2WUCA

Crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp and ac-kqlr-chloromethylketone
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
publication title Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wucA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wucA01
1O2KA 1S81A 1C2HA 4KKDA 1DWEH 1FLEE 1N8OC 2ZQ1A 1NRNH 3D49H 1YCPK 1O3FA 2OBOA 2OLGA 1FDPA 2QF0A 2Z9KA 4OS7A 5EW1H 4WMEA 3PMAB 3S7KB 1MUEB 1UO6A 1FAKH 4X1SU 1W7XH 1KXDA 3SQEE 1GMHG 1YPJH 3RP2A 5PTPA 1HCGA 1V2UT 2BD8A 3ZVBA 1PJPA 3AAUA 1T32A 2FOEA 1G9IE 3P95A 1C4V2 4FU9A 4ZKOU 2FX4A 1YLDA 1Z71A 2P3UB 2ZTXA 4I31A 4PROA 3GOVB 4Y76A 3RM0H 3P92A 1G3EA 3Q00A 4K1TA 1S6HA 1V2MT 1GJBB 3BIVH 3LGTA 2RA3A 2WYJA 3GY3A 3GCHB 4HI3A 1P2KA 2AIPA 2OC8A 3TPIZ 1O3GA 2FOCA 2D1JA 4OS4A 5LPEA 1MTVA 3VXFH 5C5OA 2EI6A 3PMBB 1DUAA 2AMQA 1L1JA 1QRXA 3DD2H 1GMDG 1YBWA 3EA8A 5H4IB 3EAJA 2ZQ2A 2IN2A 3NZIA 1B0FA 1C5UA 1IQKA 2J9NA 3RMOH 1TBZH 5DP3A 2F3CE 3UNQA 2QA9E 1Z8RA 4DIHH 3SUGA 3FAOA 3RXUA 2PWXA 1YYY1 5C3NA 5C20A 4XBBA 2ZDNA 1DY9A 1DY8A 2G8TA 2NU2E 2G52A 2ZCLP 1RXPA 1IQEA 1BTXA 2GZ9A 3CS7A 4I8HA 1E36B 2BY9X 3V7TA 3M7UA 1AE5A 1HXFH 1C1OA 2ODPA 1LDTT 2SNVA 4NWLA 4TPYA 4F4OC 2V6NA 4JCNA 1B5GH 1ELBA 4OGYA 7GCHG 1BHXB 3R0FA 1O2SA 5DG6A 1C1MA 2OC7A 2BX4A 1GBLA 3T29A 2GCTC 1SSXA 1Y5UT 1W3CA 2YNBA 3RU4E 1IHSH 1UJ1A 3RXVA 2HWLB 3PO1C 1GGDC 1NU7B 1SGQE 3M3TA 1K1PA 2ZKSA 4GHTA 1LHCH 1VR1H 2A4RA 3LGVA 2Z9GA 2AGGX 3RC4A 1SOZA 1GMHF 1V2NT 1TOCB 4XBDA 3RXIA 1OWDA 1O5FH 2XC0A 1P2OA 1MTNB 1QB1A 2QF3A 4LZ1H 1VITG 4Y11E 1ZSJA 3E91A 3MO3A 3OY6U 1AU8A 1P09A 4I7YH 4K69A 4A5TS 1GBEA 1C2DA 3RXLA 1JMOH 3M7TA 1MTUA 2ZI2H 3E90B 2VIPA 3P17H 1KTTB 4D76A 1QQ4A 2VJ1A 1CBWB 1XKAC 3RXRA 1DXWA 2Q6FA 1KSNA 4AORA 1O2JA 1K1OA 1D3DB 1V3XA 5C1YA 3RU4D 1GI7B 4GPGA 1ZHRA 2FTMA 5TJXA 4AFUA 3SO3A 2R0KA 1O3LA 2ZGJA 5CHAB 1XMNB 3SU1A 4IN2A 1ZSKA 3UR9A 2H1UA 1WTGH 4BNRA 1GMDF 1GG6B 3K6YA 3NKKA 1UMAH 1TGBA 4MPVA 3F9GA 3T5FH 1CHGA 1E35B 2G5NA 4MG3A 6CHAB 1UVOA 1CT0E 1GHZA 2NU1E 1NO9H 2Y5FA 1BZXE 1C1SA 1UTKA 1XKBC 1C2JA 5A8XA 2XYAA 2GDEH 4O3TA 1RJXB 2Y5HA 1F92A 4ZROA 1OPHB 5AHGH 1F0UA 4ABBA 5EU8A 2OQ5A 1E34B 1TMTH 4JYTA 1TLDA 1WOFA 2ZF0H 4SGBE 2DE9A 1O3EA 4LK4A 5JYIA 2R3UA 2ZHDA 1IQNA 4WXVA 3GY8A 5DPAA 4ZXYH 2P3FH 3BTKE 3PV4A 1OWHA 5DO4H 2HPQH 2AYWA 1TGSZ 1C2FA 4ZKRU 1DSUA 2Z3EA 2WINI 4MNXA 1EPTA 1S6FA 7GCHF 3Q76A 3MTYA 3NXPA 3V0XA 3P8FA 2GCHG 1QQUA 1TRNA 5FCRA 4D8NA 1T8LA 1NM6A 1QA0A 1UK3A 1O2HA 1C1QA 1P3CA 1K9OE 3UTUH 2ZZUH 2KAIA 4UFGH 4YOJA 5J4QA 2FLRH 1QR3E 2OBQA 1GBBA 2ZHFH 3SU0A 4B2CA 5JB9S 3GY4A 1A1RA 3ELAH 2J95A 3OX7U 1MTSA 1UTOA 1CQQA 1GPZA 1OWJA 3LDXH 3QK1A 2FOBA 4NG9H 1GI3A 4GUXA 3RM2H 1P05A 4NA7A 2ZCHP 1FPCH 1VITF 3T2NA 2C4FH 2V3HH 1Y3XA 4K8YA 2FESH 2TRMA 6ESTA 5EODA 2OINA 3D23A 4A6LA 2HOBA 4X8VH 4B2BA 2PHBA 3HK3B 1XUFA 4K3JA 3C27B 1QBNA 2J34A 2BY5X 3ZVCA 3KF2A 3QZQA 1XVMA 2AGEX 1FQ3A 1YPKH 1O2ZA 2ZFPH 4I8KA 3SNBA 3TH2H 2FS8A 1GI8B 4VGCB 4KTUA 2BLQA 1HRTH 3VPKA 1A5HA 2BTCE 1FY1A 4FUCA 4D9RA 4A7IB 3F1SB 1BCUH 2FLBH 1GHBG 2I6QA 3NPSA 5L2YH 3ODFA 3P8GA 2AIQA 2CGAA 4U32A 5B6OA 3CENA 1F5RA 2FYQA 1HJ9A 5L6NH 1LQEA 1O0DH 3M3VA 4GSOA 1TX6A 1PQ8A 1UCYH 1EJMA 2F9BH 1PYTD 1C5VA 4Q2KA 4AG1A 4U2WA 1L1GA 3LC5A 4A1XA 3PROA 1MMJN 4ZHLU 1TPAE 3SQHE 1C9PA 1P2QA 3BTGE 1UTNA 2NU4E 4JK6A 1MAYA 1VZQH 1H4WA 1Z1JA 2QC2A 3PLKA 1ZSLA 4A1VA 2Y5GA 2OQUA 1YP9A 2A4QA 1NRQH 1J15A 3KNXA 1BRAA 2BD4A 3V12A 3A8BA 1FN8A 1V2OT 3RC5A 4XOJA 1SQAA 1LHGH 2FTLE 2BLWA 2VINA 2ZGCA 2BD9A 2I6SA 3SI4H 4CRDA 2SFAA 2Y7ZA 4B2AA 1J14A 1P9SA 2A0QB 5FHTA 1SOTA 4CRGA 2GCHF 2LPRA 1HAIH 4ZKSU 4X2VA 3RXEA 2CHAC 3SJOA 1IOEA 5A0BA 2ZFQH 3MO6A 1NS3A 5GPIB 4CRAA 1MKWH 2ZPQA 3RXSA 1C1PA 1O2YA 1OYTH 1FPHH 2ZWLH 3AAVA 5EQSA 1K21H 1XXDA 2BLOA 1GBCA 1MCTA 1ESAA 1GCDA 2V35A 2SGEE 3PTNA 5AFYH 3SUDA 4D7FA 3S9BA 2FXRA 2PV9B 4ASHA 3SUFA 1AB9B 1VGCC 2VU8E 1SGYE 1BTZA 1E37B 1GJ6A 1O3IA 1K28D 1KXCA 4K8BA 3E3TA 5TCCA 1K2I1 1C2GA 1SI5H 3SNCA 3MH6A 3QN7A 1F7ZA 5G4BA 3L33A 3LPRA 3MNBA 3SU6A 2Y6TA 1ABIH 2W26A 4Z0KA 3DFJA 1O2XA 2VH0A 2BYAX 2WPLS 3N7OA 2STBE 2B9LA 3ZZ3A 1SGFA 2VGCC 3ATKA 1C1WH 1EPTB 5EQRA 2GV7A 1P04A 4E05H 4JYUH 5I25A 4DY7B 1GHBF 3SHAH 1AKSA 1YPGH 4XDEA 2F91A 3ZZ6A 1SHHB 1EB2A 2F9VA 2KAIB 3E0NB 2UUFB 3CP7A 1TA2A 1SBWA 2AGIX 3MMGA 1HFDA 4U01A 4O97A 1OWKA 2JETB 3T27A 1EATA 1GJ8B 2JH5D 1MKXK 1DWBH 2J38A 1P12E 1D4PB 2ANKH 5A8ZA 1BB0B 1GI0A 4FUHA 2H2ZA 1NESE 2CXVA 3K2UA 1FONA 3E16B 1GWAA 2XW9A 2ALPA 1P2JA 1AUTC 3U69H 3A89A 2PKSB 1ANCA 1BA8B 1CSOE 3P8NA 4NIXA 3A8DA 1A7SA 1N1LA 1TGCA 5L2ZH 5EXLA 2ZFSA 1YCPM 2F9PA 4I8JA 5FPSA 1KXFA 4ISNA 1CA8B 1QJ6B 3Q3YA 9LPRA 2XNIA 2P3TB 8GCHG 1LO6A 1O2VA 4NZQA 1W14U 4X6MA 1ARBA 3RXMA 3BG8A 1G36A 5DK1A 3RXQA 1ZRBA 1AVXA 1UTPA 4LZ4B 2TGPZ 3TJVA 1JWTA 4O9VA 1HNEE 1BTPA 2Z9JA 1BBRK 1QIXB 4FVDA 3MNSA 1C5MD 1TIOA 2ZU4A 1Y3WA 3M3SA 3H7TA 4DT7B 4FUIA 4ESTE 2PFEA 2ZDVH 1TA6A 3ZV8A 2A7CA 2A31A 3UQVA 1EAWA 4NCYA 8LPRA 2ZHEH 1N6XA 1SLXB 2ZPSA 2FWWA 4DOQA 2GDDA 4WH6A 1TX7A 1AUJA 5DKMA 2ZU1A 3PWBA 1TPOA 4IC5A 2XWBI 4FUBA 1GJ9B 3BV9B 1TQ7B 2Z9IA 1O3HA 5JB8S 2ZTYA 3GY6A 3L3TA 4OS1A 3RUOA 3GCHC 1QL8A 1AHTH 3UNSA 1BTWA 3KEEA 1BTUA 1C5NH 4DW2U 2GKVE 1HJAB 1ZMLA 1C4Y2 3EA9A 4JZEH 1YPMH 1GJ4H 3RLYH 1TPPA 3MU0A 1S82A 2P8OB 1O5CB 1YKTA 1XX9A 2B0FA 3KHVA 1BDAA 3Q3KA 4NIYA 2QY0B 4NIVA 2TGDA 1BTHH 1DITH 4B1TA 4HZHA 3ZYDA 4UFEH 1EB1H 4FU7A 1A2CH 1K1NA 2UWOA 1PQAA 2BQWB 2SGDE 1C4U2 2GMTB 1SGDE 1QRWA 3MU5A 1IQFA 3F68H 7ESTE 1GBIA 2BVSH 4M7GA 1FAXA 3E1XB 2ZP0H 2QXGA 3K9XB 5FPYA 4E7RG 2W7UA 3KL6A 4Y79A 5IDKA 1V2TT 1P03A 3URCA 1GHWH 1GDNA 5T6DA 1GBDA 3C1KA 2FODA 8GCHF 4I33A 1FY5A 4OS5A 3VGCB 1AFQB 3NUMA 3U8OH 2BXUH 3PMHB 4ZH8A 1Z7KA 2R3YA 3GYLB 2VWNA 4BAHB 1NC6A 3B8JA 3A85A 1AKSB 1OX1A 1OKXA 5E2OA 2ZDKA 1SPJA 3SI3H 1O3KA 3MU4A 4HFPB 1KLTA 1C2EA 1NN6A 4AB8A 2VVUA 2CN0H 3ZZBA 1C1VH 4B74A 4CH2B 4ABDA 3TNTA 4Q80A 1ELDE 3KN2A 4OS2A 3ZZDA 1BUIA 1TAWA 4KTSA 1MTNC 1BT7A 1EZQA 3QGJA 1UCYK 4YOGA 4X2WA 1UCYE 1UK4A 2C3SA 5E0JA 4IC6A 1N6YA 5ESBA 1BRBE 1TB6H 5GCHG 5T6GA 4FUGA 3A8CA 5DP5A 1V2PT 3TH3H 2BZ6H 1FN6A 1NRSH 1CBWC 1ID5H 2VH6A 2SGAA 2ZHQH 1AGJA 1MU8B 1XUJA 2W3IA 1O3BA 1QFKH 1GI1A 1J9CH 1W0YH 2UUYA 1SHYA 2FOFA 4YT7H 1GJ5H 1SL3A 2PTCE 5CHAC 1L1NA 1VJAU 1F0TA 3ZVAA 3RXOA 2GZ7A 1WQSA 1YPLH 1O5AB 1GI4A 1GG6C 3TK9A 1A0LA 1KXBA 2BX3A 4KELA 4CRFA 1DWCH 4MPUA 6CHAC 1P0SH 1SQTA 3ATIA 5F8TA 2ZHWH 1XUIA 1O5DH 1CT4E 1P57B 4K60A 1JOUB 3A80A 1SLUB 1Y3YA 4Y10E 3SNEA 1ANEA 4Q7ZA 1C1UH 4DGJA 3HGNA 2OP9A 2HPPH 4Y0ZE 3SU4A 3TK5A 1EZSC 2WYGA 1MKWK 1BMMH 4TWWA 4YT6H 3SV6A 1DSTA 2BMGB 3GDVA 3LGWA 4AOQA 1TNKA 2XXLA 2AERH 5F8ZA 3SNDA 3EE0B 5C2ZA 1QBVH 2FX6A 2Q6DA 1A5GH 1QL9A 1ETTH 1M9UA 5K0HA 1T8MA 1KXAA 2C8XB 1HAPH 3BN9A 5HXFA 3GCTG 3UFAA 3A7WA 2EC9H 4BAMB 2BD2A 1J17T 1KLIH 1AD8H 8ESTE 3M35A 2TPIZ 2PGBB 4CR5A 1PYTC 2ZDAH 1ELEE 2OCVB 5JBAS 2WPIS 1RIWB 1W10U 2A7JA 1TRYA 2QCYA 1ZJDA 4GHQA 1GJCB 1TNGA 1DX5M 3RMNH 1THRH 1VJ9U 2ZGHA 4D9QA 4X0WU 3KQEA 4BANB 1ELTA 3EGKH 4X6NA 3STJA 1LVMA 1FV9A 2Y7XA 5GJ4B 1P2MA 2P16A 2C8WB 1GBHA 1ZJKA 4WF8A 1AFEH 3BEFB 1UVUH 1A3EH 2A2XH 2A4GA 4K2YA 2P94A 3GCOA 2G4UA 2ZGBH 1OXGA 5GCHF 4X8UH 2UUKB 2IOTA 2H9TH 2BD7A 3DUXH 4FUDA 4IGDA 5EOKA 1ZRKA 1PQ7A 1JIRA 3RXKA 1GL0E 1IHTH 3VB6A 1NFXA 2CV3A 4U30A 2QN5T 3M5LA 4VGCC 4Y71A 1KYNA 3LGIA 4YLQH 3K65B 4DURA 1GI2A 4HGCA 1HDTH 1OP8A 4JZDH 1XUKA 1ZR0A 4F49A 3LH1A 1FUJA 1HGTH 3M61U 2STAE 1LCYA 1XUGA 7LPRA 3VEQB 4LOYH 2BXTH 1C5XB 3LGYA 4ISIH 1LHFH 3E6PH 1L4ZA 4QT8C 2RG3A 1TNJA 2GT8A 1L4DA 1TNLA 3QUMP 2BLVA 1ELCA 1V2LT 4RN6A 3BTDE 1P02A 2P93A 3VXEH 1DT2A 1Z8JB 2WV5A 1Q3XA 4CBNA 3FFGA 1IQJA 3MFJA 2FPZA 4MPWA 1C5PA 2TIOA 1S85A 3SUEA 2WV4A 5JBTA 1KIGH 3H7OA 4THNH 3U9AH 3GCTF 1RGQA 4ISOA 2P59A 2PTNA 2EI7A 3ZVEA 1HJ8A 2ZNKH 1AE8H 3M5MA 4MNYA 3TJUA 1O2LA 5FX6A 3TIUA 2FOGA 1OSSA 3T26A 1JBUH 2Y82A 5DJ7A 2BDBA 2FP7B 2Z9LA 4NFFA 4ZXXH 1NU9A 1GI9B 1MQ5A 3F9FA 1DVAH 1MBQA 1YCPH 3SV7A 3MWIU 2AEIH 1VCQA 4IW4E 1P2IA 1ZMNA 1XUHA 2O8MA 4JZ1A 4ABAA 2VIOA 1F0RA 1B7XB 3DT0H 1QA7A 4Z6AH 3PLBA 3IWMA 2ZDLA 4AGJA 2ILNA 5AVDA 3ZV9A 1QHRB 4NGAH 4TY6A 1AB9C 1K1LA 1HAHH 2FO9A 2PSYA 3OYPA 1MTWA 1EP5A 2BDHA 1LKBA 1BJUA 3FVFB 1TQ0B 5CE1A 1TNHA 3IG6B 1FY8E 1MBMA 2K1QA 1O2PA 1GHAG 2B7DH 1BMLA 1Y3VA 1ZPCA 2DE8A 1SGIB 5EW2H 1EPTC 1YGCH 4AX9H 3G01A 3HK6B 3RXTA 1GVZA 3TGJE 1FY3A 5IYTA 4BTUB 2QIQA 1OP2A 3ATWA 1P06A 3BG4B 5F8XA 3SGQE 3UPEA 1EZXC 2BB4A 5JBCS 3RXPA 4OGXA 1TX8A 4XBCA 4H4FA 3BTHE 1AZ8A 1W7GH 2HNTC 1V2WT 3W95A 2HNTF 4ABJA 2FI4E 2JETC 3Q3XA 3SBKA 1LVYA 3RMMH 1HAYB 2WUBA 1XM1A 3ODDA 4UDWH 3ATMA 2ANYA 5C67A 1JRTA 3A8AA 3O8CA 4DIIH 1O2RA 1O2TA 4FVBA 3A81A 5EG4A 4MDSA 3SV9A 1Q2WA 1P2NA 2FM2A 3AASA 2PKSC 1KXEA 1OS8A 1O33A 3JZ1B 4ZAEA 3ZZ4A 1GBFA 1O5EH 2BY6X 3F6UH 1ZHMA 4MPXA 1EAUA 3SJIA 1ORFA 3FZDA 4FUJA 1AIXH 3EYDA 3GY5A 1SLVB 1GBTA 3SJKA 4ABHA 5LPFA 5EPNA 2O8WA 1GI5A 3RMLH 1FMGA 4FU8A 1SC8U 1GBAA 3I78A 1PPBH 1P10A 3DFLA 2A1DB 1MZDA 1X7AC 2OUAA 4A92A 3TNSA 4X6OA 1PPFE 3U8RH 1C5WB 3T28A 4B71A 1AMHA 2TBSA 3ATLA 1MQ6A 5F6MA 1F0SA 3UOPA 1BTYA 2AMDA 4CHAB 2JH0D 4UE7H 4JZFH 2XWAA 1G32B 1G3BA 1PFXC 5T6FA 4RSPA 5EQQA 4NA8A 5FAHA 2BQ6B 3VB3A 1AI8H 2ZEBA 2G00A 1QB9A 3UY9A 1ARCA 3M5NA 2QXIA 2G51A 2VIWA 4X1PU 1D3QB 2GZ8A 5FBIA 1LMWB 2D2DA 2O8TA 1T4UH 1GHAF 1GCTB 2AH4X 3SU2A 1THSH 4LXBH 3V3MA 3LT3A 1SGCA 2R2WU 1GL1A 4MNWA 1B0EA 1J16A 4ISHH 3O8RA 5DP9A 9ESTA 1WUNH 2V3OH 1AWFH 1HXEH 2FOAA 4AG2A 1CHOG 1HJAC 2XBXA 1ABJH 2XBYA 2ZFTA 2H9EH 4MNVA 3RXHA 1NFWA 1IQLA 1THPB 1Q31A 1UTLM 3LC3A 2HNTE 2P8OC 3K6ZA 1RRKA 2VB0A 3MO9A 3S0NA 1S0RA 3UWIA 2ZTZA 3VB7A 2GV6A 1EUFA 1O3NA 2BDIA 1SGPE 4B73A 2Z3DA 2YOLA 2G5VA 2XCFA 2GMTC 3GCNA 3MI4A 1H9LB 3MHWU 1O3OA 3E8LA 2JH6D 2QXJA 3W94A 1ZHPA 1HPGA 1SFQB 5E0GA 1TALA 3SV8A 1O30A 1H1BA 3ZYEA 3KIDU 1IQGA 1V2JT 3S9AA 4UFDH 4RKJB 2UWLA 4Q7XA 3RXAA 3HKJB 1O2OA 1Z8IB 1YLCA 3VGCC 1O2MA 1AFQC 5LH8A 3NWUA 1C1RA 3ZZ7A 1WCZA 3GY2A 3KGPA 4ISLA 1A4WH 3ESTA 1AVWA 6GCHF 3QGNB 5J4SA 3ITIA 1HUTH 2ZO3H 2QXHA 3A7TA 4ZMAH 1S83A 2EI8A 2Z7FE 1XVOA 1CGIE 3KCGH 1Y3UA 2CJIA 4J2YB 4KGAA 3UOUA 1O32A 2R9PA 3FZZA 1W8BH 2PR3A 1ZYOA 1Y59T 1O2WA 3P6ZB 4B76A 4H42U 2UWPA 3I29A 1EAXA 1NROH 1PPEE 3BIUH 3RXFA 3D62A 3SJ9A 1BJVA 5DP6A 1HIAA 1HAZB 1MCVA 2UUJB 4GAWA 5A09A 3TK6A 5GDSH 2RCEA 1SGRE 1Z1IA 2FIRH 2HLCA 1KTSB 3PMJA 2HALA 2PGQB 1FIWA 1L2EA 3BTEE 2VIQA 1BOQA 1GMCG 1EOLA 1G37A 3MNXA 1F5KU 4NZLA 5LPRA 2BOKA 3PYHA 3FP8E 4OS6A 4KTCA 2FOMB 4AGKA 1CHOF 1BITA 1T7CA 3M7QA 1GJDB 4BXWA 4ABEA 1IQHA 4INHA 1QNJA 1AZZA 4H6SB 3BTQE 1FZZA 4AN7A 1K1IA 2CMYA 4DJZB 1GVKB 1HLTH 1WYKA 1O34A 3P8OA 4X1RU 1G30B 1HAGE 4YESB 3SU5A 1GBJA 2ODQA 1WQVH 2GT7A 3U98H 2O9QA 1GVLA 1O2UA 3WY8A 1T4VH 1BHXF 1JIMA 1YPHC 3GISB 1HAVA 2SGFE 2VNTA 3OY5U 3UNRA 2H5CA 2Z94A 5A8YA 1G2MA 4BTTB 1C2KA 1GHXH 1LTOA 3RC6A 4WMDA 4A1TA 1C1NA 3SV2H 3BEIB 2PKAA 3MYWA 2A5AA 4GVUA 4YM9A 1DFPA 3BSQA 1NZQH 1IQIA 1INCA 1K1MA 2WPHS 2P95A 3SW2B 2BDCA 5DP4A 1ZGIA 1D6RA 5DP7A 1OOKB 3DA9B 1EKBB 1EJAA 4Y7AA 3OU0A 1H9HE 4NA9H 3JZ2B 7KMEH 5CMXH 4CREA 3PB1E 5AF9H 1SGNE 1RIWC 5BRRE 2FI5E 1ESTA 4KP0A 1EQ9A 4WH8A 3RDZA 1MAXA 1O35A 5TCAA 1EAIA 2W3KA 1WSSH 1CA0B 4HTCH 1ELGA 4IMZA 4MQAA 1QB6A 3SU3A 1H8IH 1C9TA 1VITH 5DP8A 1UTMA 2XC5A 1RTKA 2BDYA 1W13U 1ZGVA 4DVAU 1ELAA 4DCDA 2H9HA 2PLXA 1LPZB 4IBLH 1V2ST 4K1SA 1UTQA 3B23B 3GICB 4X8SH 1CVWH 1PPZA 1O2NA 3TGKE 2FEQH 3ZZ9A 3RXBA 1CE5A 2C90B 3BTWE 3M36A 2WPJS 3LH3A 1EP6A 2Q1JA 1QJ7B 1N8OB 3EQ0H 1QRZA 3LOXA 1D6WA 3ZZCA 1GMCF 1Z6EA 1TYNA 3TU7H 4JYVH 1ZTKA 5JBBS 1QBOA 1ZTLA 1DOJA 2XBWA 1O37A 1QY6A 2A45B 4BAQB 5LGOA 4WJG2 1RFNA 3U1IB 3CS0A 1TRMA 1GI6A 2THFB 3SOSA 2A32A 2CF9H 1RS0A 5GXPA 3OTJE 1MKXH 4Q7YA 1D3TB 5E0HA 2FI3E 6LPRA 5HM9A 3ZVFA 1PPGE 1V2KT 1KDQA 1LQDB 2ZCKP 2NU3E 3BTFE 3F9EA 2VIVA 2ALVA 1HYLA 2AMPA 4TPIZ 1RTFB 1YPHE 3EDXB 2VVCA 1OWIA 1DE7H 1NFUA 1Z6JH 3MU8A 4K1EA 3A7YA 5JPMH 4X2XA 1H8DH 1MH0A 4H6TA 1HIAB 2NU0E 3R3GB 3UUZA 3TVJB 3BF6H 4E7NA 4X1QU 3T62A 4AZ2B 3D65E 1VCPA 3FP6E 2DUCA 3L6PA 3RLWH 4AYVB 1O5BB 4J1YA 3QTOH 4IS5A 2VWMA 3ZVDA 4CBOA 1DDJA 4JMYA 1O3PB 4BAOB 5ESTE 1AO5A 1ACBE 1PPHE 1BBRH 1TE0A 5EPYA 2Z6BD 3M5OA 2BQ7B 1CGHA 1ETSH 1YM0A 2FZZA 1TOMH 4YO9A 1ZZZA 1DLKB 2IJOB 2XTTB 4UFFH 1W2KH 4GLYA 4WXIA 2BHGA 4WY3A 3A7VA 1LVBA 2W7SA 1PQ5A 1GBMA 1DANH 3S7HB 1IAUA 3GDUA 4IN1A 1WTHD 1DICA 1A0JA 1O39A 4Y7BA 3UQOA 2A5KA 1HAVB 1OP0A 2O8LA 3UR6A 1UHBA 1UK2A 5JDUB 2FDAA 4MVNA 2XCNA 3PWCA 1E0FD 3S9CA 2SGPE 1KLJH 1G3CA 1FXYA 1NPMA 4NWKA 1P01A 2PKAB 1DUEA 2GCTB 3TLOA 2BVXH 1BRCE 2ANWA 3ZZ5A 1QTFA 1ZTJA 1Y8TA 2ESTE 3LKWA 3PO1B 1GGDB 2BVRH 2YNAA 1EX3A 3GDSA 4UEHH 3QTVH 1LPKB 1YPEH 3QX5H 4BTIB 1Y5BT 1O36A 2A5IA 2GD4B 2WUCA 1D9IA 1UVSH 4Y6DA 2R2MB 1EZUC 1RTLA 1NTPA 1BIOA 3BG4C 1C5OH 2XC4A 2BZAA 4JK5A 2PW8H 2ZFRH 1AQ7A 5FPTA 1YC0A 4MLFB 2OXSA 1TBQH 2AS9A 2IPHA 3KQCA 5EGMA 1OYQA 3RXDA 3U8TH 5E2PA 2HRVA 8KME2 5K7RA 4TYDA 3TITA 1DLEA 1C5YB 1BMAA 1C2IA 2QGRA 4K5ZA 1A46H 2ZGXH 1CGJE 2SGQE 2ASUB 1ZLRA 1AN1E 4IMQA 3BTME 2Y80A 1KY9A 3AVZA 2BDAA 4I8LA 4Y0YE 5EXMA 2QAAA 2QV1A 4BOHA 1O2GH 3RXCA 4AYYB 1SGEE 2NWNA 3MH7A 4D7GA 4YZUA 1P9UA 4I32A 2B8OH 3T25A 5ABWA 3QO6A 1T8OA 1FIZA 2FOHA 3UREA 1P8VC 2VIDA 1E38B 1F5LA 2GVFA 2ZU5A 1C5TA 3QZRA 1C1TA 1A61H 1O5GH 1TABE 2PUXB 2W5EA 1CT2E 1VCWA 1T31A 3RU4T 2XRCA 5FXLA 3ENSB 1ZMJA 4WWYA 1HV7A 2PUQH 3A7XA 4XSKU 1SFIA 3SORA 3E0PB 4R0IA 1CU1A 4ZHAA 1LVOA 1Z8GA 2J4IA 4TY7A 2HGTH 4CHAC 4NSVA 1O2QA 3HGPA 1D3PB 2ZG0H 4GCHG 2GTBA 1KDQB 4UONA 3A86A 2HVXA 4B75A 2R0LA 2FYRA 5HMAA 3I77A 2Y81A 1XXFA 2Z3CA 1SGTA 1DXPA 1P3EA 1GJAB 3DHKH 4ZUHA 1DS2E 1O3AA 1ZPZA 3BEUA 1QGFA 3O8DA 1EASA 5BPEA 1HBTH 4YOIA 4YTAA 1O3MA 1DM4B 2GX4A 3V13A 1EJNA 1CO7E 1U6QA 4E06H 4R8TB 2BOHB 1GCTC 2PSXA 1UVPA 2SNWA 4WMFA 4AB9A 1C2MA 5A0AE 3ZVGA 2ZC9H 2ULLA 3UWJH 3M37A 2BY7X 1ANDA 1TONA 1LPGB 1GHYH 3HATH 3KQBA 4CRCA 1V2VT 4I8GA 2F83A 3LONA 1QL7A 3H5CB 4O03A 1V6DA 5C1UA 2TGTA 1MU6B 1PPCE 1SR5C 1ANBA 2OC1A 2LNCA 3QWCH 3TGIE 1AY6H 1LHEH 1SGFG 3VB4A 4RKOB 1H9IE 1RD3B 2C93B 1BRUP 1MD7A 2J94A 1UHBB 1O3CA 1WBGB 4INKA 1P11E 3LJOA 5L30H 2D26C 1AVGH 2ZFFH 4NFEA 1ZOMA 6GCHG 1JRSA 1TMUH 2O8UA 2FS9A 4YLUA 2WPKS 5FCKA 1G3DA 2G4TA 1C5RA 1FJSA 2F9UA 3NCLA 3PTBA 3LJJA 3A84A 4TWYA 5A2MH 4O3UA 3SNAA 2C8YB 4BXSA 1S84A 4MTBA 2A4OA 3A82A 3MH4A 1K22H 3A87A 4X1NU 1S0QA 1FI8A 4X2YA 3TJOA 1SG8B 4XE4A 1SLWB 3AW0A 4CH8B 1V2RT 1C5QA 4JZIA 1C5SA 5HYOA 2F9NA 2V0BA 3PM3A 3TJNA 4ZKNU 3VB5A 1LHDH 2GP9B 2ZDMA 1DPOA 1UTJA 4ABFA 1BQYA 2AFQB 4GCHF 2XBVA 2CF8H 3SGBE 3EA7A 3Q77A 1C5LH 1W12U 1C2LA 3STIA 1DWDH 3GYMA 5GIBA 4Y8YA 1HAXB 1WAYB 2Q6GA 1QJ1B 5C5NA 2A7HA 2OTVA 4DG4A 1TGNA 2ZU3A 2C8ZB 3TH4H 2CHAB 4ZHMU 5I46H 3KQDA 1LKAA 1MZAA 3SGAE 3QDZB 4CR9A 4NIWA 1WV7H 2BM2A 2ODYB 3A88A 2M5TA 2BY8X 1GDUA 2ZECA 2JKHA 1ETRH 1GBKA 4BAKB 4WVPE 2BDGA 2RA0A 1NFYA 3ZZ8A 3SZNA 3URDA 1QCPA 4INLA 4NSYA 3A7ZA 1A0HB 1AWHB 1O2IA 2FMJA 2BD3A 1VGCB 1EXFA 1HB0B 3F9HA 3SHCH 1YF4A 3UIRA 1S5SA 2ZU2A 2OD3B 5DGJA 4XFQA 5A0CA 2ZA5A 2RDLA 3SJ8A 1GHVH 1FNIA 1O31A 2EEKA 2TGAA 1A5IA 3QLPH 1BBRE 1NY22 1OWEA 1EOJA 5HM2A 3S69A 1A3BH 1O38A 3HPTB 1HAOH 2EA3A 2VGCB 5F03A 3B9FH 2H6MA 3BTTE 5SGAE 3LU9B 3MOCA 5FBEA 2GGVB 3MU1A 2QYIA 3LIWA 3NK8A 2BD5A 3P70B 5EXNA 1TGTA 1JXPA 5E8EH 2ZPRA 5T3HA 4FUEA 3U1JB 2VWLA 3FANA 1TMBH 5ETXA 3FP7E 4ABIA 1SVPA 2A2QH 1BMNH 2F9OA 3HKIB 4SGAE 1MD8A 1TBRH 1K1JA 4X6PA 1UVTH 4AFQA 2VVVA 1O3DA 2J92A 1W0ZU 1G2LA 1GJ7B 4ABGA 2VWOA 3AW1A 4AFSA 1TWXB 1NRPH 2G81E 2ZIQH 4UD9H 4FXGH 1NRRH 3RXJA 1TPSA 2ANMH 5HGGA 5FX5A 1ZPBA 4Y8ZA 3GY7A 5AFZH 3LGUA 3ZZAA 1FY4A 2J2UA 1L0ZA 3O8BA 2B5TB 4X8TH 1ESBA 1QURH 4AFZA 1ELFA 1NT1A 2OC0A 1CA0C 3MH5A 3VFEA 1C5ZB 5C1XA 3SN8A 2H5DA 1SMFE 3RXGA 1ELVA 2WPMS 5GWZA 1T8NA 1SB1H 3A83A 1GDQA 4FUFA 1SQOA 1F2SE 1TNIA 2G55A 1IQMA 1Y5AT 1WU1A 4CRBA 4Y8XA 1TFXA 3IITA 2D8WA 3PLPA 3MNCA 1W11U 1O3JA 1V2QT 3OSYA 1J8AA
chains in the Genus database with same CATH superfamily
1O2KA 1S81A 1C2HA 4KKDA 1DWEH 1FLEE 1N8OC 2ZQ1A 1NRNH 3D49H 4OM9A 1YCPK 1O3FA 2OBOA 2OLGA 1FDPA 2QF0A 2Z9KA 4OS7A 5EW1H 4WMEA 3PMAB 3S7KB 1MUEB 1UO6A 1FAKH 4X1SU 1W7XH 1KXDA 3SQEE 1GMHG 1YPJH 3RP2A 5PTPA 1HCGA 1V2UT 2BD8A 3ZVBA 5HKKD 1PJPA 3AAUA 1T32A 2FOEA 1G9IE 3P95A 1C4V2 3FO8D 4FU9A 2FX4A 1YLDA 1Z71A 2P3UB 2ZTXA 4I31A 4PROA 3GOVB 4Y76A 3RM0H 3P92A 1G3EA 3Q00A 4K1TA 1S6HA 1V2MT 1GJBB 3BIVH 3LGTA 2RA3A 2WYJA 3GY3A 3GCHB 4HI3A 1P2KA 2AIPA 2OC8A 3TPIZ 1O3GA 2FOCA 2D1JA 4OS4A 5LPEA 1MTVA 3VXFH 5C5OA 2EI6A 3PMBB 1DUAA 2AMQA 1L1JA 1QRXA 3DD2H 1GMDG 1YBWA 2RFKC 3EA8A 5H4IB 2LP6A 3EAJA 2ZQ2A 5EJ1A 2IN2A 3NZIA 1B0FA 1C5UA 1IQKA 2J9NA 3RMOH 1TBZH 5DP3A 2F3CE 3UNQA 2QA9E 1Z8RA 4DIHH 3SUGA 3FAOA 3RXUA 2PWXA 1YYY1 5C3NA 2CK3D 5C20A 4XBBA 2ZDNA 1DY9A 1DY8A 2G8TA 3N7DA 2NU2E 2G52A 2ZCLP 1RXPA 1IQEA 1BTXA 2GZ9A 3CS7A 4I8HA 1E36B 2BY9X 3V7TA 3M7UA 1AE5A 1HXFH 1C1OA 2ODPA 1LDTT 2SNVA 4NWLA 4TPYA 4F4OC 1MABB 2V6NA 4JCNA 1B5GH 1ELBA 4OGYA 7GCHG 1BHXB 3R0FA 1O2SA 5DG6A 1C1MA 2OC7A 2BX4A 1GBLA 3T29A 2GCTC 1SSXA 1Y5UT 1W3CA 2YNBA 3RU4E 1IHSH 1UJ1A 3RXVA 2HWLB 3PO1C 1GGDC 1NU7B 1SGQE 3M3TA 1K1PA 2ZKSA 4GHTA 1LHCH 1VR1H 3PV5A 2A4RA 3LGVA 2Z9GA 1BMFD 2AGGX 3RC4A 1SOZA 1GMHF 1V2NT 1TOCB 4XBDA 3RXIA 5KEDA 1OWDA 1O5FH 2XC0A 2JIZD 1P2OA 1MTNB 1QB1A 2QF3A 4LZ1H 1VITG 4Y11E 1ZSJA 3E91A 3MO3A 3OY6U 1AU8A 1P09A 4I7YH 4K69A 4A5TS 1GBEA 1C2DA 3RXLA 1JMOH 2GJGA 3M7TA 1MTUA 2ZI2H 3E90B 2VIPA 3P17H 1KTTB 4D76A 1QQ4A 2VJ1A 1CBWB 1XKAC 3RXRA 1DXWA 2Q6FA 1KSNA 4AORA 1O2JA 1K1OA 1D3DB 1V3XA 5C1YA 3RU4D 1GI7B 4GPGA 1ZHRA 2FTMA 5TJXA 4AFUA 3SO3A 2R0KA 1O3LA 2ZGJA 5CHAB 1XMNB 3SU1A 2WSSD 4IN2A 1ZSKA 3UR9A 2H1UA 1WTGH 4BNRA 1GMDF 1GG6B 3K6YA 3NKKA 1UMAH 1TGBA 4MPVA 3F9GA 3T5FH 1CHGA 1E35B 2G5NA 4MG3A 6CHAB 1UVOA 2VBCA 1CT0E 1GHZA 2NU1E 1NO9H 2Y5FA 1BZXE 1C1SA 1UTKA 1XKBC 1C2JA 1H8ED 5A8XA 2XYAA 2GDEH 4O3TA 1RJXB 2Y5HA 1F92A 4ZROA 1OPHB 5AHGH 1F0UA 4ABBA 5EU8A 2OQ5A 3NRLA 1E34B 1TMTH 4JYTA 1TLDA 1WOFA 2ZF0H 4SGBE 2DE9A 1O3EA 4LK4A 5JYIA 2R3UA 2ZHDA 1IQNA 4WXVA 3GY8A 5DPAA 4ZXYH 2P3FH 3BTKE 3PV4A 1OWHA 5DO4H 2HPQH 2AYWA 1TGSZ 1C2FA 4ZKRU 1DSUA 2Z3EA 2WINI 4MNXA 1EPTA 1S6FA 7GCHF 3Q76A 5T1VA 3F3BA 3MTYA 3NXPA 3V0XA 3P8FA 2GCHG 1QQUA 1TRNA 5FCRA 4D8NA 1T8LA 1NM6A 1QA0A 1UK3A 1O2HA 1C1QA 1P3CA 1K9OE 1KMHB 3UTUH 2ZZUH 2KAIA 4UFGH 4YOJA 5J4QA 2FLRH 1QR3E 2OBQA 2V7QD 1GBBA 2ZHFH 3SU0A 4B2CA 5JB9S 3GY4A 1A1RA 3ELAH 2J95A 3OX7U 1MTSA 1UTOA 1CQQA 1GPZA 1OWJA 3LDXH 3QK1A 2FOBA 4NG9H 1GI3A 4GUXA 3RM2H 1P05A 4NA7A 2ZCHP 1FPCH 1VITF 2AHME 3T2NA 2C4FH 2V3HH 1Y3XA 4K8YA 2FESH 2TRMA 6ESTA 5EODA 2OINA 3D23A 4A6LA 2HOBA 4X8VH 4B2BA 2PHBA 3HK3B 1XUFA 4K3JA 3C27B 1QBNA 2J34A 2BY5X 3ZVCA 3KF2A 3QZQA 1XVMA 2AGEX 1FQ3A 1YPKH 1O2ZA 2ZFPH 4Z1MD 4I8KA 3SNBA 3TH2H 2FS8A 1GI8B 4VGCB 4KTUA 2BLQA 1HRTH 3VPKA 2KR7A 1A5HA 2BTCE 1FY1A 4FUCA 4D9RA 4A7IB 3F1SB 1BCUH 2FLBH 1GHBG 2I6QA 3NPSA 5L2YH 3ODFA 3P8GA 2AIQA 2CGAA 4U32A 5B6OA 3CENA 1F5RA 2FYQA 1HJ9A 5L6NH 3OEHD 1LQEA 3UB0A 1O0DH 3M3VA 4GSOA 1TX6A 1PQ8A 1UCYH 1EJMA 2F9BH 3MQKC 1PYTD 1C5VA 4Q2KA 4AG1A 4U2WA 1L1GA 3LC5A 4A1XA 3PROA 1MMJN 4ZHLU 1TPAE 3SQHE 1C9PA 1P2QA 3BTGE 1UTNA 2NU4E 4JK6A 1MAYA 1VZQH 1H4WA 1Z1JA 2QC2A 3PLKA 1ZSLA 4A1VA 2Y5GA 2OQUA 1YP9A 2A4QA 1NRQH 1J15A 3KNXA 1BRAA 2BD4A 3V12A 3A8BA 1FN8A 1V2OT 3RC5A 4XOJA 2JDID 1SQAA 1LHGH 5C0UA 2FTLE 2BLWA 2VINA 2ZGCA 2BD9A 4P00A 2I6SA 3SI4H 4CRDA 2SFAA 2Y7ZA 4B2AA 1J14A 1P9SA 2A0QB 2JJ1D 5FHTA 1SOTA 4CRGA 2GCHF 2LPRA 1HAIH 4ZKSU 4X2VA 3RXEA 2CHAC 3SJOA 1IOEA 5A0BA 2ZFQH 3MO6A 1NS3A 5GPIB 4CRAA 1MKWH 2ZPQA 3RXSA 1C1PA 1O2YA 1OYTH 1FPHH 2ZWLH 3AAVA 5EQSA 1K21H 1XXDA 2BLOA 1GBCA 1MCTA 1ESAA 1GCDA 2V35A 2SGEE 3PTNA 5AFYH 3SUDA 4D7FA 3S9BA 2FXRA 2PV9B 4ASHA 3SUFA 1AB9B 1VGCC 1E1QD 2VU8E 1SGYE 1BTZA 1E37B 1GJ6A 1O3IA 1K28D 1KXCA 4K8BA 3E3TA 5TCCA 1K2I1 1C2GA 1SI5H 3SNCA 3MH6A 3QN7A 1F7ZA 5G4BA 3L33A 3LPRA 3MNBA 3SU6A 2Y6TA 1ABIH 2W26A 4Z0KA 3DFJA 1O2XA 2VH0A 2BYAX 2WPLS 3N7OA 2STBE 2B9LA 3ZZ3A 1SGFA 2VGCC 3ATKA 1C1WH 1EPTB 5EQRA 2GV7A 1P04A 4E05H 3SZEA 4JYUH 5I25A 4DY7B 1GHBF 3SHAH 1AKSA 1YPGH 4XDEA 2F91A 3ZZ6A 1SHHB 1EB2A 2F9VA 2KAIB 3E0NB 2UUFB 3CP7A 1TA2A 1SBWA 2AGIX 3MMGA 1HFDA 4U01A 4O97A 1OWKA 2JETB 3T27A 1EATA 1GJ8B 2JH5D 1MKXK 1DWBH 2J38A 1P12E 1D4PB 2ANKH 5A8ZA 1BB0B 1GI0A 4FUHA 2H2ZA 1NESE 2CXVA 4F55A 3K2UA 1FONA 3E16B 1GWAA 2KCOA 2ALPA 2XW9A 1P2JA 1AUTC 3U69H 3A89A 2PKSB 1ANCA 1BA8B 1CSOE 3P8NA 4NIXA 3A8DA 1A7SA 1N1LA 1TGCA 3OE7D 5L2ZH 5EXLA 2K0QA 2ZFSA 1YCPM 2F9PA 4I8JA 5FPSA 1KXFA 4ISNA 1CA8B 1QJ6B 3Q3YA 9LPRA 2XNIA 2P3TB 8GCHG 1LO6A 1O2VA 4NZQA 1W14U 4X6MA 1ARBA 3RXMA 3BG8A 1G36A 5DK1A 3RXQA 3GS9A 1ZRBA 1AVXA 1UTPA 4LZ4B 2TGPZ 3TJVA 1JWTA 4O9VA 1HNEE 1BTPA 2Z9JA 1BBRK 1QIXB 4FVDA 3MNSA 1C5MD 1TIOA 2ZU4A 1Y3WA 3M3SA 3H7TA 4DT7B 4FUIA 4ESTE 2PFEA 2ZDVH 1TA6A 3ZV8A 2A7CA 2A31A 2W6JD 3UQVA 1EAWA 4NCYA 8LPRA 2ZHEH 1N6XA 1SLXB 2ZPSA 2FWWA 4DOQA 2GDDA 4WH6A 1TX7A 1AUJA 5DKMA 2ZU1A 3PWBA 2WPDD 1TPOA 4IC5A 2XWBI 4FUBA 1GJ9B 3BV9B 1TQ7B 2Z9IA 1O3HA 5JB8S 2ZTYA 3GY6A 3L3TA 4OS1A 3RUOA 5EIYA 3GCHC 1QL8A 1AHTH 3UNSA 1BTWA 3KEEA 1BTUA 1C5NH 4DW2U 2GKVE 1HJAB 1ZMLA 5C0TA 1C4Y2 3EA9A 4JZEH 1YPMH 1GJ4H 3RLYH 1TPPA 3MU0A 1S82A 3FKSD 2P8OB 1O5CB 1YKTA 1XX9A 2B0FA 3KHVA 1BDAA 3Q3KA 4NIYA 2QY0B 5KGOA 4NIVA 2TGDA 1BTHH 1DITH 4B1TA 4HZHA 4RT0A 2OK5A 3ZYDA 4UFEH 1EB1H 4FU7A 1A2CH 1K1NA 2UWOA 1PQAA 2BQWB 2SGDE 1C4U2 2GMTB 1SGDE 1QRWA 3MU5A 1IQFA 3F68H 2QE7D 7ESTE 1GBIA 2BVSH 4M7GA 5C94A 1FAXA 3E1XB 2ZP0H 4Q63A 2QXGA 3K9XB 5FPYA 4E7RG 2W7UA 3KL6A 4Y79A 5IDKA 1V2TT 1P03A 3URCA 1GHWH 1GDNA 5T6DA 1GBDA 3C1KA 2FODA 8GCHF 4I33A 1FY5A 4OS5A 3VGCB 1AFQB 3NUMA 3U8OH 2BXUH 3PMHB 4ZH8A 1Z7KA 2R3YA 3GYLB 2VWNA 4BAHB 1NC6A 3B8JA 3A85A 1AKSB 1OX1A 1OKXA 5E2OA 2ZDKA 1SPJA 3SI3H 1O3KA 3MU4A 4HFPB 1KLTA 1C2EA 1NN6A 4AB8A 2VVUA 2CN0H 3ZZBA 1C1VH 4B74A 2LELA 4CH2B 4ABDA 3TNTA 4Q80A 1ELDE 3KN2A 4OS2A 3ZZDA 1BUIA 1TAWA 4KTSA 1MTNC 1BT7A 1EZQA 3QGJA 1UCYK 2IPQX 4YOGA 4X2WA 1UCYE 1UK4A 2C3SA 5E0JA 4IC6A 1N6YA 5ESBA 1BRBE 1TB6H 5GCHG 2V3MA 4FUGA 3A8CA 5T6GA 5DP5A 1V2PT 3TH3H 2BZ6H 2KX4A 1FN6A 1NRSH 1CBWC 1ID5H 2VH6A 2SGAA 2ZHQH 1AGJA 1MU8B 1XUJA 3WW7A 2W3IA 1O3BA 1QFKH 1GI1A 1J9CH 1W0YH 2UUYA 1SHYA 2FOFA 4YT7H 1GJ5H 1SL3A 2PTCE 5CHAC 1L1NA 1VJAU 1F0TA 3ZVAA 3RXOA 2GZ7A 3PRDA 1WQSA 1YPLH 1O5AB 1GI4A 1GG6C 3TK9A 1A0LA 1KXBA 2BX3A 4KELA 4CRFA 1DWCH 4MPUA 6CHAC 1P0SH 1SQTA 3ATIA 4FETA 5F8TA 2ZHWH 1XUIA 1O5DH 1CT4E 1P57B 4K60A 1JOUB 3A80A 1SLUB 1Y3YA 3KYGA 4Y10E 3SNEA 1ANEA 4Q7ZA 1C1UH 4DGJA 5FL7D 3HGNA 2OP9A 2HPPH 5B6LA 4Y0ZE 3SU4A 3TK5A 1EZSC 2WYGA 1MKWK 1BMMH 4TWWA 3DSOA 4YT6H 3SV6A 1DSTA 2BMGB 3GDVA 3LGWA 4AOQA 1TNKA 2XXLA 2AERH 5F8ZA 3SNDA 3EE0B 5C2ZA 1QBVH 2FX6A 2Q6DA 1A5GH 1QL9A 1ETTH 1M9UA 5K0HA 1T8MA 1KXAA 2C8XB 1HAPH 3BN9A 5HXFA 3GCTG 3UFAA 3A7WA 2EC9H 4BAMB 2BD2A 1J17T 1KLIH 1AD8H 8ESTE 3M35A 2TPIZ 2PGBB 4CR5A 1PYTC 2ZDAH 3PRBA 1ELEE 2OCVB 5JBAS 2WPIS 1RIWB 1W10U 2A7JA 1TRYA 2QCYA 1ZJDA 4GHQA 1GJCB 1TNGA 1DX5M 3RMNH 4M9FA 1THRH 1VJ9U 2ZGHA 4D9QA 4X0WU 3KQEA 4BANB 1ELTA 3EGKH 4X6NA 3STJA 1LVMA 1FV9A 2Y7XA 5GJ4B 1P2MA 2P16A 2C8WB 1GBHA 1ZJKA 4WF8A 1AFEH 3BEFB 1UVUH 1A3EH 1EFRD 2A2XH 2A4GA 4K2YA 2P94A 3GCOA 2G4UA 2ZGBH 1OXGA 5GCHF 4X8UH 2UUKB 2IOTA 2H9TH 2BD7A 3DUXH 4FUDA 4IGDA 5EOKA 1ZRKA 1PQ7A 1JIRA 3RXKA 1GL0E 1IHTH 3VB6A 1NFXA 2CV3A 2HLDD 2QN5T 4U30A 3M5LA 4VGCC 4Y71A 1KYNA 3LGIA 4YLQH 3K65B 4DURA 1GI2A 4HGCA 1HDTH 4FOUC 1OP8A 4JZDH 1XUKA 1ZR0A 4F49A 3LH1A 1FUJA 1HGTH 3WWFA 3M61U 2STAE 1LCYA 1XUGA 7LPRA 3VEQB 4LOYH 2BXTH 1C5XB 3LGYA 4ISIH 1LHFH 3E6PH 5KECA 1L4ZA 4QT8C 2RG3A 1TNJA 2GT8A 1L4DA 1TNLA 3QUMP 2BLVA 1ELCA 1V2LT 4RN6A 3BTDE 1E79D 1P02A 2P93A 3VXEH 1DT2A 1Z8JB 2WV5A 1Q3XA 4CBNA 3FFGA 1IQJA 3MFJA 2FPZA 4MPWA 1C5PA 2TIOA 3OAAD 1S85A 3SUEA 2WV4A 5JBTA 1KIGH 3H7OA 4THNH 3U9AH 3GCTF 1RGQA 4ISOA 2P59A 2PTNA 3VG8A 2EI7A 3ZVEA 1HJ8A 2ZNKH 1AE8H 2YMSB 3M5MA 4MNYA 3TJUA 1O2LA 5FX6A 3TIUA 2FOGA 1OSSA 3T26A 1JBUH 2Y82A 5DJ7A 2BDBA 2FP7B 2Z9LA 2IJD1 4NFFA 4ZXXH 1NU9A 1GI9B 1MQ5A 3F9FA 1DVAH 1MBQA 1YCPH 3SV7A 3MWIU 1NBME 2AEIH 1VCQA 4IW4E 1P2IA 1ZMNA 1W0JD 1XUHA 2O8MA 4JZ1A 4ABAA 2VIOA 1F0RA 1B7XB 3DT0H 1QA7A 4Z6AH 3PLBA 3IWMA 3WWBA 2ZDLA 4AGJA 2ILNA 5AVDA 2EQNA 3ZV9A 1QHRB 4NGAH 4TY6A 1AB9C 1K1LA 2QF5A 1HAHH 2FO9A 2PSYA 3OYPA 1MTWA 1EP5A 2J98A 2BDHA 1LKBA 1BJUA 3FVFB 1TQ0B 5CE1A 1TNHA 3IG6B 1FY8E 4ASUD 1MBMA 2K1QA 1O2PA 1GHAG 2B7DH 1BMLA 1Y3VA 1ZPCA 2DE8A 1SGIB 5EW2H 1EPTC 1YGCH 1NBMD 4AX9H 3G01A 3HK6B 3RXTA 1GVZA 3TGJE 1FY3A 5IYTA 4BTUB 2QIQA 1OP2A 3ATWA 1P06A 3BG4B 5F8XA 3SGQE 3UPEA 1EZXC 2BB4A 5JBCS 3RXPA 3FOAA 4OGXA 1TX8A 4XBCA 4H4FA 3BTHE 1AZ8A 1W7GH 2HNTC 1V2WT 3W95A 2HNTF 4ABJA 2FI4E 2JETC 3Q3XA 3SBKA 1LVYA 5HIZA 3RMMH 1HAYB 2WUBA 1XM1A 3ODDA 4UDWH 3ATMA 2ANYA 4DT4A 5C67A 1JRTA 3A8AA 3O8CA 4DIIH 1O2RA 1O2TA 4FVBA 3A81A 5EG4A 4MDSA 3SV9A 1Q2WA 1P2NA 2FM2A 3AASA 2PKSC 1KXEA 1OS8A 1O33A 3JZ1B 4ZAEA 3ZZ4A 1GBFA 1O5EH 5CDFE 2BY6X 3F6UH 1ZHMA 1UW7A 4MPXA 1EAUA 3SJIA 1ORFA 3FZDA 4FUJA 1AIXH 3EYDA 3GY5A 1SLVB 1GBTA 3SJKA 4ABHA 5LPFA 5EPNA 2O8WA 1GI5A 2J97A 3RMLH 1FMGA 4FU8A 1SC8U 1GBAA 4TSFD 3I78A 1PPBH 1P10A 3DFLA 2A1DB 1MZDA 1X7AC 2OUAA 4A92A 3TNSA 4X6OA 1PPFE 3U8RH 1C5WB 3T28A 4B71A 1AMHA 2TBSA 3ATLA 1MQ6A 5F6MA 1F0SA 3UOPA 1BTYA 2AMDA 4CHAB 2JH0D 4UE7H 4JZFH 2XWAA 1G32B 1G3BA 1PFXC 5T6FA 3OEED 4RSPA 5EQQA 4NA8A 5FAHA 2BQ6B 3VB3A 1AI8H 4HG6A 2ZEBA 2G00A 1QB9A 3UY9A 1ARCA 3M5NA 2QXIA 2G51A 2VIWA 4X1PU 1D3QB 2GZ8A 5FBIA 1LMWB 2D2DA 2O8TA 1T4UH 1GHAF 1GCTB 2AH4X 3SU2A 1THSH 4LXBH 3V3MA 3LT3A 1SGCA 2R2WU 1GL1A 3KYFA 4MNWA 1B0EA 1J16A 4ISHH 3O8RA 5DP9A 9ESTA 1YWUA 1WUNH 2V3OH 1AWFH 1HXEH 2FOAA 4AG2A 1CHOG 1HJAC 2XBXA 1ABJH 2XBYA 2ZFTA 2H9EH 4MNVA 3RXHA 1NFWA 5DN6D 1IQLA 1THPB 1Q31A 1UTLM 3LC3A 1QZ8A 2HNTE 2P8OC 3K6ZA 1RRKA 2VB0A 3MO9A 3S0NA 1S0RA 3UWIA 2ZTZA 4XRNA 5IK2D 3VB7A 2GV6A 1EUFA 1O3NA 2BDIA 1SGPE 4B73A 2Z3DA 2YOLA 2G5VA 2XCFA 2GMTC 3DCLA 3GCNA 1H9LB 3MI4A 3MHWU 1O3OA 3E8LA 2JH6D 2QXJA 3W94A 1ZHPA 2J98B 1HPGA 1SFQB 5E0GA 1TALA 3SV8A 1O30A 1H1BA 3ZYEA 3KIDU 1IQGA 1V2JT 3S9AA 4UFDH 4RKJB 2UWLA 4Q7XA 3RXAA 3HKJB 2KFWA 1O2OA 1Z8IB 1YLCA 3VGCC 1O2MA 1AFQC 3DSGA 4RI0A 5LH8A 3NWUA 1C1RA 3ZZ7A 3U28C 1WCZA 3GY2A 3KGPA 4ISLA 1A4WH 3ESTA 1AVWA 6GCHF 3QGNB 5J4SA 3ITIA 1HUTH 2ZO3H 2QXHA 3A7TA 4ZMAH 1S83A 1WDIA 2EI8A 2Z7FE 1XVOA 1CGIE 3KCGH 1Y3UA 2CJIA 4J2YB 4KGAA 3UOUA 1O32A 2R9PA 3FZZA 1W8BH 2PR3A 1ZYOA 1Y59T 1O2WA 3P6ZB 4B76A 4H42U 2UWPA 3I29A 1EAXA 1NROH 1PPEE 3BIUH 3RXFA 3D62A 3SJ9A 1BJVA 5DP6A 1HIAA 1HAZB 1MCVA 2UUJB 4GAWA 5A09A 3TK6A 2KCAA 4F48B 5GDSH 2RCEA 1SGRE 1Z1IA 2FIRH 2HLCA 3CNRA 1KTSB 3PMJA 2HALA 2PGQB 1FIWA 1L2EA 3BTEE 2VIQA 1BOQA 1GMCG 1EOLA 1G37A 3MNXA 2WHXA 1F5KU 4NZLA 5LPRA 2BOKA 2KM0A 3FP8E 3PYHA 4OS6A 4KTCA 2FOMB 4AGKA 1CHOF 1BITA 1T7CA 3M7QA 1GJDB 4BXWA 4ABEA 1IQHA 4INHA 1QNJA 3DSPA 1AZZA 4XD7D 4H6SB 3BTQE 1FZZA 4AN7A 1K1IA 2CMYA 2M2AA 4DJZB 1GVKB 1HLTH 1WYKA 5GNDA 1O34A 1SKYE 3P8OA 4Q4LA 4X1RU 1G30B 1HAGE 4YESB 3SU5A 1GBJA 2ODQA 1WQVH 2GT7A 3U98H 2O9QA 1GVLA 1O2UA 3WY8A 1T4VH 1BHXF 1JIMA 1YPHC 3GISB 1VKYA 1HAVA 2SGFE 2VNTA 3OY5U 3UNRA 2H5CA 2Z94A 5A8YA 1G2MA 5DSFA 4BTTB 1C2KA 1GHXH 1LTOA 3RC6A 1COWD 4WMDA 4A1TA 1C1NA 2EY4C 3SV2H 3BEIB 2PKAA 3MYWA 2A5AA 4GVUA 4YM9A 1DFPA 3BSQA 2F43B 1NZQH 1IQIA 1INCA 1K1MA 5CHBA 2WPHS 2P95A 3SW2B 2BDCA 5DP4A 1ZGIA 1D6RA 5DP7A 1OOKB 3DA9B 1EKBB 1EJAA 4Y7AA 3OU0A 1H9HE 4NA9H 3JZ2B 7KMEH 5CMXH 4CREA 3PB1E 5AF9H 1SGNE 1RIWC 5BRRE 2FI5E 2KZ4A 1ESTA 3F2FA 1EQ9A 4KP0A 4WH8A 1OHHD 3RDZA 1MAXA 1O35A 5TCAA 1EAIA 2W3KA 1WSSH 1CA0B 4HTCH 1ELGA 4IMZA 4MQAA 1QB6A 4TT3D 3SU3A 1H8IH 1C9TA 1VITH 5DP8A 4ACAA 1UTMA 2XC5A 2XOKD 1RTKA 2BDYA 1W13U 1ZGVA 3KQ5A 4DVAU 1ELAA 4DCDA 4ZCNA 2H9HA 2PLXA 3W1EA 1LPZB 4IBLH 1V2ST 4K1SA 1UTQA 3B23B 3GICB 4X8SH 1CVWH 1PPZA 1O2NA 3TGKE 2FEQH 3ZZ9A 3RXBA 1CE5A 2C90B 3BTWE 3M36A 2WPJS 3LH3A 1EP6A 2Q1JA 2L6OA 1QJ7B 1N8OB 3EQ0H 1QRZA 3LOXA 1D6WA 3ZZCA 1GMCF 1Z6EA 1TYNA 3FN8A 3TU7H 4JYVH 3OTPA 1ZTKA 5JBBS 1QBOA 1ZTLA 4I86A 1DOJA 2XBWA 1O37A 1QY6A 2A45B 4BAQB 5LGOA 4WJG2 2W6ID 1RFNA 3U1IB 3CS0A 1TRMA 1GI6A 2THFB 3SOSA 4AC9A 2A32A 2CF9H 1RS0A 5GXPA 3OTJE 1MKXH 4Q7YA 1D3TB 5E0HA 2FI3E 6LPRA 5HM9A 3ZVFA 1PPGE 1V2KT 1KDQA 1LQDB 2RDEA 2ZCKP 2NU3E 3BTFE 3F9EA 2VIVA 2ALVA 1HYLA 2AMPA 4TPIZ 1RTFB 1YPHE 3EDXB 2VVCA 1OWIA 1YLNA 1DE7H 1NFUA 1Z6JH 3N7EA 3MU8A 4K1EA 3A7YA 5JPMH 4X2XA 1H8DH 1MH0A 4H6TA 1HIAB 2NU0E 3H09A 3R3GB 3UUZA 3TVJB 3BF6H 4E7NA 4X1QU 3T62A 4AZ2B 4ZKOU 3D65E 1VCPA 3FP6E 2DUCA 3L6PA 3RLWH 4AYVB 2HVYB 1O5BB 4J1YA 3QTOH 4IS5A 1H8HD 2VWMA 1WXRA 3ZVDA 4CBOA 2YMSC 1DDJA 4JMYA 1O3PB 4BAOB 5ESTE 1AO5A 1ACBE 1PPHE 1BBRH 1TE0A 5EPYA 2Z6BD 3M5OA 2BQ7B 1CGHA 1ETSH 1YM0A 2FZZA 1TOMH 4YO9A 2XNDD 1ZZZA 1DLKB 2IJOB 2XTTB 4UFFH 1W2KH 4GLYA 4WXIA 2BHGA 4WY3A 3A7VA 1LVBA 2W7SA 1PQ5A 1GBMA 1DANH 3S7HB 1IAUA 3GDUA 4IN1A 3ZIAD 5EJLA 1WTHD 1DICA 1A0JA 1O39A 4Y7BA 3UQOA 2A5KA 1HAVB 5C17A 1OP0A 2O8LA 3UR6A 1UHBA 1UK2A 5JDUB 2FDAA 4MVNA 2XCNA 3PWCA 1E0FD 3S9CA 2SGPE 1KLJH 1G3CA 1E1RD 1FXYA 1NPMA 4NWKA 1P01A 2PKAB 1DUEA 2GCTB 3TLOA 2BVXH 1BRCE 3OFND 2ANWA 3ZZ5A 1QTFA 1ZTJA 1Y8TA 2ESTE 3LKWA 3PO1B 1GGDB 2BVRH 2YNAA 1EX3A 3GDSA 4UEHH 3QTVH 1LPKB 1YPEH 3QX5H 4BTIB 1Y5BT 1O36A 2A5IA 2GD4B 2WUCA 1D9IA 1UVSH 4Y6DA 2R2MB 1EZUC 1RTLA 1NTPA 1BIOA 3BG4C 1C5OH 2XC4A 2BZAA 4JK5A 2PW8H 2ZFRH 1AQ7A 5FPTA 1YC0A 4MLFB 2OXSA 1TBQH 2AS9A 2IPHA 3KQCA 5EGMA 1OYQA 4RT1A 3RXDA 3U8TH 5E2PA 2HRVA 8KME2 5K7RA 4TYDA 3TITA 1DLEA 1C5YB 1BMAA 1C2IA 2QGRA 2K8IA 4K5ZA 1A46H 2ZGXH 1CGJE 2SGQE 2ASUB 1ZLRA 1AN1E 4IMQA 3BTME 2Y80A 1KY9A 3AVZA 2BDAA 4I8LA 4Y0YE 5EXMA 2QAAA 2QV1A 4BOHA 1O2GH 3RXCA 3AK5A 4AYYB 1SGEE 2NWNA 3MH7A 4D7GA 4YZUA 1P9UA 4I32A 2B8OH 3T25A 5ABWA 3QO6A 1T8OA 1FIZA 2FOHA 3UREA 1P8VC 2VIDA 2WV9A 1E38B 1F5LA 2GVFA 2ZU5A 1C5TA 3PV2A 3QZRA 1C1TA 1A61H 2WZQA 1O5GH 1TABE 2PUXB 5F53A 2W5EA 1CT2E 1VCWA 1T31A 3RU4T 3SYJA 2XRCA 5FXLA 1SQRA 3ENSB 1ZMJA 4WWYA 1HV7A 2PUQH 3A7XA 4XSKU 3UAIC 1SFIA 3SORA 3E0PB 4R0IA 2L74A 1CU1A 4ZHAA 1LVOA 1Z8GA 2J4IA 4TY7A 2HGTH 4CHAC 4NSVA 1O2QA 3HGPA 1D3PB 2ZG0H 4GCHG 2GTBA 1KDQB 4UONA 3A86A 2HVXA 4P02A 4B75A 2R0LA 2FYRA 5HMAA 3I77A 2Y81A 1XXFA 2Z3CA 1SGTA 1DXPA 1P3EA 1GJAB 3DHKH 4ZUHA 1DS2E 1O3AA 1ZPZA 2J5UA 3BEUA 1W0KD 1QGFA 3O8DA 1EASA 5BPEA 1HBTH 4YOIA 4YTAA 1O3MA 2YMSD 1DM4B 3F2GA 2GX4A 3EE7A 3V13A 1EJNA 1CO7E 1U6QA 4E06H 1S6LA 4R8TB 3F0OA 2BOHB 2KCYA 1GCTC 2PSXA 1UVPA 2SNWA 4WMFA 4AB9A 1C2MA 5A0AE 3ZVGA 2ZC9H 2ULLA 3UWJH 3M37A 2BY7X 2PP6A 1ANDA 1TONA 2QF4A 1LPGB 1GHYH 3HATH 3KQBA 4CRCA 1V2VT 4I8GA 2F83A 3LONA 1QL7A 3H5CB 4O03A 1V6DA 5C1UA 2TGTA 1MU6B 1PPCE 1SR5C 1ANBA 2OC1A 2LNCA 3QWCH 2F4LA 3TGIE 1AY6H 1LHEH 1SGFG 3VB4A 4RKOB 1H9IE 1RD3B 2C93B 1BRUP 3F0PA 1MD7A 2J94A 1UHBB 1O3CA 1WBGB 4INKA 1P11E 3LJOA 5L30H 4B6FA 2D26C 1AVGH 2ZFFH 4NFEA 1ZOMA 6GCHG 1JRSA 1TMUH 2O8UA 2FS9A 4YLUA 2WPKS 5FCKA 1G3DA 2G4TA 1C5RA 1FJSA 2F9UA 3NCLA 3PTBA 3LJJA 3A84A 4TWYA 5A2MH 4O3UA 3SNAA 2C8YB 4BXSA 1S84A 4MTBA 2A4OA 3A82A 3MH4A 1K22H 3A87A 4X1NU 1S0QA 1FI8A 2JJ2D 4X2YA 3TJOA 5HIYA 1SG8B 2KCPA 4XE4A 1SLWB 3AW0A 4CH8B 1V2RT 1C5QA 4JZIA 1C5SA 5HYOA 2F9NA 2V0BA 3PM3A 3TJNA 4ZKNU 3VB5A 1LHDH 2GP9B 2ZDMA 1DPOA 1UTJA 4ABFA 1BQYA 2AFQB 1FX0B 4GCHF 2XBVA 2CF8H 3SGBE 3EA7A 3Q77A 1C5LH 1W12U 1C2LA 3STIA 1DWDH 3GYMA 5GIBA 4Y8YA 1HAXB 1WAYB 2Q6GA 1QJ1B 5C5NA 2A7HA 2OTVA 4DG4A 1TGNA 2ZU3A 1YY3A 2C8ZB 3TH4H 2CHAB 4ZHMU 5I46H 3KQDA 1LKAA 1MZAA 3SGAE 3QDZB 4CR9A 4NIWA 1WV7H 2BM2A 2ODYB 3A88A 2M5TA 2BY8X 1GDUA 2ZECA 2JKHA 4ACBA 1ETRH 1GBKA 4BAKB 4WVPE 2BDGA 2RA0A 1NFYA 3ZZ8A 3SZNA 3URDA 1QCPA 4INLA 4NSYA 3A7ZA 1A0HB 1AWHB 1O2IA 3F2HA 2FMJA 2BD3A 5EJZA 1VGCB 3N99A 1EXFA 1HB0B 3F9HA 3SHCH 1YF4A 3UIRA 1S5SA 2ZU2A 2OD3B 5DGJA 4XFQA 5A0CA 2ZA5A 2RDLA 3SJ8A 1GHVH 1FNIA 1O31A 2EEKA 2TGAA 1A5IA 3QLPH 1BBRE 1NY22 1OWEA 1K0HA 1EOJA 5HM2A 3S69A 1A3BH 1O38A 3HPTB 1HAOH 2EA3A 2VGCB 5F03A 3B9FH 2H6MA 3BTTE 5SGAE 3LU9B 3MOCA 5FBEA 2GGVB 3MU1A 2QYIA 3LIWA 3NK8A 2BD5A 3P70B 5EXNA 1TGTA 1JXPA 5E8EH 2ZPRA 5T3HA 4FUEA 4YXWD 3U1JB 2VWLA 3FANA 1TMBH 5ETXA 3FP7E 4ABIA 1SVPA 2A2QH 1BMNH 2F9OA 3HKIB 4SGAE 1MD8A 1TBRH 1K1JA 4X6PA 1UVTH 4AFQA 2VVVA 1O3DA 2J92A 1W0ZU 1G2LA 1GJ7B 4ABGA 2VWOA 3AW1A 4AFSA 1TWXB 1NRPH 2G81E 2ZIQH 4UD9H 4FXGH 1NRRH 3RXJA 1TPSA 2ANMH 5HGGA 5FX5A 1ZPBA 4Y8ZA 3GY7A 5AFZH 3LGUA 3ZZAA 1FY4A 2J2UA 1L0ZA 3O8BA 2B5TB 4X8TH 4B6EA 1ESBA 1QURH 4AFZA 1ELFA 1NT1A 2OC0A 1CA0C 3MH5A 3VFEA 1C5ZB 5C1XA 3SN8A 2H5DA 1SMFE 3RXGA 1ELVA 2WPMS 5GWZA 1T8NA 1SB1H 3A83A 1GDQA 4FUFA 1SQOA 1F2SE 1TNIA 2G55A 1IQMA 1Y5AT 1WU1A 4CRBA 4Y8XA 1TFXA 3IITA 2D8WA 3PLPA 3MNCA 1W11U 1O3JA 1V2QT 3OSYA 1J8AA
chains in the Genus database with same CATH topology
1O2KA 1S81A 1C2HA 4KKDA 1DWEH 1FLEE 1N8OC 2ZQ1A 1NRNH 3D49H 1YCPK 1O3FA 2OBOA 2OLGA 1FDPA 2QF0A 2Z9KA 4OS7A 5EW1H 4WMEA 3PMAB 3S7KB 1MUEB 1UO6A 1FAKH 4X1SU 1W7XH 1KXDA 3SQEE 1GMHG 1YPJH 3RP2A 5PTPA 1HCGA 1V2UT 2BD8A 3ZVBA 1PJPA 3AAUA 1T32A 2FOEA 1G9IE 3P95A 1C4V2 4FU9A 4ZKOU 2FX4A 1YLDA 1Z71A 2P3UB 2ZTXA 4I31A 4PROA 3GOVB 4Y76A 3RM0H 3P92A 1G3EA 3Q00A 4K1TA 1S6HA 1V2MT 1GJBB 3BIVH 3LGTA 2RA3A 2WYJA 3GY3A 3GCHB 4HI3A 1P2KA 2AIPA 2OC8A 3TPIZ 1O3GA 2FOCA 2D1JA 4OS4A 5LPEA 1MTVA 3VXFH 5C5OA 2EI6A 3PMBB 1DUAA 2AMQA 1L1JA 1QRXA 3DD2H 1GMDG 1YBWA 3EA8A 5H4IB 3EAJA 2ZQ2A 2IN2A 3NZIA 1B0FA 1C5UA 1IQKA 2J9NA 3RMOH 1TBZH 5DP3A 2F3CE 3UNQA 2QA9E 1Z8RA 4DIHH 3SUGA 3FAOA 3RXUA 2PWXA 1YYY1 5C3NA 5C20A 4XBBA 2ZDNA 1DY9A 1DY8A 2G8TA 2NU2E 2G52A 2ZCLP 1RXPA 1IQEA 1BTXA 2GZ9A 3CS7A 4I8HA 1E36B 2BY9X 3V7TA 3M7UA 1AE5A 1HXFH 1C1OA 2ODPA 1LDTT 2SNVA 4NWLA 4TPYA 4F4OC 2V6NA 4JCNA 1B5GH 1ELBA 4OGYA 7GCHG 1BHXB 3R0FA 1O2SA 5DG6A 1C1MA 2OC7A 2BX4A 1GBLA 3T29A 2GCTC 1SSXA 1Y5UT 1W3CA 2YNBA 3RU4E 1IHSH 1UJ1A 3RXVA 2HWLB 3PO1C 1GGDC 1NU7B 1SGQE 3M3TA 1K1PA 2ZKSA 4GHTA 1LHCH 1VR1H 2A4RA 3LGVA 2Z9GA 2AGGX 3RC4A 1SOZA 1GMHF 1V2NT 1TOCB 4XBDA 3RXIA 1OWDA 1O5FH 2XC0A 1P2OA 1MTNB 1QB1A 2QF3A 4LZ1H 1VITG 4Y11E 1ZSJA 3E91A 3MO3A 3OY6U 1AU8A 1P09A 4I7YH 4K69A 4A5TS 1GBEA 1C2DA 3RXLA 1JMOH 3M7TA 1MTUA 2ZI2H 3E90B 2VIPA 3P17H 1KTTB 4D76A 1QQ4A 2VJ1A 1CBWB 1XKAC 3RXRA 1DXWA 2Q6FA 1KSNA 4AORA 1O2JA 1K1OA 1D3DB 1V3XA 5C1YA 3RU4D 1GI7B 4GPGA 1ZHRA 2FTMA 5TJXA 4AFUA 3SO3A 2R0KA 1O3LA 2ZGJA 5CHAB 1XMNB 3SU1A 4IN2A 1ZSKA 3UR9A 2H1UA 1WTGH 4BNRA 1GMDF 1GG6B 3K6YA 3NKKA 1UMAH 1TGBA 4MPVA 3F9GA 3T5FH 1CHGA 1E35B 2G5NA 4MG3A 6CHAB 1UVOA 1CT0E 1GHZA 2NU1E 1NO9H 2Y5FA 1BZXE 1C1SA 1UTKA 1XKBC 1C2JA 5A8XA 2XYAA 2GDEH 4O3TA 1RJXB 2Y5HA 1F92A 4ZROA 1OPHB 5AHGH 1F0UA 4ABBA 5EU8A 2OQ5A 1E34B 1TMTH 4JYTA 1TLDA 1WOFA 2ZF0H 4SGBE 2DE9A 1O3EA 4LK4A 5JYIA 2R3UA 2ZHDA 1IQNA 4WXVA 3GY8A 5DPAA 4ZXYH 2P3FH 3BTKE 3PV4A 1OWHA 5DO4H 2HPQH 2AYWA 1TGSZ 1C2FA 4ZKRU 1DSUA 2Z3EA 2WINI 4MNXA 1EPTA 1S6FA 7GCHF 3Q76A 3MTYA 3NXPA 3V0XA 3P8FA 2GCHG 1QQUA 1TRNA 5FCRA 4D8NA 1T8LA 1NM6A 1QA0A 1UK3A 1O2HA 1C1QA 1P3CA 1K9OE 3UTUH 2ZZUH 2KAIA 4UFGH 4YOJA 5J4QA 2FLRH 1QR3E 2OBQA 1GBBA 2ZHFH 3SU0A 4B2CA 5JB9S 3GY4A 1A1RA 3ELAH 2J95A 3OX7U 1MTSA 1UTOA 1CQQA 1GPZA 1OWJA 3LDXH 3QK1A 2FOBA 4NG9H 1GI3A 4GUXA 3RM2H 1P05A 4NA7A 2ZCHP 1FPCH 1VITF 3T2NA 2C4FH 2V3HH 1Y3XA 4K8YA 2FESH 2TRMA 6ESTA 5EODA 2OINA 3D23A 4A6LA 2HOBA 4X8VH 4B2BA 2PHBA 3HK3B 1XUFA 4K3JA 3C27B 1QBNA 2J34A 2BY5X 3ZVCA 3KF2A 3QZQA 1XVMA 2AGEX 1FQ3A 1YPKH 1O2ZA 2ZFPH 4I8KA 3SNBA 3TH2H 2FS8A 1GI8B 4VGCB 4KTUA 2BLQA 1HRTH 3VPKA 1A5HA 2BTCE 1FY1A 4FUCA 4D9RA 4A7IB 3F1SB 1BCUH 2FLBH 1GHBG 2I6QA 3NPSA 5L2YH 3ODFA 3P8GA 2AIQA 2CGAA 4U32A 5B6OA 3CENA 1F5RA 2FYQA 1HJ9A 5L6NH 1LQEA 1O0DH 3M3VA 4GSOA 1TX6A 1PQ8A 1UCYH 1EJMA 2F9BH 1PYTD 1C5VA 4Q2KA 4AG1A 4U2WA 1L1GA 3LC5A 4A1XA 3PROA 1MMJN 4ZHLU 1TPAE 3SQHE 1C9PA 1P2QA 3BTGE 1UTNA 2NU4E 4JK6A 1MAYA 1VZQH 1H4WA 1Z1JA 2QC2A 3PLKA 1ZSLA 4A1VA 2Y5GA 2OQUA 1YP9A 2A4QA 1NRQH 1J15A 3KNXA 1BRAA 2BD4A 3V12A 3A8BA 1FN8A 1V2OT 3RC5A 4XOJA 1SQAA 1LHGH 2FTLE 2BLWA 2VINA 2ZGCA 2BD9A 2I6SA 3SI4H 4CRDA 2SFAA 2Y7ZA 4B2AA 1J14A 1P9SA 2A0QB 5FHTA 1SOTA 4CRGA 2GCHF 2LPRA 1HAIH 4ZKSU 4X2VA 3RXEA 2CHAC 3SJOA 1IOEA 5A0BA 2ZFQH 3MO6A 1NS3A 5GPIB 4CRAA 1MKWH 2ZPQA 3RXSA 1C1PA 1O2YA 1OYTH 1FPHH 2ZWLH 3AAVA 5EQSA 1K21H 1XXDA 2BLOA 1GBCA 1MCTA 1ESAA 1GCDA 2V35A 2SGEE 3PTNA 5AFYH 3SUDA 4D7FA 3S9BA 2FXRA 2PV9B 4ASHA 3SUFA 1AB9B 1VGCC 2VU8E 1SGYE 1BTZA 1E37B 1GJ6A 1O3IA 1K28D 1KXCA 4K8BA 3E3TA 5TCCA 1K2I1 1C2GA 1SI5H 3SNCA 3MH6A 3QN7A 1F7ZA 5G4BA 3L33A 3LPRA 3MNBA 3SU6A 2Y6TA 1ABIH 2W26A 4Z0KA 3DFJA 1O2XA 2VH0A 2BYAX 2WPLS 3N7OA 2STBE 2B9LA 3ZZ3A 1SGFA 2VGCC 3ATKA 1C1WH 1EPTB 5EQRA 2GV7A 1P04A 4E05H 4JYUH 5I25A 4DY7B 1GHBF 3SHAH 1AKSA 1YPGH 4XDEA 2F91A 3ZZ6A 1SHHB 1EB2A 2F9VA 2KAIB 3E0NB 2UUFB 3CP7A 1TA2A 1SBWA 2AGIX 3MMGA 1HFDA 4U01A 4O97A 1OWKA 2JETB 3T27A 1EATA 1GJ8B 2JH5D 1MKXK 1DWBH 2J38A 1P12E 1D4PB 2ANKH 5A8ZA 1BB0B 1GI0A 4FUHA 2H2ZA 1NESE 2CXVA 3K2UA 1FONA 3E16B 1GWAA 2XW9A 2ALPA 1P2JA 1AUTC 3U69H 3A89A 2PKSB 1ANCA 1BA8B 1CSOE 3P8NA 4NIXA 3A8DA 1A7SA 1N1LA 1TGCA 5L2ZH 5EXLA 2ZFSA 1YCPM 2F9PA 4I8JA 5FPSA 1KXFA 4ISNA 1CA8B 1QJ6B 3Q3YA 9LPRA 2XNIA 2P3TB 8GCHG 1LO6A 1O2VA 4NZQA 1W14U 4X6MA 1ARBA 3RXMA 3BG8A 1G36A 5DK1A 3RXQA 1ZRBA 1AVXA 1UTPA 4LZ4B 2TGPZ 3TJVA 1JWTA 4O9VA 1HNEE 1BTPA 2Z9JA 1BBRK 1QIXB 4FVDA 3MNSA 1C5MD 1TIOA 2ZU4A 1Y3WA 3M3SA 3H7TA 4DT7B 4FUIA 4ESTE 2PFEA 2ZDVH 1TA6A 3ZV8A 2A7CA 2A31A 3UQVA 1EAWA 4NCYA 8LPRA 2ZHEH 1N6XA 1SLXB 2ZPSA 2FWWA 4DOQA 2GDDA 4WH6A 1TX7A 1AUJA 5DKMA 2ZU1A 3PWBA 1TPOA 4IC5A 2XWBI 4FUBA 1GJ9B 3BV9B 1TQ7B 2Z9IA 1O3HA 5JB8S 2ZTYA 3GY6A 3L3TA 4OS1A 3RUOA 3GCHC 1QL8A 1AHTH 3UNSA 1BTWA 3KEEA 1BTUA 1C5NH 4DW2U 2GKVE 1HJAB 1ZMLA 1C4Y2 3EA9A 4JZEH 1YPMH 1GJ4H 3RLYH 1TPPA 3MU0A 1S82A 2P8OB 1O5CB 1YKTA 1XX9A 2B0FA 3KHVA 1BDAA 3Q3KA 4NIYA 2QY0B 4NIVA 2TGDA 1BTHH 1DITH 4B1TA 4HZHA 3ZYDA 4UFEH 1EB1H 4FU7A 1A2CH 1K1NA 2UWOA 1PQAA 2BQWB 2SGDE 1C4U2 2GMTB 1SGDE 1QRWA 3MU5A 1IQFA 3F68H 7ESTE 1GBIA 2BVSH 4M7GA 1FAXA 3E1XB 2ZP0H 2QXGA 3K9XB 5FPYA 4E7RG 2W7UA 3KL6A 4Y79A 5IDKA 1V2TT 1P03A 3URCA 1GHWH 1GDNA 5T6DA 1GBDA 3C1KA 2FODA 8GCHF 4I33A 1FY5A 4OS5A 3VGCB 1AFQB 3NUMA 3U8OH 2BXUH 3PMHB 4ZH8A 1Z7KA 2R3YA 3GYLB 2VWNA 4BAHB 1NC6A 3B8JA 3A85A 1AKSB 1OX1A 1OKXA 5E2OA 2ZDKA 1SPJA 3SI3H 1O3KA 3MU4A 4HFPB 1KLTA 1C2EA 1NN6A 4AB8A 2VVUA 2CN0H 3ZZBA 1C1VH 4B74A 4CH2B 4ABDA 3TNTA 4Q80A 1ELDE 3KN2A 4OS2A 3ZZDA 1BUIA 1TAWA 4KTSA 1MTNC 1BT7A 1EZQA 3QGJA 1UCYK 4YOGA 4X2WA 1UCYE 1UK4A 2C3SA 5E0JA 4IC6A 1N6YA 5ESBA 1BRBE 1TB6H 5GCHG 5T6GA 4FUGA 3A8CA 5DP5A 1V2PT 3TH3H 2BZ6H 1FN6A 1NRSH 1CBWC 1ID5H 2VH6A 2SGAA 2ZHQH 1AGJA 1MU8B 1XUJA 2W3IA 1O3BA 1QFKH 1GI1A 1J9CH 1W0YH 2UUYA 1SHYA 2FOFA 4YT7H 1GJ5H 1SL3A 2PTCE 5CHAC 1L1NA 1VJAU 1F0TA 3ZVAA 3RXOA 2GZ7A 1WQSA 1YPLH 1O5AB 1GI4A 1GG6C 3TK9A 1A0LA 1KXBA 2BX3A 4KELA 4CRFA 1DWCH 4MPUA 6CHAC 1P0SH 1SQTA 3ATIA 5F8TA 2ZHWH 1XUIA 1O5DH 1CT4E 1P57B 4K60A 1JOUB 3A80A 1SLUB 1Y3YA 4Y10E 3SNEA 1ANEA 4Q7ZA 1C1UH 4DGJA 3HGNA 2OP9A 2HPPH 4Y0ZE 3SU4A 3TK5A 1EZSC 2WYGA 1MKWK 1BMMH 4TWWA 4YT6H 3SV6A 1DSTA 2BMGB 3GDVA 3LGWA 4AOQA 1TNKA 2XXLA 2AERH 5F8ZA 3SNDA 3EE0B 5C2ZA 1QBVH 2FX6A 2Q6DA 1A5GH 1QL9A 1ETTH 1M9UA 5K0HA 1T8MA 1KXAA 2C8XB 1HAPH 3BN9A 5HXFA 3GCTG 3UFAA 3A7WA 2EC9H 4BAMB 2BD2A 1J17T 1KLIH 1AD8H 8ESTE 3M35A 2TPIZ 2PGBB 4CR5A 1PYTC 2ZDAH 1ELEE 2OCVB 5JBAS 2WPIS 1RIWB 1W10U 2A7JA 1TRYA 2QCYA 1ZJDA 4GHQA 1GJCB 1TNGA 1DX5M 3RMNH 1THRH 1VJ9U 2ZGHA 4D9QA 4X0WU 3KQEA 4BANB 1ELTA 3EGKH 4X6NA 3STJA 1LVMA 1FV9A 2Y7XA 5GJ4B 1P2MA 2P16A 2C8WB 1GBHA 1ZJKA 4WF8A 1AFEH 3BEFB 1UVUH 1A3EH 2A2XH 2A4GA 4K2YA 2P94A 3GCOA 2G4UA 2ZGBH 1OXGA 5GCHF 4X8UH 2UUKB 2IOTA 2H9TH 2BD7A 3DUXH 4FUDA 4IGDA 5EOKA 1ZRKA 1PQ7A 1JIRA 3RXKA 1GL0E 1IHTH 3VB6A 1NFXA 2CV3A 4U30A 2QN5T 3M5LA 4VGCC 4Y71A 1KYNA 3LGIA 4YLQH 3K65B 4DURA 1GI2A 4HGCA 1HDTH 1OP8A 4JZDH 1XUKA 1ZR0A 4F49A 3LH1A 1FUJA 1HGTH 3M61U 2STAE 1LCYA 1XUGA 7LPRA 3VEQB 4LOYH 2BXTH 1C5XB 3LGYA 4ISIH 1LHFH 3E6PH 1L4ZA 4QT8C 2RG3A 1TNJA 2GT8A 1L4DA 1TNLA 3QUMP 2BLVA 1ELCA 1V2LT 4RN6A 3BTDE 1P02A 2P93A 3VXEH 1DT2A 1Z8JB 2WV5A 1Q3XA 4CBNA 3FFGA 1IQJA 3MFJA 2FPZA 4MPWA 1C5PA 2TIOA 1S85A 3SUEA 2WV4A 5JBTA 1KIGH 3H7OA 4THNH 3U9AH 3GCTF 1RGQA 4ISOA 2P59A 2PTNA 2EI7A 3ZVEA 1HJ8A 2ZNKH 1AE8H 3M5MA 4MNYA 3TJUA 1O2LA 5FX6A 3TIUA 2FOGA 1OSSA 3T26A 1JBUH 2Y82A 5DJ7A 2BDBA 2FP7B 2Z9LA 4NFFA 4ZXXH 1NU9A 1GI9B 1MQ5A 3F9FA 1DVAH 1MBQA 1YCPH 3SV7A 3MWIU 2AEIH 1VCQA 4IW4E 1P2IA 1ZMNA 1XUHA 2O8MA 4JZ1A 4ABAA 2VIOA 1F0RA 1B7XB 3DT0H 1QA7A 4Z6AH 3PLBA 3IWMA 2ZDLA 4AGJA 2ILNA 5AVDA 3ZV9A 1QHRB 4NGAH 4TY6A 1AB9C 1K1LA 1HAHH 2FO9A 2PSYA 3OYPA 1MTWA 1EP5A 2BDHA 1LKBA 1BJUA 3FVFB 1TQ0B 5CE1A 1TNHA 3IG6B 1FY8E 1MBMA 2K1QA 1O2PA