2WUHA

Crystal structure of the ddr2 discoidin domain bound to a triple- helical collagen peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
163
Chain Sequence
b'NPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN DOMAIN RECEPTOR 2
publication title Crystallographic Insight Into Collagen Recognition by Discoidin Domain Receptor 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor/peptide
total genus 37
structure length 163
sequence length 163
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wuhA00
2W3JA 1XNAA 2E26A 3I3DA 3IB3A 5DPNA 2Y6GA 1CZTA 2VZOA 1UYYA 1UZ0A 3JXSA 2YB7A 3WF4A 3T2QA 1J84A 1JYVA 4BXSV 2J22A 4KI5M 2W94A 3OEBA 3K4DA 2ORXA 1US2A 4QX2A 5C71A 4XUQA 1PMHX 2ORZA 1GOGA 4QAWA 3MV11 1LNSA 2VMEA 2V5DA 1W8NA 3EYPA 1OD3A 3OB8A 1W0NA 3T2PA 3I3EA 3WNPA 4AAXA 3MBWA 1DLCA 2WAOA 3LPGA 5B4XA 1PMJX 2VCCA 2XHNA 2YC4A 4CVUA 3VDBA 3ETPA 2QQKA 2VCBA 4XURA 1OT5A 3WNKA 4QX3A 5C70A 3LEIA 3MO4A 5A1AA 2VQUA 2VZUA 3OGVA 4XUPA 2C26A 1SG3A 3K4AA 1SDDB 3VDAA 1JYWA 2HYXA 1F4AA 2KD7A 3CZJA 1JZ8A 2J1UA 3I2JA 1KGYA 2Z4FA 3NQHA 3FHQA 2W92A 2Y8KA 4ARYA 5IHRA 3OBAA 2J1EA 4KWUA 3T0AA 3LEGA 2L9LA 5JXGA 1W8OA 4LPLA 4A4AA 2CDPA 2VTFA 2C4XA 3DECA 3FN9A 3DYMA 2VMCA 1ULPA 2J1RA 2WZ8A 4XVHA 4ET7A 4UOJA 2VZPA 3IDAA 4QDSA 5LCWL 3A7QA 5IFTA 4MOAA 4E8DA 4L0PA 2QQOA 2YFZA 4QDRA 2VR4A 3C7GA 1W99A 3LQCA 5IFPA 2VOTA 3K75B 2WQ8A 3CKHA 2VZQA 4CU8A 2PQSA 4OZOA 3T2OA 2LW8A 3IIIA 4CU9A 1NAEA 2V72A 5FUIA 3WEZA 1P8JA 1JZ4A 2VC9A 2VZRA 2Y6KA 4QB1A 1T2XA 2ZEWA 2C9KA 4CUAA 2J1SA 4ZY9A 4DEVA 2W1WA 2BZDA 4IUGA 4JKLA 2BERA 3HNBM 4OMDA 2VZVA 3THCA 1UY3A 4TXWA 3CDZB 3HOBA 5G05L 3C7HA 4XZUG 3SEPA 3U37A 4QX1A 2EICA 5LA2A 2WN2A 4DUWA 4DXRA 1MPXA 1WCQA 3CIHA 4M4PA 1UY1A 3WNMA 3WF0A 2W5FA 1JYXA 2X05A 4JKKA 1GOFA 2QQJA 3GXUA 2XQXA 2RJ2A 2JE8A 3WSOA 3A22A 2XONA 5LA0A 4D8MA 4D0QA 2X10A 4JX0A 3VD4A 3LPFA 2ID4A 3HPNA 2J1VA 4JKMA 4GWIA 2LS6A 4MO3M 4BK4A 4A44A 1HN1A 2WZEA 3DYOA 1UY4A 4ZZ5A 3ECQA 1DP0A 3WF1A 1KEXA 5G04L 4BDVB 4OMCA 2VMDA 2V4VA 3SEEA 1UWWA 1JZ2A 5CZKA 1R64A 3T0BA 3OGSA 2J7MA 1RYYA 4GZ9A 1JU4A 1GUIA 2B9VA 2JDAA 5C7GA 1GQPA 3AC0A 3VD3A 3CQOA 5HPOA 3THDA 1CX1A 1JZ7A 1WKYA 4CU7A 3NRUA 2W91A 3WQBA 3HN3A 4KMQA 1CZSA 3GGLA 4P5YA 3P1IA 3F2ZA 4PQQA 3T09A 3C8XA 2VO5A 4PF1A 2DCJA 3ACIA 1H6XA 1BHGA 2WDBA 4UI9L 4CU6A 4XUTA 1PX4A 1YQ2A 3K46A 2CDOA 3I97A 1EUUA 4ZXEA 3C7FA 1W9SA 1XNTA 3I2HA 2QQNA 2VZ3A 3IAPA 2Y6JA 4A45A 3D3AA 2EIEA 4LQRA 1W9TA 3WF2A 4W50A 1K45A 3ACHA 2W9XA 4MGQA 3VD7A 4UAPA 3W5NA 4DUXA 3HNMA 1TVGA 1UYXA 2VCAA 1JZ5A 3A21A 5DQ0A 3I2KA 4CUCA 5F7UA 4A6OA 3VD9A 5IYYA 3OEAA 2WBKA 3VD5A 5DMYA 4XUOA 2W1UA 4HG6B 2VZTA 3P6BA 3PUHA 2W95A 2WO2A 5DN2A 1D7PM 3BN6A 2YFUA 4AG4A 1CIYA 1TG7A 5JXJA 1SHWB 3MUY1 3GM8A 4A42A 1J83A 2YC2A 3I3BA 4P02B 2DDUA 1UXXX 1UMHA 1PX3A 4P08A 2ZEXA 5JXIA 1JZ3A 4Z2AA 5JR2A 3ABZA 4W8JA 2WAAA 2XOMA 1OH4A 2X09A 5EJZB 2VZ1A 2Y64A 4M4RA 1W9WA 2YG0A 4JHZA 4DXSA 2JD9A 2R7EB 2EIDA 3PUIA 2WO1A 3MUZ1 1XPWA 4YPJA 5LA1A 2HLEA 3VDCA 3FL7A 3NJXA 1NX9A 4TTGA 1GU3A 3UETA 2EIBA 1EUTA 2W1QA 1OF3A 2ZEYA 1DYOA 1NKGA 2VM9A 5JXHA 2VJXA 5IJRA 4CUBA 2W1SA 4DEQA 4QX0A 1JZ6A 4P00B 1IQDC 5CYYA 2JKXA 1O59A 4MGSA 3LE0A 4BJ0A 4E8CA 4QB6A 1O8SA 2W46A 3NNGA 1L7QA 2QQLA 3CMGA 1NUKA 3E1F1 3T08A 2VZSA 4QDQA 2W47A 4DUVA 2WYSA 1XC6A 5HXMA 3LEKA 4RN5A 2J1AA 3C7EA 4XUNA 3BGAA 3K4ZA 3J7HA 5B4NA 1UYZA 2E33A 5EJ1B 2QQIA 2WABA 3UESA 3UNPA 1GNYA 4A3ZA 2RVAA 1F4HA 1UMIA 5JMOA 1CZVA 3OGRA 4ZZ8A 4ARXA 3EB7A 2BGOA 3I2FA 3T0DA 4LKSA 3WNOA 3HNYM 4DXTA 4GWJA 3ZM8A 3ACGA 3NJVA 4LHSA 1K42A 1JYNA 2WUHA 1JI6A 2WN3A 5J1XA 2VQTA 4A41A 2OKXA 1UY0A 3HEIA 5JUVA 2W87A 1GMMA 3I2GA 4QB2A 3FHAA 2VL4A 3MV01 2Y6HA 3WNNA 3DYPA 1K3IA 4QPWA 2DCKA 4W4ZA 2ZXQA 1UY2A 2E31A 3SKVA 4MADA 1UXZA 3SKJE 1JU3A 2J1TA 2RV9A 1O8PA 3ACFA 3K77A 2ZEZA 2VMFA 3WF3A 3W5MA 2BGPA 4FI9A 3CZUA 2Y6LA 3C7OA 1GOHA 2E32A 1L7RA 2QBXA 3GDBA 1UX7A 4OUEA 3HJRA 1K12A 1ULOA 1US3A 2BBAA 5EIYB 1JHJA 2QQMA 4BK5A 1H6YA 1I5PA 2WO3A 2B4KA 3IAQA 4PT6A 1OF4A 3WNLA 3I2IA 4RYDA 3OG2A 3A23A 4OYUA 5I0DA
chains in the Genus database with same CATH superfamily
1XNAA 2E26A 2P3IA 2XUEA 1C28A 1BK1A 3M3QA 2RS53 1ULGA 4LOTA 4N9IA 3VKNA 1UYYA 1UZ0A 3D5OA 3LF7A 3NNMA 1CAWB 2R072 2YB7A 4YW7A 4FPJA 4GQ7A 5F8PA 3WF4A 1C3HA 4K40A 1XSQA 3T2QA 3U14A 4AR2A 3UGGA 5FZ1A 4O7XA 1QNYA 3FE5A 4KI5M 3P3PA 3NSTA 2QTWB 3NV2A 2D97A 4QM8A 5BPXA 4AOCA 2ORXA 2ZAAA 3FLTA 5C71A 2HWF2 4FP3A 2HBTA 4YVWC 1ZRIA 4QAWA 4CPBD 3GYDA 1DHKB 1LNSA 1POQA 1Y9MA 4PDWC 1ZRRA 1W8NA 2UYBA 1OD3A 4TSVA 3JD72 1SCRA 5ACA1 1F2NA 2EVXA 3TRSB 3RZHA 1TEIA 1H9WA 5DUVA 3TBDA 4AAXA 2BBVA 3EHKA 1DLCA 4AEJA 4YVWA 1DGRA 3I2DA 1H8TC 5IAVA 2DBIA 2GZWA 3HIFA 1VALA 4PDWA 2XHNA 1B35B 2YC4A 1AR81 4CVUA 3VDBA 3ETPA 4QXCA 2IUWA 3QACA 1OC1A 4XBNA 4MGTA 4XURA 2XVLA 2P6HA 5FIXA 4AHXA 4N90A 4DS0A 5KXEA 4FBFA 1GKBA 1H8TA 1JUHA 1V6NA 2NMNA 1LJ7A 2VQUA 3GALA 5EYXA 3UT0A 1WW6A 1O5LA 1ZBE3 4LK7A 1HRV3 4CE8A 3SC7X 1NLQA 2ZGQA 5FY7A 3ZSEA 1O4TA 4LITA 1SG3A 4P9IA 1AX0A 2D43A 4UW4A 2YMZA 2HWB2 2HYXA 3O1MA 3MICA 2FCVA 2VVDA 4BISA 4XQ4A 3I2JA 2F4LA 1ZNPA 2B42B 3IDBB 3CO2A 4XOGA 4DXZA 3FHQA 1LU2A 1LAJA 2BEOA 2J1EA 3PVNA 4HMZA 4EN0A 2PHWA 4Q4X1 5JXGA 4LO4B 3ZXJA 1R093 2BP6A 3TEZA 3OF1A 4AEDB 4CDWB 4IE4A 1YUDA 3H8OA 5FLIA 4C1XA 1PO13 4LPLA 4A4AA 5F2SA 2CDPA 5FYHA 2VTFA 5FXXA 5A6XA 1KS5A 4O9GA 4KH9A 4YGEA 1ULPA 4XHXA 4DZGA 3TOJA 4ET7A 4A7YA 4QDSA 2IFRA 1EPWA 2BOJA 3A7QA 1RL3A 3POGA 4S2HA 5IFTA 1W28A 2HWE3 2QQOA 1AL0G 5FJHA 3ZSKA 3C7GA 2OYZA 4H14A 4IV1C 4Q8LA 4INDA 4BQ2A 3LQCA 2HWC2 1TNRA 3CNAA 1LGNA 4X8NA 4DO0A 2HWD3 4W6XA 2B8MA 5DUWA 2OXBA 2AR6A 3T2OA 1N1VA 2B46X 2HH9A 3HN1A 2WINB 5LK5A 4MG2A 1NLRA 1SLBA 1ZZ6A 3IIIA 1ZBE1 1RUJ3 4IV1A 5AFBA 1HRV1 1NAEA 4FFGA 1QF3A 5FUIA 3J7MA 3PURA 3WEZA 3CLPA 4IGPA 1W6MB 5JPNB 2C5DA 1JZ4A 1LOBA 2PXJA 3D8CA 1RXFA 1YYNA 2Y6KA 5F3CA 5I91A 4C1WA 1J3QA 3ZFFC 4CUAA 3AVRA 5A3PA 2YPJA 4YZ2A 1RVF3 1RMU2 1Z7S1 3KGZA 2E9QA 3P3NA 1QNWA 2J1SA 1ENSA 3WQ0A 2PYTA 2E6VA 1N3OA 1ND2A 1IPJA 1NOVA 1PO22 3R0RA 4JDOA 2BERA 3HNBM 4JKLA 2DVAA 5FPUA 5LZ6A 1QXJA 3ZFEB 1ZBA1 4B7EA 3IIAA 3ZFFA 5J09A 4LO5B 5CAZA 1SLIA 4CCCA 1X7NA 5FPZA 4PLOA 3WQ7A 4OVEA 4QPIB 4DMIA 4YFZA 4GJZA 2QQPA 1ZVFA 1RUG2 2RS33 4Y3OA 3HOBA 4XAEA 1JUIA 4XZUG 3SEPA 3U37A 3MFCA 5DG1A 1TMF3 3ELNA 4YG6A 4KNCA 4DUWA 2E7TA 3VL9A 1K5JA 1H4GA 4IESA 2HWE1 1OMIA 4OI1A 3CIHA 3R4DB 1UY1A 3WF0A 1FATA 5ISLA 4RA0A 2VECA 4CCLA 4K6BA 2ZOEB 2ZGLA 5C4WB 4Z1VA 4LT5A 3A22A 4Y5Z0 3WP6A 2JE7A 2P4EA 2HWD1 2XONA 1PNGA 1DZTA 1UKRA 3AP7A 3RZGA 1FPN2 1NCQC 4OZXA 4O65A 4A2UA 4B4PA 4D0QA 1W8HA 3LKJA 3VDDC 1QEXA 3MZHA 1RUF1 4U2AA 3GZAA 2ID4A 1ULEA 3HPNA 1VBB3 4XJUA 2ZX1A 1JYCA 4UBGA 2PAMA 1WCSA 1UOBA 5H9RA 4XJAA 3W21A 1J1TA 2PMWB 2VXJA 4LO8A 4BQ5A 3U07A 3VDDA 5H9PA 3KT7A 4ZU7A 4ZHNA 3NJYA 4BK4A 1UQXA 2DU1A 3H7YA 3SQOA 1PZ7A 4GIQA 1RVF1 1AL22 1WW4A 3KVAA 1N1SA 2Q1MA 3PDQA 2OX0A 4W6WA 1N1TA 2R30A 2GC2A 4IEZA 2RDSA 3TWIA 4DQAA 5LRSA 3QD6A 3AZXA 3ZFGB 4CCJA 1MZFA 2EAAA 3TYJA 2I45A 4F7ZA 2MHFA 3MHZA 3NKTA 2B45X 4OMCA 3SNMA 1V9U3 2VTXA 4TN7A 2WS91 4PI0A 2RS31 4FPOB 1YCIA 5CZKA 1RYYA 1ND2B 2A6YA 3PUSA 4LUMA 3FFQA 1TMF1 2B9VA 4IE7A 1LHUA 4XF4A 5BV6A 1YFUA 1GQPA 2XXZA 1QKQA 3AC0A 3VD3A 5F5CA 3USUB 3VBSA 4BWOA 3QLQA 4D7TA 3VBUC 5D21A 5EWSA 2ZS6B 4JDMA 1V0AA 1XU2A 1E57A 4IE0A 5FMCA 1O3RA 4BMEA 3PMEA 4EN9B 3NRUA 2VUCA 4J6GA 1YNAA 5L9BA 3P1IA 4YW3A 3PU3A 3ZXLA 2ZGMA 2UYAA 1XXNA 2UWAA 3F2ZA 3JU9A 4PQQA 1LULA 2WZPP 2VO5A 4PF1A 3VBUA 2DCJA 1H30A 3ACIA 3AKPA 3M4FA 5K9YA 1HB3A 4UBHA 1R081 2OS2A 3UYJA 1CAUB 1BMV2 3B01A 2QQUA 5GZGA 1PX4A 2E51A 3K46A 4FTBA 1X33A 5FY5A 2IXJA 2RM22 3ES4A 4HSLA 4CP9A 4HN0A 4ZXEA 2VVFA 3LA3A 1XNTA 1PVXA 3POYA 3I2HA 3A4UA 1AJKA 4QM9A 1DGRN 2VZ3A 3IAPA 1OI6A 4DIQA 1VAVA 4WVMA 3VBOC 1MZEA 1FX5A 4A45A 2YU1A 1LOCA 2ATFA 1EAH3 1R1A2 4LQRA 5FJKA 4XJ9A 1CESA 4LKEA 3AMNA 3NO8A 4FOYA 3V0AA 1V9U1 2JENA 5CFCC 5GZCA 2C6SA 5IVBA 1W6PA 1DF0A 4HLTA 3VBOA 4AVCA 1EY2A 4GMP3 2GNTA 4Y5TA 4DUXA 5IK4A 5AVAA 3HNMA 1TVGA 4S2GA 3B02A 4F3JA 3H8UA 5CB7A 5C8CA 3KQ4B 4IEUA 4QXKA 3K48A 3CHXA 3QH6A 4YSFA 2VQAA 1D0GA 2ZZJA 3ILFA 4AVSA 2Q8EA 1JBCA 4QPGC 1AXYA 1KRIA 4A6OA 2UURA 1GWLA 2ZGSA 4J1XA 5IYYA 4EZ4A 1Q8SA 5DMYA 1V6MA 4XUOA 1URXA 4META 3RYRA 5FAXA 3PUHA 4LBMA 2WO2A 3VBSB 2ZMNA 5DABA 5DN2A 4KWJA 4MYEA 4AQTA 1CONA 1KD7A 5EP9A 5FV3A 4S2FA 1IG0A 1IGOA 2PN5A 3GZTB 1DGWA 1TG7A 3VZNA 4TLFA 2JB4A 1J83A 4NAMA 4PI2A 1V6JA 2XBO1 3I3BA 5FWEA 1YLLA 4MGKE 3VBUB 2ZA9A 2DDUA 3FLPA 2OW4A 2SBAA 5EHDA 4SLIA 5E6HA 1K5MA 1MEC2 1S0JA 2IXKA 1GP6A 4Q1RA 5JR2A 3WDVA 2RS52 2K2SA 2BDRA 2A3XA 4BU2A 3Q8EA 2RE9A 3KB5A 1EAH1 3MIEA 1OH4A 4YGCA 3SH4A 2XLGA 1BEV2 1H8VA 1SCSA 2A1XA 4GA9A 4TLGA 4RS5B 5FZ6A 1I1EA 3UK9A 1CAXA 1F31A 4L8QA 3JBG2 4W6YA 3WQ1A 4EZHA 4GMP1 1WCUA 4WVMB 3ZN5A 1YJLA 4H7LA 4NPRA 4QX5A 4DXSA 2JD9A 4XTPA 5A70A 1MZ6A 4L9BA 1O3QA 1EYBA 4H55A 3ZKYA 3AKQA 3IMNA 3MUZ1 5CFDB 4KGQA 3V0AB 5LA1A 3DEMA 3FL7A 4JQRA 4BB3A 4XHBA 1C8M3 1GU3A 4LXLA 2BV4A 2VOVA 2O0OA 4Z07A 3WG2A 3O12A 5FK8A 1KS4A 3NNJA 3WW2A 1X36A 1XRUA 3HAGA 1V6OA 2J42A 1WLCA 1X9PA 3LZZA 3R4SA 3WUCA 5C8CB 5F5AA 2X5IB 1PNFA 2GAUA 2A5ZA 2VM9A 5EV7A 3M8LA 1H2NA 4R4ZA 3KF3A 2VJXA 4MGYE 4YWAA 3B00A 3DPRC 1JZ6A 4CP2A 4Q4W2 5BNPB 1WW7A 5CYYA 1O59A 1HRV2 5FDBA 1GNHA 1VRH2 1ULCA 2D6MA 3LE0A 2PHFA 4QHZA 4BJ0A 1X50A 2LUWA 4ZPIA 1NT0A 3KF5A 1CGPA 2GMMA 2W46A 1OKQA 5DUUA 2VNVA 5EJ3A 4AQ6A 5FZLA 2DF7A 2VZSA 5LW9A 4QDQA 5EXOA 3N9MA 4FPKA 5HXMA 2QQVA 3LEKA 2R1DA 4RN5A 3RNSA 3RYKA 3C7EA 4BQ1A 2CWMA 1QJEA 1L3JA 3FHIB 3OUJA 1GR3A 4FOVA 4UFKA 3U10A 2OUJA 3OBTA 4YM1A 2C24A 3ZYJB 4CEYB 4RQPC 1CJDA 1DGLA 1MQTC 1PGW2 1R092 2HKXA 1K5MB 4V2WA 4Y1VA 4AVVA 1Q3EA 1QJX2 2E33A 5A7NA 5FCCA 1PO12 3UNPA 4XF0A 4E2GA 4CCNA 4A3ZA 3N4MA 1NA1C 2RVAA 1F4HA 1CZVA 5HBAA 2RDNA 4BYYA 4RQPA 1MQTA 2BTVC 3EB7A 1DZRA 2BGOA 1CAXB 3MIDA 4E4DX 3LD8A 1W8TA 2DTWA 5FK7A 2ZZQA 1ZZ9A 1LHOA 3DUIA 3N9QA 2OT7A 3ORJA 5FQ0A 2WN3A 3VGIA 5J1XA 3FMGA 5JSPA 5CEHA 3AL6A 3KD4A 1UY0A 2OKXA 4K1YA 5FY8A 5A7WB 3TNQA 5L7OC 1JTZX 5FXWA 3MPBA 2HWD2 2WL1A 4LMFA 4QB2A 3POBA 2DUPA 2PTMA 2XGXA 3I59B 5GZEA 3VBRC 2FDIA 4M0NA 1VMHA 3WINE 3WNXA 2VH9A 1TME3 2XJPA 1RUJ2 1WUVA 1C1FA 5FZBA 1FMD2 2Y6HA 4LUKA 2VUAA 3ZXAC 4N9HA 2XH6A 5IVFA 2CGPA 1UYPA 4YG3A 2DCKA 3RMXA 3FJSA 4E4ZA 2WQ4A 3E6DA 4KWLA 5T5JA 3VBRA 3WDWA 5L73A 2FHRA 1SFPA 1Y43B 1G8WA 4IW3A 2EXKA 2E31A 1COV3 5C5UA 1ENRA 4K3UA 4M0HA 3SKJE 5E88A 2Q0AA 1YHFA 4WBBA 1RVF2 2J1TA 4ZXKA 1CD3G 3OOXA 5A6QA 1G7YA 2QFEA 2ZEZA 1PGL1 4DPNA 3T3YA 1GWMA 1SFNA 3IM0A 3M3OA 3ZSLA 3C7OA 1GOHA 1ZZCA 1L7RA 4CXXA 3ZYGA 4OUEA 1HRI3 1BZWA 4CCKA 2JG9C 1K12A 3BU7A 4NIIA 4XE9A 2LALA 3OYWB 1ACCA 3GBFA 4CDQC 4BK5A 1I5PA 2WO3A 4X6QB 5IT6A 5CG9A 2GU9A 3IAQA 1PZ9A 4IE5A 3I2IA 1F5FA 4XXPA 2RR13 4K8FA 1W2UA 2JG9A 5BNQA 3AMMA 1IG3A 4LLFA 2JEMA 3H42B 3KQRA 4BHPA 3Q9OA 5SV5A 4OYUA 4CDQA 1DYKA 4Q4Y2 5LB6A 3VZKA 3AKSA 1GZTA 3ITQA 1S2BA 2BNNA 2AH2A 1ZRFA 4GB32 5FPLA 1DZQA 1H1AA 1IHMA 4NHKA 1VP6A 4NHLA 5DDJ3 3ZMOA 4TZDA 1TME1 1JYTA 1IKPA 5FQ0B 1WA6X 4YNIA 5A3OA 1VBB2 1VIWB 2IXLA 4BXSV 1O6UA 3HQXA 4E4SA 1HXS3 2RHPA 4V1PA 1F15A 1SZBA 1Y9QA 1W2OA 3LAGA 3OEBA 2ET7A 3QOPA 5CBLA 1US2A 4QX2A 1PK6B 3T1MA 1COV1 1YEWA 2R062 2VNOA 3NJZA 4K21A 3BI3A 2DUQA 3OB8A 2FDHA 1QY4A 1VAKA 1W0NA 2JJ6A 2Q8CA 4PIZA 3GBGA 1G9CA 4XDQA 2O8OA 2RDRA 5EZWA 2EXJA 3LIGA 5FZKA 2UY9A 5BNNC 2VU9A 4COVA 4RGKA 3AFKA 3WW4A 2XLFA 3T4VA 1PMJX 1CVNA 3AZZA 2WWSA 1HRI1 1CX4A 2VCBA 4KU8A 4XIKA 4XZPA 3WG3A 4R9BA 1F8VA 1KDKA 2E7QA 4NRPA 2ES3A 5C3PA 3UL2A 1NZCA 5BNNA 3MO4A 4AI9A 5A1AA 3AJZA 2JG8C 2RR11 4XUPA 3A0NA 5GJ6A 3I7DA 3N9NA 5A33A 4XXAA 3TN93 3AZVA 1FNZA 4XJ8A 1JYWA 2KD7A 3FX3A 3G6JB 3I4IA 1HJGA 2J1UA 1RUE2 2P17A 1ODMA 1OURA 3NQHA 5LBFA 2V4AA 1WWYA 3EJKA 5DDJ1 1Y9GA 1ZZ7A 3UGHA 5KWRA 2GALA 1UU4A 1W06A 4XBQA 5FZFA 5LBEA 3B5LB 4KWUA 3O1OA 1BVVA 1HDKA 3DXTA 4Y24A 2D98A 2IFWA 5F5QA 5A32B 1WCDJ 3EMRA 1HXS1 3T4HB 5A7SA 4NE9A 3WDXA 3L9JT 4AVTA 1QOOA 2W0XA 3ZDVA 2WFPA 2C4XA 2YHJA 3NL1A 2IZWA 3POWA 4GKYA 3NV4A 1OLME 2VMCA 3WW3A 2FCTA 1AZDA 2XWBB 2VZPA 4QKFA 2BFUL 1PHMA 4L11A 4Y22A 5FY4A 5F6KA 2FCUA 2AACA 4XTMA 5FREA 1O4YA 3OCPA 3RWKX 4FFFA 1XQNA 3BTYA 2P3YA 3AYCA 5DZEA 2WIIB 1W99A 1IPSA 5IFPA 4COUA 4CA9A 3ALQA 3QBQA 2B7YA 2WQ8A 2ZGOA 2VNGA 5FZOA 2VZQA 4PBPA 1CJPA 2WQZC 1VPHA 2LW8A 4GXLA 2DUOA 1JOBA 4XEZA 4XF1A 1GP5A 5JSRA 5K8SA 4IXLA 2VW2A 3B69A 1AR73 2QVSB 3TN91 4OHYA 3USSA 5A7PA 2MEV3 1YIPA 1AYN1 3M3IA 4Q0PA 5BNNB 5HCFA 4QB1A 1T2XA 4ES9A 3LSDA 1POV0 3MLLA 5BNOB 1H4HA 5I8YA 2VW0A 3SHRA 3MI8A 1PIV3 3AYDA 5J36A 2AEYA 2QQWA 4DEVA 2BZDA 1TNFA 1HJFA 5HV0A 5FY0A 5FZ7A 5HXVA 4CP0A 2NLRA 2VBDA 2RS12 5DG2A 1O3SA 2X29A 4DY5A 1KFXL 2WA4A 4LLOA 1RUH2 2GMEA 1UY3A 2GH8A 4ITCA 4TXWA 2PLV3 1U5ZA 3CDZB 5HV4A 3RI9A 3C7HA 5JSOA 4LIUA 5LK7B 2D6NA 4IV3A 5JZGB 5LA2A 1OD5A 3J7LA 2JIJA 4LO6B 3POIA 1E5SA 2P3JA 2W2IA 1RUD2 3AP5A 1DYPA 2CAVA 2X05A 3WVJA 1PMIA 4YM0A 1ULDA 2FQPA 3PUAA 4Q4X3 5JIAA 1DBNA 4AVAA 3MW4A 4XPVA 1UL9A 1SPPB 4Y22B 3J9SA 1UPIA 2RMU2 3VUOA 2QZ3A 1H9PA 2X10A 3E5QA 2R0FA 1UOFA 4UFJA 1OLQA 1C5IA 5FYYA 2ZHLA 1BKZA 1AR71 5EFUA 5FYTA 1LB2A 2VAUA 3ME2A 3KV6A 4CXYA 2MEV1 1RHI3 1UAIA 5JCTA 1C8M2 1F5JA 4D3WA 1G9FA 2CY6A 1LECA 1NE6A 2LS6A 2VMGA 2WR9A 1S0CA 3FUOA 4UFHA 3INAA 1JXNA 5C9AB 2CAUA 4BA6A 2ZGNA 1GSLA 4XFAA 1PIV1 1QDOA 3DYOA 4HANA 1QXRA 5KC6A 4IEQA 1UY4A 2BU9A 4Y33A 3RZJA 1ENQA 2DCZA 4YYOA 5ABJC 1RUC2 1KEXA 2PHTA 3LCPA 3VBFB 4C0HA 2MPFA 4YGBA 4B29A 2XVGA 4QHBA 4BDVB 4QT6A 2XHKA 2V4VA 1UWWA 1VRBA 4Q27A 3MFAA 2BRTA 4HVQA 2CGOA 2PLV1 3T0BA 5ABJA 4RFT0 3WLUA 3MPPG 2YBPA 2Y6FA 5FBJA 2R16A 3KM5A 3EO6A 1JU4A 4ATFA 2FDGA 3CQOA 5E8AA 4BQ4A 1Z7S3 5EYYA 3THDA 3POEA 5FZ3A 2XJRA 1ASJ3 4EN6B 2VTXJ 1WKYA 2BWAA 5GZFA 5A3WA 1LESA 5FZAA 1I5ZA 4EE2A 1OFSA 2P2KA 2D44A 2VVEA 3KGLA 1ZBA3 4BIOA 3HN3A 4IV3B 3HD8B 4IDZA 1PVC3 4BQ3A 4KG0A 4XCAA 1A8MA 5GLZA 1BHGA 2JDKA 5FKBA 3WZ1A 1OOPC 3SITA 2WDBA 3J4UH 5T5LA 3LGRA 3E97A 2O1QA 1RHI1 3L2HA 4I09A 1REEA 1QOTA 1ZRDA 1AYM2 2CDOA 1GANA 2QZ2A 3I97A 1QQP2 3C7FA 5GLTA 1W9SA 4MV2A 2D93A 5JI7A 2QQNA 3DXUA 4XILA 4URAA 2LM3A 5FP9A 4FOQA 1DQ2A 1GP4A 4GMP0 2Y6JA 2YC0A 1RUI2 1VAMA 3OGJA 2NM1A 4TWTA 2GN7A 5FYZA 4UXAA 1W9TA 3J8F3 4YVWB 2CYFA 1TME2 3BCWA 4NWWA 4Y4RA 1RUF3 5FO8B 4PDWB 2ZTNA 4FQZA 4D7YA 1RXGA 5C3RA 2YY1A 3ASIA 4JRLA 4COWA 2FZ2A 3WDTA 4NPLA 4UW3A 3W5NA 2VY0A 5FY9A 4GD4A 1RUNA 2ZABA 1JOPA 1UYXA 1H8TB 1OFNA 3KVBA 3H8XA 1COV2 3A21A 5FMBA 1DGWX 3ES1A 2FDFA 2NYYA 5FYCA 3ZMNA 4D69A 1FOD2 5KC5A 5DQ0A 1H2KA 1S4CA 1ASJ1 4FVVA 1NE4A 2WT0A 3GBWA 4AEKA 4CXWA 4DNYA 4NMIA 2JDYA 3H9AA 3JB4C 2JX9A 4PHZA 2ZHKA 1X8MA 2W1UA 4HG6B 4NHXA 4L2NA 3S57A 4B1LA 1PVC1 3P6BA 2Q8DA 5LBBA 2WS93 3AZYA 3AKRA 4FPHA 4JHTA 3BN6A 5H9QA 2YFUA 4LNVA 4P5HA 1SHWB 3MUY1 5FXVA 3GM8A 1IPKA 4A42A 2AYHA 1SEFA 3SH3A 2MNGA 2YXSA 2XKPA 5LASA 3I2OA 1KJRA 2DYCA 3NV1A 2HBUA 4FXGB 3VZLA 4EV0A 5BY5A 1AR62 2JXAA 4WV8A 3WP3A 4AQ2A 1ZREA 1BBT3 4BZ4A 5J3UA 2ZEXA 5JXIA 1JZ3A 3SCHA 4Z2AA 3U75A 1BLZA 2WYFA 4QD2A 3NMBA 1VBD1 4SBVA 1M06G 4FFHA 3QH7A 2PHDA 3IMMA 1AR92 2WO7A 4XC9A 1QJU3 4A7ZA 3J8F1 1BXHA 1E5HA 3HT2A 4PIXA 2PAEA 4G9SB 1YFWA 2Y64A 1QHDA 1R083 1JODA 4JGYC 1LEMA 5FP3A 2YYOA 3DKQA 4L99A 3UKNA 1NCQA 1HQWA 2R7EB 3VBHC 2EIDA 3IWZA 1DQ4A 4ISQA 4KG8A 2VPVA 3NNLA 4AFBA 2WWUA 1V6KA 3LA7A 4IV1B 1H0BA 2JECA 2ET1A 4N7IA 5FLHA 1W8WA 4YPJA 1D2QA 2P3KA 4JGYA 3NJXA 4WM7C 2EIBA 2Y0OA 5A3LA 3VBHA 1Y7BA 3GJBA 3H50A 3V65A 5FR3A 2ERFA 4NROA 4CYDA 1DYOA 3ZXFA 2ZGTA 1VBA2 1NKGA 3BOPA 4WM7A 2AENA 4WM8C 3KS7A 1GLHA 1FXZA 1I9RA 1WMDA 2DFCA 5KXCA 2ETEA 2W1SA 5FXZA 3MIHA 1DLLA 4P00B 3ZIXA 4Q1PA 3IPVA 3ZFFB 1HB2A 3MLJA 4MGSA 2O8QA 5KHJA 4E8CA 3CBNA 4WM8A 2CTVA 4QB6A 5ANNA 4DINB 4RSUA 3JZVA 3TN92 1GBGA 1O8SA 1LKNA 1CPMA 2DTYA 1L7QA 1BBT1 3CMGA 1NUKA 3T08A 3LOBA 4H7MA 1XE7A 2FBEA 2WYSA 3RSJA 1XC6A 2ZGKA 2D7FA 2J1AA 2PELA 4XJZA 1YO8A 1ZM1A 1QJU1 1QGLA 2QJVA 1VBE2 1FAYA 1EV12 1W05A 3ZSJA 4LBOA 4FAGA 4HONA 4P9GA 4U36A 4HXCA 1A34A 3NWKA 2I74A 2CHHA 5GLUA 1T6GC 1UYZA 5IVVA 1IS4A 4AWDA 3OPWA 1NCRC 1GNYA 1LHNA 2XBO3 4EJRA 1N47A 1TE1B 1QJY2 1UMIA 3I8TA 3NW4A 4DRVA 3AVSA 3OGRA 1WD3A 2CL2A 2D6LX 2DVDA 4RGAA 5F3GA 2F17A 4JGZC 4P9XA 1O3TA 1UNBA 1C4RA 2YDEA 3HBKA 5I0UA 3ZLIA 4DXTA 2OPWA 2JDUA 3ZR5A 3NJVA 3E5UA 1OLMA 2LTNA 2OQ6A 1K42A 1KFUL 1NCQB 3CJIC 3D0SA 1XE0A 3RZKA 3IKWA 1YRZA 2WUHA 1L7LA 3OUHA 4JGZA 1JI6A 3AMQA 1I6XA 3VDDB 2GDFA 4JTOA 3QCWA 2QE3A 5H9SA 1W9FA 4B3NA 3H3LA 4JTNA 5IVCA 5B2GB 1GMMA 4UFLA 3S6PA 5GKAC 3ZDSA 1KXGA 1NZIA 3CJIA 3BUCA 2FD8A 1OHFA 3MIFA 3VBHB 3O1RA 5JWPA 2GC3A 2R49A 1ALYA 4NHMA 3DYPA 4A6SA 3KV9A 2PHRA 4DFSA 2VBPA 3UJOA 2IXCA 2PQQA 1X9TA 3BTXA 2Z69A 5ACA2 5FP8A 2WZR3 4H3WA 4CSWA 1SBFA 5LEJA 5E16A 5FYSA 2CV6A 3HWJA 4RFRB 1WLWA 4M3CA 1UZWA 2ZGUA 3IPVB 3POJA 3SKVA 1D0HA 1XB9A 1AR82 4LIVA 1XYNA 3POSA 4QPGA 3GCXA 5J48A 4NO4A 4UW5A 3ZOIA 2EIGA 3WF3A 3WDUA 3VB9A 4AZZA 1KDMA 4FI9A 1UN1A 3CZUA 3ILRA 1UIKA 3AM2A 3N7KA 4DY3A 2KA3A 3VZOA 1UX7A 3HJRA 4NVPA 5J37A 2BBAA 4I01A 1O7FA 2D3RA 3E6BA 4NIAA 1H6YA 2PLV2 1MVEA 4IGQA 4CCMA 5HCAA 5CISA 1BVP1 4PT6A 4W65A 3MIBA 1UMZA 3DN7A 1CQ9A 4Q4V3 3OG2A 1NQJA 1D2SA 2VULA 2NZ9A 2ZKLA 5T54A 1MS4A 4RHV3 2W3JA 4CP9B 5FO9B 3H1YA 3HBZA 4XDPA 3SMHA 4LHKA 5IVEA 4Q4X2 3I3DA 4G4FA 4LO7A 3RJ2X 1R1ZA 3IB3A 3ZKUA 5HI0A 2H0VA 3U0ZA 5DPNA 2Y6GA 2VZOA 3K2OA 4YZ3A 3T2TA 3KLSA 5IAXA 5DAWA 5FZGA 2CU5A 1D4M3 3LA2A 5C3SA 2H6BA 3LFIA 4LOSA 2NP0A 1S0GA 2Y0IA 1J84A 3LFMA 4Q0SA 2Y26A 5I0TA 1JYVA 3O1UA 2FDKA 3OUIA 1HB1A 2J22A 4WVVA 1W6PB 3TAYA 3VBOB 2XL7A 4Y1UA 3CL1A 2R073 2W94A 4S2DA 1JOJA 2WNUC 1YJKA 2WZR1 1GICA 3OBZA 4YW4A 4E4HA 5LWBA 4LBQA 3O7OA 1PMHX 3KZ4C 1GOGA 4FOWA 4CDUC 3MV11 1LGCA 5A1FA 2VMEA 3OTFA 2XMLA 4OQ9A 4AXOA 5JAXA 5KBFA 5LY1A 2IWGB 2KM2A 4K9SA 3I3EA 3WNPA 3DF0A 1AX2A 3RQ0A 2HWF3 2GC1A 2WAOA 3LPGA 1N1YA 2VOXA 2Z79A 2ZX4A 2ADEA 1VMFA 4JDNA 4CDUA 3AYEA 2VCCA 1YC61 2X8KA 1ZBE2 4ZS3A 5F39A 2A71A 2XPJA 3JD73 1OPMA 1XBFA 2QQKA 3B7MA 4MXWA 1OT5A 1HB4A 3BU0A 3WNKA 4QPGB 1FYUA 2EALA 3DPRA 3PTYA 3AMHA 4WVWA 3BTAA 4Q4V1 1NXMA 2WNVC 2C26A 2XVKA 3H0OA 4K7JA 1FI2A 2VCMA 4HETA 4BQXA 2PHUA 2YBKA 1W6NA 1SDDB 1Z7S2 4LHNA 1GFF2 4RHV1 3VDAA 4NN0A 3CZJA 1N3PA 1ASJ2 5K0UC 4GH4C 5JVVA 4AL9A 5FPAA 1HQLA 3BALA 1HX6A 2WNVA 4HKOA 1KGYA 1LENA 3UV9A 3WXPA 1ZBA2 2Z4FA 1MS3A 3LB9A 4P9YA 5LATA 4JV4A 5A3UA 2HWB3 4LBLA 5AC93 3OBAA 5IHRA 5E1RA 2F4PA 2PFWA 1D4M1 3T0AA 1H1IA 1FV2A 3VKLA 2L9LA 1OUXA 3GZUC 4LBNA 4OULA 4XBLA 2LROA 5JR7B 3W58A 4UF0A 1MR5A 3MW3A 5IK8A 4IE6A 3WHTA 2B39A 2R071 3G7DA 4ASLA 2A70A 1NA1A 1AXZA 2WLQA 4ONUA 1HN0A 4OHVA 2HWE2 3ZO0B 5F2WA 4OHWA 5GALA 2WSVA 2J1RA 4Z82A 2WZ8A 4XVHA 1G9AA 3IDAA 2YUEA 4YW1A 5A7OA 4QQHA 4NR1A 5DXDA 5FRAA 3B9CA 2ARBA 4E8DA 2HWF1 1DCSA 3P5BA 2YFZA 2Q1ZB 2VR4A 4QDRA 5C33A 3VHNA 3U4XA 1IKQA 5FUPA 4XIOA 2H6CA 3JD71 1RUF2 4XFGA 5I0SA 3PHMA 2VOTA 5CKQA 2JDPA 1IOAA 1NY71 1SBDA 4NHYA 3VKMA 5L7OA 5I93A 4CDXC 3RRDA 1IS5A 4YVSC 3W9AA 3ZXDA 3ZXGA 4K8RB 2RG4A 3X29B 3O1TA 2Z5WA 1GQHA 2HWC3 4YW5A 2V72A 3MF9A 1YFXA 2ARAA 4MXWB 2ZPXA 4Q29A 1NYWA 4MHRA 4OUSA 4XW3A 4CDXA 4YVSA 4A7KA 2QUOA 3KV4A 5A3TA 4LA3A 4X8PA 2XG3A 3DPRB 4UYBA 1DG6A 1SACA 3D0JA 3DL3A 3OD0A 4OFGA 1C1LA 4BQWA 2C9KA 2W68A 3LEMA 4H2AA 2HWB1 4UWDA 5AC91 3K3OA 5L19A 1CAVA 1RJ8A 1MS5A 1W6NB 2WS92 4C0BA 2RS32 4IEXA 2DURA 1Y3TA 2Q5TA 4IUGA 1KITA 4C8DA 1LOGA 3AKTA 2QDRA 3PNAA 3NV3A 3DKWA 2VQ0A 1HIXA 4HSJA 4OMDA 4RR3C 3PMSA 2Q8OA 3UKTA 1GNZA 4F8AA 5D8AC 3GHNA 3THCA 2BFUS 1RMU3 1TMF2 3GZEA 3SLIA 4ZU5A 3EBRA 2QKDA 4Z92B 2F6BA 1PO23 5G05L 4XDOA 1S2KA 4RR3A 3K51A 4RQPB 2P37A 1MQTB 4EWDA 4QX1A 1U5XA 5D8AA 2EICA 3R6SA 1MS1A 1WA4A 2WN2A 4KBZA 4DXRA 4QKBA 1WCQA 4XQDA 1RUG3 2ILMA 3WNMA 1NA1B 1JYXA 3VN4A 4YM3A 5FYBA 5FYIA 3KCCA 4JKKA 2BNOA 1MS8A 4B8EA 1OKOA 5CFCA 2JE8A 5T50A 3WSOA 3JB8A 4EQVA 3NAPC 4RD7A 4V2VA 1YQ8A 4E2SA 1R082 5KHGA 1O5UA 2VBBA 4AFAA 4WZCA 2BNMA 2AZ5A 1BQPA 4P9WA 4AQSA 5C5TA 4JX0A 1S0DA 1TZOA 3VD4A 1UCXA 2HWC1 4MSVA 2OUHA 2JDNA 3BPZA 3BPSA 3NAPA 3OBRA 3WHUA 1W2NA 2GH2A 3T30A 2DVGA 2J1VA 4HPKA 4QKDA 2JIGA 5LA9A 1SLAA 5L7OB 2EXIA 4L92A 3B94A 1FT9A 1V6IA 3PJYA 3ZXKA 3VBRB 3IDCB 4YLZA 3V64A 4MZUA 3HVDA 1Y4WA 1WBFA 2I07B 2TEPA 1V9U2 1XSRA 4Y5SA 4CDXB 3C2UA 1WZXA 1O91A 3ECQA 3PVOA 1YQ5A 1DP0A 4ZZ5A 3WF1A 4CEWC 4LBKA 3H1WA 2VW1A 1Q5OA 1APNA 2K46A 2VOWA 2X53S 1AL23 1RMU1 2G9FA 5A6YA 4LA2A 1OH3A 1NLSA 1JYIA 5IWFA 2WJSA 2ZACA 1VBC3 3LOIA 1PO21 1R64A 4IERA 3OGSA 2J7MA 4FP2A 4HFSA 3VV1A 1QH7A 1S0BA 4CEWA 1AYN3 4O9EA 4LJHA 4URTA 2HYKA 3D4KA 2JG8A 3L2YA 4OI2A 1IZ3A 2OZ6A 4NJ4A 1RUG1 2JG9B 3ATGA 1ND3C 5HPOA 4CDQB 3BODA 4ZS2A 5FZ4A 3HT1A 1W9YA 3O1VA 3WCRA 1UX6A 2HJIA 2RJLA 4AVBA 4CU7A 2W91A 3AJYA 3FZ3A 2AUYA 4PLMA 1IS6A 2WSUA 3GGLA 5J98B 1QWRA 1W2AX 1ND3A 1J59A 2XBO2 1WMXA 1H6XA 4OHZA 4HN1A 5LBCA 2XJTA 4Y20A 4PIYA 1G9DA 1HW5A 5CU1A 1DQ1A 1QJZA 4UI9L 3S30A 3WUDA 4BXFA 4CU6A 4PLNA 1FPN1 5GM0A 3V0BA 4IEPA 4GAZA 5T55A 1UOJA 2A7AA 5DZFA 1W8UA 1EAH2 1EUUA 1V00A 2XUMA 3I49A 4TYSA 5KXBA 2W08A 1C5HA 1ZX5A 3N3HA 3WR0A 3ZXEA 2ZCWA 1CPNA 3H8RA 2BW8A 3LIHA 3BKZA 2JICA 5C6CA 1WLDA 4PJYA 5L36A 1UPSA 2WLPA 4HPKB 4Q0QA 5EPAA 3TEYA 3BTZA 2RM23 3ROUA 2EIEA 4FPCA 4AI3A 4XJWA 3FC0A 1AL21 3KV5A 3WDYA 4W50A 1YFYA 2E63A 1AUYA 2BJSA 2H0BA 1DIWA 1ZYBA 1YIFA 2EXHA 1VBC1 3N35A 4M3CE 4LBQD 1R1A3 3S0MA 1LOEA 1RIRA 1H2MA 2VCAA 4JAAA 1UW8A 1B35C 2EA7A 3O0XA 4ZU4A 5HCBA 4M00A 5F5IA 5A33B 4JZRA 2PA7A 4LKDA 2TNFA 1WMFA 4P9LA 3I2KA 5F7UA 1OXCA 2ZAHA 2XJVA 2ZBJA 3OEAA 4MH0E 3WP4A 4CEWB 3ZYBA 1LTEA 1VLNA 3H3UA 3MLKA 4QKNA 2QNKA 2JG8B 5HCHA 3S5QA 1ULFA 3HQRA 2GMPA 2W95A 4D94A 2WFF3 1CWPA 4CTEA 2G19A 4BE3A 5L9RA 1SFYA 2ARCA 2WNEA 1D7PM 4FPGA 4AG4A 1W6OA 5JI9A 2XL9A 5JXJA 3RZLA 3M70A 4Y1ZA 2YC2A 3F95A 1GZCA 5FMOL 3ENRA 4OQ8A 2VG9A 2TBVA 3HMYA 2JD4A 1UXXX 2Y34A 1UMHA 4KU7A 2OPKA 4RHV2 5F3IA 3ZPYA 2D6KA 1PX3A 4XFHA 4AEDC 4Y20B 3VHOA 4CDWC 4XETA 4XACA 4AFCA 3CJXA 2A3YA 2RM21 3V0BB 2EAKA 2R32A 4MGIE 3JCIA 2XWJB 3KWVA 1SMVA 1S0FA 4GKXA 4N7UA 4ZKTB 5JMCA 1D4M2 4AEDA 4CDWA 1H2LA 1MEC3 5FPXA 3FUQA 2Q4SA 3WCSA 4M4RA 1PM4A 4MUVA 2YG0A 2A6VA 4JHZA 1TQ5A 4KBBA 4ASKA 1XOYA 4NIGA 5FZOB 1R1A1 4PCRA 3O1PA 2FDJA 3RPQA 1OA3A 2WO1A 1BEV3 3ZYIB 3ZYRA 1XPWA 3WG1A 2NQYA 1OSGA 2LRPA 4YRDA 4BQYA 3JBG3 3VDCA 4YZ5A 1UZYA 5J96B 1NX9A 2D40A 3MIGA 4TTGA 3UETA 4NPMA 1W8FA 2RJKA 4JCKA 3KMHA 1HQNA 1BYHA 2W1QA 3UJQA 1OF3A 4E2QA 3AP6A 2JDHA 4LULA 3ACLA 2WFF1 4QXBA 1LHVA 3AK0A 5LEKA 1NY72 5DZGA 3RG0A 2IC1A 3N7LA 5IJRA 3ST7A 4QX0A 5JOYA 5GZDA 2A73B 4HVOA 1YQ6A 4O61A 1IQDC 3Q8BA 2JKXA 3K3NA 4YG0A 1QMJA 2Y60A 4Q2FA 3WX5A 1W6MA 4F83A 1EPZA 2IVIB 3GCWA 1H1MA 4MXVA 1W0OA 2YGMA 4Q4W3 4WZFA 3EXUA 1PGL2 3BB6A 3ZFEC 1W6OB 4QQLA 1VRH3 3TEXA 1XNBA 2NPIA 2QDNA 3T1LA 4QPIC 1Q8PA 2XKOA 1XNDA 3H7JA 4BM8A 4COZA 5AC92 3BGAA 3K4ZA 1MEC1 2ARXA 4MHUA 1NG0A 3ZFEA 3JUUA 4NIHA 2RS51 3J7HA 5B4NA 3GJAA 1B09A 2WC2A 4R9DA 2E7AA 4QHOA 4QPIA 4I3PA 4NAOA 2ZHNA 2OVUA 5IW0A 1BEV1 1GWKA 1RGSA 4OLLA 4CUGA 1JMUB 1OOPA 3N9PA 1S2EA 4ARXA 2D5HA 2Y38A 3JBG1 3PVEA 3I2FA 5C4WC 3NKGA 5CA6A 1QJX3 3VZJA 3HNYM 3WNOA 3ZM8A 1VBD3 1CN1A 1HLCA 3JQXA 4LE3A 2RDQA 1WD4A 2K9ZA 1WMEA 5C4WA 4KGGA 4Y1XA 2JB8A 2XJQA 5A7QA 2B5HA 3PU8A 3HEIA 5JUVA 2W87A 4FPYA 4C90A 3SXWA 2YPDA 2N7GA 1KQRA 5KHIA 4FT8A 4COYA 1XU1A 2WT1A 2W52A 2BVVA 3FHAA 3OPTA 2ZX0A 2VL4A 2WNOA 2Z2SB 3N36A 3MV01 3VKFC 1J3RA 3RZMA 2YV8A 1K3IA 4XYXA 2Z42A 4QPWA 4GJYA 4D6QA 2E53A 3VL8A 4W4ZA 1VE0A 4Q4W1 1MZ5A 5IUQA 3ZFGC 4FCAA 2ZXQA 2P34A 3U1XA 5ABJB 5BUVA 2JKBA 1VRH1 1FMD3 1UZZA 4YFWA 4E27A 5FOJB 4MADA 1W2TA 1JU3A 2PHLA 2XLAA 3WY6A 1HRI2 3ACFA 1O8PA 5CVRA 4LKFA 1OQEA 3NVCA 3SISA 3ZFGA 4D7SA 1ND2C 4HKLA 2BGPA 1F9KA 5KHHA 2Y6LA 5APAA 2SLIA 3O0VA 2E32A 2JDZA 2WA3A 4IGOA 4XFIA 2QBXA 2RR12 5FWJA 3GDBA 4OI4A 5FOBB 4AHZA 1ULOA 1US3A 4FFIA 2KR2A 1GQGA 2QQMA 5EIYB 2IXIA 2B4KA 1ODNA 1R091 1PGW1 3RVHA 3SCFA 1ZZ8A 1QOSA 4XMIA 1OF4A 1QJX1 5C70A 4RYDA 1POV3 1PO11 4NWVA 1Q43A 1QJFA 3Q8FA 3USUA 3TB0A 3AX4A 3A23A 5T52A 2ZMKA 4HKWA 5DDJ2 4WVZA 1J3PA 3BOWA 1N3QA 1REDA 2VE1A 3WD5A 1OOPB 2XQRA 4P9JA 3RS6A 1WGPA 2BQPA 1UZVA 1W6QA 1CZTA 3JXSA 4P14A 3M2MA 4Q4Y3 1HXS2 2R0HA 4YZ1A 5FBZA 4CCOA 5FPBA 1CIWA 4GB33 1U12A 2G1MA 1CAUA 3O1SA 4B4QA 5FZMA 1DQ6A 2GNMA 1XYOA 2A6WA 2OZJA 5FZ8A 4NIDA 3K4DA 3AL5A 4MVTA 1LGBA 1RUJ1 4AGVA 4XUQA 1FMD1 3MW2A 2ORZA 2XDVA 1BCXA 2D3PA 2HEVF 2V5DA 1SBEA 3CF6E 3EYPA 2DCTA 4YW6A 5FZ0A 2GSYA 4JVAA 4XCBA 1OA2A 2PHXA 1WW5A 3T2PA 1LOFC 5A1LA 3WV6A 5FYVA 1E5RA 3MBWA 1ZRCA 2R063 2XB6C 5B4XA 5IVJA 1ST8A 1XNKA 2Q30A 4QU2A 4XABA 3AMPA 5DAXA 5K4LA 3LDKA 4PBOA 1A3KA 1C57A 1A8DA 2UWBA 4I3GA 3FBYA 3SCGA 4ATEA 1LOFA 1UU5A 1SQ4A 4YZ4A 1VBC2 2UWCA 3AP9A 4QX3A 3LEIA 2PAKA 2VGDA 2R043 1XJAA 2YZ4A 1MVQA 5IVYA 5FFOC 1AYN2 2VZUA 1POV1 3OGVA 4XF9A 3NNFA 4IEWA 3Q8CA 3U11A 3B3QE 3VBSC 3K4AA 1SDWA 3EQEA 3DV8A 5A6ZA 2G9GA 5GLVA 4I30A 1F4AA 4BCUA 4B1MA 1JS9A 5FZIA 5JIUA 1YXWA 2CNAA 5BXXA 4XFFA 1FNYA 2ZX3A 1AVBA 1JZ8A 2R6QA 3OY8A 5CKNA 4YARA 4JRAA 3H1MA 1LEDA 5I8SA 4CP1A 4Q4Y1 4ARYA 2W92A 2Y8KA 3D82A 3RMYA 3ZPOA 4BH9A 3LEGA 1G86A 4GB31 5C3OA 4OUMA 1W8OA 2BUKA 4LEJA 1RUE3 1JW6A 4AYUA 4QXHA 1NCRA 1LHWA 2DVFA 3S5AA 1W6QB 3THPA 3POFA 2ADDA 4AGGA 5JPMB 4IL7A 4FQ4A 3DECA 3FN9A 3DYMA 1VBB1 1HV0A 4RS5C 2W39A 4UOJA 3ZN6B 4B7KA 1W8ZA 2BWCA 4XQWA 5LCWL 4M3CF 4JGYB 5A3MA 4MOAA 4L0PA 4NUBA 2R061 3C3VA 3OJBA 5FZHA 1AJOA 3KHCA 2GC0A 4RS5A 5CFDC 4EN8B 4KWKA 2DU0A 3K75B 1AR72 4BLIA 3CKHA 3U4SA 4E9KA 4WM7B 3GNEA 2PQSA 4OZOA 5GLWA 4CU8A 4EWEA 1VR3A 2KXLA 2R041 5IATA 2MEV2 3PL0A 1J1LA 4AAPA 1MS0A 3TEWA 1AXKA 4AFDA 5CFDA 4CU9A 2IVJA 4HK8A 5C8CC 2I2SA 3RDIA 2X5IC 1XE8A 4C91A 4QQOA 4AE2A 1P8JA 1WBLA 4HL0A 4WM8B 3MDPA 5DAQA 5CG8A 1PIV2 2VC9A 3ZVXA 4Q5OA 1IQAA 2VZRA 5DUXA 4J25A 5BNPC 2VNRA 2D5FA 2ZEWA 1W3XA 1Z0HA 3URFA 1S0IA 2A3WA 5J7MA 2X5IA 5D2AA 5LRRA 2FMDA 3HQUA 2WFF2 2P5BA 2QCSB 1XNCA 1UO9A 2C9AA 3N7MA 4Q26A 4QMAA 1YI7A 1EP0A 2W1WA 3IDEA 4QQPA 4ZY9A 1ENXA 4AF9A 4MLOA 2DFBA 3CEWA 5BNPA 1RUE1 2AGSA 1RTVA 1F35A 1A6CA 4AFMA 3WG4A 2VZVA 3J7NA 5CIRA 4Q8KA 3OY8B 1ZZBA 3Q8AA 5LY2A 4Q0VA 2ZX2A 4Z8BA 1QXPA 3AXDA 4QQ2A 3GF6A 4XMAA 4XAAA 4CEYC 2ZMLA 1QDCA 3VLBB 3O14A 3O0WA 5K7PA 2RS13 1K5MC 5AVPA 4CRQA 3FLRA 3B9IA 3ZX7A 1RUH3 1IS3A 1MPXA 1NCRB 1Q8OA 5M0TA 4M4PA 5FY1A 3ZYPA 2W5FA 4YGDA 3S7IA 1GOFA 4CEYA 4UT5A 4JGZB 4N53C 2QQJA 3GXUA 2XQXA 2RJ2A 3SH5A 4Z2WA 1WLTA 1OBNA 1DFQA 4K20A 4K1ZA 1XYPA 5F37A 1J58A 1RHI2 1OVSA 1RUD3 1JN2P 3MEPA 4D8MA 1I3HA 2UU8A 2VMIA 3CJIB 5LA0A 3IZOA 4N53A 2GNDA 4DRRA 3DGTA 3LPFA 4ORFA 1PM7A 2NN8A 4JC1A 4YM2A 1RITA 3H3ZA 2RMU3 4JKMA 5L9VA 2WNUA 4BMBA 5FP4A 1X82A 2OA2A 4GWIA 4MO3M 2C0ZA 3N7JA 1S0EA 5JOWA 4A44A 3ZYHA 1HN1A 4M3CB 5FZCA 5A7WA 4AHWA 2WZEA 3KHBA 5FP7A 1MACA 3I59A 1LOAA 4I0AA 1AF9A 3FFZA 4EWAA 1Q8QA 1JH5A 1W04A 4I0BA 4LR4A 5G04L 4X6RB 1HKDA 1T6BX 2AC1A 2Y33A 4AHYA 2ENRA 2VMDA 3PIGA 3SEEA 1JZ2A 5C3QA 1V70A 3DCQA 5DAPA 1GZWA 4IEYA 2ZKNA 5D1IA 1HV1A 5KR7A 2BVBA 1RUC3 1SLTA 2DVBA 2RS11 1GYKA 5JOXA 4GZ9A 2K0GA 1FV3A 1GUIA 2JDAA 5C7GA 1RUH1 4D6RA 1UF2C 2P6CA 3I3MA 4AI2A 2GN3A 1PVC2 5AFEA 1CX1A 5JOZA 1U0AA 5CNAA 1JZ7A 2CSGA 5K0UA 4GH4A 4FSJA 3I54A 4I02A 5BYNA 3VZMA 1UIJA 3WQBA 5IK5A 1WCKA 5FYMA 4KMQA 1CZSA 3IBMA 3N9LA 4FPLA 4P5YA 3OYWA 1RUD1 4D6SA 3T09A 3C8XA 2WKKA 3HR9A 4RGGA 1W0PA 5I0RA 1ZA7A 2ZGPA 1ZA4A 2YGLA 1AX1A 4IEVA 1U5IA 4YW2A 5DAVA 5FO7B 2HEWF 4R52A 2EF6A 2RMU1 4XUTA 1YQ2A 1VBD2 5F32A 2VOKA 4FXKB 4FTEA 3LWCA 3MYXA 5FZ9A 1QH6A 2WWJA 3KCXA 4LBQB 3J8F2 4HT1T 4N53B 5EQUA 1LU1A 1NXD1 4GWNA 4CPBA 1UKGA 4Y26A 1C8M1 2VD7A 4FPEA 3FWEA 1AYM3 1U5YA 2GP3A 1OUSA 4NRQA 2WNUB 3D3AA 3BYWA 1QQP3 1PK6C 2P1BA 1D4VB 3M7AA 4I2OA 4QGNA 3MGUA 1VB2A 3BIEA 3WF2A 4CDUB 4NRMA 1K45A 3ACHA 3CU7A 4IQPA 4LE4A 2AREA 2W9XA 4MGQA 3ZN4A 1RUI3 4IEOA 3VD7A 4UAPA 4A3XA 1RUC1 4OI0A 1RC6A 2NMOA 4AEMA 4AK3A 1JHNA 1PK6A 4HZFA 4B4RA 4AI0A 2XJUA 1JZ5A 3I3QA 1VB4A 4QX8A 1CR7A 3OSDA 4GALA 4N43C 3THTA 2FMYA 4RL7A 4CZSA 3B93A 4LK6A 4MX3A 4CUCA 1GZWB 1NQDA 3VD9A 1AHSA 2WBKA 5FMDA 3VD5A 3ZSMA 4AI1A 1PGSA 4Y4YA 1YI9A 2BGCA 5FUNA 5FZEA 2WNVB 3VHRA 2VZTA 1FOD3 4N43A 3R4UA 3R05A 5KHKA 1QU0A 4IETA 2JDMA 4GH4B 1CIYA 5K0UB 1BBT2 1O4ZA 2VUJA 3V56A 3ZN6A 4R4XA 4EYUA 5F1RA 1W03A 1S1AA 4Y1YA 4QX7A 3WP5A 4UF0B 4QPYA 5A3NA 1G9BA 1STMA 3JQWA 2A75A 5FZDA 4P02B 5FYUA 4R9CA 1OLRA 1QJU2 4EN7B 2G4IA 4P08A 1VJ2A 2VUDA 2V73A 4HOOA 1OA4A 3ABZA 3RWNA 3M1HA 3BVCA 1AYM1 3M3EA 1ONAA 3KT4A 3D6EA 5F3EA 4ES8A 3S7EA 1S55A 4W8JA 1SLCA 1AR63 2WAAA 1QQP1 2XOMA 1MS9A 2X09A 2ZHMA 2R1BA 4EROA 4R8HA 5CKMA 5EJZB 3ZR6A 2VZ1A 3PIJA 1W9WA 2WT2A 3GHMA 5A32A 4XFBA 1RB8G 1RUI1 2VMHA 2ZGRA 3AFGA 4LTAA 1LR5A 1AR93 1FPN3 3O5SA 3PJQA 1RJ7A 1C8NA 1UOGA 3RFRA 5ERLA 2YBSA 3KCYA 3PUIA 3RYPA 3PLQA 4QGLA 4KL1A 2V09A 2JE9A 2HLEA 4GULA 5SV8A 2O14A 4FPFA 5F6LB 4YVSB 2D6OX 4XF3A 1EUTA 4R9AA 3W59A 2DCYA 2ZEYA 1REFA 4MGZE 1FOD1 2ZJCA 4BLJA 4XFCA 3FBMA 3VHPA 5FMOS 3TNPB 1LODA 2Q1FA 4NOTA 5JXHA 1CAVB 5FKCA 2B9UA 3IT8A 3A0KA 4AW7A 4PQ9A 4CUBA 4DEQA 2R042 1DDLA 2UY8A 4PF5A 3U78A 1YQCA 2GNBA 5FPVA 2D3SA 4G3YC 1SLLA 5FTTC 4CCEA 1W90A 2XR4A 5BNOC 1VBA3 2WRAA 5JDBA 4N43B 3ZYFA 3E5XA 3NNGA 2BOIA 2QQLA 1M4WA 3LSEA 3E1F1 2W47A 3PTRB 4RR3B 1Q8VA 2JWPA 4KQ7A 4ASMB 4DUVA 5BNOA 5D8AB 1G6NA 2DBNA 2DV9A 3AYAA 1X8EA 2G9ZA 1AR61 4XUNA 4JQTA 1BK0A 4QGMA 5T3NA 1OQDA 2A6ZA 1BJQA 3OD4A 1GV9A 5T5OA 3W20A 3UKVA 5CFCB 5JZGC 2IXHA 3WOGA 5EJ1B 3KT1A 1PZ8A 2QQIA 2WABA 1AR91 3UESA 3VKOA 1Q56A 5JLVA 1VBE3 2TUNA 1EV13 5JMOA 4AGRA 1KJLA 4ZZ8A 3ZIWA 5FLJA 3WT3A 3E6CC 4LORA 2YROA 5T5PA 4FAHA 5JZGA 3NAPB 3T0DA 4LKSA 4HVRA 5IK7A 4DOUA 1YWKA 4GWJA 1A78A 3ACGA 1CAWA 4LHSA 1QJY3 1RINA 1JYNA 5A80A 3LDRA 4LHLA 5CADA 4BOWA 5KXDA 3MF6A 2BYVE 2HEYF 2VQTA 4A41A 5TSWA 1SPPA 1GZ9A 3RGBA 3PUQA 2BPA2 3I2GA 4FTSA 1QIQA 3APBA 1UD1A 4CCDA 2OQ7A 5E89A 2FZ1A 4FO9A 1OPOA 2WZR2 4OHXA 4ISRA 4HBNA 4BIFA 5C9AC 3AZWA 1VBA1 3AB0A 3WNNA 3UGFA 2A6XA 4HK9A 5I8TA 2DWRA 4DB5A 3OGGA 2CGNA 4J1WA 3N9OA 4L97A 4QU1A 2V5YA 2CWSA 3AXEA 1LCLA 4LBJA 3M3CA 3VBFC 5C9AA 1B35A 1UY2A 4I0WB 1OQ1A 3LDBA 4UFIA 4M01A 1DQ0A 5F9TA 1UXZA 2VXRA 1DU3D 1W3VA 4Q0UA 1OVPA 4UW6A 2RV9A 3K77A 3KSCA 1RUOA 5ACA3 1DQ5A 4OCTA 2VMFA 3W5MA 3VBFA 1LRHA 1V6LA 4BPZA 1E5IA 2OIIA 3RJRA 4Q4V2 3BIWE 1AR83 2GP5A 3ILNA 3WW1A 4GWMA 1VBE1 1EV11 1ND3B 3IN9A 1JHJA 1VMJA 3OPZA 4ZONA 5ANQA 4AI8A 3ON7A 3ETQA 1Z78A 2AEZA 1BMV1 1UU6A 2C1FA 3RZZA 3AP4A 3WNLA 5C8WA 2YU2A 2D6PA 2XJSA 4IV3C 3RI8A 4UFMA 4N8MA 1QJY1 4QWNA 3J26N 5I0DA 1W39A 3PVBB
chains in the Genus database with same CATH topology
2W3JA 1XNAA 2E26A 3I3DA 3IB3A 5DPNA 2Y6GA 1CZTA 2VZOA 1UYYA 1UZ0A 3JXSA 2YB7A 3WF4A 3T2QA 1J84A 1JYVA 4BXSV 2J22A 4KI5M 2W94A 3OEBA 3K4DA 2ORXA 1US2A 4QX2A 5C71A 4XUQA 1PMHX 2ORZA 1GOGA 4QAWA 3MV11 1LNSA 2VMEA 2V5DA 1W8NA 3EYPA 1OD3A 3OB8A 1W0NA 3T2PA 3I3EA 3WNPA 4AAXA 3MBWA 1DLCA 2WAOA 3LPGA 5B4XA 1PMJX 2VCCA 2XHNA 2YC4A 4CVUA 3VDBA 3ETPA 2QQKA 2VCBA 4XURA 1OT5A 3WNKA 4QX3A 5C70A 3LEIA 3MO4A 5A1AA 2VQUA 2VZUA 3OGVA 4XUPA 2C26A 1SG3A 3K4AA 1SDDB 3VDAA 1JYWA 2HYXA 1F4AA 2KD7A 3CZJA 1JZ8A 2J1UA 3I2JA 1KGYA 2Z4FA 3NQHA 3FHQA 2W92A 2Y8KA 4ARYA 5IHRA 3OBAA 2J1EA 4KWUA 3T0AA 3LEGA 2L9LA 5JXGA 1W8OA 4LPLA 4A4AA 2CDPA 2VTFA 2C4XA 3DECA 3FN9A 3DYMA 2VMCA 1ULPA 2J1RA 2WZ8A 4XVHA 4ET7A 4UOJA 2VZPA 3IDAA 4QDSA 5LCWL 3A7QA 5IFTA 4MOAA 4E8DA 4L0PA 2QQOA 2YFZA 4QDRA 2VR4A 3C7GA 1W99A 3LQCA 5IFPA 2VOTA 3K75B 2WQ8A 3CKHA 2VZQA 4CU8A 2PQSA 4OZOA 3T2OA 2LW8A 3IIIA 4CU9A 1NAEA 2V72A 5FUIA 3WEZA 1P8JA 1JZ4A 2VC9A 2VZRA 2Y6KA 4QB1A 1T2XA 2ZEWA 2C9KA 4CUAA 2J1SA 4ZY9A 4DEVA 2W1WA 2BZDA 4IUGA 4JKLA 2BERA 3HNBM 4OMDA 2VZVA 3THCA 1UY3A 4TXWA 3CDZB 3HOBA 5G05L 3C7HA 4XZUG 3SEPA 3U37A 4QX1A 2EICA 5LA2A 2WN2A 4DUWA 4DXRA 1MPXA 1WCQA 3CIHA 4M4PA 1UY1A 3WNMA 3WF0A 2W5FA 1JYXA 2X05A 4JKKA 1GOFA 2QQJA 3GXUA 2XQXA 2RJ2A 2JE8A 3WSOA 3A22A 2XONA 5LA0A 4D8MA 4D0QA 2X10A 4JX0A 3VD4A 3LPFA 2ID4A 3HPNA 2J1VA 4JKMA 4GWIA 2LS6A 4MO3M 4BK4A 4A44A 1HN1A 2WZEA 3DYOA 1UY4A 4ZZ5A 3ECQA 1DP0A 3WF1A 1KEXA 5G04L 4BDVB 4OMCA 2VMDA 2V4VA 3SEEA 1UWWA 1JZ2A 5CZKA 1R64A 3T0BA 3OGSA 2J7MA 1RYYA 4GZ9A 1JU4A 1GUIA 2B9VA 2JDAA 5C7GA 1GQPA 3AC0A 3VD3A 3CQOA 5HPOA 3THDA 1CX1A 1JZ7A 1WKYA 4CU7A 3NRUA 2W91A 3WQBA 3HN3A 4KMQA 1CZSA 3GGLA 4P5YA 3P1IA 3F2ZA 4PQQA 3T09A 3C8XA 2VO5A 4PF1A 2DCJA 3ACIA 1H6XA 1BHGA 2WDBA 4UI9L 4CU6A 4XUTA 1PX4A 1YQ2A 3K46A 2CDOA 3I97A 1EUUA 4ZXEA 3C7FA 1W9SA 1XNTA 3I2HA 2QQNA 2VZ3A 3IAPA 2Y6JA 4A45A 3D3AA 2EIEA 4LQRA 1W9TA 3WF2A 4W50A 1K45A 3ACHA 2W9XA 4MGQA 3VD7A 4UAPA 3W5NA 4DUXA 3HNMA 1TVGA 1UYXA 2VCAA 1JZ5A 3A21A 5DQ0A 3I2KA 4CUCA 5F7UA 4A6OA 3VD9A 5IYYA 3OEAA 2WBKA 3VD5A 5DMYA 4XUOA 2W1UA 4HG6B 2VZTA 3P6BA 3PUHA 2W95A 2WO2A 5DN2A 1D7PM 3BN6A 2YFUA 4AG4A 1CIYA 1TG7A 5JXJA 1SHWB 3MUY1 3GM8A 4A42A 1J83A 2YC2A 3I3BA 4P02B 2DDUA 1UXXX 1UMHA 1PX3A 4P08A 2ZEXA 5JXIA 1JZ3A 4Z2AA 5JR2A 3ABZA 4W8JA 2WAAA 2XOMA 1OH4A 2X09A 5EJZB 2VZ1A 2Y64A 4M4RA 1W9WA 2YG0A 4JHZA 4DXSA 2JD9A 2R7EB 2EIDA 3PUIA 2WO1A 3MUZ1 1XPWA 4YPJA 5LA1A 2HLEA 3VDCA 3FL7A 3NJXA 1NX9A 4TTGA 1GU3A 3UETA 2EIBA 1EUTA 2W1QA 1OF3A 2ZEYA 1DYOA 1NKGA 2VM9A 5JXHA 2VJXA 5IJRA 4CUBA 2W1SA 4DEQA 4QX0A 1JZ6A 4P00B 1IQDC 5CYYA 2JKXA 1O59A 4MGSA 3LE0A 4BJ0A 4E8CA 4QB6A 1O8SA 2W46A 3NNGA 1L7QA 2QQLA 3CMGA 1NUKA 3E1F1 3T08A 2VZSA 4QDQA 2W47A 4DUVA 2WYSA 1XC6A 5HXMA 3LEKA 4RN5A 2J1AA 3C7EA 4XUNA 3BGAA 3K4ZA 3J7HA 5B4NA 1UYZA 2E33A 5EJ1B 2QQIA 2WABA 3UESA 3UNPA 1GNYA 4A3ZA 2RVAA 1F4HA 1UMIA 5JMOA 1CZVA 3OGRA 4ZZ8A 4ARXA 3EB7A 2BGOA 3I2FA 3T0DA 4LKSA 3WNOA 3HNYM 4DXTA 4GWJA 3ZM8A 3ACGA 3NJVA 4LHSA 1K42A 1JYNA 2WUHA 1JI6A 2WN3A 5J1XA 2VQTA 4A41A 2OKXA 1UY0A 3HEIA 5JUVA 2W87A 1GMMA 3I2GA 4QB2A 3FHAA 2VL4A 3MV01 2Y6HA 3WNNA 3DYPA 1K3IA 4QPWA 2DCKA 4W4ZA 2ZXQA 1UY2A 2E31A 3SKVA 4MADA 1UXZA 3SKJE 1JU3A 2J1TA 2RV9A 1O8PA 3ACFA 3K77A 2ZEZA 2VMFA 3WF3A 3W5MA 2BGPA 4FI9A 3CZUA 2Y6LA 3C7OA 1GOHA 2E32A 1L7RA 2QBXA 3GDBA 1UX7A 4OUEA 3HJRA 1K12A 1ULOA 1US3A 2BBAA 5EIYB 1JHJA 2QQMA 4BK5A 1H6YA 1I5PA 2WO3A 2B4KA 3IAQA 4PT6A 1OF4A 3WNLA 3I2IA 4RYDA 3OG2A 3A23A 4OYUA 5I0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3J A;  1XNA A;  2E26 A;  3I3D A;  3IB3 A;  5DPN A;  2Y6G A;  1CZT A;  2VZO A;  1UYY A;  1UZ0 A;  3JXS A;  2YB7 A;  3WF4 A;  3T2Q A;  1J84 A;  1JYV A;  4BXS V;  2J22 A;  4KI5 M;  2W94 A;  3OEB A;  3K4D A;  2ORX A;  1US2 A;  4QX2 A;  5C71 A;  4XUQ A;  1PMH X;  2ORZ A;  1GOG A;  4QAW A;  3MV1 1;  1LNS A;  2VME A;  2V5D A;  1W8N A;  3EYP A;  1OD3 A;  3OB8 A;  1W0N A;  3T2P A;  3I3E A;  3WNP A;  4AAX A;  3MBW A;  1DLC A;  2WAO A;  3LPG A;  5B4X A;  1PMJ X;  2VCC A;  2XHN A;  2YC4 A;  4CVU A;  3VDB A;  3ETP A;  2QQK A;  2VCB A;  4XUR A;  1OT5 A;  3WNK A;  4QX3 A;  5C70 A;  3LEI A;  3MO4 A;  5A1A A;  2VQU A;  2VZU A;  3OGV A;  4XUP A;  2C26 A;  1SG3 A;  3K4A A;  1SDD B;  3VDA A;  1JYW A;  2HYX A;  1F4A A;  2KD7 A;  3CZJ A;  1JZ8 A;  2J1U A;  3I2J A;  1KGY A;  2Z4F A;  3NQH A;  3FHQ A;  2W92 A;  2Y8K A;  4ARY A;  5IHR A;  3OBA A;  2J1E A;  4KWU A;  3T0A A;  3LEG A;  2L9L A;  5JXG A;  1W8O A;  4LPL A;  4A4A A;  2CDP A;  2VTF A;  2C4X A;  3DEC A;  3FN9 A;  3DYM A;  2VMC A;  1ULP A;  2J1R A;  2WZ8 A;  4XVH A;  4ET7 A;  4UOJ A;  2VZP A;  3IDA A;  4QDS A;  5LCW L;  3A7Q A;  5IFT A;  4MOA A;  4E8D A;  4L0P A;  2QQO A;  2YFZ A;  4QDR A;  2VR4 A;  3C7G A;  1W99 A;  3LQC A;  5IFP A;  2VOT A;  3K75 B;  2WQ8 A;  3CKH A;  2VZQ A;  4CU8 A;  2PQS A;  4OZO A;  3T2O A;  2LW8 A;  3III A;  4CU9 A;  1NAE A;  2V72 A;  5FUI A;  3WEZ A;  1P8J A;  1JZ4 A;  2VC9 A;  2VZR A;  2Y6K A;  4QB1 A;  1T2X A;  2ZEW A;  2C9K A;  4CUA A;  2J1S A;  4ZY9 A;  4DEV A;  2W1W A;  2BZD A;  4IUG A;  4JKL A;  2BER A;  3HNB M;  4OMD A;  2VZV A;  3THC A;  1UY3 A;  4TXW A;  3CDZ B;  3HOB A;  5G05 L;  3C7H A;  4XZU G;  3SEP A;  3U37 A;  4QX1 A;  2EIC A;  5LA2 A;  2WN2 A;  4DUW A;  4DXR A;  1MPX A;  1WCQ A;  3CIH A;  4M4P A;  1UY1 A;  3WNM A;  3WF0 A;  2W5F A;  1JYX A;  2X05 A;  4JKK A;  1GOF A;  2QQJ A;  3GXU A;  2XQX A;  2RJ2 A;  2JE8 A;  3WSO A;  3A22 A;  2XON A;  5LA0 A;  4D8M A;  4D0Q A;  2X10 A;  4JX0 A;  3VD4 A;  3LPF A;  2ID4 A;  3HPN A;  2J1V A;  4JKM A;  4GWI A;  2LS6 A;  4MO3 M;  4BK4 A;  4A44 A;  1HN1 A;  2WZE A;  3DYO A;  1UY4 A;  4ZZ5 A;  3ECQ A;  1DP0 A;  3WF1 A;  1KEX A;  5G04 L;  4BDV B;  4OMC A;  2VMD A;  2V4V A;  3SEE A;  1UWW A;  1JZ2 A;  5CZK A;  1R64 A;  3T0B A;  3OGS A;  2J7M A;  1RYY A;  4GZ9 A;  1JU4 A;  1GUI A;  2B9V A;  2JDA A;  5C7G A;  1GQP A;  3AC0 A;  3VD3 A;  3CQO A;  5HPO A;  3THD A;  1CX1 A;  1JZ7 A;  1WKY A;  4CU7 A;  3NRU A;  2W91 A;  3WQB A;  3HN3 A;  4KMQ A;  1CZS A;  3GGL A;  4P5Y A;  3P1I A;  3F2Z A;  4PQQ A;  3T09 A;  3C8X A;  2VO5 A;  4PF1 A;  2DCJ A;  3ACI A;  1H6X A;  1BHG A;  2WDB A;  4UI9 L;  4CU6 A;  4XUT A;  1PX4 A;  1YQ2 A;  3K46 A;  2CDO A;  3I97 A;  1EUU A;  4ZXE A;  3C7F A;  1W9S A;  1XNT A;  3I2H A;  2QQN A;  2VZ3 A;  3IAP A;  2Y6J A;  4A45 A;  3D3A A;  2EIE A;  4LQR A;  1W9T A;  3WF2 A;  4W50 A;  1K45 A;  3ACH A;  2W9X A;  4MGQ A;  3VD7 A;  4UAP A;  3W5N A;  4DUX A;  3HNM A;  1TVG A;  1UYX A;  2VCA A;  1JZ5 A;  3A21 A;  5DQ0 A;  3I2K A;  4CUC A;  5F7U A;  4A6O A;  3VD9 A;  5IYY A;  3OEA A;  2WBK A;  3VD5 A;  5DMY A;  4XUO A;  2W1U A;  4HG6 B;  2VZT A;  3P6B A;  3PUH A;  2W95 A;  2WO2 A;  5DN2 A;  1D7P M;  3BN6 A;  2YFU A;  4AG4 A;  1CIY A;  1TG7 A;  5JXJ A;  1SHW B;  3MUY 1;  3GM8 A;  4A42 A;  1J83 A;  2YC2 A;  3I3B A;  4P02 B;  2DDU A;  1UXX X;  1UMH A;  1PX3 A;  4P08 A;  2ZEX A;  5JXI A;  1JZ3 A;  4Z2A A;  5JR2 A;  3ABZ A;  4W8J A;  2WAA A;  2XOM A;  1OH4 A;  2X09 A;  5EJZ B;  2VZ1 A;  2Y64 A;  4M4R A;  1W9W A;  2YG0 A;  4JHZ A;  4DXS A;  2JD9 A;  2R7E B;  2EID A;  3PUI A;  2WO1 A;  3MUZ 1;  1XPW A;  4YPJ A;  5LA1 A;  2HLE A;  3VDC A;  3FL7 A;  3NJX A;  1NX9 A;  4TTG A;  1GU3 A;  3UET A;  2EIB A;  1EUT A;  2W1Q A;  1OF3 A;  2ZEY A;  1DYO A;  1NKG A;  2VM9 A;  5JXH A;  2VJX A;  5IJR A;  4CUB A;  2W1S A;  4DEQ A;  4QX0 A;  1JZ6 A;  4P00 B;  1IQD C;  5CYY A;  2JKX A;  1O59 A;  4MGS A;  3LE0 A;  4BJ0 A;  4E8C A;  4QB6 A;  1O8S A;  2W46 A;  3NNG A;  1L7Q A;  2QQL A;  3CMG A;  1NUK A;  3E1F 1;  3T08 A;  2VZS A;  4QDQ A;  2W47 A;  4DUV A;  2WYS A;  1XC6 A;  5HXM A;  3LEK A;  4RN5 A;  2J1A A;  3C7E A;  4XUN A;  3BGA A;  3K4Z A;  3J7H A;  5B4N A;  1UYZ A;  2E33 A;  5EJ1 B;  2QQI A;  2WAB A;  3UES A;  3UNP A;  1GNY A;  4A3Z A;  2RVA A;  1F4H A;  1UMI A;  5JMO A;  1CZV A;  3OGR A;  4ZZ8 A;  4ARX A;  3EB7 A;  2BGO A;  3I2F A;  3T0D A;  4LKS A;  3WNO A;  3HNY M;  4DXT A;  4GWJ A;  3ZM8 A;  3ACG A;  3NJV A;  4LHS A;  1K42 A;  1JYN A;  2WUH A;  1JI6 A;  2WN3 A;  5J1X A;  2VQT A;  4A41 A;  2OKX A;  1UY0 A;  3HEI A;  5JUV A;  2W87 A;  1GMM A;  3I2G A;  4QB2 A;  3FHA A;  2VL4 A;  3MV0 1;  2Y6H A;  3WNN A;  3DYP A;  1K3I A;  4QPW A;  2DCK A;  4W4Z A;  2ZXQ A;  1UY2 A;  2E31 A;  3SKV A;  4MAD A;  1UXZ A;  3SKJ E;  1JU3 A;  2J1T A;  2RV9 A;  1O8P A;  3ACF A;  3K77 A;  2ZEZ A;  2VMF A;  3WF3 A;  3W5M A;  2BGP A;  4FI9 A;  3CZU A;  2Y6L A;  3C7O A;  1GOH A;  2E32 A;  1L7R A;  2QBX A;  3GDB A;  1UX7 A;  4OUE A;  3HJR A;  1K12 A;  1ULO A;  1US3 A;  2BBA A;  5EIY B;  1JHJ A;  2QQM A;  4BK5 A;  1H6Y A;  1I5P A;  2WO3 A;  2B4K A;  3IAQ A;  4PT6 A;  1OF4 A;  3WNL A;  3I2I A;  4RYD A;  3OG2 A;  3A23 A;  4OYU A;  5I0D A; 
#chains in the Genus database with same CATH topology
 1XNA A;  2E26 A;  2P3I A;  2XUE A;  1C28 A;  1BK1 A;  3M3Q A;  2RS5 3;  1ULG A;  4LOT A;  4N9I A;  3VKN A;  1UYY A;  1UZ0 A;  3D5O A;  3LF7 A;  3NNM A;  1CAW B;  2R07 2;  2YB7 A;  4YW7 A;  4FPJ A;  4GQ7 A;  5F8P A;  3WF4 A;  1C3H A;  4K40 A;  1XSQ A;  3T2Q A;  3U14 A;  4AR2 A;  3UGG A;  5FZ1 A;  4O7X A;  1QNY A;  3FE5 A;  4KI5 M;  3P3P A;  3NST A;  2QTW B;  3NV2 A;  2D97 A;  4QM8 A;  5BPX A;  4AOC A;  2ORX A;  2ZAA A;  3FLT A;  5C71 A;  2HWF 2;  4FP3 A;  2HBT A;  4YVW C;  1ZRI A;  4QAW A;  4CPB D;  3GYD A;  1DHK B;  1LNS A;  1POQ A;  1Y9M A;  4PDW C;  1ZRR A;  1W8N A;  2UYB A;  1OD3 A;  4TSV A;  3JD7 2;  1SCR A;  5ACA 1;  1F2N A;  2EVX A;  3TRS B;  3RZH A;  1TEI A;  1H9W A;  5DUV A;  3TBD A;  4AAX A;  2BBV A;  3EHK A;  1DLC A;  4AEJ A;  4YVW A;  1DGR A;  3I2D A;  1H8T C;  5IAV A;  2DBI A;  2GZW A;  3HIF A;  1VAL A;  4PDW A;  2XHN A;  1B35 B;  2YC4 A;  1AR8 1;  4CVU A;  3VDB A;  3ETP A;  4QXC A;  2IUW A;  3QAC A;  1OC1 A;  4XBN A;  4MGT A;  4XUR A;  2XVL A;  2P6H A;  5FIX A;  4AHX A;  4N90 A;  4DS0 A;  5KXE A;  4FBF A;  1GKB A;  1H8T A;  1JUH A;  1V6N A;  2NMN A;  1LJ7 A;  2VQU A;  3GAL A;  5EYX A;  3UT0 A;  1WW6 A;  1O5L A;  1ZBE 3;  4LK7 A;  1HRV 3;  4CE8 A;  3SC7 X;  1NLQ A;  2ZGQ A;  5FY7 A;  3ZSE A;  1O4T A;  4LIT A;  1SG3 A;  4P9I A;  1AX0 A;  2D43 A;  4UW4 A;  2YMZ A;  2HWB 2;  2HYX A;  3O1M A;  3MIC A;  2FCV A;  2VVD A;  4BIS A;  4XQ4 A;  3I2J A;  2F4L A;  1ZNP A;  2B42 B;  3IDB B;  3CO2 A;  4XOG A;  4DXZ A;  3FHQ A;  1LU2 A;  1LAJ A;  2BEO A;  2J1E A;  3PVN A;  4HMZ A;  4EN0 A;  2PHW A;  4Q4X 1;  5JXG A;  4LO4 B;  3ZXJ A;  1R09 3;  2BP6 A;  3TEZ A;  3OF1 A;  4AED B;  4CDW B;  4IE4 A;  1YUD A;  3H8O A;  5FLI A;  4C1X A;  1PO1 3;  4LPL A;  4A4A A;  5F2S A;  2CDP A;  5FYH A;  2VTF A;  5FXX A;  5A6X A;  1KS5 A;  4O9G A;  4KH9 A;  4YGE A;  1ULP A;  4XHX A;  4DZG A;  3TOJ A;  4ET7 A;  4A7Y A;  4QDS A;  2IFR A;  1EPW A;  2BOJ A;  3A7Q A;  1RL3 A;  3POG A;  4S2H A;  5IFT A;  1W28 A;  2HWE 3;  2QQO A;  1AL0 G;  5FJH A;  3ZSK A;  3C7G A;  2OYZ A;  4H14 A;  4IV1 C;  4Q8L A;  4IND A;  4BQ2 A;  3LQC A;  2HWC 2;  1TNR A;  3CNA A;  1LGN A;  4X8N A;  4DO0 A;  2HWD 3;  4W6X A;  2B8M A;  5DUW A;  2OXB A;  2AR6 A;  3T2O A;  1N1V A;  2B46 X;  2HH9 A;  3HN1 A;  2WIN B;  5LK5 A;  4MG2 A;  1NLR A;  1SLB A;  1ZZ6 A;  3III A;  1ZBE 1;  1RUJ 3;  4IV1 A;  5AFB A;  1HRV 1;  1NAE A;  4FFG A;  1QF3 A;  5FUI A;  3J7M A;  3PUR A;  3WEZ A;  3CLP A;  4IGP A;  1W6M B;  5JPN B;  2C5D A;  1JZ4 A;  1LOB A;  2PXJ A;  3D8C A;  1RXF A;  1YYN A;  2Y6K A;  5F3C A;  5I91 A;  4C1W A;  1J3Q A;  3ZFF C;  4CUA A;  3AVR A;  5A3P A;  2YPJ A;  4YZ2 A;  1RVF 3;  1RMU 2;  1Z7S 1;  3KGZ A;  2E9Q A;  3P3N A;  1QNW A;  2J1S A;  1ENS A;  3WQ0 A;  2PYT A;  2E6V A;  1N3O A;  1ND2 A;  1IPJ A;  1NOV A;  1PO2 2;  3R0R A;  4JDO A;  2BER A;  3HNB M;  4JKL A;  2DVA A;  5FPU A;  5LZ6 A;  1QXJ A;  3ZFE B;  1ZBA 1;  4B7E A;  3IIA A;  3ZFF A;  5J09 A;  4LO5 B;  5CAZ A;  1SLI A;  4CCC A;  1X7N A;  5FPZ A;  4PLO A;  3WQ7 A;  4OVE A;  4QPI B;  4DMI A;  4YFZ A;  4GJZ A;  2QQP A;  1ZVF A;  1RUG 2;  2RS3 3;  4Y3O A;  3HOB A;  4XAE A;  1JUI A;  4XZU G;  3SEP A;  3U37 A;  3MFC A;  5DG1 A;  1TMF 3;  3ELN A;  4YG6 A;  4KNC A;  4DUW A;  2E7T A;  3VL9 A;  1K5J A;  1H4G A;  4IES A;  2HWE 1;  1OMI A;  4OI1 A;  3CIH A;  3R4D B;  1UY1 A;  3WF0 A;  1FAT A;  5ISL A;  4RA0 A;  2VEC A;  4CCL A;  4K6B A;  2ZOE B;  2ZGL A;  5C4W B;  4Z1V A;  4LT5 A;  3A22 A;  4Y5Z 0;  3WP6 A;  2JE7 A;  2P4E A;  2HWD 1;  2XON A;  1PNG A;  1DZT A;  1UKR A;  3AP7 A;  3RZG A;  1FPN 2;  1NCQ C;  4OZX A;  4O65 A;  4A2U A;  4B4P A;  4D0Q A;  1W8H A;  3LKJ A;  3VDD C;  1QEX A;  3MZH A;  1RUF 1;  4U2A A;  3GZA A;  2ID4 A;  1ULE A;  3HPN A;  1VBB 3;  4XJU A;  2ZX1 A;  1JYC A;  4UBG A;  2PAM A;  1WCS A;  1UOB A;  5H9R A;  4XJA A;  3W21 A;  1J1T A;  2PMW B;  2VXJ A;  4LO8 A;  4BQ5 A;  3U07 A;  3VDD A;  5H9P A;  3KT7 A;  4ZU7 A;  4ZHN A;  3NJY A;  4BK4 A;  1UQX A;  2DU1 A;  3H7Y A;  3SQO A;  1PZ7 A;  4GIQ A;  1RVF 1;  1AL2 2;  1WW4 A;  3KVA A;  1N1S A;  2Q1M A;  3PDQ A;  2OX0 A;  4W6W A;  1N1T A;  2R30 A;  2GC2 A;  4IEZ A;  2RDS A;  3TWI A;  4DQA A;  5LRS A;  3QD6 A;  3AZX A;  3ZFG B;  4CCJ A;  1MZF A;  2EAA A;  3TYJ A;  2I45 A;  4F7Z A;  2MHF A;  3MHZ A;  3NKT A;  2B45 X;  4OMC A;  3SNM A;  1V9U 3;  2VTX A;  4TN7 A;  2WS9 1;  4PI0 A;  2RS3 1;  4FPO B;  1YCI A;  5CZK A;  1RYY A;  1ND2 B;  2A6Y A;  3PUS A;  4LUM A;  3FFQ A;  1TMF 1;  2B9V A;  4IE7 A;  1LHU A;  4XF4 A;  5BV6 A;  1YFU A;  1GQP A;  2XXZ A;  1QKQ A;  3AC0 A;  3VD3 A;  5F5C A;  3USU B;  3VBS A;  4BWO A;  3QLQ A;  4D7T A;  3VBU C;  5D21 A;  5EWS A;  2ZS6 B;  4JDM A;  1V0A A;  1XU2 A;  1E57 A;  4IE0 A;  5FMC A;  1O3R A;  4BME A;  3PME A;  4EN9 B;  3NRU A;  2VUC A;  4J6G A;  1YNA A;  5L9B A;  3P1I A;  4YW3 A;  3PU3 A;  3ZXL A;  2ZGM A;  2UYA A;  1XXN A;  2UWA A;  3F2Z A;  3JU9 A;  4PQQ A;  1LUL A;  2WZP P;  2VO5 A;  4PF1 A;  3VBU A;  2DCJ A;  1H30 A;  3ACI A;  3AKP A;  3M4F A;  5K9Y A;  1HB3 A;  4UBH A;  1R08 1;  2OS2 A;  3UYJ A;  1CAU B;  1BMV 2;  3B01 A;  2QQU A;  5GZG A;  1PX4 A;  2E51 A;  3K46 A;  4FTB A;  1X33 A;  5FY5 A;  2IXJ A;  2RM2 2;  3ES4 A;  4HSL A;  4CP9 A;  4HN0 A;  4ZXE A;  2VVF A;  3LA3 A;  1XNT A;  1PVX A;  3POY A;  3I2H A;  3A4U A;  1AJK A;  4QM9 A;  1DGR N;  2VZ3 A;  3IAP A;  1OI6 A;  4DIQ A;  1VAV A;  4WVM A;  3VBO C;  1MZE A;  1FX5 A;  4A45 A;  2YU1 A;  1LOC A;  2ATF A;  1EAH 3;  1R1A 2;  4LQR A;  5FJK A;  4XJ9 A;  1CES A;  4LKE A;  3AMN A;  3NO8 A;  4FOY A;  3V0A A;  1V9U 1;  2JEN A;  5CFC C;  5GZC A;  2C6S A;  5IVB A;  1W6P A;  1DF0 A;  4HLT A;  3VBO A;  4AVC A;  1EY2 A;  4GMP 3;  2GNT A;  4Y5T A;  4DUX A;  5IK4 A;  5AVA A;  3HNM A;  1TVG A;  4S2G A;  3B02 A;  4F3J A;  3H8U A;  5CB7 A;  5C8C A;  3KQ4 B;  4IEU A;  4QXK A;  3K48 A;  3CHX A;  3QH6 A;  4YSF A;  2VQA A;  1D0G A;  2ZZJ A;  3ILF A;  4AVS A;  2Q8E A;  1JBC A;  4QPG C;  1AXY A;  1KRI A;  4A6O A;  2UUR A;  1GWL A;  2ZGS A;  4J1X A;  5IYY A;  4EZ4 A;  1Q8S A;  5DMY A;  1V6M A;  4XUO A;  1URX A;  4MET A;  3RYR A;  5FAX A;  3PUH A;  4LBM A;  2WO2 A;  3VBS B;  2ZMN A;  5DAB A;  5DN2 A;  4KWJ A;  4MYE A;  4AQT A;  1CON A;  1KD7 A;  5EP9 A;  5FV3 A;  4S2F A;  1IG0 A;  1IGO A;  2PN5 A;  3GZT B;  1DGW A;  1TG7 A;  3VZN A;  4TLF A;  2JB4 A;  1J83 A;  4NAM A;  4PI2 A;  1V6J A;  2XBO 1;  3I3B A;  5FWE A;  1YLL A;  4MGK E;  3VBU B;  2ZA9 A;  2DDU A;  3FLP A;  2OW4 A;  2SBA A;  5EHD A;  4SLI A;  5E6H A;  1K5M A;  1MEC 2;  1S0J A;  2IXK A;  1GP6 A;  4Q1R A;  5JR2 A;  3WDV A;  2RS5 2;  2K2S A;  2BDR A;  2A3X A;  4BU2 A;  3Q8E A;  2RE9 A;  3KB5 A;  1EAH 1;  3MIE A;  1OH4 A;  4YGC A;  3SH4 A;  2XLG A;  1BEV 2;  1H8V A;  1SCS A;  2A1X A;  4GA9 A;  4TLG A;  4RS5 B;  5FZ6 A;  1I1E A;  3UK9 A;  1CAX A;  1F31 A;  4L8Q A;  3JBG 2;  4W6Y A;  3WQ1 A;  4EZH A;  4GMP 1;  1WCU A;  4WVM B;  3ZN5 A;  1YJL A;  4H7L A;  4NPR A;  4QX5 A;  4DXS A;  2JD9 A;  4XTP A;  5A70 A;  1MZ6 A;  4L9B A;  1O3Q A;  1EYB A;  4H55 A;  3ZKY A;  3AKQ A;  3IMN A;  3MUZ 1;  5CFD B;  4KGQ A;  3V0A B;  5LA1 A;  3DEM A;  3FL7 A;  4JQR A;  4BB3 A;  4XHB A;  1C8M 3;  1GU3 A;  4LXL A;  2BV4 A;  2VOV A;  2O0O A;  4Z07 A;  3WG2 A;  3O12 A;  5FK8 A;  1KS4 A;  3NNJ A;  3WW2 A;  1X36 A;  1XRU A;  3HAG A;  1V6O A;  2J42 A;  1WLC A;  1X9P A;  3LZZ A;  3R4S A;  3WUC A;  5C8C B;  5F5A A;  2X5I B;  1PNF A;  2GAU A;  2A5Z A;  2VM9 A;  5EV7 A;  3M8L A;  1H2N A;  4R4Z A;  3KF3 A;  2VJX A;  4MGY E;  4YWA A;  3B00 A;  3DPR C;  1JZ6 A;  4CP2 A;  4Q4W 2;  5BNP B;  1WW7 A;  5CYY A;  1O59 A;  1HRV 2;  5FDB A;  1GNH A;  1VRH 2;  1ULC A;  2D6M A;  3LE0 A;  2PHF A;  4QHZ A;  4BJ0 A;  1X50 A;  2LUW A;  4ZPI A;  1NT0 A;  3KF5 A;  1CGP A;  2GMM A;  2W46 A;  1OKQ A;  5DUU A;  2VNV A;  5EJ3 A;  4AQ6 A;  5FZL A;  2DF7 A;  2VZS A;  5LW9 A;  4QDQ A;  5EXO A;  3N9M A;  4FPK A;  5HXM A;  2QQV A;  3LEK A;  2R1D A;  4RN5 A;  3RNS A;  3RYK A;  3C7E A;  4BQ1 A;  2CWM A;  1QJE A;  1L3J A;  3FHI B;  3OUJ A;  1GR3 A;  4FOV A;  4UFK A;  3U10 A;  2OUJ A;  3OBT A;  4YM1 A;  2C24 A;  3ZYJ B;  4CEY B;  4RQP C;  1CJD A;  1DGL A;  1MQT C;  1PGW 2;  1R09 2;  2HKX A;  1K5M B;  4V2W A;  4Y1V A;  4AVV A;  1Q3E A;  1QJX 2;  2E33 A;  5A7N A;  5FCC A;  1PO1 2;  3UNP A;  4XF0 A;  4E2G A;  4CCN A;  4A3Z A;  3N4M A;  1NA1 C;  2RVA A;  1F4H A;  1CZV A;  5HBA A;  2RDN A;  4BYY A;  4RQP A;  1MQT A;  2BTV C;  3EB7 A;  1DZR A;  2BGO A;  1CAX B;  3MID A;  4E4D X;  3LD8 A;  1W8T A;  2DTW A;  5FK7 A;  2ZZQ A;  1ZZ9 A;  1LHO A;  3DUI A;  3N9Q A;  2OT7 A;  3ORJ A;  5FQ0 A;  2WN3 A;  3VGI A;  5J1X A;  3FMG A;  5JSP A;  5CEH A;  3AL6 A;  3KD4 A;  1UY0 A;  2OKX A;  4K1Y A;  5FY8 A;  5A7W B;  3TNQ A;  5L7O C;  1JTZ X;  5FXW A;  3MPB A;  2HWD 2;  2WL1 A;  4LMF A;  4QB2 A;  3POB A;  2DUP A;  2PTM A;  2XGX A;  3I59 B;  5GZE A;  3VBR C;  2FDI A;  4M0N A;  1VMH A;  3WIN E;  3WNX A;  2VH9 A;  1TME 3;  2XJP A;  1RUJ 2;  1WUV A;  1C1F A;  5FZB A;  1FMD 2;  2Y6H A;  4LUK A;  2VUA A;  3ZXA C;  4N9H A;  2XH6 A;  5IVF A;  2CGP A;  1UYP A;  4YG3 A;  2DCK A;  3RMX A;  3FJS A;  4E4Z A;  2WQ4 A;  3E6D A;  4KWL A;  5T5J A;  3VBR A;  3WDW A;  5L73 A;  2FHR A;  1SFP A;  1Y43 B;  1G8W A;  4IW3 A;  2EXK A;  2E31 A;  1COV 3;  5C5U A;  1ENR A;  4K3U A;  4M0H A;  3SKJ E;  5E88 A;  2Q0A A;  1YHF A;  4WBB A;  1RVF 2;  2J1T A;  4ZXK A;  1CD3 G;  3OOX A;  5A6Q A;  1G7Y A;  2QFE A;  2ZEZ A;  1PGL 1;  4DPN A;  3T3Y A;  1GWM A;  1SFN A;  3IM0 A;  3M3O A;  3ZSL A;  3C7O A;  1GOH A;  1ZZC A;  1L7R A;  4CXX A;  3ZYG A;  4OUE A;  1HRI 3;  1BZW A;  4CCK A;  2JG9 C;  1K12 A;  3BU7 A;  4NII A;  4XE9 A;  2LAL A;  3OYW B;  1ACC A;  3GBF A;  4CDQ C;  4BK5 A;  1I5P A;  2WO3 A;  4X6Q B;  5IT6 A;  5CG9 A;  2GU9 A;  3IAQ A;  1PZ9 A;  4IE5 A;  3I2I A;  1F5F A;  4XXP A;  2RR1 3;  4K8F A;  1W2U A;  2JG9 A;  5BNQ A;  3AMM A;  1IG3 A;  4LLF A;  2JEM A;  3H42 B;  3KQR A;  4BHP A;  3Q9O A;  5SV5 A;  4OYU A;  4CDQ A;  1DYK A;  4Q4Y 2;  5LB6 A;  3VZK A;  3AKS A;  1GZT A;  3ITQ A;  1S2B A;  2BNN A;  2AH2 A;  1ZRF A;  4GB3 2;  5FPL A;  1DZQ A;  1H1A A;  1IHM A;  4NHK A;  1VP6 A;  4NHL A;  5DDJ 3;  3ZMO A;  4TZD A;  1TME 1;  1JYT A;  1IKP A;  5FQ0 B;  1WA6 X;  4YNI A;  5A3O A;  1VBB 2;  1VIW B;  2IXL A;  4BXS V;  1O6U A;  3HQX A;  4E4S A;  1HXS 3;  2RHP A;  4V1P A;  1F15 A;  1SZB A;  1Y9Q A;  1W2O A;  3LAG A;  3OEB A;  2ET7 A;  3QOP A;  5CBL A;  1US2 A;  4QX2 A;  1PK6 B;  3T1M A;  1COV 1;  1YEW A;  2R06 2;  2VNO A;  3NJZ A;  4K21 A;  3BI3 A;  2DUQ A;  3OB8 A;  2FDH A;  1QY4 A;  1VAK A;  1W0N A;  2JJ6 A;  2Q8C A;  4PIZ A;  3GBG A;  1G9C A;  4XDQ A;  2O8O A;  2RDR A;  5EZW A;  2EXJ A;  3LIG A;  5FZK A;  2UY9 A;  5BNN C;  2VU9 A;  4COV A;  4RGK A;  3AFK A;  3WW4 A;  2XLF A;  3T4V A;  1PMJ X;  1CVN A;  3AZZ A;  2WWS A;  1HRI 1;  1CX4 A;  2VCB A;  4KU8 A;  4XIK A;  4XZP A;  3WG3 A;  4R9B A;  1F8V A;  1KDK A;  2E7Q A;  4NRP A;  2ES3 A;  5C3P A;  3UL2 A;  1NZC A;  5BNN A;  3MO4 A;  4AI9 A;  5A1A A;  3AJZ A;  2JG8 C;  2RR1 1;  4XUP A;  3A0N A;  5GJ6 A;  3I7D A;  3N9N A;  5A33 A;  4XXA A;  3TN9 3;  3AZV A;  1FNZ A;  4XJ8 A;  1JYW A;  2KD7 A;  3FX3 A;  3G6J B;  3I4I A;  1HJG A;  2J1U A;  1RUE 2;  2P17 A;  1ODM A;  1OUR A;  3NQH A;  5LBF A;  2V4A A;  1WWY A;  3EJK A;  5DDJ 1;  1Y9G A;  1ZZ7 A;  3UGH A;  5KWR A;  2GAL A;  1UU4 A;  1W06 A;  4XBQ A;  5FZF A;  5LBE A;  3B5L B;  4KWU A;  3O1O A;  1BVV A;  1HDK A;  3DXT A;  4Y24 A;  2D98 A;  2IFW A;  5F5Q A;  5A32 B;  1WCD J;  3EMR A;  1HXS 1;  3T4H B;  5A7S A;  4NE9 A;  3WDX A;  3L9J T;  4AVT A;  1QOO A;  2W0X A;  3ZDV A;  2WFP A;  2C4X A;  2YHJ A;  3NL1 A;  2IZW A;  3POW A;  4GKY A;  3NV4 A;  1OLM E;  2VMC A;  3WW3 A;  2FCT A;  1AZD A;  2XWB B;  2VZP A;  4QKF A;  2BFU L;  1PHM A;  4L11 A;  4Y22 A;  5FY4 A;  5F6K A;  2FCU A;  2AAC A;  4XTM A;  5FRE A;  1O4Y A;  3OCP A;  3RWK X;  4FFF A;  1XQN A;  3BTY A;  2P3Y A;  3AYC A;  5DZE A;  2WII B;  1W99 A;  1IPS A;  5IFP A;  4COU A;  4CA9 A;  3ALQ A;  3QBQ A;  2B7Y A;  2WQ8 A;  2ZGO A;  2VNG A;  5FZO A;  2VZQ A;  4PBP A;  1CJP A;  2WQZ C;  1VPH A;  2LW8 A;  4GXL A;  2DUO A;  1JOB A;  4XEZ A;  4XF1 A;  1GP5 A;  5JSR A;  5K8S A;  4IXL A;  2VW2 A;  3B69 A;  1AR7 3;  2QVS B;  3TN9 1;  4OHY A;  3USS A;  5A7P A;  2MEV 3;  1YIP A;  1AYN 1;  3M3I A;  4Q0P A;  5BNN B;  5HCF A;  4QB1 A;  1T2X A;  4ES9 A;  3LSD A;  1POV 0;  3MLL A;  5BNO B;  1H4H A;  5I8Y A;  2VW0 A;  3SHR A;  3MI8 A;  1PIV 3;  3AYD A;  5J36 A;  2AEY A;  2QQW A;  4DEV A;  2BZD A;  1TNF A;  1HJF A;  5HV0 A;  5FY0 A;  5FZ7 A;  5HXV A;  4CP0 A;  2NLR A;  2VBD A;  2RS1 2;  5DG2 A;  1O3S A;  2X29 A;  4DY5 A;  1KFX L;  2WA4 A;  4LLO A;  1RUH 2;  2GME A;  1UY3 A;  2GH8 A;  4ITC A;  4TXW A;  2PLV 3;  1U5Z A;  3CDZ B;  5HV4 A;  3RI9 A;  3C7H A;  5JSO A;  4LIU A;  5LK7 B;  2D6N A;  4IV3 A;  5JZG B;  5LA2 A;  1OD5 A;  3J7L A;  2JIJ A;  4LO6 B;  3POI A;  1E5S A;  2P3J A;  2W2I A;  1RUD 2;  3AP5 A;  1DYP A;  2CAV A;  2X05 A;  3WVJ A;  1PMI A;  4YM0 A;  1ULD A;  2FQP A;  3PUA A;  4Q4X 3;  5JIA A;  1DBN A;  4AVA A;  3MW4 A;  4XPV A;  1UL9 A;  1SPP B;  4Y22 B;  3J9S A;  1UPI A;  2RMU 2;  3VUO A;  2QZ3 A;  1H9P A;  2X10 A;  3E5Q A;  2R0F A;  1UOF A;  4UFJ A;  1OLQ A;  1C5I A;  5FYY A;  2ZHL A;  1BKZ A;  1AR7 1;  5EFU A;  5FYT A;  1LB2 A;  2VAU A;  3ME2 A;  3KV6 A;  4CXY A;  2MEV 1;  1RHI 3;  1UAI A;  5JCT A;  1C8M 2;  1F5J A;  4D3W A;  1G9F A;  2CY6 A;  1LEC A;  1NE6 A;  2LS6 A;  2VMG A;  2WR9 A;  1S0C A;  3FUO A;  4UFH A;  3INA A;  1JXN A;  5C9A B;  2CAU A;  4BA6 A;  2ZGN A;  1GSL A;  4XFA A;  1PIV 1;  1QDO A;  3DYO A;  4HAN A;  1QXR A;  5KC6 A;  4IEQ A;  1UY4 A;  2BU9 A;  4Y33 A;  3RZJ A;  1ENQ A;  2DCZ A;  4YYO A;  5ABJ C;  1RUC 2;  1KEX A;  2PHT A;  3LCP A;  3VBF B;  4C0H A;  2MPF A;  4YGB A;  4B29 A;  2XVG A;  4QHB A;  4BDV B;  4QT6 A;  2XHK A;  2V4V A;  1UWW A;  1VRB A;  4Q27 A;  3MFA A;  2BRT A;  4HVQ A;  2CGO A;  2PLV 1;  3T0B A;  5ABJ A;  4RFT 0;  3WLU A;  3MPP G;  2YBP A;  2Y6F A;  5FBJ A;  2R16 A;  3KM5 A;  3EO6 A;  1JU4 A;  4ATF A;  2FDG A;  3CQO A;  5E8A A;  4BQ4 A;  1Z7S 3;  5EYY A;  3THD A;  3POE A;  5FZ3 A;  2XJR A;  1ASJ 3;  4EN6 B;  2VTX J;  1WKY A;  2BWA A;  5GZF A;  5A3W A;  1LES A;  5FZA A;  1I5Z A;  4EE2 A;  1OFS A;  2P2K A;  2D44 A;  2VVE A;  3KGL A;  1ZBA 3;  4BIO A;  3HN3 A;  4IV3 B;  3HD8 B;  4IDZ A;  1PVC 3;  4BQ3 A;  4KG0 A;  4XCA A;  1A8M A;  5GLZ A;  1BHG A;  2JDK A;  5FKB A;  3WZ1 A;  1OOP C;  3SIT A;  2WDB A;  3J4U H;  5T5L A;  3LGR A;  3E97 A;  2O1Q A;  1RHI 1;  3L2H A;  4I09 A;  1REE A;  1QOT A;  1ZRD A;  1AYM 2;  2CDO A;  1GAN A;  2QZ2 A;  3I97 A;  1QQP 2;  3C7F A;  5GLT A;  1W9S A;  4MV2 A;  2D93 A;  5JI7 A;  2QQN A;  3DXU A;  4XIL A;  4URA A;  2LM3 A;  5FP9 A;  4FOQ A;  1DQ2 A;  1GP4 A;  4GMP 0;  2Y6J A;  2YC0 A;  1RUI 2;  1VAM A;  3OGJ A;  2NM1 A;  4TWT A;  2GN7 A;  5FYZ A;  4UXA A;  1W9T A;  3J8F 3;  4YVW B;  2CYF A;  1TME 2;  3BCW A;  4NWW A;  4Y4R A;  1RUF 3;  5FO8 B;  4PDW B;  2ZTN A;  4FQZ A;  4D7Y A;  1RXG A;  5C3R A;  2YY1 A;  3ASI A;  4JRL A;  4COW A;  2FZ2 A;  3WDT A;  4NPL A;  4UW3 A;  3W5N A;  2VY0 A;  5FY9 A;  4GD4 A;  1RUN A;  2ZAB A;  1JOP A;  1UYX A;  1H8T B;  1OFN A;  3KVB A;  3H8X A;  1COV 2;  3A21 A;  5FMB A;  1DGW X;  3ES1 A;  2FDF A;  2NYY A;  5FYC A;  3ZMN A;  4D69 A;  1FOD 2;  5KC5 A;  5DQ0 A;  1H2K A;  1S4C A;  1ASJ 1;  4FVV A;  1NE4 A;  2WT0 A;  3GBW A;  4AEK A;  4CXW A;  4DNY A;  4NMI A;  2JDY A;  3H9A A;  3JB4 C;  2JX9 A;  4PHZ A;  2ZHK A;  1X8M A;  2W1U A;  4HG6 B;  4NHX A;  4L2N A;  3S57 A;  4B1L A;  1PVC 1;  3P6B A;  2Q8D A;  5LBB A;  2WS9 3;  3AZY A;  3AKR A;  4FPH A;  4JHT A;  3BN6 A;  5H9Q A;  2YFU A;  4LNV A;  4P5H A;  1SHW B;  3MUY 1;  5FXV A;  3GM8 A;  1IPK A;  4A42 A;  2AYH A;  1SEF A;  3SH3 A;  2MNG A;  2YXS A;  2XKP A;  5LAS A;  3I2O A;  1KJR A;  2DYC A;  3NV1 A;  2HBU A;  4FXG B;  3VZL A;  4EV0 A;  5BY5 A;  1AR6 2;  2JXA A;  4WV8 A;  3WP3 A;  4AQ2 A;  1ZRE A;  1BBT 3;  4BZ4 A;  5J3U A;  2ZEX A;  5JXI A;  1JZ3 A;  3SCH A;  4Z2A A;  3U75 A;  1BLZ A;  2WYF A;  4QD2 A;  3NMB A;  1VBD 1;  4SBV A;  1M06 G;  4FFH A;  3QH7 A;  2PHD A;  3IMM A;  1AR9 2;  2WO7 A;  4XC9 A;  1QJU 3;  4A7Z A;  3J8F 1;  1BXH A;  1E5H A;  3HT2 A;  4PIX A;  2PAE A;  4G9S B;  1YFW A;  2Y64 A;  1QHD A;  1R08 3;  1JOD A;  4JGY C;  1LEM A;  5FP3 A;  2YYO A;  3DKQ A;  4L99 A;  3UKN A;  1NCQ A;  1HQW A;  2R7E B;  3VBH C;  2EID A;  3IWZ A;  1DQ4 A;  4ISQ A;  4KG8 A;  2VPV A;  3NNL A;  4AFB A;  2WWU A;  1V6K A;  3LA7 A;  4IV1 B;  1H0B A;  2JEC A;  2ET1 A;  4N7I A;  5FLH A;  1W8W A;  4YPJ A;  1D2Q A;  2P3K A;  4JGY A;  3NJX A;  4WM7 C;  2EIB A;  2Y0O A;  5A3L A;  3VBH A;  1Y7B A;  3GJB A;  3H50 A;  3V65 A;  5FR3 A;  2ERF A;  4NRO A;  4CYD A;  1DYO A;  3ZXF A;  2ZGT A;  1VBA 2;  1NKG A;  3BOP A;  4WM7 A;  2AEN A;  4WM8 C;  3KS7 A;  1GLH A;  1FXZ A;  1I9R A;  1WMD A;  2DFC A;  5KXC A;  2ETE A;  2W1S A;  5FXZ A;  3MIH A;  1DLL A;  4P00 B;  3ZIX A;  4Q1P A;  3IPV A;  3ZFF B;  1HB2 A;  3MLJ A;  4MGS A;  2O8Q A;  5KHJ A;  4E8C A;  3CBN A;  4WM8 A;  2CTV A;  4QB6 A;  5ANN A;  4DIN B;  4RSU A;  3JZV A;  3TN9 2;  1GBG A;  1O8S A;  1LKN A;  1CPM A;  2DTY A;  1L7Q A;  1BBT 1;  3CMG A;  1NUK A;  3T08 A;  3LOB A;  4H7M A;  1XE7 A;  2FBE A;  2WYS A;  3RSJ A;  1XC6 A;  2ZGK A;  2D7F A;  2J1A A;  2PEL A;  4XJZ A;  1YO8 A;  1ZM1 A;  1QJU 1;  1QGL A;  2QJV A;  1VBE 2;  1FAY A;  1EV1 2;  1W05 A;  3ZSJ A;  4LBO A;  4FAG A;  4HON A;  4P9G A;  4U36 A;  4HXC A;  1A34 A;  3NWK A;  2I74 A;  2CHH A;  5GLU A;  1T6G C;  1UYZ A;  5IVV A;  1IS4 A;  4AWD A;  3OPW A;  1NCR C;  1GNY A;  1LHN A;  2XBO 3;  4EJR A;  1N47 A;  1TE1 B;  1QJY 2;  1UMI A;  3I8T A;  3NW4 A;  4DRV A;  3AVS A;  3OGR A;  1WD3 A;  2CL2 A;  2D6L X;  2DVD A;  4RGA A;  5F3G A;  2F17 A;  4JGZ C;  4P9X A;  1O3T A;  1UNB A;  1C4R A;  2YDE A;  3HBK A;  5I0U A;  3ZLI A;  4DXT A;  2OPW A;  2JDU A;  3ZR5 A;  3NJV A;  3E5U A;  1OLM A;  2LTN A;  2OQ6 A;  1K42 A;  1KFU L;  1NCQ B;  3CJI C;  3D0S A;  1XE0 A;  3RZK A;  3IKW A;  1YRZ A;  2WUH A;  1L7L A;  3OUH A;  4JGZ A;  1JI6 A;  3AMQ A;  1I6X A;  3VDD B;  2GDF A;  4JTO A;  3QCW A;  2QE3 A;  5H9S A;  1W9F A;  4B3N A;  3H3L A;  4JTN A;  5IVC A;  5B2G B;  1GMM A;  4UFL A;  3S6P A;  5GKA C;  3ZDS A;  1KXG A;  1NZI A;  3CJI A;  3BUC A;  2FD8 A;  1OHF A;  3MIF A;  3VBH B;  3O1R A;  5JWP A;  2GC3 A;  2R49 A;  1ALY A;  4NHM A;  3DYP A;  4A6S A;  3KV9 A;  2PHR A;  4DFS A;  2VBP A;  3UJO A;  2IXC A;  2PQQ A;  1X9T A;  3BTX A;  2Z69 A;  5ACA 2;  5FP8 A;  2WZR 3;  4H3W A;  4CSW A;  1SBF A;  5LEJ A;  5E16 A;  5FYS A;  2CV6 A;  3HWJ A;  4RFR B;  1WLW A;  4M3C A;  1UZW A;  2ZGU A;  3IPV B;  3POJ A;  3SKV A;  1D0H A;  1XB9 A;  1AR8 2;  4LIV A;  1XYN A;  3POS A;  4QPG A;  3GCX A;  5J48 A;  4NO4 A;  4UW5 A;  3ZOI A;  2EIG A;  3WF3 A;  3WDU A;  3VB9 A;  4AZZ A;  1KDM A;  4FI9 A;  1UN1 A;  3CZU A;  3ILR A;  1UIK A;  3AM2 A;  3N7K A;  4DY3 A;  2KA3 A;  3VZO A;  1UX7 A;  3HJR A;  4NVP A;  5J37 A;  2BBA A;  4I01 A;  1O7F A;  2D3R A;  3E6B A;  4NIA A;  1H6Y A;  2PLV 2;  1MVE A;  4IGQ A;  4CCM A;  5HCA A;  5CIS A;  1BVP 1;  4PT6 A;  4W65 A;  3MIB A;  1UMZ A;  3DN7 A;  1CQ9 A;  4Q4V 3;  3OG2 A;  1NQJ A;  1D2S A;  2VUL A;  2NZ9 A;  2ZKL A;  5T54 A;  1MS4 A;  4RHV 3;  2W3J A;  4CP9 B;  5FO9 B;  3H1Y A;  3HBZ A;  4XDP A;  3SMH A;  4LHK A;  5IVE A;  4Q4X 2;  3I3D A;  4G4F A;  4LO7 A;  3RJ2 X;  1R1Z A;  3IB3 A;  3ZKU A;  5HI0 A;  2H0V A;  3U0Z A;  5DPN A;  2Y6G A;  2VZO A;  3K2O A;  4YZ3 A;  3T2T A;  3KLS A;  5IAX A;  5DAW A;  5FZG A;  2CU5 A;  1D4M 3;  3LA2 A;  5C3S A;  2H6B A;  3LFI A;  4LOS A;  2NP0 A;  1S0G A;  2Y0I A;  1J84 A;  3LFM A;  4Q0S A;  2Y26 A;  5I0T A;  1JYV A;  3O1U A;  2FDK A;  3OUI A;  1HB1 A;  2J22 A;  4WVV A;  1W6P B;  3TAY A;  3VBO B;  2XL7 A;  4Y1U A;  3CL1 A;  2R07 3;  2W94 A;  4S2D A;  1JOJ A;  2WNU C;  1YJK A;  2WZR 1;  1GIC A;  3OBZ A;  4YW4 A;  4E4H A;  5LWB A;  4LBQ A;  3O7O A;  1PMH X;  3KZ4 C;  1GOG A;  4FOW A;  4CDU C;  3MV1 1;  1LGC A;  5A1F A;  2VME A;  3OTF A;  2XML A;  4OQ9 A;  4AXO A;  5JAX A;  5KBF A;  5LY1 A;  2IWG B;  2KM2 A;  4K9S A;  3I3E A;  3WNP A;  3DF0 A;  1AX2 A;  3RQ0 A;  2HWF 3;  2GC1 A;  2WAO A;  3LPG A;  1N1Y A;  2VOX A;  2Z79 A;  2ZX4 A;  2ADE A;  1VMF A;  4JDN A;  4CDU A;  3AYE A;  2VCC A;  1YC6 1;  2X8K A;  1ZBE 2;  4ZS3 A;  5F39 A;  2A71 A;  2XPJ A;  3JD7 3;  1OPM A;  1XBF A;  2QQK A;  3B7M A;  4MXW A;  1OT5 A;  1HB4 A;  3BU0 A;  3WNK A;  4QPG B;  1FYU A;  2EAL A;  3DPR A;  3PTY A;  3AMH A;  4WVW A;  3BTA A;  4Q4V 1;  1NXM A;  2WNV C;  2C26 A;  2XVK A;  3H0O A;  4K7J A;  1FI2 A;  2VCM A;  4HET A;  4BQX A;  2PHU A;  2YBK A;  1W6N A;  1SDD B;  1Z7S 2;  4LHN A;  1GFF 2;  4RHV 1;  3VDA A;  4NN0 A;  3CZJ A;  1N3P A;  1ASJ 2;  5K0U C;  4GH4 C;  5JVV A;  4AL9 A;  5FPA A;  1HQL A;  3BAL A;  1HX6 A;  2WNV A;  4HKO A;  1KGY A;  1LEN A;  3UV9 A;  3WXP A;  1ZBA 2;  2Z4F A;  1MS3 A;  3LB9 A;  4P9Y A;  5LAT A;  4JV4 A;  5A3U A;  2HWB 3;  4LBL A;  5AC9 3;  3OBA A;  5IHR A;  5E1R A;  2F4P A;  2PFW A;  1D4M 1;  3T0A A;  1H1I A;  1FV2 A;  3VKL A;  2L9L A;  1OUX A;  3GZU C;  4LBN A;  4OUL A;  4XBL A;  2LRO A;  5JR7 B;  3W58 A;  4UF0 A;  1MR5 A;  3MW3 A;  5IK8 A;  4IE6 A;  3WHT A;  2B39 A;  2R07 1;  3G7D A;  4ASL A;  2A70 A;  1NA1 A;  1AXZ A;  2WLQ A;  4ONU A;  1HN0 A;  4OHV A;  2HWE 2;  3ZO0 B;  5F2W A;  4OHW A;  5GAL A;  2WSV A;  2J1R A;  4Z82 A;  2WZ8 A;  4XVH A;  1G9A A;  3IDA A;  2YUE A;  4YW1 A;  5A7O A;  4QQH A;  4NR1 A;  5DXD A;  5FRA A;  3B9C A;  2ARB A;  4E8D A;  2HWF 1;  1DCS A;  3P5B A;  2YFZ A;  2Q1Z B;  2VR4 A;  4QDR A;  5C33 A;  3VHN A;  3U4X A;  1IKQ A;  5FUP A;  4XIO A;  2H6C A;  3JD7 1;  1RUF 2;  4XFG A;  5I0S A;  3PHM A;  2VOT A;  5CKQ A;  2JDP A;  1IOA A;  1NY7 1;  1SBD A;  4NHY A;  3VKM A;  5L7O A;  5I93 A;  4CDX C;  3RRD A;  1IS5 A;  4YVS C;  3W9A A;  3ZXD A;  3ZXG A;  4K8R B;  2RG4 A;  3X29 B;  3O1T A;  2Z5W A;  1GQH A;  2HWC 3;  4YW5 A;  2V72 A;  3MF9 A;  1YFX A;  2ARA A;  4MXW B;  2ZPX A;  4Q29 A;  1NYW A;  4MHR A;  4OUS A;  4XW3 A;  4CDX A;  4YVS A;  4A7K A;  2QUO A;  3KV4 A;  5A3T A;  4LA3 A;  4X8P A;  2XG3 A;  3DPR B;  4UYB A;  1DG6 A;  1SAC A;  3D0J A;  3DL3 A;  3OD0 A;  4OFG A;  1C1L A;  4BQW A;  2C9K A;  2W68 A;  3LEM A;  4H2A A;  2HWB 1;  4UWD A;  5AC9 1;  3K3O A;  5L19 A;  1CAV A;  1RJ8 A;  1MS5 A;  1W6N B;  2WS9 2;  4C0B A;  2RS3 2;  4IEX A;  2DUR A;  1Y3T A;  2Q5T A;  4IUG A;  1KIT A;  4C8D A;  1LOG A;  3AKT A;  2QDR A;  3PNA A;  3NV3 A;  3DKW A;  2VQ0 A;  1HIX A;  4HSJ A;  4OMD A;  4RR3 C;  3PMS A;  2Q8O A;  3UKT A;  1GNZ A;  4F8A A;  5D8A C;  3GHN A;  3THC A;  2BFU S;  1RMU 3;  1TMF 2;  3GZE A;  3SLI A;  4ZU5 A;  3EBR A;  2QKD A;  4Z92 B;  2F6B A;  1PO2 3;  5G05 L;  4XDO A;  1S2K A;  4RR3 A;  3K51 A;  4RQP B;  2P37 A;  1MQT B;  4EWD A;  4QX1 A;  1U5X A;  5D8A A;  2EIC A;  3R6S A;  1MS1 A;  1WA4 A;  2WN2 A;  4KBZ A;  4DXR A;  4QKB A;  1WCQ A;  4XQD A;  1RUG 3;  2ILM A;  3WNM A;  1NA1 B;  1JYX A;  3VN4 A;  4YM3 A;  5FYB A;  5FYI A;  3KCC A;  4JKK A;  2BNO A;  1MS8 A;  4B8E A;  1OKO A;  5CFC A;  2JE8 A;  5T50 A;  3WSO A;  3JB8 A;  4EQV A;  3NAP C;  4RD7 A;  4V2V A;  1YQ8 A;  4E2S A;  1R08 2;  5KHG A;  1O5U A;  2VBB A;  4AFA A;  4WZC A;  2BNM A;  2AZ5 A;  1BQP A;  4P9W A;  4AQS A;  5C5T A;  4JX0 A;  1S0D A;  1TZO A;  3VD4 A;  1UCX A;  2HWC 1;  4MSV A;  2OUH A;  2JDN A;  3BPZ A;  3BPS A;  3NAP A;  3OBR A;  3WHU A;  1W2N A;  2GH2 A;  3T30 A;  2DVG A;  2J1V A;  4HPK A;  4QKD A;  2JIG A;  5LA9 A;  1SLA A;  5L7O B;  2EXI A;  4L92 A;  3B94 A;  1FT9 A;  1V6I A;  3PJY A;  3ZXK A;  3VBR B;  3IDC B;  4YLZ A;  3V64 A;  4MZU A;  3HVD A;  1Y4W A;  1WBF A;  2I07 B;  2TEP A;  1V9U 2;  1XSR A;  4Y5S A;  4CDX B;  3C2U A;  1WZX A;  1O91 A;  3ECQ A;  3PVO A;  1YQ5 A;  1DP0 A;  4ZZ5 A;  3WF1 A;  4CEW C;  4LBK A;  3H1W A;  2VW1 A;  1Q5O A;  1APN A;  2K46 A;  2VOW A;  2X53 S;  1AL2 3;  1RMU 1;  2G9F A;  5A6Y A;  4LA2 A;  1OH3 A;  1NLS A;  1JYI A;  5IWF A;  2WJS A;  2ZAC A;  1VBC 3;  3LOI A;  1PO2 1;  1R64 A;  4IER A;  3OGS A;  2J7M A;  4FP2 A;  4HFS A;  3VV1 A;  1QH7 A;  1S0B A;  4CEW A;  1AYN 3;  4O9E A;  4LJH A;  4URT A;  2HYK A;  3D4K A;  2JG8 A;  3L2Y A;  4OI2 A;  1IZ3 A;  2OZ6 A;  4NJ4 A;  1RUG 1;  2JG9 B;  3ATG A;  1ND3 C;  5HPO A;  4CDQ B;  3BOD A;  4ZS2 A;  5FZ4 A;  3HT1 A;  1W9Y A;  3O1V A;  3WCR A;  1UX6 A;  2HJI A;  2RJL A;  4AVB A;  4CU7 A;  2W91 A;  3AJY A;  3FZ3 A;  2AUY A;  4PLM A;  1IS6 A;  2WSU A;  3GGL A;  5J98 B;  1QWR A;  1W2A X;  1ND3 A;  1J59 A;  2XBO 2;  1WMX A;  1H6X A;  4OHZ A;  4HN1 A;  5LBC A;  2XJT A;  4Y20 A;  4PIY A;  1G9D A;  1HW5 A;  5CU1 A;  1DQ1 A;  1QJZ A;  4UI9 L;  3S30 A;  3WUD A;  4BXF A;  4CU6 A;  4PLN A;  1FPN 1;  5GM0 A;  3V0B A;  4IEP A;  4GAZ A;  5T55 A;  1UOJ A;  2A7A A;  5DZF A;  1W8U A;  1EAH 2;  1EUU A;  1V00 A;  2XUM A;  3I49 A;  4TYS A;  5KXB A;  2W08 A;  1C5H A;  1ZX5 A;  3N3H A;  3WR0 A;  3ZXE A;  2ZCW A;  1CPN A;  3H8R A;  2BW8 A;  3LIH A;  3BKZ A;  2JIC A;  5C6C A;  1WLD A;  4PJY A;  5L36 A;  1UPS A;  2WLP A;  4HPK B;  4Q0Q A;  5EPA A;  3TEY A;  3BTZ A;  2RM2 3;  3ROU A;  2EIE A;  4FPC A;  4AI3 A;  4XJW A;  3FC0 A;  1AL2 1;  3KV5 A;  3WDY A;  4W50 A;  1YFY A;  2E63 A;  1AUY A;  2BJS A;  2H0B A;  1DIW A;  1ZYB A;  1YIF A;  2EXH A;  1VBC 1;  3N35 A;  4M3C E;  4LBQ D;  1R1A 3;  3S0M A;  1LOE A;  1RIR A;  1H2M A;  2VCA A;  4JAA A;  1UW8 A;  1B35 C;  2EA7 A;  3O0X A;  4ZU4 A;  5HCB A;  4M00 A;  5F5I A;  5A33 B;  4JZR A;  2PA7 A;  4LKD A;  2TNF A;  1WMF A;  4P9L A;  3I2K A;  5F7U A;  1OXC A;  2ZAH A;  2XJV A;  2ZBJ A;  3OEA A;  4MH0 E;  3WP4 A;  4CEW B;  3ZYB A;  1LTE A;  1VLN A;  3H3U A;  3MLK A;  4QKN A;  2QNK A;  2JG8 B;  5HCH A;  3S5Q A;  1ULF A;  3HQR A;  2GMP A;  2W95 A;  4D94 A;  2WFF 3;  1CWP A;  4CTE A;  2G19 A;  4BE3 A;  5L9R A;  1SFY A;  2ARC A;  2WNE A;  1D7P M;  4FPG A;  4AG4 A;  1W6O A;  5JI9 A;  2XL9 A;  5JXJ A;  3RZL A;  3M70 A;  4Y1Z A;  2YC2 A;  3F95 A;  1GZC A;  5FMO L;  3ENR A;  4OQ8 A;  2VG9 A;  2TBV A;  3HMY A;  2JD4 A;  1UXX X;  2Y34 A;  1UMH A;  4KU7 A;  2OPK A;  4RHV 2;  5F3I A;  3ZPY A;  2D6K A;  1PX3 A;  4XFH A;  4AED C;  4Y20 B;  3VHO A;  4CDW C;  4XET A;  4XAC A;  4AFC A;  3CJX A;  2A3Y A;  2RM2 1;  3V0B B;  2EAK A;  2R32 A;  4MGI E;  3JCI A;  2XWJ B;  3KWV A;  1SMV A;  1S0F A;  4GKX A;  4N7U A;  4ZKT B;  5JMC A;  1D4M 2;  4AED A;  4CDW A;  1H2L A;  1MEC 3;  5FPX A;  3FUQ A;  2Q4S A;  3WCS A;  4M4R A;  1PM4 A;  4MUV A;  2YG0 A;  2A6V A;  4JHZ A;  1TQ5 A;  4KBB A;  4ASK A;  1XOY A;  4NIG A;  5FZO B;  1R1A 1;  4PCR A;  3O1P A;  2FDJ A;  3RPQ A;  1OA3 A;  2WO1 A;  1BEV 3;  3ZYI B;  3ZYR A;  1XPW A;  3WG1 A;  2NQY A;  1OSG A;  2LRP A;  4YRD A;  4BQY A;  3JBG 3;  3VDC A;  4YZ5 A;  1UZY A;  5J96 B;  1NX9 A;  2D40 A;  3MIG A;  4TTG A;  3UET A;  4NPM A;  1W8F A;  2RJK A;  4JCK A;  3KMH A;  1HQN A;  1BYH A;  2W1Q A;  3UJQ A;  1OF3 A;  4E2Q A;  3AP6 A;  2JDH A;  4LUL A;  3ACL A;  2WFF 1;  4QXB A;  1LHV A;  3AK0 A;  5LEK A;  1NY7 2;  5DZG A;  3RG0 A;  2IC1 A;  3N7L A;  5IJR A;  3ST7 A;  4QX0 A;  5JOY A;  5GZD A;  2A73 B;  4HVO A;  1YQ6 A;  4O61 A;  1IQD C;  3Q8B A;  2JKX A;  3K3N A;  4YG0 A;  1QMJ A;  2Y60 A;  4Q2F A;  3WX5 A;  1W6M A;  4F83 A;  1EPZ A;  2IVI B;  3GCW A;  1H1M A;  4MXV A;  1W0O A;  2YGM A;  4Q4W 3;  4WZF A;  3EXU A;  1PGL 2;  3BB6 A;  3ZFE C;  1W6O B;  4QQL A;  1VRH 3;  3TEX A;  1XNB A;  2NPI A;  2QDN A;  3T1L A;  4QPI C;  1Q8P A;  2XKO A;  1XND A;  3H7J A;  4BM8 A;  4COZ A;  5AC9 2;  3BGA A;  3K4Z A;  1MEC 1;  2ARX A;  4MHU A;  1NG0 A;  3ZFE A;  3JUU A;  4NIH A;  2RS5 1;  3J7H A;  5B4N A;  3GJA A;  1B09 A;  2WC2 A;  4R9D A;  2E7A A;  4QHO A;  4QPI A;  4I3P A;  4NAO A;  2ZHN A;  2OVU A;  5IW0 A;  1BEV 1;  1GWK A;  1RGS A;  4OLL A;  4CUG A;  1JMU B;  1OOP A;  3N9P A;  1S2E A;  4ARX A;  2D5H A;  2Y38 A;  3JBG 1;  3PVE A;  3I2F A;  5C4W C;  3NKG A;  5CA6 A;  1QJX 3;  3VZJ A;  3HNY M;  3WNO A;  3ZM8 A;  1VBD 3;  1CN1 A;  1HLC A;  3JQX A;  4LE3 A;  2RDQ A;  1WD4 A;  2K9Z A;  1WME A;  5C4W A;  4KGG A;  4Y1X A;  2JB8 A;  2XJQ A;  5A7Q A;  2B5H A;  3PU8 A;  3HEI A;  5JUV A;  2W87 A;  4FPY A;  4C90 A;  3SXW A;  2YPD A;  2N7G A;  1KQR A;  5KHI A;  4FT8 A;  4COY A;  1XU1 A;  2WT1 A;  2W52 A;  2BVV A;  3FHA A;  3OPT A;  2ZX0 A;  2VL4 A;  2WNO A;  2Z2S B;  3N36 A;  3MV0 1;  3VKF C;  1J3R A;  3RZM A;  2YV8 A;  1K3I A;  4XYX A;  2Z42 A;  4QPW A;  4GJY A;  4D6Q A;  2E53 A;  3VL8 A;  4W4Z A;  1VE0 A;  4Q4W 1;  1MZ5 A;  5IUQ A;  3ZFG C;  4FCA A;  2ZXQ A;  2P34 A;  3U1X A;  5ABJ B;  5BUV A;  2JKB A;  1VRH 1;  1FMD 3;  1UZZ A;  4YFW A;  4E27 A;  5FOJ B;  4MAD A;  1W2T A;  1JU3 A;  2PHL A;  2XLA A;  3WY6 A;  1HRI 2;  3ACF A;  1O8P A;  5CVR A;  4LKF A;  1OQE A;  3NVC A;  3SIS A;  3ZFG A;  4D7S A;  1ND2 C;  4HKL A;  2BGP A;  1F9K A;  5KHH A;  2Y6L A;  5APA A;  2SLI A;  3O0V A;  2E32 A;  2JDZ A;  2WA3 A;  4IGO A;  4XFI A;  2QBX A;  2RR1 2;  5FWJ A;  3GDB A;  4OI4 A;  5FOB B;  4AHZ A;  1ULO A;  1US3 A;  4FFI A;  2KR2 A;  1GQG A;  2QQM A;  5EIY B;  2IXI A;  2B4K A;  1ODN A;  1R09 1;  1PGW 1;  3RVH A;  3SCF A;  1ZZ8 A;  1QOS A;  4XMI A;  1OF4 A;  1QJX 1;  5C70 A;  4RYD A;  1POV 3;  1PO1 1;  4NWV A;  1Q43 A;  1QJF A;  3Q8F A;  3USU A;  3TB0 A;  3AX4 A;  3A23 A;  5T52 A;  2ZMK A;  4HKW A;  5DDJ 2;  4WVZ A;  1J3P A;  3BOW A;  1N3Q A;  1RED A;  2VE1 A;  3WD5 A;  1OOP B;  2XQR A;  4P9J A;  3RS6 A;  1WGP A;  2BQP A;  1UZV A;  1W6Q A;  1CZT A;  3JXS A;  4P14 A;  3M2M A;  4Q4Y 3;  1HXS 2;  2R0H A;  4YZ1 A;  5FBZ A;  4CCO A;  5FPB A;  1CIW A;  4GB3 3;  1U12 A;  2G1M A;  1CAU A;  3O1S A;  4B4Q A;  5FZM A;  1DQ6 A;  2GNM A;  1XYO A;  2A6W A;  2OZJ A;  5FZ8 A;  4NID A;  3K4D A;  3AL5 A;  4MVT A;  1LGB A;  1RUJ 1;  4AGV A;  4XUQ A;  1FMD 1;  3MW2 A;  2ORZ A;  2XDV A;  1BCX A;  2D3P A;  2HEV F;  2V5D A;  1SBE A;  3CF6 E;  3EYP A;  2DCT A;  4YW6 A;  5FZ0 A;  2GSY A;  4JVA A;  4XCB A;  1OA2 A;  2PHX A;  1WW5 A;  3T2P A;  1LOF C;  5A1L A;  3WV6 A;  5FYV A;  1E5R A;  3MBW A;  1ZRC A;  2R06 3;  2XB6 C;  5B4X A;  5IVJ A;  1ST8 A;  1XNK A;  2Q30 A;  4QU2 A;  4XAB A;  3AMP A;  5DAX A;  5K4L A;  3LDK A;  4PBO A;  1A3K A;  1C57 A;  1A8D A;  2UWB A;  4I3G A;  3FBY A;  3SCG A;  4ATE A;  1LOF A;  1UU5 A;  1SQ4 A;  4YZ4 A;  1VBC 2;  2UWC A;  3AP9 A;  4QX3 A;  3LEI A;  2PAK A;  2VGD A;  2R04 3;  1XJA A;  2YZ4 A;  1MVQ A;  5IVY A;  5FFO C;  1AYN 2;  2VZU A;  1POV 1;  3OGV A;  4XF9 A;  3NNF A;  4IEW A;  3Q8C A;  3U11 A;  3B3Q E;  3VBS C;  3K4A A;  1SDW A;  3EQE A;  3DV8 A;  5A6Z A;  2G9G A;  5GLV A;  4I30 A;  1F4A A;  4BCU A;  4B1M A;  1JS9 A;  5FZI A;  5JIU A;  1YXW A;  2CNA A;  5BXX A;  4XFF A;  1FNY A;  2ZX3 A;  1AVB A;  1JZ8 A;  2R6Q A;  3OY8 A;  5CKN A;  4YAR A;  4JRA A;  3H1M A;  1LED A;  5I8S A;  4CP1 A;  4Q4Y 1;  4ARY A;  2W92 A;  2Y8K A;  3D82 A;  3RMY A;  3ZPO A;  4BH9 A;  3LEG A;  1G86 A;  4GB3 1;  5C3O A;  4OUM A;  1W8O A;  2BUK A;  4LEJ A;  1RUE 3;  1JW6 A;  4AYU A;  4QXH A;  1NCR A;  1LHW A;  2DVF A;  3S5A A;  1W6Q B;  3THP A;  3POF A;  2ADD A;  4AGG A;  5JPM B;  4IL7 A;  4FQ4 A;  3DEC A;  3FN9 A;  3DYM A;  1VBB 1;  1HV0 A;  4RS5 C;  2W39 A;  4UOJ A;  3ZN6 B;  4B7K A;  1W8Z A;  2BWC A;  4XQW A;  5LCW L;  4M3C F;  4JGY B;  5A3M A;  4MOA A;  4L0P A;  4NUB A;  2R06 1;  3C3V A;  3OJB A;  5FZH A;  1AJO A;  3KHC A;  2GC0 A;  4RS5 A;  5CFD C;  4EN8 B;  4KWK A;  2DU0 A;  3K75 B;  1AR7 2;  4BLI A;  3CKH A;  3U4S A;  4E9K A;  4WM7 B;  3GNE A;  2PQS A;  4OZO A;  5GLW A;  4CU8 A;  4EWE A;  1VR3 A;  2KXL A;  2R04 1;  5IAT A;  2MEV 2;  3PL0 A;  1J1L A;  4AAP A;  1MS0 A;  3TEW A;  1AXK A;  4AFD A;  5CFD A;  4CU9 A;  2IVJ A;  4HK8 A;  5C8C C;  2I2S A;  3RDI A;  2X5I C;  1XE8 A;  4C91 A;  4QQO A;  4AE2 A;  1P8J A;  1WBL A;  4HL0 A;  4WM8 B;  3MDP A;  5DAQ A;  5CG8 A;  1PIV 2;  2VC9 A;  3ZVX A;  4Q5O A;  1IQA A;  2VZR A;  5DUX A;  4J25 A;  5BNP C;  2VNR A;  2D5F A;  2ZEW A;  1W3X A;  1Z0H A;  3URF A;  1S0I A;  2A3W A;  5J7M A;  2X5I A;  5D2A A;  5LRR A;  2FMD A;  3HQU A;  2WFF 2;  2P5B A;  2QCS B;  1XNC A;  1UO9 A;  2C9A A;  3N7M A;  4Q26 A;  4QMA A;  1YI7 A;  1EP0 A;  2W1W A;  3IDE A;  4QQP A;  4ZY9 A;  1ENX A;  4AF9 A;  4MLO A;  2DFB A;  3CEW A;  5BNP A;  1RUE 1;  2AGS A;  1RTV A;  1F35 A;  1A6C A;  4AFM A;  3WG4 A;  2VZV A;  3J7N A;  5CIR A;  4Q8K A;  3OY8 B;  1ZZB A;  3Q8A A;  5LY2 A;  4Q0V A;  2ZX2 A;  4Z8B A;  1QXP A;  3AXD A;  4QQ2 A;  3GF6 A;  4XMA A;  4XAA A;  4CEY C;  2ZML A;  1QDC A;  3VLB B;  3O14 A;  3O0W A;  5K7P A;  2RS1 3;  1K5M C;  5AVP A;  4CRQ A;  3FLR A;  3B9I A;  3ZX7 A;  1RUH 3;  1IS3 A;  1MPX A;  1NCR B;  1Q8O A;  5M0T A;  4M4P A;  5FY1 A;  3ZYP A;  2W5F A;  4YGD A;  3S7I A;  1GOF A;  4CEY A;  4UT5 A;  4JGZ B;  4N53 C;  2QQJ A;  3GXU A;  2XQX A;  2RJ2 A;  3SH5 A;  4Z2W A;  1WLT A;  1OBN A;  1DFQ A;  4K20 A;  4K1Z A;  1XYP A;  5F37 A;  1J58 A;  1RHI 2;  1OVS A;  1RUD 3;  1JN2 P;  3MEP A;  4D8M A;  1I3H A;  2UU8 A;  2VMI A;  3CJI B;  5LA0 A;  3IZO A;  4N53 A;  2GND A;  4DRR A;  3DGT A;  3LPF A;  4ORF A;  1PM7 A;  2NN8 A;  4JC1 A;  4YM2 A;  1RIT A;  3H3Z A;  2RMU 3;  4JKM A;  5L9V A;  2WNU A;  4BMB A;  5FP4 A;  1X82 A;  2OA2 A;  4GWI A;  4MO3 M;  2C0Z A;  3N7J A;  1S0E A;  5JOW A;  4A44 A;  3ZYH A;  1HN1 A;  4M3C B;  5FZC A;  5A7W A;  4AHW A;  2WZE A;  3KHB A;  5FP7 A;  1MAC A;  3I59 A;  1LOA A;  4I0A A;  1AF9 A;  3FFZ A;  4EWA A;  1Q8Q A;  1JH5 A;  1W04 A;  4I0B A;  4LR4 A;  5G04 L;  4X6R B;  1HKD A;  1T6B X;  2AC1 A;  2Y33 A;  4AHY A;  2ENR A;  2VMD A;  3PIG A;  3SEE A;  1JZ2 A;  5C3Q A;  1V70 A;  3DCQ A;  5DAP A;  1GZW A;  4IEY A;  2ZKN A;  5D1I A;  1HV1 A;  5KR7 A;  2BVB A;  1RUC 3;  1SLT A;  2DVB A;  2RS1 1;  1GYK A;  5JOX A;  4GZ9 A;  2K0G A;  1FV3 A;  1GUI A;  2JDA A;  5C7G A;  1RUH 1;  4D6R A;  1UF2 C;  2P6C A;  3I3M A;  4AI2 A;  2GN3 A;  1PVC 2;  5AFE A;  1CX1 A;  5JOZ A;  1U0A A;  5CNA A;  1JZ7 A;  2CSG A;  5K0U A;  4GH4 A;  4FSJ A;  3I54 A;  4I02 A;  5BYN A;  3VZM A;  1UIJ A;  3WQB A;  5IK5 A;  1WCK A;  5FYM A;  4KMQ A;  1CZS A;  3IBM A;  3N9L A;  4FPL A;  4P5Y A;  3OYW A;  1RUD 1;  4D6S A;  3T09 A;  3C8X A;  2WKK A;  3HR9 A;  4RGG A;  1W0P A;  5I0R A;  1ZA7 A;  2ZGP A;  1ZA4 A;  2YGL A;  1AX1 A;  4IEV A;  1U5I A;  4YW2 A;  5DAV A;  5FO7 B;  2HEW F;  4R52 A;  2EF6 A;  2RMU 1;  4XUT A;  1YQ2 A;  1VBD 2;  5F32 A;  2VOK A;  4FXK B;  4FTE A;  3LWC A;  3MYX A;  5FZ9 A;  1QH6 A;  2WWJ A;  3KCX A;  4LBQ B;  3J8F 2;  4HT1 T;  4N53 B;  5EQU A;  1LU1 A;  1NXD 1;  4GWN A;  4CPB A;  1UKG A;  4Y26 A;  1C8M 1;  2VD7 A;  4FPE A;  3FWE A;  1AYM 3;  1U5Y A;  2GP3 A;  1OUS A;  4NRQ A;  2WNU B;  3D3A A;  3BYW A;  1QQP 3;  1PK6 C;  2P1B A;  1D4V B;  3M7A A;  4I2O A;  4QGN A;  3MGU A;  1VB2 A;  3BIE A;  3WF2 A;  4CDU B;  4NRM A;  1K45 A;  3ACH A;  3CU7 A;  4IQP A;  4LE4 A;  2ARE A;  2W9X A;  4MGQ A;  3ZN4 A;  1RUI 3;  4IEO A;  3VD7 A;  4UAP A;  4A3X A;  1RUC 1;  4OI0 A;  1RC6 A;  2NMO A;  4AEM A;  4AK3 A;  1JHN A;  1PK6 A;  4HZF A;  4B4R A;  4AI0 A;  2XJU A;  1JZ5 A;  3I3Q A;  1VB4 A;  4QX8 A;  1CR7 A;  3OSD A;  4GAL A;  4N43 C;  3THT A;  2FMY A;  4RL7 A;  4CZS A;  3B93 A;  4LK6 A;  4MX3 A;  4CUC A;  1GZW B;  1NQD A;  3VD9 A;  1AHS A;  2WBK A;  5FMD A;  3VD5 A;  3ZSM A;  4AI1 A;  1PGS A;  4Y4Y A;  1YI9 A;  2BGC A;  5FUN A;  5FZE A;  2WNV B;  3VHR A;  2VZT A;  1FOD 3;  4N43 A;  3R4U A;  3R05 A;  5KHK A;  1QU0 A;  4IET A;  2JDM A;  4GH4 B;  1CIY A;  5K0U B;  1BBT 2;  1O4Z A;  2VUJ A;  3V56 A;  3ZN6 A;  4R4X A;  4EYU A;  5F1R A;  1W03 A;  1S1A A;  4Y1Y A;  4QX7 A;  3WP5 A;  4UF0 B;  4QPY A;  5A3N A;  1G9B A;  1STM A;  3JQW A;  2A75 A;  5FZD A;  4P02 B;  5FYU A;  4R9C A;  1OLR A;  1QJU 2;  4EN7 B;  2G4I A;  4P08 A;  1VJ2 A;  2VUD A;  2V73 A;  4HOO A;  1OA4 A;  3ABZ A;  3RWN A;  3M1H A;  3BVC A;  1AYM 1;  3M3E A;  1ONA A;  3KT4 A;  3D6E A;  5F3E A;  4ES8 A;  3S7E A;  1S55 A;  4W8J A;  1SLC A;  1AR6 3;  2WAA A;  1QQP 1;  2XOM A;  1MS9 A;  2X09 A;  2ZHM A;  2R1B A;  4ERO A;  4R8H A;  5CKM A;  5EJZ B;  3ZR6 A;  2VZ1 A;  3PIJ A;  1W9W A;  2WT2 A;  3GHM A;  5A32 A;  4XFB A;  1RB8 G;  1RUI 1;  2VMH A;  2ZGR A;  3AFG A;  4LTA A;  1LR5 A;  1AR9 3;  1FPN 3;  3O5S A;  3PJQ A;  1RJ7 A;  1C8N A;  1UOG A;  3RFR A;  5ERL A;  2YBS A;  3KCY A;  3PUI A;  3RYP A;  3PLQ A;  4QGL A;  4KL1 A;  2V09 A;  2JE9 A;  2HLE A;  4GUL A;  5SV8 A;  2O14 A;  4FPF A;  5F6L B;  4YVS B;  2D6O X;  4XF3 A;  1EUT A;  4R9A A;  3W59 A;  2DCY A;  2ZEY A;  1REF A;  4MGZ E;  1FOD 1;  2ZJC A;  4BLJ A;  4XFC A;  3FBM A;  3VHP A;  5FMO S;  3TNP B;  1LOD A;  2Q1F A;  4NOT A;  5JXH A;  1CAV B;  5FKC A;  2B9U A;  3IT8 A;  3A0K A;  4AW7 A;  4PQ9 A;  4CUB A;  4DEQ A;  2R04 2;  1DDL A;  2UY8 A;  4PF5 A;  3U78 A;  1YQC A;  2GNB A;  5FPV A;  2D3S A;  4G3Y C;  1SLL A;  5FTT C;  4CCE A;  1W90 A;  2XR4 A;  5BNO C;  1VBA 3;  2WRA A;  5JDB A;  4N43 B;  3ZYF A;  3E5X A;  3NNG A;  2BOI A;  2QQL A;  1M4W A;  3LSE A;  3E1F 1;  2W47 A;  3PTR B;  4RR3 B;  1Q8V A;  2JWP A;  4KQ7 A;  4ASM B;  4DUV A;  5BNO A;  5D8A B;  1G6N A;  2DBN A;  2DV9 A;  3AYA A;  1X8E A;  2G9Z A;  1AR6 1;  4XUN A;  4JQT A;  1BK0 A;  4QGM A;  5T3N A;  1OQD A;  2A6Z A;  1BJQ A;  3OD4 A;  1GV9 A;  5T5O A;  3W20 A;  3UKV A;  5CFC B;  5JZG C;  2IXH A;  3WOG A;  5EJ1 B;  3KT1 A;  1PZ8 A;  2QQI A;  2WAB A;  1AR9 1;  3UES A;  3VKO A;  1Q56 A;  5JLV A;  1VBE 3;  2TUN A;  1EV1 3;  5JMO A;  4AGR A;  1KJL A;  4ZZ8 A;  3ZIW A;  5FLJ A;  3WT3 A;  3E6C C;  4LOR A;  2YRO A;  5T5P A;  4FAH A;  5JZG A;  3NAP B;  3T0D A;  4LKS A;  4HVR A;  5IK7 A;  4DOU A;  1YWK A;  4GWJ A;  1A78 A;  3ACG A;  1CAW A;  4LHS A;  1QJY 3;  1RIN A;  1JYN A;  5A80 A;  3LDR A;  4LHL A;  5CAD A;  4BOW A;  5KXD A;  3MF6 A;  2BYV E;  2HEY F;  2VQT A;  4A41 A;  5TSW A;  1SPP A;  1GZ9 A;  3RGB A;  3PUQ A;  2BPA 2;  3I2G A;  4FTS A;  1QIQ A;  3APB A;  1UD1 A;  4CCD A;  2OQ7 A;  5E89 A;  2FZ1 A;  4FO9 A;  1OPO A;  2WZR 2;  4OHX A;  4ISR A;  4HBN A;  4BIF A;  5C9A C;  3AZW A;  1VBA 1;  3AB0 A;  3WNN A;  3UGF A;  2A6X A;  4HK9 A;  5I8T A;  2DWR A;  4DB5 A;  3OGG A;  2CGN A;  4J1W A;  3N9O A;  4L97 A;  4QU1 A;  2V5Y A;  2CWS A;  3AXE A;  1LCL A;  4LBJ A;  3M3C A;  3VBF C;  5C9A A;  1B35 A;  1UY2 A;  4I0W B;  1OQ1 A;  3LDB A;  4UFI A;  4M01 A;  1DQ0 A;  5F9T A;  1UXZ A;  2VXR A;  1DU3 D;  1W3V A;  4Q0U A;  1OVP A;  4UW6 A;  2RV9 A;  3K77 A;  3KSC A;  1RUO A;  5ACA 3;  1DQ5 A;  4OCT A;  2VMF A;  3W5M A;  3VBF A;  1LRH A;  1V6L A;  4BPZ A;  1E5I A;  2OII A;  3RJR A;  4Q4V 2;  3BIW E;  1AR8 3;  2GP5 A;  3ILN A;  3WW1 A;  4GWM A;  1VBE 1;  1EV1 1;  1ND3 B;  3IN9 A;  1JHJ A;  1VMJ A;  3OPZ A;  4ZON A;  5ANQ A;  4AI8 A;  3ON7 A;  3ETQ A;  1Z78 A;  2AEZ A;  1BMV 1;  1UU6 A;  2C1F A;  3RZZ A;  3AP4 A;  3WNL A;  5C8W A;  2YU2 A;  2D6P A;  2XJS A;  4IV3 C;  3RI8 A;  4UFM A;  4N8M A;  1QJY 1;  4QWN A;  3J26 N;  5I0D A;  1W39 A;  3PVB B; 
#chains in the Genus database with same CATH homology
 2W3J A;  1XNA A;  2E26 A;  3I3D A;  3IB3 A;  5DPN A;  2Y6G A;  1CZT A;  2VZO A;  1UYY A;  1UZ0 A;  3JXS A;  2YB7 A;  3WF4 A;  3T2Q A;  1J84 A;  1JYV A;  4BXS V;  2J22 A;  4KI5 M;  2W94 A;  3OEB A;  3K4D A;  2ORX A;  1US2 A;  4QX2 A;  5C71 A;  4XUQ A;  1PMH X;  2ORZ A;  1GOG A;  4QAW A;  3MV1 1;  1LNS A;  2VME A;  2V5D A;  1W8N A;  3EYP A;  1OD3 A;  3OB8 A;  1W0N A;  3T2P A;  3I3E A;  3WNP A;  4AAX A;  3MBW A;  1DLC A;  2WAO A;  3LPG A;  5B4X A;  1PMJ X;  2VCC A;  2XHN A;  2YC4 A;  4CVU A;  3VDB A;  3ETP A;  2QQK A;  2VCB A;  4XUR A;  1OT5 A;  3WNK A;  4QX3 A;  5C70 A;  3LEI A;  3MO4 A;  5A1A A;  2VQU A;  2VZU A;  3OGV A;  4XUP A;  2C26 A;  1SG3 A;  3K4A A;  1SDD B;  3VDA A;  1JYW A;  2HYX A;  1F4A A;  2KD7 A;  3CZJ A;  1JZ8 A;  2J1U A;  3I2J A;  1KGY A;  2Z4F A;  3NQH A;  3FHQ A;  2W92 A;  2Y8K A;  4ARY A;  5IHR A;  3OBA A;  2J1E A;  4KWU A;  3T0A A;  3LEG A;  2L9L A;  5JXG A;  1W8O A;  4LPL A;  4A4A A;  2CDP A;  2VTF A;  2C4X A;  3DEC A;  3FN9 A;  3DYM A;  2VMC A;  1ULP A;  2J1R A;  2WZ8 A;  4XVH A;  4ET7 A;  4UOJ A;  2VZP A;  3IDA A;  4QDS A;  5LCW L;  3A7Q A;  5IFT A;  4MOA A;  4E8D A;  4L0P A;  2QQO A;  2YFZ A;  4QDR A;  2VR4 A;  3C7G A;  1W99 A;  3LQC A;  5IFP A;  2VOT A;  3K75 B;  2WQ8 A;  3CKH A;  2VZQ A;  4CU8 A;  2PQS A;  4OZO A;  3T2O A;  2LW8 A;  3III A;  4CU9 A;  1NAE A;  2V72 A;  5FUI A;  3WEZ A;  1P8J A;  1JZ4 A;  2VC9 A;  2VZR A;  2Y6K A;  4QB1 A;  1T2X A;  2ZEW A;  2C9K A;  4CUA A;  2J1S A;  4ZY9 A;  4DEV A;  2W1W A;  2BZD A;  4IUG A;  4JKL A;  2BER A;  3HNB M;  4OMD A;  2VZV A;  3THC A;  1UY3 A;  4TXW A;  3CDZ B;  3HOB A;  5G05 L;  3C7H A;  4XZU G;  3SEP A;  3U37 A;  4QX1 A;  2EIC A;  5LA2 A;  2WN2 A;  4DUW A;  4DXR A;  1MPX A;  1WCQ A;  3CIH A;  4M4P A;  1UY1 A;  3WNM A;  3WF0 A;  2W5F A;  1JYX A;  2X05 A;  4JKK A;  1GOF A;  2QQJ A;  3GXU A;  2XQX A;  2RJ2 A;  2JE8 A;  3WSO A;  3A22 A;  2XON A;  5LA0 A;  4D8M A;  4D0Q A;  2X10 A;  4JX0 A;  3VD4 A;  3LPF A;  2ID4 A;  3HPN A;  2J1V A;  4JKM A;  4GWI A;  2LS6 A;  4MO3 M;  4BK4 A;  4A44 A;  1HN1 A;  2WZE A;  3DYO A;  1UY4 A;  4ZZ5 A;  3ECQ A;  1DP0 A;  3WF1 A;  1KEX A;  5G04 L;  4BDV B;  4OMC A;  2VMD A;  2V4V A;  3SEE A;  1UWW A;  1JZ2 A;  5CZK A;  1R64 A;  3T0B A;  3OGS A;  2J7M A;  1RYY A;  4GZ9 A;  1JU4 A;  1GUI A;  2B9V A;  2JDA A;  5C7G A;  1GQP A;  3AC0 A;  3VD3 A;  3CQO A;  5HPO A;  3THD A;  1CX1 A;  1JZ7 A;  1WKY A;  4CU7 A;  3NRU A;  2W91 A;  3WQB A;  3HN3 A;  4KMQ A;  1CZS A;  3GGL A;  4P5Y A;  3P1I A;  3F2Z A;  4PQQ A;  3T09 A;  3C8X A;  2VO5 A;  4PF1 A;  2DCJ A;  3ACI A;  1H6X A;  1BHG A;  2WDB A;  4UI9 L;  4CU6 A;  4XUT A;  1PX4 A;  1YQ2 A;  3K46 A;  2CDO A;  3I97 A;  1EUU A;  4ZXE A;  3C7F A;  1W9S A;  1XNT A;  3I2H A;  2QQN A;  2VZ3 A;  3IAP A;  2Y6J A;  4A45 A;  3D3A A;  2EIE A;  4LQR A;  1W9T A;  3WF2 A;  4W50 A;  1K45 A;  3ACH A;  2W9X A;  4MGQ A;  3VD7 A;  4UAP A;  3W5N A;  4DUX A;  3HNM A;  1TVG A;  1UYX A;  2VCA A;  1JZ5 A;  3A21 A;  5DQ0 A;  3I2K A;  4CUC A;  5F7U A;  4A6O A;  3VD9 A;  5IYY A;  3OEA A;  2WBK A;  3VD5 A;  5DMY A;  4XUO A;  2W1U A;  4HG6 B;  2VZT A;  3P6B A;  3PUH A;  2W95 A;  2WO2 A;  5DN2 A;  1D7P M;  3BN6 A;  2YFU A;  4AG4 A;  1CIY A;  1TG7 A;  5JXJ A;  1SHW B;  3MUY 1;  3GM8 A;  4A42 A;  1J83 A;  2YC2 A;  3I3B A;  4P02 B;  2DDU A;  1UXX X;  1UMH A;  1PX3 A;  4P08 A;  2ZEX A;  5JXI A;  1JZ3 A;  4Z2A A;  5JR2 A;  3ABZ A;  4W8J A;  2WAA A;  2XOM A;  1OH4 A;  2X09 A;  5EJZ B;  2VZ1 A;  2Y64 A;  4M4R A;  1W9W A;  2YG0 A;  4JHZ A;  4DXS A;  2JD9 A;  2R7E B;  2EID A;  3PUI A;  2WO1 A;  3MUZ 1;  1XPW A;  4YPJ A;  5LA1 A;  2HLE A;  3VDC A;  3FL7 A;  3NJX A;  1NX9 A;  4TTG A;  1GU3 A;  3UET A;  2EIB A;  1EUT A;  2W1Q A;  1OF3 A;  2ZEY A;  1DYO A;  1NKG A;  2VM9 A;  5JXH A;  2VJX A;  5IJR A;  4CUB A;  2W1S A;  4DEQ A;  4QX0 A;  1JZ6 A;  4P00 B;  1IQD C;  5CYY A;  2JKX A;  1O59 A;  4MGS A;  3LE0 A;  4BJ0 A;  4E8C A;  4QB6 A;  1O8S A;  2W46 A;  3NNG A;  1L7Q A;  2QQL A;  3CMG A;  1NUK A;  3E1F 1;  3T08 A;  2VZS A;  4QDQ A;  2W47 A;  4DUV A;  2WYS A;  1XC6 A;  5HXM A;  3LEK A;  4RN5 A;  2J1A A;  3C7E A;  4XUN A;  3BGA A;  3K4Z A;  3J7H A;  5B4N A;  1UYZ A;  2E33 A;  5EJ1 B;  2QQI A;  2WAB A;  3UES A;  3UNP A;  1GNY A;  4A3Z A;  2RVA A;  1F4H A;  1UMI A;  5JMO A;  1CZV A;  3OGR A;  4ZZ8 A;  4ARX A;  3EB7 A;  2BGO A;  3I2F A;  3T0D A;  4LKS A;  3WNO A;  3HNY M;  4DXT A;  4GWJ A;  3ZM8 A;  3ACG A;  3NJV A;  4LHS A;  1K42 A;  1JYN A;  2WUH A;  1JI6 A;  2WN3 A;  5J1X A;  2VQT A;  4A41 A;  2OKX A;  1UY0 A;  3HEI A;  5JUV A;  2W87 A;  1GMM A;  3I2G A;  4QB2 A;  3FHA A;  2VL4 A;  3MV0 1;  2Y6H A;  3WNN A;  3DYP A;  1K3I A;  4QPW A;  2DCK A;  4W4Z A;  2ZXQ A;  1UY2 A;  2E31 A;  3SKV A;  4MAD A;  1UXZ A;  3SKJ E;  1JU3 A;  2J1T A;  2RV9 A;  1O8P A;  3ACF A;  3K77 A;  2ZEZ A;  2VMF A;  3WF3 A;  3W5M A;  2BGP A;  4FI9 A;  3CZU A;  2Y6L A;  3C7O A;  1GOH A;  2E32 A;  1L7R A;  2QBX A;  3GDB A;  1UX7 A;  4OUE A;  3HJR A;  1K12 A;  1ULO A;  1US3 A;  2BBA A;  5EIY B;  1JHJ A;  2QQM A;  4BK5 A;  1H6Y A;  1I5P A;  2WO3 A;  2B4K A;  3IAQ A;  4PT6 A;  1OF4 A;  3WNL A;  3I2I A;  4RYD A;  3OG2 A;  3A23 A;  4OYU A;  5I0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...