2WUCA

Crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp and ac-kqlr-chloromethylketone
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
239
structure length
239
Chain Sequence
b'IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
pubmed doi rcsb
total genus 53
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wucA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wucA01
2GV7A 2HALA 2FS9A 1O2QA 1ANDA 1YP9A 2EC9H 2HWLB 2ZF0H 5B6OA 1Q31A 3O8CA 3RLYH 1SPJA 1C5TA 2D2DA 2XTTB 1TB6H 3DFJA 1NRPH 2A1DB 2QGRA 1Z6JH 4MTBA 1YPKH 1SGQE 1C5MD 5CMXH 5DG6A 3UFAA 3UOPA 3BG4C 3E0NB 4BXSA 1EZSC 1GVZA 3TK5A 3M3VA 4TPYA 4X2XA 1XUHA 1FUJA 4K60A 1AWHB 3A89A 4MNWA 2QV1A 2VIOA 2PSXA 3QLPH 1G30B 1ANCA 3A8DA 2Y7XA 1O3JA 3D49H 5C5NA 1O2LA 2A5IA 1K2I1 5E2OA 1BTPA 3QN7A 4D76A 2Q6FA 2FX4A 3RU4D 3UR9A 1LKAA 4ASHA 1FAXA 2F9PA 1YBWA 3NWUA 4IMZA 1XUJA 3ZZCA 3LH1A 1SSXA 1OWJA 3QZQA 1RTFB 1GHWH 1DXPA 1GL1A 3UY9A 1BITA 1GBJA 4MNXA 1FMGA 1V2TT 1D6WA 3K9XB 1GBLA 3HGNA 2P95A 2ANMH 3ODFA 3SOSA 3LGVA 1S0RA 4X1QU 1ZTJA 4A6LA 3KQEA 2BQ7B 2D1JA 2XRCA 2QCYA 1BDAA 3RM0H 1SB1H 1IQGA 1C2JA 1V2WT 2UWOA 3P8NA 4QT8C 4B73A 1H9IE 1SGRE 6CHAB 2GT8A 2BHGA 3S0NA 1EAXA 3AASA 1H1BA 2FO9A 2GCTB 2STBE 3A88A 1DS2E 2J38A 5HGGA 4WXVA 1F5KU 1GJBB 1P9SA 1AVXA 3FP8E 4WF8A 4JK6A 3SQHE 2OQUA 2R2MB 1TGSZ 1Y5UT 4GSOA 1ELAA 1GI3A 2ALVA 1AHTH 3TK6A 4BAQB 2V3HH 1LO6A 1ELCA 2FWWA 3S9AA 1RGQA 2Q1JA 1YPHE 1MTVA 1Y5AT 2FOMB 1NRRH 4UDWH 1C5UA 4WXIA 4DJZB 1DDJA 3AAUA 1XVMA 1L1JA 2A2QH 1W3CA 2FYRA 3RU4E 1GMCG 1C2DA 4OS6A 1P03A 2NU4E 3U9AH 4U2WA 1V2MT 4CH8B 4UFEH 4DIHH 1HAPH 3MU5A 1TRNA 1BIOA 3LGTA 4ABBA 2VGCB 3HK6B 2JH5D 1TLDA 1Y3WA 4KGAA 3HATH 4TY6A 1ZPBA 1C4Y2 1O3OA 1A46H 2G8TA 2SGPE 1MAXA 3TJOA 1VGCB 1Y8TA 1GHAG 3SJOA 1QBNA 1MU6B 2BLWA 1J14A 3B23B 1O2KA 1T7CA 2A5AA 1GBTA 1ANEA 3GY8A 3AVZA 1PPGE 2H9HA 3Q00A 1UCYK 5FPSA 1GHXH 2GP9B 1D9IA 2FZZA 2FLRH 1GJAB 2OXSA 2PTNA 3MFJA 3SNBA 3Q76A 1UTPA 1NRQH 3P17H 5HMAA 2BZAA 1C5SA 3MU1A 4AG1A 3A84A 1QJ7B 2Q6GA 2OCVB 1SBWA 3BEFB 5E0HA 1C1RA 1ZPZA 1KXFA 3RU4T 2DE9A 4X1SU 4DG4A 1GBAA 4FXGH 1BRAA 1V2RT 3P92A 3KCGH 1G9IE 2BOHB 1LKBA 5C1YA 5IDKA 1DICA 1Z7KA 3ZYEA 1Z8RA 3EE0B 1EJNA 3F1SB 3PMBB 1Z8IB 4OGXA 5EODA 3RMLH 4LXBH 3ATIA 2TBSA 3ATWA 3A8AA 3Q77A 4JYUH 1A5GH 1EZUC 5EOKA 3T2NA 3PTBA 4K2YA 5FHTA 5TCCA 1CE5A 2ODYB 5T6FA 2ZFTA 1IQNA 1QNJA 5EG4A 4ABFA 1AI8H 5F03A 1TA2A 1O3PB 1TBZH 3SUDA 3LGWA 1SOZA 5I25A 1Y3UA 5F8TA 1TBRH 1QB9A 2QN5T 3GCHC 3AW0A 1TALA 3MNXA 2F9NA 1TMUH 3BTHE 4WMFA 4D7GA 1QL7A 4X1PU 4BOHA 1V2LT 4I8JA 1MQ5A 4DY7B 1GI6A 1SQTA 3SV8A 2OBQA 4FU8A 2AGGX 4AYVB 4ZUHA 2RCEA 2BX4A 3FANA 4WMDA 1DLKB 5FXLA 4BTTB 1BJVA 1SOTA 3S7HB 1RJXB 4MVNA 4B2BA 3D23A 4B2AA 1EPTA 2OC0A 3GDSA 1VR1H 4WWYA 3RXKA 3HK3B 2FXRA 1JMOH 3TLOA 2WINI 4ISIH 1DT2A 3GDUA 4DCDA 4HTCH 1KY9A 2D26C 6LPRA 2VU8E 2BY6X 3OU0A 5JBBS 3UQVA 2GV6A 2CF9H 1S6HA 2W7UA 3KL6A 3A7VA 2PR3A 3SN8A 1O5AB 1V2KT 4BAMB 1QQUA 2WPMS 1S84A 1ZSLA 2FI3E 2BY5X 1KDQA 2GCHF 4CBNA 1GPZA 1K1IA 1NY22 3SO3A 3VGCB 2C8WB 1P01A 1FY4A 5F8ZA 4WVPE 3GY4A 4CBOA 1BJUA 2FOBA 2TIOA 2ZKSA 3UREA 5GIBA 1LVMA 1C1NA 1ZR0A 1TNKA 3FZZA 4GCHF 2AIQA 2XNIA 1HCGA 1O30A 3SV2H 3UNSA 1GI8B 1EZQA 2F91A 1OWEA 3SNDA 1GBEA 1MTSA 4HFPB 1OWHA 2A0QB 5HXFA 5C5OA 3RXLA 4CHAC 2QXGA 1SLUB 4AZ2B 1Y59T 2NWNA 1A5IA 2FEQH 4MPXA 2AGIX 1SGIB 4GVUA 1O3KA 3QDZB 3WY8A 4B75A 1H4WA 1ZRBA 2QYIA 3SBKA 2G00A 4ABGA 2AS9A 1E34B 3CP7A 1QCPA 1GVKB 1WU1A 2CGAA 3B9FH 4K8BA 1AVWA 1HAXB 2FMJA 4GLYA 2ZC9H 4YESB 1TPSA 2SNVA 1BTXA 5L2YH 1BUIA 2A4QA 3E16B 1N6YA 2OP9A 1QB1A 2ZFSA 2VIQA 4AFZA 4YO9A 4Y79A 2GCTC 1OPHB 4MDSA 3A7YA 3EA9A 3RXRA 4CRBA 1X7AC 2ZDLA 6CHAC 1LQEA 1YPJH 3BTFE 2G4TA 1L1NA 1O3MA 3LOXA 2F9VA 1G36A 3PLPA 3ZVBA 1K9OE 1BQYA 1AB9C 7KMEH 1RRKA 3UUZA 5A09A 3E1XB 3SORA 1AIXH 1NFWA 1W11U 6GCHF 3MU8A 1WOFA 4PROA 4GUXA 4OS4A 4BAKB 2QAAA 1O5DH 4Z0KA 4MNYA 1ETSH 1GVLA 2OUAA 3FP6E 1RIWB 1H8IH 1ZZZA 1EATA 1HXEH 4A1TA 3LONA 5EQQA 3RXGA 2SFAA 3C27B 3M5MA 2F9OA 1O2PA 5PTPA 2BXUH 1HUTH 2FESH 1P2IA 2ZQ1A 1SI5H 2XWBI 4YM9A 1W14U 2BD4A 1A7SA 1H8DH 1Y3XA 2J94A 3RXUA 4Y11E 1UTOA 4X2YA 3SU2A 4X1NU 3BTTE 1KLTA 1P02A 1OP8A 1QRWA 2DUCA 2P3FH 1A0JA 1ZRKA 1TPAE 1DANH 1CHOF 1NESE 3PMJA 2ZPRA 1RD3B 1V2JT 1O2RA 2WPLS 1KTSB 3BTQE 1F0TA 1CSOE 4NWKA 8ESTE 3VFEA 2ZU4A 1RTKA 1KDQB 1WV7H 4XFQA 5AF9H 1ELFA 1QL8A 1UTQA 3L3TA 3ZVAA 4U32A 4U01A 1GJCB 3SNAA 4NWLA 1YPLH 3TITA 1O2GH 2Y82A 2J34A 2BLQA 1C4U2 1DWEH 5ETXA 1YF4A 4NCYA 5ESTE 3IWMA 4MPWA 2C3SA 1VZQH 1SGFG 4NZQA 3KHVA 4AN7A 2UUFB 2VVCA 4NA7A 1ZYOA 1NT1A 4RN6A 2A7CA 1C5PA 1CGHA 3D65E 4IW4E 2THFB 1LQDB 4TWYA 1J8AA 1O37A 5JB9S 2ANYA 7GCHG 4ZROA 1QBOA 2AYWA 4J2YB 2PLXA 5DPAA 3ZZ8A 3RXDA 1BA8B 3A83A 4HGCA 1FY8E 2Y80A 1C2GA 1WSSH 2BD5A 3EA8A 3PLBA 2VVVA 4K5ZA 3PM3A 1O5CB 2ZGBH 1C1OA 1GGDB 1OSSA 2P8OC 3ZV9A 1QTFA 4KKDA 3GCNA 1E37B 5DP9A 2W3KA 1CQQA 1QRZA 1GHYH 2R9PA 2Y7ZA 2NU0E 1UVSH 1BTZA 5CHAC 1HAHH 1W0ZU 1GCTB 1LHGH 1XX9A 2BDCA 5C1XA 3RUOA 3GYMA 2H6MA 2G81E 2BD8A 5DKMA 1W0YH 1HAOH 1ZHPA 2BM2A 1VCWA 2OTVA 3SU6A 4E05H 1E36B 3U1IB 2BD2A 1PQ8A 4JYVH 3NK8A 2C8YB 2GMTB 3M61U 1SGPE 1ZGIA 3UOUA 3EYDA 3MH7A 2ILNA 4IN1A 2PKAB 1G3BA 4WMEA 2WUCA 1TX7A 2R0KA 5LPRA 1GHAF 4BNRA 3ZVCA 3SHAH 1LDTT 2G5VA 4ISOA 2JH6D 1Z8JB 2XXLA 3ZZ9A 1LTOA 3K2UA 1UTMA 2SGEE 3BF6H 1P0SH 1T8MA 3RLWH 3P70B 3L33A 1ZPCA 1ELEE 1YPEH 5FBEA 4FU7A 5DP7A 3S69A 1Z1JA 1BOQA 1DPOA 1GG6B 5HM9A 2FP7B 1FY3A 4K8YA 2VWMA 5K7RA 2BY8X 4ESTE 4ISHH 1TRMA 1DOJA 3MU0A 3STJA 1BTYA 2WYGA 4DT7B 3BIVH 2BDIA 1C5RA 3ZV8A 2M5TA 5JB8S 3E8LA 1MBQA 4O3UA 2HVXA 2IN2A 1T4VH 1FY5A 1GHVH 1P06A 1Z1IA 2BVSH 1DM4B 1YGCH 4K3JA 1THPB 4RSPA 3GY2A 2P8OB 3M5OA 4D7FA 1GGDC 1O34A 1XKAC 4XE4A 1QQ4A 1JBUH 1SHYA 1T31A 1KXBA 4BXWA 1O2MA 3SUEA 1WTGH 1C1UH 4KP0A 3TJVA 1F5RA 2VH6A 4YLQH 2IOTA 2B8OH 2ZHQH 1PPEE 1L4DA 2XWAA 2PTCE 2Z6BD 3RP2A 2Z9GA 2R3YA 1KIGH 2RDLA 1ABIH 4I8LA 2QXIA 4ZAEA 4O3TA 1NZQH 2WPJS 3SUGA 2ZPQA 1SFIA 3U8TH 1K1MA 2FX6A 3KQDA 4IN2A 2EEKA 2SGQE 3HGPA 1XUIA 3P95A 5F8XA 1O5GH 1WQSA 1QBVH 3VB6A 3UPEA 2AEIH 2ZGCA 2Z94A 1UCYH 3DUXH 2PUXB 3F6UH 4HI3A 1QJ6B 2XCNA 1IAUA 5T6DA 3RXBA 1SLWB 4O9VA 2OC8A 2VIWA 1UK4A 1TMTH 3ESTA 1TWXB 2VB0A 2WPKS 2Y81A 1BRCE 2LNCA 1O31A 2PGBB 1PYTD 1O38A 1GBMA 2J92A 4FU9A 1FPHH 3ZVFA 5IYTA 1K22H 1Z8GA 3T29A 2AGEX 4O03A 1ABJH 1TABE 1HB0B 2P59A 5C2ZA 5GDSH 1CHOG 3A7XA 1YM0A 2A7JA 1MKXH 1PQ5A 5J4QA 1G37A 1D4PB 1JIMA 2ZTYA 1GI1A 3T27A 3NUMA 2JH0D 1BRUP 1OOKB 1SGYE 1AQ7A 2G52A 3M5LA 1ZMNA 1UK2A 3GISB 7GCHF 2I6QA 1VITG 1S6FA 3EAJA 4TPIZ 1MZAA 4KTCA 4WH8A 1C5YB 1TA6A 2KAIA 1A0HB 1ELTA 1L0ZA 4NSVA 3KGPA 1SGNE 4I31A 3SU5A 4UFGH 3F9HA 2ZGHA 1FZZA 2ZDAH 2WV5A 2PKSC 4I32A 1NFYA 3KIDU 1V2QT 3A87A 4R0IA 1UTKA 1T8OA 1DWCH 4OGYA 1TGCA 2IPHA 2GZ9A 4K69A 4XDEA 3RXHA 3E91A 1IQLA 3OSYA 5DP3A 4NFFA 4Q2KA 2UWPA 4Y7BA 1YLCA 3RXMA 2QIQA 4FUGA 1MU8B 1AUTC 1L2EA 4ISNA 3KQCA 4TY7A 1FN6A 1DWBH 3M35A 1YCPM 1Q2WA 2CXVA 5AVDA 4D8NA 4YT6H 1HIAA 3O8BA 4MLFB 1BT7A 3OYPA 1LPZB 1O3CA 3SV9A 2HLCA 4ABEA 1RIWC 1QIXB 2SGAA 2GKVE 1GBBA 2C4FH 3DA9B 5A2MH 1NU9A 1XMNB 4D9RA 3EDXB 3H7OA 4IC6A 3SJKA 4DIIH 1SL3A 2FI4E 1T8LA 5G4BA 2XBVA 1BMAA 4ZKRU 1YPHC 2TGAA 4FUIA 1C4V2 1V6DA 2ZTZA 2XBYA 4X0WU 4CHAB 3T5FH 1O33A 4JZEH 1GJ7B 1AB9B 1P2JA 1UK3A 1HIAB 1QY6A 1NU7B 4XSKU 3QGJA 4Q80A 2R2WU 2ZQ2A 1SGTA 1GMDG 3I77A 1DX5M 4WY3A 1GI9B 1NPMA 1D3PB 1FI8A 3RXSA 2EI6A 4FVDA 4BTUB 1HYLA 3RM2H 3P8OA 4AFSA 5HYOA 2CF8H 1ELBA 1XXDA 1NRNH 1MTWA 4A1VA 1RXPA 3RXAA 1GBFA 1PFXC 2OC1A 1K1OA 1GMHF 4B71A 2W7SA 3ATLA 5ABWA 3M7QA 2JETC 1P2QA 1SFQB 2Z9IA 4KTUA 1A3EH 2H9EH 1GJ9B 1AUJA 1SQAA 2ZTXA 1GMHG 3S9CA 2VIDA 5AHGH 1E0FD 1CT2E 1YKTA 3RXCA 2ZDVH 1BRBE 1OX1A 2CHAC 4O97A 3PB1E 3HKIB 1CGIE 1Y3YA 2B7DH 1V2VT 1ZJDA 8KME2 1O2IA 3SU1A 3ZZBA 2JKHA 3VB3A 2BOKA 2ZGXH 3A82A 1EJAA 4AFQA 2FPZA 3BSQA 4F49A 4CH2B 1C1PA 1G3DA 1GBHA 3MI4A 4OS1A 4XBBA 4ZHLU 1P05A 2BQWB 4FUDA 1O2NA 1TX6A 1K1LA 1M9UA 3ZYDA 1GJ8B 2BDYA 2ZU3A 1AZZA 1EP5A 1K1PA 4TWWA 4ZKSU 1SMFE 5FBIA 3A86A 2XC0A 4R8TB 1ELVA 2WPHS 3K6YA 1GL0E 3SI4H 3RMMH 4H4FA 2F83A 5L30H 3PV4A 3ODDA 2GDDA 1ZHMA 4LZ1H 1IQMA 5FX5A 3TVJB 4NZLA 4YZUA 2BY7X 1BMMH 3W94A 1GHBG 3BTWE 3SGQE 2IJOB 1SGFA 4X1RU 1C9TA 3VGCC 3GDVA 3GYLB 1YCPH 4NGAH 4A92A 1GI0A 3ATKA 3TGKE 2P93A 7ESTE 3MMGA 3ZZ5A 1LVYA 1P57B 1UCYE 4RKOB 1O2SA 1CVWH 1PPZA 3GY6A 2OQ5A 2ZI2H 4Q7XA 1YCPK 1GJ5H 3VB5A 3SJ8A 5A8XA 2VWLA 2H5DA 1YC0A 2EA3A 3G01A 3TGIE 4YLUA 2FDAA 3JZ2B 1DY8A 3RXFA 2ZDKA 2FTLE 1IQIA 5AFYH 3E6PH 5EGMA 3M7UA 1OYTH 1TGNA 3MO6A 1EOLA 3UWJH 1TE0A 5GCHG 1GJDB 1EB1H 2XBXA 1FNIA 5DP6A 1TNJA 1EAWA 5EW1H 1O2XA 2DE8A 3V7TA 3A8BA 3GCHB 3NPSA 3MNSA 1J9CH 2AMDA 1LHEH 1UHBA 3VB7A 2FODA 1KLJH 4NA8A 3PWCA 3O8DA 1P12E 3UWIA 1K1JA 3LGYA 4IC5A 4HZHA 1VCQA 1GI2A 2BX3A 3LJJA 3PWBA 1DITH 1TGBA 4I8KA 6GCHG 3OY5U 1VGCC 2ALPA 5E0JA 5JBCS 3IITA 2ZHWH 4B76A 1TX8A 5JBAS 3F9EA 1FPCH 1P09A 3O8RA 1P2OA 5F6MA 1GI5A 1MKWK 2C8ZB 1AFEH 1RTLA 2EI8A 1YLDA 2VGCC 2SNWA 4FUHA 1P9UA 4B74A 1HJAC 1C5OH 1C2IA 1HNEE 1N1LA 1MCTA 1OP0A 5L2ZH 2G55A 4Y7AA 1S82A 6ESTA 1V2OT 2YNBA 2UUJB 3DFLA 3AW1A 3MH4A 1U6QA 1CT0E 1UMAH 3KN2A 4JK5A 1C5QA 1RFNA 3SNCA 2QXHA 1PPBH 2BZ6H 2XC4A 3MNBA 2FOCA 3L6PA 2VIPA 1VCPA 2O8UA 2O8LA 3E3TA 2UWLA 1F2SE 3BTME 2GZ7A 4ZHMU 3SI3H 1KLIH 5C3NA 1MD7A 4CRGA 4BANB 2CHAB 4AX9H 1IQJA 1G32B 1O2JA 2I6SA 3MYWA 1O2VA 2ZU5A 1HJ8A 1W7XH 1G3CA 2WUBA 4AOQA 1SVPA 5GJ4B 4ZXXH 1AFQB 4Y8YA 3FP7E 2JETB 4FUEA 1HXFH 2O8TA 3SW2B 3AAVA 4E7NA 3GY7A 1AZ8A 2P16A 2ZEBA 5HM2A 1F92A 1AKSA 2PHBA 1C2FA 2CJIA 1AE8H 3F9FA 3ZZ6A 3TNTA 2VINA 1GBCA 1MCVA 2PSYA 3A85A 4CRCA 1GDQA 2XBWA 4A1XA 3FAOA 1UO6A 3GOVB 1TQ0B 3MO9A 1A5HA 3RXVA 3STIA 4JYTA 3M37A 2BQ6B 1C5VA 4INKA 1TNLA 3ENSB 2ZA5A 4Y0ZE 2W5EA 3QTOH 1V2PT 3LGIA 1L4ZA 4LK4A 1S83A 1GI4A 1OYQA 1CGJE 5SGAE 2ZO3H 4NIVA 3M7TA 2ZDMA 3LDXH 3QO6A 1XVOA 3RXOA 1AN1E 4GHQA 1JRSA 5J4SA 1CHGA 1PQAA 1TONA 2OINA 1P04A 1A2CH 4UFDH 1SGCA 4YTAA 1T32A 2J95A 3M3SA 4X6NA 1L1GA 4JZDH 1GCDA 5LH8A 2F9BH 1J15A 3MO3A 3LPRA 4E06H 1JXPA 2A31A 2TGTA 2Z7FE 1GJ4H 3VXEH 1OS8A 4NIXA 3TK9A 2D8WA 1O2HA 2VWNA 3ZVEA 3RXIA 1P10A 1EXFA 4IGDA 4MPVA 3BTKE 1LPGB 3I29A 1UVOA 4ABIA 4JZ1A 3SJIA 3P8GA 5EQSA 2ZU2A 3OY6U 1QHRB 1GBDA 2SGFE 4I7YH 2ZFFH 1O2WA 1TQ7B 3TNSA 1C2KA 5DGJA 3A81A 4H42U 3MTYA 5LPFA 2ZG0H 1AD8H 3JZ1B 3MU4A 1AO5A 2G51A 1XM1A 2PKSB 3LJOA 1HAIH 1O36A 4CR5A 3GCTG 3M5NA 1EPTC 2OLGA 2SGDE 3RMOH 3Q3KA 4DW2U 2ZP0H 1S5SA 4FUCA 1BTWA 2PUQH 1BMNH 1RS0A 1TIOA 3NCLA 2CN0H 1LMWB 1TYNA 2ZCHP 1PYTC 3FVFB 4X8SH 3V3MA 1YPMH 2QC2A 2NU2E 2FOAA 3ITIA 1NO9H 3F68H 4Q7YA 5EW2H 2BDHA 3KEEA 4ABJA 3QUMP 3M3TA 5FX6A 2OC7A 2ZHEH 3HKJB 3ZVDA 5DP4A 2BTCE 1FIWA 4YOIA 2Y5GA 3BG8A 1EASA 5GWZA 1WAYB 3R0FA 1AE5A 1AFQC 4CRFA 2BVRH 4D9QA 3VXFH 2VIVA 1QJ1B 1O39A 2FOHA 3BG4B 5EXLA 3BEUA 1ETRH 1TAWA 1UTJA 1TPPA 5EQRA 3RDZA 2TGPZ 1INCA 3U98H 4AFUA 4DURA 1O2TA 3ZZ3A 4A5TS 3LC5A 1SGDE 4AB9A 5EPYA 3ELAH 1C1WH 3A7WA 4NSYA 2FOGA 3UR6A 8LPRA 4XBCA 5FCKA 1LHCH 2PFEA 1F0RA 2PV9B 1QRXA 5CE1A 3MHWU 3FFGA 1K28D 1D3TB 1TNGA 1ELGA 2AH4X 3M36A 3ZZ4A 1UVPA 1HLTH 2FOFA 1B0FA 4INLA 4B2CA 4K1EA 3W95A 1HJAB 1EKBB 2O8WA 4I8HA 3RXPA 4AGKA 1DVAH 2F9UA 1NM6A 4Y8ZA 3RXQA 2XCFA 2GGVB 2RA3A 3MNCA 2F3CE 5E2PA 3V0XA 3GY3A 3ZZ7A 3PMAB 1OWDA 2HGTH 1IQHA 2A4GA 4ZKOU 4DGJA 1FQ3A 4LOYH 1BZXE 1FDPA 1LHDH 1KXEA 4ABAA 3RC6A 1ZMLA 3MWIU 2XC5A 4ZKNU 1O3DA 1UJ1A 3CENA 1JRTA 2CMYA 2XW9A 4X8UH 4DOQA 3A7ZA 1KYNA 5TCAA 2ASUB 2FTMA 3ZVGA 4GHTA 1YPGH 1CT4E 1LCYA 1MTUA 2UUYA 3F9GA 3VPKA 1KXDA 4H6TA 5GPIB 3T62A 4I8GA 1LVOA 2WV4A 5A0AE 3SGAE 4THNH 3A8CA 3HPTB 1J16A 3TH4H 3TIUA 3T26A 1CA0C 4YOJA 1FJSA 4Y6DA 2A4OA 2TGDA 3PO1C 1KTTB 3EQ0H 4B1TA 1G2LA 1FIZA 5L6NH 2V35A 2H1UA 2BMGB 4JMYA 4JZIA 1B5GH 2TPIZ 2YOLA 2ZNKH 1SQOA 4YT7H 1P2NA 1IQFA 3BEIB 4FUFA 1SC8U 4Y76A 1BTHH 5TJXA 1BBRH 3K6ZA 2WPIS 1A3BH 2VH0A 1UVUH 1XUFA 1TGTA 1GWAA 4AGJA 4ZMAH 1CU1A 1GG6C 2C8XB 3P6ZB 4UONA 2KAIB 1ZLRA 1GDNA 1ZSKA 2LPRA 1CA8B 3SQEE 1FAKH 4X6PA 1HAZB 3T28A 1AWFH 1CBWC 3LU9B 5EXMA 1ESTA 2TRMA 1JOUB 4VGCB 2BDBA 1GHBF 1J17T 1PPCE 4Y71A 1UTLM 2Y5HA 2PKAA 1V2ST 5T6GA 3LGUA 1SR5C 1W8BH 1EAIA 1O3BA 2O9QA 1C2MA 1OKXA 1ZGVA 4WH6A 3SU4A 5A0CA 2GMTC 2QF3A 1O32A 3LT3A 1TNHA 1O2UA 1O2ZA 3BV9B 1KXCA 5EPNA 1UTNA 2ODPA 4GPGA 1HAGE 2Z3EA 2Z9JA 3SU3A 1F5LA 8GCHF 2Y5FA 7LPRA 3KF2A 1HV7A 2G4UA 1AU8A 2ZCKP 3PYHA 4CRDA 3SV7A 4U30A 2Y6TA 2GD4B 1HGTH 2O8MA 4AORA 1LHFH 2RA0A 1P3CA 2ZCLP 1HJ9A 1P2MA 2UUKB 4UFFH 5JDUB 4J1YA 4ZXYH 2QF0A 1O3EA 1O3NA 2CV3A 1BTUA 4I33A 1TNIA 1P3EA 1D3DB 3IG6B 3DT0H 1G2MA 5T3HA 5DO4H 1MKXK 2V6NA 1A61H 1C1TA 3OX7U 3RXJA 4MG3A 4IS5A 5FCRA 1C9PA 1S0QA 2ZZUH 2J9NA 1NFXA 1ZTLA 4ISLA 5LPEA 4XOJA 1C5ZB 3UNRA 3LC3A 3GCOA 1OWKA 1ARBA 2V0BA 3NKKA 3TU7H 4UEHH 5C20A 2GZ8A 1DXWA 1N8OC 1TOCB 1QURH 1C2LA 1MQ6A 1PJPA 3URDA 3NXPA 1O5BB 1NROH 2BD9A 1FXYA 3S7KB 3GICB 2GVFA 2BDGA 3ZZDA 5A0BA 3R3GB 1CO7E 2NU3E 5DK1A 1O35A 3ATMA 1BMLA 1C1SA 3UQOA 1DSTA 1DUAA 1HRTH 1W12U 1WTHD 1OXGA 4X6OA 3C1KA 3S9BA 2HPQH 5A8YA 1HFDA 2B9LA 5K0HA 1O3GA 4BAOB 1ETTH 2J2UA 4NA9H 1WUNH 1DFPA 4ZH8A 4Y0YE 3U8RH 1ZOMA 3QWCH 4Q7ZA 4AG2A 3FZDA 4M7GA 4TYDA 1MTNB 3DD2H 4NG9H 1P11E 2FIRH 1FY1A 1WBGB 1D3QB 3RMNH 4DVAU 1Q3XA 2ZFQH 1O3AA 4X2WA 3A7TA 1TOMH 2EI7A 1QA7A 3UTUH 1DY9A 1O0DH 4ZHAA 1MH0A 2AIPA 1MD8A 1NN6A 2BVXH 1HDTH 3SU0A 2HNTE 1IOEA 1MTNC 5BPEA 1ORFA 1EJMA 4UE7H 1O3IA 1GBKA 4SGAE 1SG8B 2XYAA 1SLXB 1ZJKA 1LVBA 3VEQB 2VJ1A 2PW8H 1E38B 2Z3CA 1THSH 3SGBE 2QY0B 1NRSH 4K1SA 1W10U 1ZMJA 2ZFRH 2A2XH 2Z9KA 5ESBA 1O3FA 1VITF 2ANWA 4WJG2 4JZFH 3Q3YA 1O2OA 2FI5E 3PMHB 2GTBA 5E0GA 3TJNA 3SV6A 1HAVA 4NIWA 2HRVA 1BBRE 1QGFA 3QGNB 2ZGJA 1W2KH 1Y3VA 3RXTA 1IHTH 3I78A 1ID5H 2ZIQH 2BYAX 3PROA 4MPUA 3KQBA 1C5XB 4Y10E 1HAVB 1OWIA 1GJ6A 1XUKA 1N6XA 5JBTA 2AMQA 5E8EH 1HBTH 2BY9X 1YYY1 1WCZA 1IQEA 3BTDE 1GI7B 4X8VH 1ELDE 2BDAA 1O5EH 1ESAA 1TRYA 1MAYA 3KNXA 3Q3XA 1IQKA 1XUGA 3ZZAA 3TGJE 1C1QA 1T4UH 1W7GH 4FVBA 1SGEE 4ABDA 2BD3A 3QX5H 3EA7A 3CS7A 1W13U 3U69H 4K1TA 1GBIA 4RKJB 2ZPSA 5FAHA 2GDEH 2ZU1A 1KSNA 2Q6DA 1AY6H 1C1VH 4SGBE 1G3EA 4E7RG 1S81A 3BIUH 3NZIA 2G5NA 2FOEA 1EUFA 1GMDF 3TJUA 2AMPA 3QZRA 1EQ9A 2ULLA 1JWTA 1MUEB 4X2VA 2A45B 1KXAA 1C1MA 1IHSH 1QFKH 1A1RA 3TPIZ 2ZECA 2H5CA 1BB0B 5DP5A 3RXEA 2FLBH 1K21H 4X8TH 3U8OH 3N7OA 1Z71A 3T25A 3QTVH 1ACBE 5I46H 1N8OB 3K65B 2BD7A 2Z9LA 3D62A 3RC5A 1T8NA 1BCUH 3A80A 4KTSA 1EB2A 1JIRA 1F7ZA 1H9LB 1VJ9U 4IMQA 3LKWA 4GCHG 1F0SA 2WYJA 2W26A 1S85A 1NTPA 2B0FA 2ODQA 3LIWA 2Z3DA 1QL9A 4VGCC 3SJ9A 3VB4A 3V13A 3DHKH 1SLVB 3UIRA 1CBWB 4H6SB 5LGOA 1ZSJA 5A8ZA 1AKSB 1UHBB 1LPKB 1FN8A 2OD3B 3TH3H 1QB6A 2C93B 3SZNA 1DWDH 4INHA 2R3UA 2ANKH 1TBQH 1XKBC 3RC4A 3GY5A 2QXJA 3MOCA 2GCHG 1O5FH 3LH3A 5DJ7A 1GMCF 3PTNA 1H9HE 2J4IA 1TFXA 1BHXB 1ZTKA 3E90B 1EZXC 1AGJA 1B7XB 2R0LA 3E0PB 1F0UA 4NFEA 1D6RA 1PPFE 3PO1B 3QK1A 2QA9E 4OS7A 4CREA 1P8VC 2A5KA 1O3LA 2HPPH 2BLOA 1FLEE 1OP2A 1O3HA 4MNVA 1XXFA 1EX3A 5C67A 2ZWLH 2BLVA 2BB4A 3UNQA 1ZHRA 1C2EA 1MBMA 1DSUA 1TPOA 1EAUA 4MQAA 4NIYA 8GCHG 5JYIA 4Y8XA 1EP6A 2HOBA 1TMBH 2PWXA 2HNTF 2YNAA 2P3UB 2ZHDA 3H5CB 2GX4A 1ANBA 4YOGA 2HNTC 2OBOA 2ZFPH 4LZ4B 2B5TB 2P3TB 3SHCH 4AYYB 4CR9A 1WQVH 1C2HA 4FUJA 3B8JA 1QR3E 4Z6AH 1UVTH 3H7TA 2ZDNA 5H4IB 1VJAU 1AVGH 1EOJA 5BRRE 2H2ZA 5GXPA 1A4WH 4FUBA 9ESTA 1AMHA 1ARCA 1FONA 1V2UT 5DP8A 2FYQA 5JPMH 3URCA 2V3OH 1V2NT 4GAWA 1C5WB 1SHHB 5EXNA 1DLEA 2FM2A 4XBDA 1BHXF 1GCTC 4ABHA 5CHAB 3BTGE 1ESBA 1QA0A 2FS8A 5AFZH 1NS3A 3TH2H 9LPRA 1MZDA 1Z6EA 1PPHE 5FPYA 2BXTH 4OS5A 3P8FA 1MMJN 1NC6A 2A4RA 2VNTA 2C90B 3U1JB 1CA0B 1V3XA 1HPGA 4KELA 3MH6A 1Y5BT 2GT7A 3BTEE 4OS2A 4CRAA 4F4OC 3EGKH 4BTIB 2ZHFH 2P94A 1C5LH 3OTJE 1FV9A 1E35B 3MH5A 4IBLH 2AFQB 1DUEA 1NFUA 1GDUA 5FPTA 4BAHB 2W3IA 5C1UA 3SNEA 3V12A 2A7HA 1PQ7A 3GCTF 3PLKA 1WYKA 1BBRK 1C5NH 1P2KA 4X6MA 5GCHF 1HAYB 1B0EA 2VWOA 1THRH 2VVUA 1DE7H 1MKWH 4AB8A 4JCNA 2AERH 2H9TH 2K1QA 2RG3A 3BN9A 4UD9H 2PGQB 2STAE 1O2YA 1VITH 3SUFA 2NU1E 1A0LA 2A32A 1EPTB 1K1NA 1GHZA 3CS0A 5EU8A 2ESTE 4A7IB
chains in the Genus database with same CATH superfamily
2GV7A 2HALA 2FS9A 1O2QA 1ANDA 1YP9A 2EC9H 2HWLB 2ZF0H 1SQRA 5B6OA 1Q31A 3O8CA 3RLYH 1SPJA 1C5TA 2D2DA 2XTTB 1TB6H 3DFJA 1NRPH 2A1DB 2QGRA 1Z6JH 4MTBA 1YPKH 1SGQE 1C5MD 5CMXH 5DG6A 3UFAA 3UOPA 3BG4C 3E0NB 4BXSA 1EZSC 1GVZA 3TK5A 3M3VA 4TPYA 4X2XA 1XUHA 1FUJA 4K60A 5IK2D 1AWHB 3A89A 4MNWA 2QV1A 2VIOA 2PSXA 3QLPH 1G30B 1ANCA 3A8DA 2Y7XA 1O3JA 3D49H 5C5NA 1O2LA 2A5IA 1K2I1 5E2OA 1BTPA 3QN7A 4D76A 2Q6FA 2FX4A 3RU4D 3UR9A 1LKAA 4ASHA 1FAXA 2F9PA 1YBWA 3NWUA 4IMZA 1XUJA 3ZZCA 3UB0A 3LH1A 1SSXA 1OWJA 3QZQA 1RTFB 1GHWH 1DXPA 1GL1A 3UY9A 1BITA 1GBJA 4MNXA 1FMGA 2J5UA 1V2TT 1D6WA 3K9XB 1GBLA 3HGNA 2P95A 2ANMH 3ODFA 3FOAA 3SOSA 3LGVA 1S0RA 4X1QU 1ZTJA 4A6LA 3KQEA 2BQ7B 2AHME 2D1JA 2XRCA 2QCYA 1BDAA 3RM0H 1SB1H 1IQGA 1C2JA 1V2WT 2UWOA 3P8NA 4QT8C 4B73A 1H9IE 1SGRE 6CHAB 2GT8A 2BHGA 3N7DA 3S0NA 1EAXA 3AASA 1H1BA 2FO9A 2GCTB 2STBE 3A88A 1DS2E 2J38A 5HGGA 4WXVA 1F5KU 1GJBB 1P9SA 1AVXA 3FP8E 1SKYE 4WF8A 4JK6A 3SQHE 2OQUA 2R2MB 1TGSZ 1Y5UT 4GSOA 1ELAA 1GI3A 2ALVA 1AHTH 1OHHD 3TK6A 4BAQB 2CK3D 2V3HH 1LO6A 3F0OA 1ELCA 2FWWA 3S9AA 1RGQA 2Q1JA 1YPHE 1MTVA 1Y5AT 2FOMB 1NRRH 4UDWH 1C5UA 4WXIA 4DJZB 1DDJA 3AAUA 1XVMA 1L1JA 2A2QH 1W3CA 2FYRA 3RU4E 1E1RD 1GMCG 1C2DA 4OS6A 1P03A 2NU4E 3U9AH 4U2WA 1V2MT 4CH8B 4UFEH 4XD7D 4DIHH 1HAPH 3MU5A 1TRNA 1BIOA 3LGTA 4ABBA 2VGCB 3HK6B 2JH5D 1TLDA 1Y3WA 4KGAA 3HATH 4TY6A 1ZPBA 1C4Y2 1O3OA 1A46H 2G8TA 4Q63A 2SGPE 1MAXA 3TJOA 1VGCB 1Y8TA 1GHAG 3SJOA 1QBNA 1MU6B 2BLWA 1J14A 3B23B 1O2KA 1T7CA 2A5AA 1GBTA 1ANEA 3GY8A 3AVZA 1PPGE 2H9HA 4RI0A 3Q00A 1UCYK 5FPSA 1GHXH 2GP9B 1D9IA 2FZZA 2FLRH 1GJAB 2OXSA 2PTNA 3MFJA 3SNBA 3Q76A 1UTPA 1NRQH 3P17H 5HMAA 2BZAA 1C5SA 3MU1A 4AG1A 3A84A 1QJ7B 2Q6GA 2OCVB 1SBWA 3BEFB 5E0HA 1C1RA 2PP6A 1ZPZA 1KXFA 3RU4T 2L6OA 2DE9A 4X1SU 4DG4A 1GBAA 4FXGH 1BRAA 1V2RT 3P92A 3KCGH 1G9IE 2BOHB 1LKBA 5C1YA 5IDKA 1DICA 1Z7KA 3ZYEA 1Z8RA 3EE0B 1EJNA 3F1SB 3PMBB 1Z8IB 4OGXA 5EODA 3RMLH 1H8ED 4LXBH 3ATIA 2TBSA 3ATWA 3A8AA 3Q77A 4JYUH 1A5GH 1EZUC 5EOKA 3T2NA 3PTBA 4K2YA 5FHTA 5TCCA 1CE5A 2ODYB 5T6FA 2ZFTA 1IQNA 1QNJA 4ACAA 5EG4A 4ABFA 1AI8H 5F03A 1TA2A 1O3PB 1TBZH 3SUDA 3LGWA 1SOZA 5I25A 1Y3UA 5F8TA 1TBRH 1QB9A 3WWBA 2QN5T 3GCHC 1W0JD 3AW0A 1TALA 3MNXA 2F9NA 1TMUH 3BTHE 2IPQX 4WMFA 4D7GA 1QL7A 4X1PU 4BOHA 1V2LT 4I8JA 1MQ5A 4DY7B 1GI6A 1SQTA 3SV8A 2OBQA 4FU8A 2AGGX 4AYVB 4ZUHA 2RCEA 2BX4A 3FANA 3F2GA 4WMDA 1DLKB 5FXLA 4BTTB 1BJVA 1SOTA 3S7HB 1RJXB 4MVNA 4B2BA 3D23A 4B2AA 1EPTA 2OC0A 3GDSA 1VR1H 3ZIAD 4WWYA 3RXKA 3HK3B 2FXRA 1JMOH 3TLOA 2WINI 4ISIH 1DT2A 3GDUA 4DCDA 4HTCH 1KY9A 2D26C 6LPRA 2VU8E 2BY6X 3OU0A 5JBBS 3UQVA 2GV6A 2CF9H 1S6HA 2W7UA 3KL6A 3A7VA 2PR3A 3SN8A 1O5AB 1V2KT 4BAMB 1QQUA 2WPMS 1S84A 1ZSLA 2FI3E 2BY5X 1KDQA 2GCHF 4CBNA 1GPZA 1K1IA 1NY22 3SO3A 3VGCB 2C8WB 1P01A 1FY4A 5F8ZA 4WVPE 3GY4A 2VBCA 4CBOA 1BJUA 2FOBA 2TIOA 2ZKSA 3UREA 5GIBA 1LVMA 1C1NA 1ZR0A 1TNKA 3FZZA 4GCHF 2AIQA 2XNIA 1HCGA 1O30A 3SV2H 3UNSA 1GI8B 1EZQA 2F91A 1OWEA 3SNDA 1GBEA 2F4LA 1MTSA 4HFPB 1OWHA 2A0QB 5HXFA 5C5OA 3RXLA 4CHAC 2QXGA 1SLUB 4AZ2B 1Y59T 2NWNA 1A5IA 2FEQH 2KZ4A 4MPXA 2AGIX 1SGIB 4GVUA 1O3KA 3QDZB 3WY8A 4B75A 1H4WA 3NRLA 1ZRBA 2QYIA 3EE7A 5EJLA 3SBKA 2G00A 4ABGA 2AS9A 4DT4A 1E34B 3CP7A 1QCPA 1GVKB 1WU1A 2KCPA 2CGAA 3B9FH 4K8BA 1AVWA 1HAXB 3CNRA 2FMJA 2J98B 4GLYA 2ZC9H 4YESB 1TPSA 2SNVA 1BTXA 5L2YH 1BUIA 1UW7A 2A4QA 3E16B 1N6YA 2OP9A 1QB1A 2ZFSA 2VIQA 4AFZA 4YO9A 4Y79A 2GCTC 1OPHB 4MDSA 3A7YA 3EA9A 3RXRA 4CRBA 2WV9A 1X7AC 2ZDLA 6CHAC 1LQEA 1YPJH 3BTFE 2YMSC 2G4TA 1L1NA 1O3MA 3LOXA 2F9VA 1G36A 1KMHB 3PLPA 3ZVBA 1K9OE 1BQYA 1AB9C 7KMEH 1RRKA 3UUZA 5A09A 3E1XB 3SORA 1AIXH 1NFWA 1W11U 6GCHF 3MU8A 2IJD1 3W1EA 1WOFA 4PROA 2WPDD 4GUXA 4OS4A 4BAKB 2QAAA 1O5DH 4Z0KA 4MNYA 1ETSH 1GVLA 2OUAA 3FP6E 1RIWB 1H8IH 2KCYA 1ZZZA 2QF5A 1EATA 1HXEH 4A1TA 3LONA 5EQQA 3RXGA 2SFAA 3C27B 3M5MA 2F9OA 1O2PA 5PTPA 2BXUH 1HUTH 2FESH 1P2IA 2ZQ1A 1SI5H 2XWBI 4YM9A 1W14U 2BD4A 1A7SA 1H8DH 1Y3XA 2J94A 3RXUA 4Y11E 1UTOA 4X2YA 3SU2A 4X1NU 3BTTE 1KLTA 1P02A 1OP8A 1QRWA 2DUCA 2P3FH 1A0JA 1ZRKA 1TPAE 1DANH 1CHOF 1NESE 3PMJA 2ZPRA 1RD3B 1V2JT 1BMFD 1O2RA 2WPLS 1KTSB 3BTQE 1F0TA 1CSOE 4NWKA 8ESTE 3VFEA 2ZU4A 3PV2A 1RTKA 1KDQB 1WV7H 4XFQA 5AF9H 1ELFA 1QL8A 1UTQA 3L3TA 3ZVAA 4U32A 1COWD 4U01A 1GJCB 3DCLA 4NWLA 3SNAA 1YPLH 4I86A 3UAIC 3TITA 1O2GH 2Y82A 2J34A 2BLQA 1C4U2 1DWEH 5ETXA 1YF4A 4NCYA 5ESTE 3IWMA 4MPWA 2C3SA 1VZQH 1SGFG 4NZQA 3KHVA 4AN7A 2UUFB 2VVCA 4NA7A 1ZYOA 1NT1A 4RN6A 2A7CA 1C5PA 1CGHA 3D65E 4IW4E 2L74A 2THFB 1LQDB 4AC9A 4TWYA 1J8AA 1O37A 5KEDA 5JB9S 2ANYA 7GCHG 4ZROA 3OE7D 2JIZD 1QBOA 2AYWA 4J2YB 2PLXA 5DPAA 3ZZ8A 3RXDA 1BA8B 3A83A 4HGCA 1FY8E 2Y80A 1C2GA 1WSSH 2BD5A 3EA8A 3PLBA 2VVVA 4K5ZA 3PM3A 1O5CB 2ZGBH 1C1OA 1GGDB 1OSSA 2P8OC 4TT3D 3ZV9A 1QTFA 4KKDA 3GCNA 1E37B 5DP9A 2W3KA 1CQQA 1QRZA 1GHYH 2R9PA 2Y7ZA 2NU0E 1UVSH 1BTZA 5CHAC 1HAHH 1W0ZU 1GCTB 1LHGH 1XX9A 2BDCA 5C1XA 3PRBA 3RUOA 3GYMA 2H6MA 2G81E 2BD8A 5DKMA 5EIYA 1W0YH 1HAOH 1ZHPA 2BM2A 1VCWA 2OTVA 3SU6A 2LP6A 4E05H 3PRDA 1E36B 3U1IB 2BD2A 1PQ8A 4JYVH 3NK8A 2C8YB 2GMTB 3M61U 1SGPE 2M2AA 1ZGIA 3UOUA 3SYJA 3EYDA 3MH7A 2ILNA 3OEHD 4FETA 4IN1A 2RFKC 2PKAB 1H8HD 1G3BA 4WMEA 2WUCA 1TX7A 2R0KA 5LPRA 1GHAF 4BNRA 3ZVCA 3H09A 1E79D 1LDTT 3SHAH 2G5VA 4ISOA 2JH6D 1Z8JB 2XXLA 3ZZ9A 1LTOA 3K2UA 1UTMA 2SGEE 3BF6H 1P0SH 1T8MA 3RLWH 3P70B 3L33A 1ZPCA 1ELEE 1YPEH 5FBEA 4FU7A 5DP7A 3S69A 1Z1JA 1BOQA 1DPOA 1GG6B 2LELA 5HM9A 2FP7B 1FY3A 4K8YA 2VWMA 5K7RA 2BY8X 4ESTE 4ISHH 1TRMA 1DOJA 3MU0A 1W0KD 3STJA 1BTYA 2WYGA 4DT7B 3BIVH 2BDIA 1C5RA 3ZV8A 2M5TA 5JB8S 3E8LA 1MBQA 2EY4C 2HVXA 4O3UA 2IN2A 1T4VH 1FY5A 1GHVH 1P06A 1Z1IA 2BVSH 1DM4B 3DSOA 1YGCH 4K3JA 1THPB 4RSPA 3GY2A 2P8OB 3M5OA 4D7FA 1GGDC 1O34A 1XKAC 4XE4A 1QQ4A 1JBUH 1SHYA 1T31A 1KXBA 4BXWA 3SZEA 1O2MA 3SUEA 4OM9A 1WTGH 1C1UH 4KP0A 3TJVA 1F5RA 2VH6A 4YLQH 3KYFA 2IOTA 2B8OH 2ZHQH 4ZCNA 1PPEE 1L4DA 2XWAA 2PTCE 2Z6BD 3RP2A 2Z9GA 2R3YA 5C17A 1KIGH 2RDLA 1ABIH 4I8LA 2QXIA 4ZAEA 4O3TA 1NZQH 2WPJS 3SUGA 2ZPQA 1SFIA 3U8TH 1K1MA 5HIZA 2FX6A 3KQDA 4IN2A 2EEKA 2SGQE 3HGPA 2OK5A 1XUIA 3P95A 5F8XA 1O5GH 1WQSA 1QBVH 3VB6A 3UPEA 2AEIH 2ZGCA 2Z94A 1UCYH 3DUXH 2PUXB 4B6EA 3F6UH 4HI3A 1QJ6B 2XCNA 2GJGA 1IAUA 5T6DA 3RXBA 1SLWB 3VG8A 4O9VA 2OC8A 2VIWA 1UK4A 2JJ2D 1TMTH 3ESTA 1TWXB 2VB0A 2WPKS 2Y81A 1BRCE 2LNCA 1O31A 2PGBB 1PYTD 1O38A 1GBMA 2J92A 4FU9A 1FPHH 3ZVFA 5IYTA 1K22H 1Z8GA 3T29A 2AGEX 4O03A 1ABJH 1TABE 1HB0B 2P59A 5C2ZA 5GDSH 1CHOG 3A7XA 1YM0A 2A7JA 1MKXH 1PQ5A 5J4QA 1G37A 1D4PB 1JIMA 2ZTYA 1GI1A 3T27A 3NUMA 2JH0D 1BRUP 1OOKB 1SGYE 1AQ7A 2G52A 3M5LA 1ZMNA 1UK2A 3GISB 7GCHF 2I6QA 3U28C 1VITG 1S6FA 3EAJA 3N7EA 4TPIZ 1MZAA 4KTCA 4WH8A 1C5YB 1TA6A 2KAIA 1A0HB 1ELTA 1L0ZA 4NSVA 3KGPA 1SGNE 4I31A 3SU5A 4UFGH 3F9HA 2ZGHA 1FZZA 2ZDAH 2WV5A 2PKSC 4I32A 1NFYA 3KIDU 1V2QT 3A87A 4R0IA 1UTKA 1T8OA 1DWCH 4OGYA 1TGCA 2IPHA 2GZ9A 4K69A 4XDEA 3RXHA 2QE7D 3E91A 1IQLA 3OSYA 5DP3A 4NFFA 4Q2KA 2UWPA 4Y7BA 1YLCA 4M9FA 3RXMA 2QIQA 4FUGA 1MU8B 1AUTC 1L2EA 4ISNA 3KQCA 4TY7A 2F43B 1FN6A 1DWBH 3M35A 4FOUC 1YCPM 1Q2WA 5KECA 2CXVA 5AVDA 4D8NA 4YT6H 1HIAA 3O8BA 4MLFB 1BT7A 3OYPA 1LPZB 1O3CA 3SV9A 2HLCA 4ABEA 1RIWC 1QIXB 2SGAA 2GKVE 1GBBA 2C4FH 3DA9B 5A2MH 1NU9A 1XMNB 4D9RA 3EDXB 3H7OA 4IC6A 3SJKA 1VKYA 4DIIH 1SL3A 2FI4E 1T8LA 5G4BA 2XBVA 1BMAA 4ZKRU 1YPHC 2TGAA 4FUIA 1C4V2 1V6DA 2ZTZA 2XBYA 4X0WU 4CHAB 3T5FH 1O33A 4JZEH 1GJ7B 1AB9B 1P2JA 1UK3A 1HIAB 1QY6A 1NU7B 4XSKU 3QGJA 4Q80A 4P00A 2R2WU 2ZQ2A 1SGTA 1GMDG 3I77A 3F3BA 1DX5M 4WY3A 1GI9B 1NPMA 1D3PB 1FI8A 3RXSA 2EI6A 4FVDA 4BTUB 2QF4A 1HYLA 2KR7A 3P8OA 3RM2H 4AFSA 5HYOA 2CF8H 1ELBA 1XXDA 1NRNH 1MTWA 4A1VA 5F53A 1RXPA 3RXAA 3DSGA 1GBFA 1PFXC 2OC1A 1K1OA 2W6JD 1GMHF 4B71A 2W7SA 3ATLA 5ABWA 3M7QA 2JETC 1P2QA 1SFQB 3F0PA 2Z9IA 4KTUA 1A3EH 2H9EH 1GJ9B 1AUJA 1SQAA 2ZTXA 1GMHG 3S9CA 2VIDA 5AHGH 1E0FD 1CT2E 1YKTA 3RXCA 2ZDVH 1BRBE 1OX1A 2CHAC 4O97A 3PB1E 3HKIB 1CGIE 1Y3YA 2B7DH 1V2VT 1ZJDA 8KME2 1O2IA 3OFND 3SU1A 3ZZBA 2JKHA 3VB3A 2BOKA 2ZGXH 3A82A 1EJAA 4AFQA 2FPZA 3BSQA 4F49A 4CH2B 1C1PA 1G3DA 1GBHA 3MI4A 4OS1A 4XBBA 4ZHLU 1P05A 2BQWB 4FUDA 1O2NA 1TX6A 1K1LA 1M9UA 3ZYDA 1GJ8B 2BDYA 2ZU3A 1AZZA 1EP5A 1K1PA 4TWWA 4ZKSU 1SMFE 5FBIA 3A86A 2XC0A 4R8TB 1ELVA 2WPHS 3K6YA 1GL0E 3SI4H 3RMMH 4H4FA 2F83A 5L30H 3PV4A 3ODDA 2GDDA 1ZHMA 4LZ1H 1IQMA 5FX5A 3TVJB 4NZLA 4YZUA 2BY7X 1BMMH 3W94A 1GHBG 3BTWE 3SGQE 2IJOB 1SGFA 4X1RU 1C9TA 3VGCC 3GDVA 3GYLB 1YCPH 4NGAH 4A92A 1GI0A 3ATKA 3TGKE 2P93A 7ESTE 3MMGA 3ZZ5A 1LVYA 1P57B 1UCYE 4RKOB 1O2SA 1CVWH 1PPZA 3GY6A 2OQ5A 2ZI2H 4Q7XA 1YCPK 1GJ5H 3VB5A 3SJ8A 5A8XA 2VWLA 2H5DA 2KCOA 4TSFD 1YC0A 2EA3A 3G01A 3TGIE 2JJ1D 3DSPA 4YLUA 2FDAA 3JZ2B 1DY8A 3RXFA 2ZDKA 2FTLE 1IQIA 5AFYH 3E6PH 5EGMA 3M7UA 1OYTH 3OEED 1TGNA 3MO6A 1EOLA 3WWFA 3UWJH 1TE0A 5GCHG 1GJDB 1EB1H 2XBXA 1FNIA 5DP6A 1MABB 1TNJA 1EAWA 5EW1H 1O2XA 2DE8A 3V7TA 3A8BA 3GCHB 3NPSA 3KYGA 3MNSA 1J9CH 2AMDA 1LHEH 1UHBA 3VB7A 2FODA 1KLJH 1NBME 4NA8A 3PWCA 3O8DA 1P12E 3UWIA 1K1JA 2K0QA 3LGYA 4IC5A 4HZHA 2RDEA 1VCQA 1GI2A 2BX3A 3LJJA 3PWBA 1DITH 1TGBA 5C0UA 5CHBA 4I8KA 6GCHG 3OY5U 1VGCC 2ALPA 5E0JA 5C94A 5JBCS 1WXRA 3IITA 2ZHWH 4B76A 1TX8A 5JBAS 3F9EA 1FPCH 1P09A 3O8RA 1P2OA 2JDID 5F6MA 1GI5A 1MKWK 2C8ZB 1AFEH 1RTLA 2EI8A 1YLDA 2VGCC 2SNWA 2J97A 4FUHA 1P9UA 4B74A 1HJAC 1C5OH 1C2IA 1HNEE 1N1LA 1MCTA 1OP0A 5L2ZH 2G55A 4Y7AA 1S82A 6ESTA 1V2OT 2YNBA 2UUJB 3DFLA 3AW1A 3MH4A 1U6QA 1CT0E 1UMAH 3KN2A 4JK5A 1C5QA 1RFNA 3SNCA 2QXHA 1PPBH 2BZ6H 2XC4A 3MNBA 2FOCA 3L6PA 2VIPA 1VCPA 2O8UA 2O8LA 3E3TA 2UWLA 1F2SE 3BTME 2GZ7A 4ZHMU 3SI3H 1KLIH 5C3NA 1MD7A 4CRGA 4BANB 2CHAB 4AX9H 1IQJA 1G32B 1O2JA 2I6SA 3MYWA 1O2VA 2ZU5A 1HJ8A 1W7XH 1G3CA 2WUBA 4AOQA 1SVPA 5GJ4B 4ZXXH 1AFQB 4Y8YA 3FP7E 2JETB 4FUEA 1HXFH 2O8TA 3SW2B 3AAVA 4E7NA 3GY7A 1AZ8A 2P16A 2ZEBA 5HM2A 2K8IA 1F92A 1AKSA 2PHBA 1C2FA 2CJIA 1AE8H 2HVYB 3F9FA 3ZZ6A 5C0TA 3TNTA 2VINA 1GBCA 1MCVA 2PSYA 3A85A 4CRCA 1GDQA 2XBWA 4A1XA 3FAOA 1UO6A 3GOVB 1TQ0B 3MO9A 1A5HA 3RXVA 3STIA 4JYTA 3M37A 2BQ6B 1C5VA 4INKA 1TNLA 3ENSB 2ZA5A 4Y0ZE 2W5EA 3QTOH 1V2PT 3LGIA 1L4ZA 4LK4A 1S83A 1GI4A 1OYQA 1CGJE 5SGAE 2ZO3H 4NIVA 3M7TA 2ZDMA 3LDXH 5EJ1A 3QO6A 1XVOA 3RXOA 1AN1E 4GHQA 1JRSA 5J4SA 1CHGA 1PQAA 1TONA 2OINA 1P04A 1A2CH 4UFDH 1SGCA 4YTAA 1T32A 2J95A 3M3SA 4X6NA 1L1GA 4JZDH 1GCDA 5LH8A 2F9BH 1J15A 3MO3A 3LPRA 4E06H 1JXPA 2A31A 2TGTA 2Z7FE 1GJ4H 3VXEH 2KCAA 1OS8A 4NIXA 3TK9A 2D8WA 1O2HA 2VWNA 4ACBA 3ZVEA 3RXIA 1P10A 1EXFA 4IGDA 4MPVA 3BTKE 1LPGB 3I29A 4XRNA 1UVOA 4ABIA 4JZ1A 3SJIA 3P8GA 5EQSA 2ZU2A 3OY6U 1QHRB 5T1VA 1GBDA 2SGFE 4I7YH 2ZFFH 1O2WA 1TQ7B 3TNSA 1C2KA 5DGJA 3A81A 4H42U 3MTYA 5LPFA 2ZG0H 1AD8H 3JZ1B 3MU4A 1AO5A 2G51A 1XM1A 2PKSB 5B6LA 3FO8D 1HAIH 3LJOA 1O36A 4CR5A 3GCTG 3M5NA 1EPTC 2OLGA 2SGDE 3RMOH 3Q3KA 1QZ8A 4DW2U 2ZP0H 1S5SA 4FUCA 1BTWA 2PUQH 1BMNH 1RS0A 1TIOA 3NCLA 2CN0H 1LMWB 1TYNA 2ZCHP 1PYTC 3FVFB 4X8SH 3V3MA 1YPMH 2QC2A 2NU2E 2FOAA 3ITIA 1NO9H 3F68H 4Q7YA 5EW2H 2BDHA 3KEEA 4ABJA 3QUMP 3M3TA 5FX6A 2OC7A 2ZHEH 3HKJB 3ZVDA 5DP4A 2BTCE 1FIWA 4YOIA 2Y5GA 3BG8A 1EASA 5GWZA 1WAYB 3R0FA 1AE5A 1AFQC 4CRFA 2BVRH 4D9QA 3VXFH 2VIVA 2J98A 1QJ1B 1O39A 2FOHA 3BG4B 5EXLA 3BEUA 1ETRH 1TAWA 1UTJA 1TPPA 5EQRA 3RDZA 2TGPZ 1INCA 3U98H 4AFUA 4DURA 1O2TA 3ZZ3A 4A5TS 3LC5A 1SGDE 4AB9A 5EPYA 3ELAH 1C1WH 3A7WA 4NSYA 2FOGA 3UR6A 4YXWD 4XBCA 8LPRA 5FCKA 1LHCH 2PFEA 1F0RA 2PV9B 5DN6D 1QRXA 5CE1A 3MHWU 3FFGA 1K28D 1D3TB 1TNGA 1ELGA 2AH4X 3M36A 3ZZ4A 1UVPA 1HLTH 2FOFA 1B0FA 4INLA 4B2CA 4K1EA 3W95A 1HJAB 3KQ5A 1EKBB 2O8WA 4I8HA 3RXPA 4AGKA 1DVAH 2F9UA 1NM6A 4Y8ZA 3RXQA 2XCFA 2GGVB 2RA3A 2XOKD 2F3CE 3MNCA 5E2PA 3V0XA 3GY3A 3ZZ7A 3PMAB 1OWDA 2HGTH 1IQHA 2A4GA 4ZKOU 4DGJA 1FQ3A 4LOYH 1BZXE 1FDPA 1LHDH 1KXEA 4ABAA 3RC6A 1K0HA 1ZMLA 3MWIU 2XC5A 4ZKNU 1O3DA 1UJ1A 3OAAD 3CENA 1JRTA 2CMYA 2XW9A 4X8UH 4DOQA 3A7ZA 1KYNA 5TCAA 2ASUB 2FTMA 3ZVGA 4GHTA 1YPGH 1CT4E 1LCYA 1MTUA 2UUYA 3F9GA 3VPKA 1KXDA 4H6TA 5GPIB 3T62A 4I8GA 1LVOA 2WV4A 3PV5A 5A0AE 3SGAE 4THNH 3A8CA 3HPTB 1J16A 3TH4H 3TIUA 1E1QD 3T26A 1CA0C 5DSFA 4YOJA 1FJSA 4Y6DA 2A4OA 2TGDA 3PO1C 1KTTB 3EQ0H 4B1TA 1G2LA 1FIZA 5L6NH 2V35A 2H1UA 2BMGB 4JMYA 4JZIA 1B5GH 2TPIZ 2YOLA 2ZNKH 1SQOA 4YT7H 1P2NA 1IQFA 3BEIB 2WZQA 4FUFA 1SC8U 4Y76A 1BTHH 5TJXA 1BBRH 3MQKC 3K6ZA 2WPIS 1A3BH 2VH0A 1UVUH 1XUFA 1TGTA 1GWAA 4AGJA 4ZMAH 1CU1A 1GG6C 2C8XB 3P6ZB 4UONA 2KAIB 1ZLRA 1GDNA 1ZSKA 2LPRA 1CA8B 3SQEE 1FAKH 5CDFE 4X6PA 1HAZB 3T28A 2XNDD 1AWFH 1CBWC 3LU9B 5EXMA 1ESTA 2TRMA 1JOUB 5FL7D 4VGCB 2BDBA 1GHBF 1J17T 1PPCE 4Y71A 1UTLM 2Y5HA 2PKAA 1V2ST 5T6GA 3LGUA 1SR5C 1W8BH 1EAIA 1O3BA 2O9QA 1C2MA 1OKXA 1ZGVA 4WH6A 3SU4A 5A0CA 2GMTC 2QF3A 1O32A 3LT3A 1TNHA 1O2UA 1O2ZA 3BV9B 1KXCA 5EPNA 1UTNA 2ODPA 4GPGA 1HAGE 2Z3EA 2Z9JA 3SU3A 1F5LA 8GCHF 2Y5FA 7LPRA 3KF2A 3WW7A 1HV7A 2G4UA 1AU8A 2ZCKP 3PYHA 4CRDA 3SV7A 4U30A 2Y6TA 2GD4B 2WSSD 1HGTH 2O8MA 4AORA 1LHFH 2RA0A 1P3CA 2ZCLP 1HJ9A 1P2MA 2UUKB 4UFFH 5JDUB 4J1YA 4ZXYH 1NBMD 2QF0A 1O3EA 1O3NA 2V3MA 2CV3A 1BTUA 4I33A 1TNIA 1P3EA 1D3DB 3IG6B 3DT0H 1G2MA 5T3HA 5DO4H 1MKXK 2V6NA 1A61H 1C1TA 3OX7U 3RXJA 4MG3A 4IS5A 5FCRA 1C9PA 1S0QA 2ZZUH 2J9NA 1NFXA 1ZTLA 4ISLA 5LPEA 4XOJA 1C5ZB 3UNRA 3LC3A 3GCOA 1OWKA 1ARBA 2V0BA 3NKKA 3TU7H 4UEHH 5C20A 2GZ8A 1DXWA 1N8OC 1TOCB 1WDIA 1QURH 1C2LA 1MQ6A 1YY3A 1PJPA 3URDA 3NXPA 1O5BB 1NROH 2BD9A 1FXYA 3S7KB 3GICB 2GVFA 2BDGA 3ZZDA 5A0BA 3R3GB 1CO7E 2NU3E 5DK1A 1O35A 3ATMA 1BMLA 1C1SA 3UQOA 1DSTA 1DUAA 1HRTH 1W12U 5KGOA 2KM0A 1WTHD 4F55A 1OXGA 4X6OA 3C1KA 3S9BA 2HPQH 5A8YA 1HFDA 2B9LA 5K0HA 1O3GA 4BAOB 1ETTH 2J2UA 4NA9H 1WUNH 1DFPA 4ZH8A 4Y0YE 3U8RH 1ZOMA 3QWCH 4Q7ZA 4AG2A 3FZDA 4M7GA 4TYDA 1MTNB 3DD2H 4NG9H 1P11E 2FIRH 1FY1A 1WBGB 1D3QB 3RMNH 4DVAU 1Q3XA 2ZFQH 1O3AA 4X2WA 2KFWA 3A7TA 1TOMH 2EI7A 1QA7A 3UTUH 1DY9A 1O0DH 4ZHAA 1MH0A 2AIPA 1MD8A 1YLNA 1NN6A 2BVXH 1HDTH 3SU0A 2HNTE 1IOEA 1MTNC 3N99A 5BPEA 1ORFA 2WHXA 1EJMA 4UE7H 1O3IA 1GBKA 4SGAE 1SG8B 2XYAA 1SLXB 1ZJKA 1LVBA 3VEQB 2VJ1A 2PW8H 1E38B 2Z3CA 1THSH 3SGBE 2QY0B 1NRSH 4K1SA 1W10U 1ZMJA 2ZFRH 2A2XH 2Z9KA 5ESBA 1O3FA 1VITF 2ANWA 4WJG2 4JZFH 3Q3YA 1O2OA 2V7QD 3AK5A 2FI5E 3PMHB 4P02A 2GTBA 5E0GA 3TJNA 3SV6A 1HAVA 4NIWA 2HRVA 1BBRE 1QGFA 3QGNB 2ZGJA 1W2KH 1Y3VA 3RXTA 1IHTH 3I78A 1ID5H 2ZIQH 2BYAX 3PROA 4MPUA 3KQBA 1C5XB 4Y10E 1HAVB 1OWIA 1GJ6A 1XUKA 1N6XA 5JBTA 1YWUA 2AMQA 5E8EH 2YMSB 1HBTH 2BY9X 4F48B 1YYY1 1WCZA 4Q4LA 1IQEA 3BTDE 1GI7B 4X8VH 1ELDE 2BDAA 1O5EH 1ESAA 1TRYA 1MAYA 3KNXA 3Q3XA 1IQKA 1XUGA 3ZZAA 3TGJE 1C1QA 1T4UH 4HG6A 1W7GH 4FVBA 1SGEE 4ABDA 2BD3A 3QX5H 3EA7A 3CS7A 1W13U 2EQNA 4K1TA 3U69H 1GBIA 4RKJB 2ZPSA 5FAHA 2GDEH 2ZU1A 1KSNA 2Q6DA 1AY6H 1C1VH 4SGBE 1G3EA 2KX4A 4E7RG 1S81A 3BIUH 3NZIA 2G5NA 2FOEA 1EUFA 1GMDF 3TJUA 2AMPA 3QZRA 1EQ9A 2ULLA 1JWTA 1MUEB 4X2VA 2A45B 1KXAA 1C1MA 1IHSH 1QFKH 1A1RA 3TPIZ 2ZECA 2H5CA 1BB0B 5DP5A 3RXEA 2FLBH 1K21H 4X8TH 3U8OH 3N7OA 1Z71A 3T25A 3QTVH 1ACBE 5I46H 1N8OB 3K65B 2BD7A 2Z9LA 3D62A 3RC5A 1T8NA 1BCUH 3A80A 4KTSA 1EB2A 1JIRA 1F7ZA 1H9LB 1VJ9U 4IMQA 3LKWA 4GCHG 1F0SA 2WYJA 2W26A 1S85A 1NTPA 2B0FA 2ODQA 3LIWA 2Z3DA 1QL9A 4VGCC 3SJ9A 3VB4A 3V13A 3DHKH 1SLVB 3UIRA 1CBWB 4H6SB 5LGOA 1ZSJA 5A8ZA 1AKSB 1UHBB 1LPKB 1FN8A 2OD3B 3TH3H 1QB6A 2C93B 3SZNA 1DWDH 4INHA 2R3UA 2ANKH 1TBQH 1XKBC 3RC4A 3GY5A 2QXJA 3MOCA 2GCHG 1O5FH 3LH3A 5DJ7A 1GMCF 3PTNA 1H9HE 2J4IA 4RT0A 1TFXA 1BHXB 1ZTKA 3E90B 1EZXC 1AGJA 1B7XB 2R0LA 3E0PB 1F0UA 5EJZA 4NFEA 1D6RA 1PPFE 3PO1B 3QK1A 2QA9E 4OS7A 4CREA 4RT1A 1P8VC 2A5KA 1O3LA 2HPPH 2BLOA 4Z1MD 1FLEE 1OP2A 1O3HA 4MNVA 1XXFA 1EX3A 5C67A 2ZWLH 2BLVA 2BB4A 3UNQA 1ZHRA 1C2EA 3FKSD 1MBMA 1DSUA 1TPOA 1EAUA 4MQAA 4NIYA 8GCHG 5JYIA 1FX0B 4Y8XA 1EP6A 2HOBA 1TMBH 2PWXA 2HNTF 2YNAA 2P3UB 2ZHDA 3H5CB 2GX4A 1ANBA 4YOGA 2HNTC 1S6LA 2OBOA 2ZFPH 4LZ4B 2B5TB 2P3TB 3SHCH 4AYYB 4CR9A 1WQVH 1C2HA 4FUJA 3B8JA 1QR3E 4Z6AH 1UVTH 3H7TA 2ZDNA 5H4IB 1VJAU 1AVGH 1EOJA 5BRRE 2H2ZA 3OTPA 5GXPA 1A4WH 4FUBA 9ESTA 1AMHA 1ARCA 1FONA 1V2UT 5DP8A 2FYQA 5JPMH 3URCA 2V3OH 1V2NT 4GAWA 1C5WB 1SHHB 2YMSD 5EXNA 1DLEA 2FM2A 5HIYA 4XBDA 1BHXF 1GCTC 3GS9A 4ABHA 5CHAB 3BTGE 1ESBA 1QA0A 2FS8A 5AFZH 1NS3A 3TH2H 9LPRA 1MZDA 1Z6EA 1PPHE 5FPYA 2BXTH 4OS5A 3P8FA 1MMJN 1NC6A 2A4RA 2VNTA 2C90B 3U1JB 1CA0B 1V3XA 1HPGA 4KELA 3MH6A 1Y5BT 2GT7A 3BTEE 4OS2A 4CRAA 4F4OC 4ASUD 3EGKH 4BTIB 2ZHFH 2P94A 1C5LH 3OTJE 1FV9A 2W6ID 5HKKD 1E35B 5GNDA 3MH5A 3F2HA 4IBLH 2AFQB 2HLDD 1DUEA 1NFUA 1GDUA 5FPTA 4B6FA 4BAHB 2W3IA 5C1UA 3SNEA 3V12A 2A7HA 1PQ7A 3GCTF 3PLKA 1WYKA 3F2FA 1BBRK 1C5NH 1P2KA 4X6MA 5GCHF 1HAYB 1B0EA 2VWOA 1THRH 2VVUA 1DE7H 1EFRD 1MKWH 4AB8A 4JCNA 2AERH 2H9TH 2K1QA 2RG3A 3BN9A 4UD9H 2PGQB 3FN8A 2STAE 1O2YA 1VITH 3SUFA 2NU1E 1A0LA 2A32A 1EPTB 1K1NA 1GHZA 3CS0A 5EU8A 2ESTE 4A7IB
chains in the Genus database with same CATH topology
2GV7A 2HALA 2FS9A 1O2QA 1ANDA 1YP9A 2EC9H 2HWLB 2ZF0H 5B6OA 1Q31A 3O8CA 3RLYH 1SPJA 1C5TA 2D2DA 2XTTB 1TB6H 3DFJA 1NRPH 2A1DB 2QGRA 1Z6JH 4MTBA 1YPKH 1SGQE 1C5MD 5CMXH 5DG6A 3UFAA 3UOPA 3BG4C 3E0NB 4BXSA 1EZSC 1GVZA 3TK5A 3M3VA 4TPYA 4X2XA 1XUHA 1FUJA 4K60A 1AWHB 3A89A 4MNWA 2QV1A 2VIOA 2PSXA 3QLPH 1G30B 1ANCA 3A8DA 2Y7XA 1O3JA 3D49H 5C5NA 1O2LA 2A5IA 1K2I1 5E2OA 1BTPA 3QN7A 4D76A 2Q6FA 2FX4A 3RU4D 3UR9A 1LKAA 4ASHA 1FAXA 2F9PA 1YBWA 3NWUA 4IMZA 1XUJA 3ZZCA 3LH1A 1SSXA 1OWJA 3QZQA 1RTFB 1GHWH 1DXPA 1GL1A 3UY9A 1BITA 1GBJA 4MNXA 1FMGA 1V2TT 1D6WA 3K9XB 1GBLA 3HGNA 2P95A 2ANMH 3ODFA 3SOSA 3LGVA 1S0RA 4X1QU 1ZTJA 4A6LA 3KQEA 2BQ7B 2D1JA 2XRCA 2QCYA 1BDAA 3RM0H 1SB1H 1IQGA 1C2JA 1V2WT 2UWOA 3P8NA 4QT8C 4B73A 1H9IE 1SGRE 6CHAB 2GT8A 2BHGA 3S0NA 1EAXA 3AASA 1H1BA 2FO9A 2GCTB 2STBE 3A88A 1DS2E 2J38A 5HGGA 4WXVA 1F5KU 1GJBB 1P9SA 1AVXA 3FP8E 4WF8A 4JK6A 3SQHE 2OQUA 2R2MB 1TGSZ 1Y5UT 4GSOA 1ELAA 1GI3A 2ALVA 1AHTH 3TK6A 4BAQB 2V3HH 1LO6A 1ELCA 2FWWA 3S9AA 1RGQA 2Q1JA 1YPHE 1MTVA 1Y5AT 2FOMB 1NRRH 4UDWH 1C5UA 4WXIA 4DJZB 1DDJA 3AAUA 1XVMA 1L1JA 2A2QH 1W3CA 2FYRA 3RU4E 1GMCG 1C2DA 4OS6A 1P03A 2NU4E 3U9AH 4U2WA 1V2MT 4CH8B 4UFEH 4DIHH 1HAPH 3MU5A 1TRNA 1BIOA 3LGTA 4ABBA 2VGCB 3HK6B 2JH5D 1TLDA 1Y3WA 4KGAA 3HATH 4TY6A 1ZPBA 1C4Y2 1O3OA 1A46H 2G8TA 2SGPE 1MAXA 3TJOA 1VGCB 1Y8TA 1GHAG 3SJOA 1QBNA 1MU6B 2BLWA 1J14A 3B23B 1O2KA 1T7CA 2A5AA 1GBTA 1ANEA 3GY8A 3AVZA 1PPGE 2H9HA 3Q00A 1UCYK 5FPSA 1GHXH 2GP9B 1D9IA 2FZZA 2FLRH 1GJAB 2OXSA 2PTNA 3MFJA 3SNBA 3Q76A 1UTPA 1NRQH 3P17H 5HMAA 2BZAA 1C5SA 3MU1A 4AG1A 3A84A 1QJ7B 2Q6GA 2OCVB 1SBWA 3BEFB 5E0HA 1C1RA 1ZPZA 1KXFA 3RU4T 2DE9A 4X1SU 4DG4A 1GBAA 4FXGH 1BRAA 1V2RT 3P92A 3KCGH 1G9IE 2BOHB 1LKBA 5C1YA 5IDKA 1DICA 1Z7KA 3ZYEA 1Z8RA 3EE0B 1EJNA 3F1SB 3PMBB 1Z8IB 4OGXA 5EODA 3RMLH 4LXBH 3ATIA 2TBSA 3ATWA 3A8AA 3Q77A 4JYUH 1A5GH 1EZUC 5EOKA 3T2NA 3PTBA 4K2YA 5FHTA 5TCCA 1CE5A 2ODYB 5T6FA 2ZFTA 1IQNA 1QNJA 5EG4A 4ABFA 1AI8H 5F03A 1TA2A 1O3PB 1TBZH 3SUDA 3LGWA 1SOZA 5I25A 1Y3UA 5F8TA 1TBRH 1QB9A 2QN5T 3GCHC 3AW0A 1TALA 3MNXA 2F9NA 1TMUH 3BTHE 4WMFA 4D7GA 1QL7A 4X1PU 4BOHA 1V2LT 4I8JA 1MQ5A 4DY7B 1GI6A 1SQTA 3SV8A 2OBQA 4FU8A 2AGGX 4AYVB 4ZUHA 2RCEA 2BX4A 3FANA 4WMDA 1DLKB 5FXLA 4BTTB 1BJVA 1SOTA 3S7HB 1RJXB 4MVNA 4B2BA 3D23A 4B2AA 1EPTA 2OC0A 3GDSA 1VR1H 4WWYA 3RXKA 3HK3B 2FXRA 1JMOH 3TLOA 2WINI 4ISIH 1DT2A 3GDUA 4DCDA 4HTCH 1KY9A 2D26C 6LPRA 2VU8E 2BY6X 3OU0A 5JBBS 3UQVA 2GV6A 2CF9H 1S6HA 2W7UA 3KL6A 3A7VA 2PR3A 3SN8A 1O5AB 1V2KT 4BAMB 1QQUA 2WPMS 1S84A 1ZSLA 2FI3E 2BY5X 1KDQA 2GCHF 4CBNA 1GPZA 1K1IA 1NY22 3SO3A 3VGCB 2C8WB 1P01A 1FY4A 5F8ZA 4WVPE 3GY4A 4CBOA 1BJUA 2FOBA 2TIOA 2ZKSA 3UREA 5GIBA 1LVMA 1C1NA 1ZR0A 1TNKA 3FZZA 4GCHF 2AIQA 2XNIA 1HCGA 1O30A 3SV2H 3UNSA 1GI8B 1EZQA 2F91A 1OWEA 3SNDA 1GBEA 1MTSA 4HFPB 1OWHA 2A0QB 5HXFA 5C5OA 3RXLA 4CHAC 2QXGA 1SLUB 4AZ2B 1Y59T 2NWNA 1A5IA 2FEQH 4MPXA 2AGIX 1SGIB 4GVUA 1O3KA 3QDZB 3WY8A 4B75A 1H4WA 1ZRBA 2QYIA 3SBKA 2G00A 4ABGA 2AS9A 1E34B 3CP7A 1QCPA 1GVKB 1WU1A 2CGAA 3B9FH 4K8BA 1AVWA 1HAXB 2FMJA 4GLYA 2ZC9H 4YESB 1TPSA 2SNVA 1BTXA 5L2YH 1BUIA 2A4QA 3E16B 1N6YA 2OP9A 1QB1A 2ZFSA 2VIQA 4AFZA 4YO9A 4Y79A 2GCTC 1OPHB 4MDSA 3A7YA 3EA9A 3RXRA 4CRBA 1X7AC 2ZDLA 6CHAC 1LQEA 1YPJH 3BTFE 2G4TA 1L1NA 1O3MA 3LOXA 2F9VA 1G36A 3PLPA 3ZVBA 1K9OE 1BQYA 1AB9C 7KMEH 1RRKA 3UUZA 5A09A 3E1XB 3SORA 1AIXH 1NFWA 1W11U 6GCHF 3MU8A 1WOFA 4PROA 4GUXA 4OS4A 4BAKB 2QAAA 1O5DH 4Z0KA 4MNYA 1ETSH 1GVLA 2OUAA 3FP6E 1RIWB 1H8IH 1ZZZA 1EATA 1HXEH 4A1TA 3LONA 5EQQA 3RXGA 2SFAA 3C27B 3M5MA 2F9OA 1O2PA 5PTPA 2BXUH 1HUTH 2FESH 1P2IA 2ZQ1A 1SI5H 2XWBI 4YM9A 1W14U 2BD4A 1A7SA 1H8DH 1Y3XA 2J94A 3RXUA 4Y11E 1UTOA 4X2YA 3SU2A 4X1NU 3BTTE 1KLTA 1P02A 1OP8A 1QRWA 2DUCA 2P3FH 1A0JA 1ZRKA 1TPAE 1DANH 1CHOF 1NESE 3PMJA 2ZPRA 1RD3B 1V2JT 1O2RA 2WPLS 1KTSB 3BTQE 1F0TA 1CSOE 4NWKA 8ESTE 3VFEA 2ZU4A 1RTKA 1KDQB 1WV7H 4XFQA 5AF9H 1ELFA 1QL8A 1UTQA 3L3TA 3ZVAA 4U32A 4U01A 1GJCB 3SNAA 4NWLA 1YPLH 3TITA 1O2GH 2Y82A 2J34A 2BLQA 1C4U2 1DWEH 5ETXA 1YF4A 4NCYA 5ESTE 3IWMA 4MPWA 2C3SA 1VZQH 1SGFG 4NZQA 3KHVA 4AN7A 2UUFB 2VVCA 4NA7A 1ZYOA 1NT1A 4RN6A 2A7CA 1C5PA 1CGHA 3D65E 4IW4E 2THFB 1LQDB 4TWYA 1J8AA 1O37A 5JB9S 2ANYA 7GCHG 4ZROA 1QBOA 2AYWA 4J2YB 2PLXA 5DPAA 3ZZ8A 3RXDA 1BA8B 3A83A 4HGCA 1FY8E 2Y80A 1C2GA 1WSSH 2BD5A 3EA8A 3PLBA 2VVVA 4K5ZA 3PM3A 1O5CB 2ZGBH 1C1OA 1GGDB 1OSSA 2P8OC 3ZV9A 1QTFA 4KKDA 3GCNA 1E37B 5DP9A 2W3KA 1CQQA 1QRZA 1GHYH 2R9PA 2Y7ZA 2NU0E 1UVSH 1BTZA 5CHAC 1HAHH 1W0ZU 1GCTB 1LHGH 1XX9A 2BDCA 5C1XA 3RUOA 3GYMA 2H6MA 2G81E 2BD8A 5DKMA 1W0YH 1HAOH 1ZHPA 2BM2A 1VCWA 2OTVA 3SU6A 4E05H 1E36B 3U1IB 2BD2A 1PQ8A 4JYVH 3NK8A 2C8YB 2GMTB 3M61U 1SGPE 1ZGIA 3UOUA 3EYDA 3MH7A 2ILNA 4IN1A 2PKAB 1G3BA 4WMEA 2WUCA 1TX7A 2R0KA 5LPRA 1GHAF 4BNRA 3ZVCA 3SHAH 1LDTT 2G5VA 4ISOA 2JH6D 1Z8JB 2XXLA 3ZZ9A 1LTOA 3K2UA 1UTMA 2SGEE 3BF6H 1P0SH 1T8MA 3RLWH 3P70B 3L33A 1ZPCA 1ELEE 1YPEH 5FBEA 4FU7A 5DP7A 3S69A 1Z1JA 1BOQA 1DPOA 1GG6B 5HM9A 2FP7B 1FY3A 4K8YA 2VWMA 5K7RA 2BY8X 4ESTE 4ISHH 1TRMA 1DOJA 3MU0A 3STJA 1BTYA 2WYGA 4DT7B 3BIVH 2BDIA 1C5RA 3ZV8A 2M5TA 5JB8S 3E8LA 1MBQA 4O3UA 2HVXA 2IN2A 1T4VH 1FY5A 1GHVH 1P06A 1Z1IA 2BVSH 1DM4B 1YGCH 4K3JA 1THPB 4RSPA 3GY2A 2P8OB 3M5OA 4D7FA 1GGDC 1O34A 1XKAC 4XE4A 1QQ4A 1JBUH 1SHYA 1T31A 1KXBA 4BXWA 1O2MA 3SUEA 1WTGH 1C1UH 4KP0A 3TJVA 1F5RA 2VH6A 4YLQH 2IOTA 2B8OH 2ZHQH 1PPEE 1L4DA 2XWAA 2PTCE 2Z6BD 3RP2A 2Z9GA 2R3YA 1KIGH 2RDLA 1ABIH 4I8LA 2QXIA 4ZAEA 4O3TA 1NZQH 2WPJS 3SUGA 2ZPQA 1SFIA 3U8TH 1K1MA 2FX6A 3KQDA 4IN2A 2EEKA 2SGQE 3HGPA 1XUIA 3P95A 5F8XA 1O5GH 1WQSA 1QBVH 3VB6A 3UPEA 2AEIH 2ZGCA 2Z94A 1UCYH 3DUXH 2PUXB 3F6UH 4HI3A 1QJ6B 2XCNA 1IAUA 5T6DA 3RXBA 1SLWB 4O9VA 2OC8A 2VIWA 1UK4A 1TMTH 3ESTA 1TWXB 2VB0A 2WPKS 2Y81A 1BRCE 2LNCA 1O31A 2PGBB 1PYTD 1O38A 1GBMA 2J92A 4FU9A 1FPHH 3ZVFA 5IYTA 1K22H 1Z8GA 3T29A 2AGEX 4O03A 1ABJH 1TABE 1HB0B 2P59A 5C2ZA 5GDSH 1CHOG 3A7XA 1YM0A 2A7JA 1MKXH 1PQ5A 5J4QA 1G37A 1D4PB 1JIMA 2ZTYA 1GI1A 3T27A 3NUMA 2JH0D 1BRUP 1OOKB 1SGYE 1AQ7A 2G52A 3M5LA 1ZMNA 1UK2A 3GISB 7GCHF 2I6QA 1VITG 1S6FA 3EAJA 4TPIZ 1MZAA 4KTCA 4WH8A 1C5YB 1TA6A 2KAIA 1A0HB 1ELTA 1L0ZA 4NSVA 3KGPA 1SGNE 4I31A 3SU5A 4UFGH 3F9HA 2ZGHA 1FZZA 2ZDAH 2WV5A 2PKSC 4I32A 1NFYA 3KIDU 1V2QT 3A87A 4R0IA 1UTKA 1T8OA 1DWCH 4OGYA 1TGCA 2IPHA 2GZ9A 4K69A 4XDEA 3RXHA 3E91A 1IQLA 3OSYA 5DP3A 4NFFA 4Q2KA 2UWPA 4Y7BA 1YLCA 3RXMA 2QIQA 4FUGA 1MU8B 1AUTC 1L2EA 4ISNA 3KQCA 4TY7A 1FN6A 1DWBH 3M35A 1YCPM 1Q2WA 2CXVA 5AVDA 4D8NA 4YT6H 1HIAA 3O8BA 4MLFB 1BT7A 3OYPA 1LPZB 1O3CA 3SV9A 2HLCA 4ABEA 1RIWC 1QIXB 2SGAA 2GKVE 1GBBA 2C4FH 3DA9B 5A2MH 1NU9A 1XMNB 4D9RA 3EDXB 3H7OA 4IC6A 3SJKA 4DIIH 1SL3A 2FI4E 1T8LA 5G4BA 2XBVA 1BMAA 4ZKRU 1YPHC 2TGAA 4FUIA 1C4V2 1V6DA 2ZTZA 2XBYA 4X0WU 4CHAB 3T5FH 1O33A 4JZEH 1GJ7B 1AB9B 1P2JA 1UK3A 1HIAB 1QY6A 1NU7B 4XSKU 3QGJA 4Q80A 2R2WU 2ZQ2A 1SGTA 1GMDG 3I77A 1DX5M 4WY3A 1GI9B 1NPMA 1D3PB 1FI8A 3RXSA 2EI6A 4FVDA 4BTUB 1HYLA 3RM2H 3P8OA 4AFSA 5HYOA 2CF8H 1ELBA 1XXDA 1NRNH 1MTWA 4A1VA 1RXPA 3RXAA 1GBFA 1PFXC 2OC1A 1K1OA 1GMHF 4B71A 2W7SA 3ATLA 5ABWA 3M7QA 2JETC 1P2QA 1SFQB 2Z9IA 4KTUA 1A3EH 2H9EH 1GJ9B 1AUJA 1SQAA 2ZTXA 1GMHG 3S9CA 2VIDA 5AHGH 1E0FD 1CT2E 1YKTA 3RXCA 2ZDVH 1BRBE 1OX1A 2CHAC 4O97A 3PB1E 3HKIB 1CGIE 1Y3YA 2B7DH 1V2VT 1ZJDA 8KME2 1O2IA 3SU1A 3ZZBA 2JKHA 3VB3A 2BOKA 2ZGXH 3A82A 1EJAA 4AFQA 2FPZA 3BSQA 4F49A 4CH2B 1C1PA 1G3DA 1GBHA 3MI4A 4OS1A 4XBBA 4ZHLU 1P05A 2BQWB 4FUDA 1O2NA 1TX6A 1K1LA 1M9UA 3ZYDA 1GJ8B 2BDYA 2ZU3A 1AZZA 1EP5A 1K1PA 4TWWA 4ZKSU 1SMFE 5FBIA 3A86A 2XC0A 4R8TB 1ELVA 2WPHS 3K6YA 1GL0E 3SI4H 3RMMH 4H4FA 2F83A 5L30H 3PV4A 3ODDA 2GDDA 1ZHMA 4LZ1H 1IQMA 5FX5A 3TVJB 4NZLA 4YZUA 2BY7X 1BMMH 3W94A 1GHBG 3BTWE 3SGQE 2IJOB 1SGFA 4X1RU 1C9TA 3VGCC 3GDVA 3GYLB 1YCPH 4NGAH 4A92A 1GI0A 3ATKA 3TGKE 2P93A 7ESTE 3MMGA 3ZZ5A 1LVYA 1P57B 1UCYE 4RKOB 1O2SA 1CVWH 1PPZA 3GY6A 2OQ5A 2ZI2H 4Q7XA