2IJOB 3UAIC 3BG4C 1QRZA 2GCHG 2TBSA 1EAXA 1JBUH 3DFJA 5HGGA 2FTLE 1J15A 1ACBE 1GJBB 1ZOMA 1OX1A 1LO6A 5DP4A 1MUEB 1ABJH 2BY6X 2PTNA 4RSPA 3RDZA 5HXFA 4YLQH 1MBQA 3VGCC 2IPHA 1D6WA 2F4LA 1TFXA 4MG3A 1D9IA 3KQBA 3ATIA 1Y59T 5EQSA 5JBCS 3P6ZB 3MO6A 2BD8A 1DUAA 1TOCB 2VIPA 1S83A 2P8OC 4JYVH 3URCA 2WUBA 1FONA 3T28A 1FXYA 8GCHG 5C1UA 1S81A 3L3TA 1SOTA 1UVUH 1L1JA 3MH6A 1O2NA 2CN0H 1VCPA 2GMTC 3UREA 1L4DA 4Z6AH 1BB0B 2V3OH 2TGTA 3SU1A 1QR3E 1C2EA 1O3FA 2JETB 1V2JT 3OAAD 3TPIZ 1V2KT 5AF9H 4XBDA 1GJDB 1C5XB 2WPDD 3A7XA 1KXFA 1UTOA 2TIOA 4ABBA 1NFUA 1OWHA 2ZFFH 2PWXA 1C2HA 9LPRA 3ZZ4A 1UK4A 4UFFH 1GJAB 1CT4E 3UB0A 4CR5A 1UTQA 1V2TT 1XM1A 1TX6A 4K69A 2ZNKH 3EA9A 1GBTA 2WINI 3NRLA 2BQ7B 5A8XA 3FP7E 2I6SA 5GIBA 3S9BA 5JPMH 4F4OC 2BOHB 1J16A 1DICA 3HKJB 2BVXH 4K60A 5JBTA 2QV1A 1GHBG 2BX4A 1UCYE 3GY7A 2XWAA 1EPTC 3Q77A 3SJKA 2ZU1A 2FP7B 2Z94A 4MNYA 3FAOA 1H4WA 3M37A 5J4QA 3BTWE 1GI3A 1O5AB 2KZ4A 4D7GA 3Q3KA 5IDKA 3MU1A 1P2JA 1PPBH 2W3IA 3GY2A 1SHHB 1YLDA 1Z1JA 2EI8A 6ESTA 4X6MA 4OS6A 4JZFH 3E8LA 3EYDA 3RC4A 5FCKA 3LJJA 3GICB 1HPGA 1AKSA 5HKKD 3L33A 1ESAA 1GMDG 1DPOA 2KCAA 3DA9B 1KLJH 1KMHB 1H8IH 1O2YA 3PRDA 2PHBA 4FUIA 1K1NA 2ZPRA 3CS7A 4KGAA 1ZSLA 2A31A 1Z8IB 1F5RA 1LHGH 2AHME 2F9UA 2Y80A 1ZLRA 5GWZA 2O8TA 4Y0ZE 1TQ0B 4B2BA 3RUOA 4OS1A 4I8JA 3ZV8A 2DE9A 2PTCE 2R0KA 1OWEA 1P2MA 1O5FH 2FOEA 2GGVB 1H1BA 1AWFH 1GBBA 4X1SU 2CF8H 2Z7FE 1NBME 2GT8A 2ZPQA 1LVYA 1O2MA 1SL3A 2YMSB 4AOQA 5A8YA 1AO5A 3GDUA 5DGJA 4M9FA 1RS0A 5AFYH 4DIIH 3MWIU 3N7OA 3M3VA 5B6LA 1YC0A 3BTGE 4MPVA 5I25A 1C5TA 1TYNA 1GI5A 3RXAA 1JIMA 2XXLA 2G51A 4INLA 2XC0A 5CHBA 5A2MH 2WV4A 1CHOF 4A92A 2VINA 3ODFA 1F0RA 1NC6A 3QGNB 4FOUC 4H6TA 3TK5A 1HIAB 2ANKH 2YMSD 2FOHA 3AAVA 1MABB 1TGCA 1GI2A 4K8BA 3KQ5A 1WYKA 2PLXA 1T8OA 2P3UB 1A2CH 1CA0C 4AZ2B 2AEIH 1N6YA 1IQJA 2AS9A 2IPQX 1GBIA 3PO1C 1SLVB 2HPQH 1XMNB 3A86A 1AWHB 1V2ST 1AZZA 2BDAA 1G2LA 3SO3A 3TH3H 4YESB 1TMTH 3RC5A 2ZU5A 1V2MT 4LZ4B 2THFB 3BEUA 1YBWA 3WWBA 3LC5A 2QN5T 1GI8B 1EAWA 1Q2WA 1O37A 1SR5C 3AAUA 1BUIA 4ACBA 1RFNA 2BD4A 2Y7XA 3RXMA 2GDDA 1T31A 4TPIZ 4P00A 1F2SE 3A88A 1CSOE 1UCYK 1VR1H 4OS7A 4XSKU 3UFAA 1BJVA 4Y76A 2JKHA 1A46H 2XWBI 4DOQA 1O35A 2OQUA 1C5ZB 2ZHWH 1BZXE 3E0NB 3N99A 1BRUP 1KLIH 3LPRA 3GOVB 4MNWA 2V6NA 1DY9A 1Y5AT 2B7DH 3ATLA 4MLFB 5C5OA 2ZO3H 3UNSA 2FM2A 3MU5A 4AG1A 1YPHC 2HNTC 5E8EH 2KM0A 1WAYB 1AVWA 2QF5A 1KLTA 1FV9A 2BD5A 2ESTE 1BRCE 2SNVA 1JIRA 3RXSA 4TPYA 2QE7D 2VJ1A 4J2YB 1OWKA 4A1VA 3LIWA 1CT0E 1MBMA 1W0JD 2HNTF 1MCVA 1FY1A 3CS0A 1G2MA 1WQSA 5HIYA 3BTDE 1GGDB 4FVDA 2Z9KA 1C5VA 3RM0H 2P94A 1ZHMA 1N6XA 3MNCA 4SGAE 4DCDA 1VJAU 2AYWA 3KQDA 3VFEA 4FUFA 3MYWA 1TBRH 1QL7A 2FOAA 2A2QH 2W5EA 4MNVA 1P02A 1LQDB 2GZ8A 2F9OA 2KX4A 4BAOB 2OD3B 1FI8A 1G3CA 2XRCA 1YPLH 4AORA 1P01A 6CHAB 1GBLA 1SGFG 1EZQA 1P2IA 4BOHA 2OQ5A 1L0ZA 4X1QU 3ZZ6A 3TJVA 3S9CA 5DJ7A 3ZVBA 3D49H 1JXPA 2AMDA 1BBRE 1DE7H 3RU4T 3HK3B 3GY6A 4IBLH 1O31A 1XUFA 3MQKC 1D3PB 1IQKA 2ODPA 2RCEA 1FAXA 1L1GA 1TOMH 2XW9A 3BTQE 5C0UA 2EY4C 2EI6A 5FPTA 3RXBA 1ZMNA 3FP8E 1VITH 1ELFA 3F6UH 2Q6GA 4Q63A 3ZZ8A 5JB8S 4FU8A 2ZFQH 2AIQA 2FI4E 1MQ6A 2Q6FA 2VGCB 4D7FA 4THNH 2QCYA 1CU1A 4UONA 1VITF 1QB6A 4JYUH 1CGHA 1GJ9B 4NSVA 3AW1A 3GDVA 1THRH 4O97A 1OPHB 2ZC9H 1G32B 1LTOA 3PMAB 3A8DA 1OWJA 4Y10E 4X8VH 5GCHF 3MOCA 2FODA 3FOAA 2ZFTA 3E1XB 2GP9B 3GY3A 4IMQA 1O5EH 2F43B 2ZFRH 2JH0D 5ABWA 4IC6A 4MPUA 1BOQA 1O2LA 1ANBA 1EOJA 2GTBA 3RLYH 1K1MA 2VIVA 3TNSA 3SU4A 1UVPA 1W3CA 1C1RA 2HRVA 3VB7A 1G30B 1AUTC 4ABGA 1O2VA 1K1OA 1FUJA 5FX6A 2AMQA 2JETC 2FS8A 1BMNH 4ZHMU 4WXVA 4XE4A 2EQNA 3LGTA 3UOUA 1IQLA 4WJG2 1BT7A 1YCPM 1V2PT 3MO9A 2QXIA 2NU0E 2QIQA 2RA0A 1TPSA 3V12A 1C2GA 1BTWA 1GHXH 4HFPB 1D3QB 1CT2E 1GJ4H 1WOFA 4KTUA 2R2WU 3S7KB 1LDTT 2KR7A 1O0DH 2L74A 2J2UA 1GDUA 3SNEA 3WWFA 1TA2A 2VB0A 1LHEH 1RXPA 2G55A 2P95A 1B5GH 1DWDH 3DSPA 1GBEA 1H8DH 3WW7A 2BB4A 3OY5U 1NO9H 1W14U 2PR3A 3I78A 2JH5D 4UEHH 4ACAA 1NFXA 1VITG 4MQAA 2LNCA 2O8MA 4NIWA 3PMBB 3IG6B 1O3LA 3GCNA 6GCHG 1ETRH 2VVCA 1E34B 3TJNA 7GCHF 4LK4A 2BXUH 1TNKA 4I7YH 1W10U 5GCHG 1MH0A 2XCFA 1O3HA 5CHAB 1WU1A 1SSXA 5EQQA 1H9LB 2BLWA 3A81A 2GD4B 1BBRK 5AVDA 3SJ9A 1QHRB 2FIRH 4I32A 1Y3YA 3PMHB 1PPFE 4NWLA 1THSH 2VWLA 1FIWA 1NROH 1HUTH 1AVGH 5LPEA 4K1EA 2VVUA 3BG8A 3KCGH 4OM9A 2K1QA 3IWMA 5FBEA 5EXMA 5KECA 4NZQA 1AMHA 1GMHG 2ZU2A 1A61H 2Y5GA 5GDSH 5C2ZA 1SGRE 1D3TB 1F0SA 1W13U 5DKMA 4K5ZA 2HGTH 3H7OA 4AX9H 1DWCH 1EB1H 3WY8A 2WSSD 4TYDA 2WPKS 2YMSC 4U30A 4Y8YA 2W6JD 3A84A 1GBJA 1ZHPA 3ODDA 1NRRH 2DUCA 1TB6H 3BEFB 4NWKA 1F0TA 2J5UA 1C5LH 3TNTA 3MH4A 1BTXA 3F2GA 1TNGA 1C5WB 1HXFH 1PPCE 3KGPA 3U28C 3P8NA 1GI9B 2B5TB 1HNEE 3U8TH 7GCHG 3KYGA 1WDIA 2H1UA 3FZDA 3HGPA 1GI6A 3OFND 1C2JA 2ZI2H 3SQHE 5CMXH 2A5AA 1SQRA 3RXKA
chains in the Genus database with same CATH topology
1AE8H 2BDBA 2ALVA 1T8LA 5ETXA 1MTUA 3SNBA 1SQTA 4KTSA 3PWCA 3W94A 1O36A 2G5NA 2OC0A 2J34A 3ZVGA 1PQ8A 2FOFA 1CBWB 2C3SA 3VXEH 1NS3A 2VIWA 1B7XB 2ZU4A 2SGPE 1MZDA 2ZHQH 1QJ7B 3A85A 4ZROA 5FHTA 3LDXH 2ZGHA 1N1LA 2GCTB 3RXLA 3RXDA 2BLQA 3TITA 3D62A 3UWIA 4FXGH 5DPAA 3ZVFA 2G52A 1TLDA 1C5YB 1QL9A 2F83A 2ZHFH 1V2WT 1LVOA 3M5LA 1SB1H 3MO3A 4UD9H 1UVSH 4YZUA 1OWIA 2SFAA 4H4FA 1DITH 5F03A 1GBAA 4ZH8A 1IHTH 2G81E 1GBFA 2GDEH 3A83A 3TH2H 3OTJE 2C8WB 2ZFPH 4O3UA 1TE0A 1OWDA 1O2UA 2OP9A 4NSYA 3KHVA 1U6QA 2BY7X 1SGYE 1YM0A 4U32A 3VB6A 4IS5A 1MAYA 3SUFA 1TALA 2C4FH 1V2QT 1AE5A 3VB4A 3TK6A 3TH4H 2P16A 1GGDC 1FQ3A 1TNJA 3NPSA 1XUGA 1JRSA 2BDCA 2QAAA 1HXEH 3VB3A 2GV7A 3SU0A 3T27A 3RXVA 5C5NA 4I33A 1QURH 2GX4A 5E0GA 1L2EA 6CHAC 2D2DA 1SVPA 5DO4H 2PKSB 3A87A 3LKWA 5HMAA 3JZ1B 1GCDA 1HIAA 1OSSA 2A4RA 4RKOB 4I8KA 2P93A 4BTUB 5F6MA 1ZJKA 3VXFH 3ZV9A 2CF9H 4D8NA 3UWJH 4ABDA 1HFDA 2BY8X 2RA3A 4LXBH 5DP7A 1ANDA 3RXGA 4OS4A 1XUJA 1HCGA 2Y5HA 4DJZB 2R3UA 3D65E 2BM2A 2G4UA 2HWLB 1Z7KA 3SQEE 1CA8B 2WYGA 2VGCC 3A8BA 1SPJA 1E0FD 2UUKB 1EAIA 1YP9A 4XBCA 1CQQA 1LMWB 3RXOA 1PPZA 2AH4X 1O3EA 1C1QA 2HVXA 4JZIA 4TY6A 2EEKA 1BTPA 1P11E 1AB9B 3U98H 1MD8A 4Y71A 5GJ4B 3T2NA 1SI5H 4B1TA 3RU4D 2F9NA 1C2DA 2OC7A 1O3DA 4ZMAH 3O8CA 3OSYA 1YPKH 2V0BA 2ZGBH 2J95A 1DSUA 4CBNA 1O2TA 1P2OA 5EG4A 4ABEA 1TNHA 1YPHE 2HNTE 1ZPZA 4GLYA 4IN2A 2TRMA 4D9QA 1C1TA 2OUAA 2XC5A 3P17H 1QRXA 1AUJA 3HATH 5ESTE 1XKAC 1W11U 1AD8H 1YLCA 3CENA 1Y3VA 3LH1A 4X6OA 1C4V2 4MTBA 2R3YA 2A7JA 3SNAA 5C20A 5C3NA 1C1PA 1K28D 1O30A 3SV9A 1C4Y2 3QZRA 2ZGJA 5DP6A 5EPYA 4FU7A 2FMJA 3RXJA 3QO6A 1SGEE 1O2KA 3RXRA 3DT0H 1XVMA 5EW2H 3BV9B 2FLBH 1ANEA 1G9IE 2PGBB 1QBVH 3H7TA 3Q3XA 2GKVE 1C5SA 4NA8A 5PTPA 5E2PA 2A4GA 3LGWA 5DP3A 1GBMA 2AFQB 3O8BA 3UQVA 4R0IA 1IQEA 1DANH 2G5VA 1ARBA 4CRGA 3H5CB 1O39A 1KY9A 5EPNA 5CE1A 4A7IB 2AGIX 2B9LA 3A7WA 4CRAA 4TY7A 1ELGA 4WXIA 1KYNA 1G36A 2TGDA 4GCHF 3NCLA 3S9AA 2Z3DA 3MFJA 1EOLA 3NWUA 2A7CA 3A7TA 1EATA 3BN9A 4Y7BA 1XVOA 3NXPA 4GSOA 1PJPA 3ATWA 1WQVH 2BDHA 3UIRA 4HI3A 3E6PH 5EGMA 4AFQA 5L2ZH 2ZDKA 3PWBA 1MKXH 1DOJA 3U8OH 1TQ7B 3SV6A 2XTTB 4JZDH 1P2KA 2H6MA 3JZ2B 3FP6E 2VIDA 1GBCA 2SGFE 2ZTYA 4K1SA 4Q2KA 5H4IB 1MQ5A 4VGCB 3QX5H 3PMJA 4X6PA 1ZSKA 3BTFE 3UTUH 1BMAA 4DT7B 4Y0YE 4JK5A 3V13A 1C5OH 1FDPA 5K0HA 3LGIA 2BQWB 1FMGA 1PQAA 5LGOA 3LGYA 3KL6A 1ZRBA 2PUQH 3A89A 4NA9H 2FLRH 2F9PA 4SGBE 2ZECA 2R2MB 3R3GB 4O9VA 1FY5A 1ID5H 2BOKA 1C5PA 3BF6H 1C1SA 2G8TA 2JH6D 4DVAU 1A4WH 4X6NA 4INKA 1PYTD 1Q3XA 3GYLB 2ZGXH 4BAQB 1ZYOA 1L4ZA 4NCYA 3QK1A 4NA7A 1C5UA 4X8SH 3ZZ3A 1TNLA 4ZKRU 2QY0B 3KN2A 1LCYA 1DWBH 3ZZAA 1XXDA 3F1SB 1MTNB 1OYTH 1FY8E 1ZJDA 1DXPA 3MTYA 5G4BA 1ZTLA 3ATKA 1NFYA 3QGJA 1T8NA 2B8OH 2AIPA 1MMJN 2ZTXA 1TBQH 4I8LA 4BAMB 5A8ZA 3EGKH 1UJ1A 1HAXB 2RDLA 1EJAA 4TWWA 1C1VH 1TX8A 2H2ZA 3PB1E 3NK8A 2FYQA 1AQ7A 3T29A 3GCTF 1GWAA 3PROA 1O3JA 3EAJA 1C1UH 1Z71A 2A5KA 1NRNH 1SGPE 4A6LA 4Q7YA 1K1JA 1HAPH 1RJXB 1D6RA 5SGAE 3UNRA 4PROA 1AHTH 3BEIB 3LOXA 1BITA 1CBWC 1HDTH 1KXDA 4Y8XA 2BMGB 4QT8C 3ZZCA 5FXLA 3B23B 1CHOG 1C5MD 2GV6A 2ZTZA 2QXGA 3RXHA 1VZQH 1GDQA 1VGCB 2GCTC 4FUEA 3T25A 5F8XA 3ZYDA 2ZDNA 3SI3H 2KAIB 5HYOA 1SQOA 3RM2H 3RXQA 1C1MA 1HV7A 3BTEE 1F0UA 3EE0B 1GL0E 1SGDE 2H9HA 3HGNA 1O3OA 1CHGA 3OX7U 5TCAA 4LZ1H 1O3NA 4ISHH 1NRQH 4BNRA 1GI0A 3KNXA 2CHAB 4IGDA 4JZEH 3UUZA 1EKBB 1Z6JH 2D8WA 2J94A 1QA0A 1F7ZA 1BIOA 1ORFA 1OOKB 1TABE 2F91A 2A32A 3QZQA 3MU8A 2ZDLA 4CHAB 3TU7H 1T32A 2WPMS 1UTPA 1SC8U 2IOTA 3M7UA 3GCHB 3SGAE 1ANCA 1O33A 1KTSB 3Q00A 1UTNA 1XKBC 2BD7A 3P95A 3I29A 2OINA 1HAZB 3A80A 3EDXB 2BZ6H 2CGAA 1P57B 1V2VT 1EQ9A 1QJ6B 4JK6A 1SGFA 4U2WA 3TVJB 5JBAS 3GCTG 1KDQB 1SGCA 3L6PA 3TIUA 4YOIA 4YM9A 2BQ6B 3G01A 4CRDA 8LPRA 1ESBA 2XBYA 2STBE 4UFEH 2C8YB 5FPSA 2VU8E 3SZNA 1ABIH 2AGEX 3ESTA 1XXFA 2XYAA 2PKSC 1RIWB 2CMYA 3P8GA 4DURA 3FANA 1ESTA 2ZPSA 1TPAE 2ZWLH 4U01A 4MPXA 1YPGH 3A7VA 4Q7XA 3TK9A 1GJ5H 2NU2E 1HJAB 4O03A 4NIVA 1GHAF 2XC4A 4BXSA 3RXTA 1P04A 3K65B 1GHZA 1MU8B 3MU4A 1ARCA 3BIVH 1E38B 1P0SH 1KXEA 1NY22 5TCCA 1KSNA 1YCPH 3E16B 4UE7H 5ESBA 1INCA 1DWEH 3IITA 2BVSH 2J38A 4XOJA 1Y3UA 2EC9H 3QWCH 1A0LA 4JYTA 4O3TA 2V3HH 1A3BH 2CXVA 1MU6B 1QCPA 1QNJA 3SV2H 3BTME 1IOEA 3PTBA 1O2IA 1SGNE 2J9NA 2PKAA 1O3IA 1TMBH 4JZ1A 1O3AA 2AGGX 1IQIA 4X8UH 4X2VA 1C2KA 4DIHH 1BTZA 1M9UA 1AFQB 2ZQ1A 1DDJA 4ZXXH 4AN7A 1D4PB 1AI8H 1GPZA 1K22H 1ZRKA 2CJIA 1BCUH 1TGNA 1AB9C 1EZUC 3RMNH 1KXCA 3UNQA 5J4SA 1ZTKA 3STJA 1ELBA 4CBOA 3SU3A 3ZVCA 2SNWA 3HPTB 2P59A 1UTMA 3PLKA 1OP2A 1YYY1 2UUYA 4E05H 1V2LT 2ZCKP 1GHYH 3E3TA 3LU9B 2H9TH 4K1TA 4BAHB 3DHKH 4Y6DA 1K1PA 3OU0A 4X2XA 2OBQA 3UPEA 1SGTA 5HM2A 3BIUH 1SMFE 3ZVEA 1TIOA 1DS2E 2J92A 1C2LA 1K9OE 5C1XA 2NU3E 2XCNA 1FN8A 2SGAA 1S6FA 2ZIQH 1GJCB 2HPPH 1J14A 2GZ7A 4WMDA 5F8ZA 1UTKA 2A4QA 1O2ZA 1QIXB 2PGQB 1P05A 3QTOH 2ZCLP 1AZ8A 2QC2A 1G3EA 1XX9A 4RN6A 3BSQA 1KTTB 1WBGB 1UVOA 2UUJB 2GVFA 3LGUA 1HAVA 1P09A 1S0RA 5HM9A 2FX4A 4X0WU 4GUXA 3UR6A 2HOBA 4YT7H 4CRCA 2FTMA 5GXPA 2BHGA 4I8HA 3FVFB 3SJ8A 1Z8RA 2ALPA 5E2OA 4ZAEA 4YTAA 3RXIA 1P3CA 1CVWH 4IMZA 4GPGA 1O2QA 4I31A 2M5TA 1S6HA 1NM6A 1DT2A 1O3BA 2QYIA 3RXFA 1N8OB 4WWYA 2UUFB 2A4OA 3ZZ9A 3NZIA 4A5TS 3NKKA 1NZQH 2ZF0H 1RGQA 2BTCE 1GG6B 3F9EA 1YPJH 1A5HA 5JB9S 2A45B 2VIOA 1TGTA 4FU9A 2XBWA 3KEEA 1S82A 2VVVA 1BTYA 4VGCC 3VEQB 4AYVB 3M5OA 3TLOA 5B6OA 2CV3A 1HJ9A 5K7RA 1WUNH 3GY5A 1S85A 3RXUA 4B73A 4DGJA 1SHYA 2HALA 1ZZZA 1QB1A 2VNTA 2WPJS 1GVLA 4H6SB 5EODA 1EZSC 1LPGB 1C1NA 1HYLA 1UK3A 3ITIA 1GHWH 1JRTA 2A7HA 1EUFA 1Z6EA 2WYJA 1DLKB 1GBDA 1EJMA 2ZCHP 1MTSA 2H5CA 3NUMA 2XBVA 4K2YA 1Y8TA 4BTIB 2ASUB 3HK6B 2F3CE 4WF8A 2PKAB 1MZAA 4AFSA 1KIGH 1JOUB 2UWPA 1F5LA 1EAUA 4A1XA 5T3HA 1OKXA 4ZHAA 2R0LA 1PPEE 2BDYA 1A0JA 1KXAA 1OXGA 2FX6A 2C90B 4ISNA 1TWXB 2VWOA 1DY8A 5BPEA 1GL1A 1DM4B 3AASA 4WMEA 1PQ5A 2VIQA 4CRFA 8GCHF 1RD3B 2P3TB 1O2XA 5JDUB 4A1TA 2OBOA 1FLEE 3A8AA 3QLPH 1XUIA 3SNDA 3TGJE 1TPPA 1UHBA 4BXWA 1MKWH 1WV7H 4KELA 4ABHA 4E06H 3BTKE 1YGCH 1B0FA 2QF0A 1YPMH 1P9SA 4B76A 2A2XH 2Y7ZA 4IC5A 1K1LA 4X1PU 2OTVA 1DXWA 4XFQA 2FESH 2BX3A 3P8FA 3B8JA 2Z3EA 1VGCC 4MDSA 2VWNA 2W3KA 1AGJA 4X2YA 2FOGA 5EW1H 2SGQE 3ZVDA 1T4UH 3F9FA 1IQFA 3GCOA 1HGTH 1BHXB 3A82A 1XUHA 3M61U 3EA8A 1NU7B 2PFEA 3KIDU 1NESE 1P3EA 2LPRA 1ELEE 1TRNA 1J9CH 1HAVB 1SLXB 1HBTH 4XDEA 2BD2A 1A5GH 3T62A 1LPKB 2CHAC 2FI3E 1GHBF 2BY5X 4CH2B 4UFDH 4ZKOU 3CP7A 1SQAA 1O2PA 4WH6A 1O34A 1O2OA 2C93B 1L1NA 2Z9IA 1PPHE 4CHAC 1LKAA 4K8YA 1SG8B 2ZGCA 3ENSB 3VB5A 3MI4A 3GCHC 4KP0A 1V2OT 3QTVH 2PSXA 1P2NA 1K2I1 3SJOA 3SGBE 1GI1A 5EU8A 1GMDF 4Z0KA 3U9AH 1FPHH 1TGBA 2ANYA 3MH7A 3M5NA 1SLUB 5GPIB 1BDAA 1E37B 5DP8A 3S0NA 1W0YH 2FS9A 5BRRE 5DG6A 1RTFB 1RIWC 2ZDMA 2ZFSA 1THPB 1MCTA 1FN6A 1Y3XA 2OLGA 4K3JA 2ANMH 1HJAC 1X7AC 1QQUA 3DFLA 3MU0A 1UVTH 5DK1A 1K21H 1BJUA 3TGKE 2Z6BD 1FIZA 2GT7A 1QB9A 3SUEA 3Q76A 1ELCA 4X8TH 1C5RA 4Y79A 1O5DH 2ILNA 1LHDH 4HZHA 1EZXC 4ISIH 1P06A 2OCVB 5DP5A 3M36A 3C27B 3QUMP 4DY7B 2QF3A 1DX5M 1BMLA 4IW4E 4GHQA 1GCTB 4B2CA 1O5CB 1Y3WA 2WPIS 1ZTJA 3RC6A 2FOBA 2KAIA 1AY6H 1AFQC 1P12E 2BZAA 1EASA 5FBIA 2OXSA 1BRAA 4F49A 1TNIA 2PW8H 1GMCF 2FDAA 4NGAH 1EX3A 2ANWA 2VH0A 3BTTE 1DSTA 3SU5A 2QXHA 1ETTH 1O2WA 1UHBB 1SFIA 1A7SA 4YT6H 1MAXA 2FO9A 2O8WA 4YOJA 1HAYB 4E7RG 2SGEE 1CGJE 3SHCH 4TWYA 1MKXK 2RG3A 6LPRA 1AIXH 1G3BA 3LJOA 1O38A 1FAKH 1RTKA 3VPKA 5JYIA 2G4TA 2Q1JA 3MHWU 1NN6A 2ZDAH 3SOSA 5AFZH 3GYMA 3M5MA 4AYYB 1QRWA 2GZ9A 2STAE 3FFGA 4RKJB 4XBBA 5CHAC 1ELVA 2Q6DA 2WPHS 1TRYA 1IQNA 1GDNA 1FJSA 4YO9A 4DG4A 1SGIB 3O8RA 4AGKA 3RMLH 1KDQA 3RXEA 1GI7B 1A3EH 1O5GH 3ZYEA 3U1JB 2ODYB 1LVMA 4LOYH 3ZZ5A 1TPOA 1BTUA 4CR9A 2Y81A 4Q80A 1DVAH 2W26A 1SOZA 2BY9X 5EXNA 2UWLA 3HKIB 4X2WA 1XUKA 3K6YA 5T6FA 1C4U2 1MTVA 1O2JA 4ZXYH 1HAGE 4R8TB 1ELDE 2FOCA 2ZZUH 4BANB 4ISOA 1Z8JB 3BTHE 3TJOA 1NFWA 1ELTA 2FOMB 1ZHRA 1GJ7B 2FYRA 1BQYA 1EB2A 1N8OC 4HTCH 1GMCG 1O3MA 1OP0A 3M35A 1WSSH 3P8OA 1WTGH 3T26A 1PQ7A 1GBHA 5A0CA