2WUHA

Crystal structure of the ddr2 discoidin domain bound to a triple- helical collagen peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
163
Chain Sequence
NPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISCOIDIN DOMAIN RECEPTOR 2
publication title Crystallographic Insight Into Collagen Recognition by Discoidin Domain Receptor 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor/peptide
total genus 37
structure length 163
sequence length 163
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wuhA00
1JZ3A 4W4ZA 2CDOA 2B4KA 4MGQA 1NUKA 5C70A 3AC0A 1GMMA 3VDCA 5JXIA 4CUBA 2XHNA 4M4PA 3ETPA 3HEIA 2BERA 3LPFA 2ZXQA 3C7GA 1OT5A 4TTGA 1L7QA 1JZ4A 1GNYA 1MPXA 2JE8A 1L7RA 2JKXA 2WAAA 4ZY9A 3BGAA 2YB7A 3MBWA 1R64A 2QQJA 3C7EA 4GWJA 1UY3A 2Z4FA 2B9VA 1PMJX 4TXWA 3IB3A 3WNNA 1NX9A 3I3BA 1PMHX 2YC4A 3CIHA 3WNLA 4ZZ8A 5C7GA 2J1SA 2W1SA 4PQQA 2OKXA 4HG6B 2ZEWA 1K3IA 3FHQA 3ECQA 2EIDA 1NAEA 2VCBA 3P1IA 4GZ9A 3U37A 5LA1A 3VDBA 2DCJA 4DXTA 1O8SA 2VR4A 2Y64A 4RN5A 4A41A 3NRUA 3BN6A 4LHSA 1W9SA 3WNOA 2VZRA 4MGSA 4QB2A 3CMGA 1OD3A 3DECA 2XOMA 1JZ5A 2WO2A 2BZDA 1CIYA 2QQKA 4MADA 5JXGA 1J84A 3LE0A 4A3ZA 1DP0A 1CZVA 3J7HA 4KWUA 2HYXA 1O8PA 4FI9A 4AAXA 3OB8A 4P5YA 4XZUG 1GU3A 4GWIA 3WSOA 4UAPA 1UX7A 2W92A 1UZ0A 1OF3A 3NQHA 1JU4A 3UNPA 4QX0A 3ACGA 3IAPA 1UMIA 3DYMA 1SDDB 5JMOA 3T2PA 1OH4A 3E1F1 2ID4A 4DEQA 5IHRA 3HNMA 2Y6HA 3CDZB 5HXMA 3PUHA 2VMFA 5LCWL 2RV9A 3P6BA 2WO3A 2ORZA 2VL4A 4DUVA 2Y6JA 1JYXA 3K46A 3HJRA 5G04L 2VZUA 5JXHA 4L0PA 2X05A 2VMCA 3LEGA 3GGLA 3K4ZA 3I2KA 2WZ8A 3NJXA 3WF3A 1LNSA 2J7MA 4A4AA 3T0AA 2W3JA 2J1RA 1UXZA 4QB6A 2VCCA 1IQDC 2W94A 5B4XA 2QQMA 3ACIA 4BJ0A 4XVHA 4A42A 3OG2A 4QX1A 1HN1A 5I0DA 2PQSA 3WF2A 5JXJA 3VDAA 1US2A 4OYUA 1UYZA 3OEAA 4CU6A 2BGOA 1W99A 4QX3A 3PUIA 3C7FA 2W47A 1W0NA 2J1UA 4JKMA 5JR2A 2WBKA 3HNBM 1F4HA 3VD3A 1EUUA 4A44A 4QB1A 4CU8A 5IYYA 1CX1A 1KEXA 2E32A 4AG4A 4LPLA 2QQNA 4XUNA 4DUWA 3SEEA 3OGRA 2VQTA 2VZ3A 2J1VA 2QBXA 3T2QA 3GDBA 1O59A 1JYVA 2VOTA 3WEZA 3FL7A 3LQCA 2KD7A 4BK5A 1GUIA 2QQLA 3T09A 2C26A 3MO4A 2VO5A 4A45A 5G05L 3A22A 2JD9A 1TG7A 4A6OA 3WF1A 2VC9A 1WKYA 1WCQA 2YG0A 4JKLA 2QQIA 3WNKA 1GQPA 4P00B 2BGPA 3C7HA 4BK4A 4XUTA 4W50A 2J1EA 2WYSA 1UY1A 3GM8A 2R7EB 2ORXA 1UWWA 4D8MA 3WF4A 2ZEXA 2V5DA 3OBAA 1JZ7A 1TVGA 4CU7A 3HPNA 1K42A 1DYOA 5HPOA 1GOHA 3LPGA 4ET7A 4DUXA 4UOJA 4E8CA 3THCA 1CZTA 2DCKA 4OMDA 3C7OA 3DYOA 4DXSA 2C4XA 3A7QA 3C8XA 3W5NA 2WQ8A 2VM9A 2C9KA 2J1TA 2W1WA 3CQOA 3I3EA 4LKSA 2JDAA 5LA2A 3SKJE 5CYYA 3VD9A 2YFUA 3K4AA 1J83A 2VZOA 1OF4A 2DDUA 4QPWA 4P02B 5DQ0A 3I2IA 1JZ2A 1GOGA 1K12A 3EYPA 3DYPA 4CVUA 4PF1A 4OZOA 3LEIA 2L9LA 3SKVA 3OGVA 2WUHA 4XURA 3MV11 2VMDA 2W95A 2WN3A 4CU9A 3MV01 4PT6A 3VD4A 2VZ1A 1JYWA 3W5MA 5DPNA 4BDVB 2WABA 3HOBA 2CDPA 2X10A 4QDSA 2VCAA 2QQOA 4W8JA 3T08A 1SHWB 1PX3A 2W1QA 1D7PM 3WNMA 1EUTA 4P08A 2E26A 4YPJA 2XONA 3WNPA 3F2ZA 3I2GA 3LEKA 2YFZA 3T0BA 3ABZA 1PX4A 2WN2A 3IAQA 2HLEA 3SEPA 3OEBA 4QDQA 2Y6LA 4KMQA 4ZXEA 2Y8KA 1JI6A 2VJXA 5JUVA 3I3DA 5EJZB 1ULOA 4ZZ5A 2W1UA 3I2JA 1US3A 2W46A 2E33A 2W9XA 1ULPA 3FHAA 5IFPA 5A1AA 1T2XA 1JHJA 5J1XA 3T0DA 2E31A 3VD7A 3D3AA 3JXSA 4UI9L 2X09A 4OMCA 2W87A 5EIYB 1UXXX 4OUEA 2EIBA 3HNYM 3I97A 1UMHA 1XNAA 3ACHA 4DXRA 2WO1A 3WF0A 1DLCA 2YC2A 1W8OA 2W5FA 5F7UA 1XPWA 3CZUA 3MUZ1 2LW8A 3HN3A 5CZKA 1BHGA 1XNTA 3THDA 5LA0A 3NJVA 3A21A 1UY2A 1F4AA 3WQBA 4Z2AA 3CKHA 3OGSA 2WZEA 5IJRA 3K77A 1RYYA 2VZVA 3UETA 2Y6GA 2J1AA 4IUGA 4BXSV 1I5PA 1SG3A 3GXUA 4RYDA 1GOFA 5C71A 2VQUA 1JZ6A 4MOAA 3FN9A 1W9WA 1XC6A 3ZM8A 1YQ2A 2Y6KA 4MO3M 5DMYA 4XUPA 1UYYA 3UESA 3T2OA 2ZEYA 4ARYA 4XUQA 2W91A 3VD5A 1UY0A 2V4VA 2ZEZA 3CZJA 4LQRA 2V72A 1KGYA 4CUAA 2BBAA 4M4RA 5IFTA 4D0QA 1NKGA 1W9TA 1P8JA 1H6XA 3MUY1 4QAWA 4ARXA 2VMEA 1JU3A 1H6YA 3EB7A 4DEVA 2XQXA 1UY4A 1K45A 4E8DA 3NNGA 3A23A 2VZPA 5FUIA 3I2HA 5B4NA 2RVAA 4XUOA 2RJ2A 2EICA 1W8NA 4JX0A 2VZTA 2EIEA 2VZSA 1UYXA 3K75B 4JKKA 2WDBA 2J22A 2VZQA 1CZSA 4QDRA 3K4DA 3I2FA 3ACFA 4CUCA 2LS6A 4QX2A 5EJ1B 4JHZA 3IIIA 2VTFA 1JYNA 3IDAA 5DN2A 1JZ8A 4KI5M 2WAOA
chains in the Genus database with same CATH superfamily
2VOKA 4X8NA 2CDOA 2B4KA 2ATFA 2RMU1 3MIBA 1NUKA 4PI0A 5C70A 1ZRCA 3GHNA 2B42B 3U0ZA 4MGYE 3H3ZA 3MIEA 3VDCA 5A3LA 1F2NA 2XBO3 4LITA 1EV11 3GJBA 3HVDA 1RUJ1 4CUBA 3J8F1 4K40A 3MIDA 1HV0A 3Q9OA 4UFLA 5FMBA 1WW7A 1HIXA 4LO4B 1EYBA 4JDMA 1APNA 4TTGA 1L7QA 5FJKA 3S7EA 5B4NA 3IPVA 3HQRA 1YJKA 1N3OA 2RDNA 4XFHA 2ZPXA 1L7RA 4ZY9A 1O4YA 3NV4A 4WVVA 4YVSA 4GWNA 1UX6A 2XJSA 1R64A 1B35C 1G9AA 4M0HA 3BODA 2LUWA 4NMIA 4FPGA 2B9UA 2B9VA 3SCHA 3IB3A 4CXWA 4QX7A 2CGPA 3I3BA 5K0UB 1VJ2A 3O1VA 1A34A 2YC4A 3CIHA 4PQ9A 5C7GA 5F3CA 2GN3A 2J1SA 5AVAA 4U2AA 1AR72 1ENXA 4HG6B 4OQ9A 1VMFA 1K3IA 1KFXL 3FHQA 1V6KA 4HSLA 5C4WB 3ECQA 2EIDA 5FKBA 2XHKA 4WZFA 1VBE1 5BNOA 1UNBA 3TEWA 4GULA 3AZYA 4BQ3A 3VLBB 4AFBA 3NRUA 4N53A 1IKPA 4NIHA 1HW5A 4WVMA 4LHSA 1HRI3 1M4WA 1OKOA 1W0PA 1S2KA 2UWCA 3VV1A 2VZRA 5H9SA 3ZIXA 5A6XA 3ZYGA 3U4SA 1QJX2 3A4UA 3HQXA 5CADA 2ZGSA 5K4LA 3PTYA 2XOMA 1JZ5A 2WO2A 1CIYA 1BCXA 1Y7BA 4UW3A 1KJLA 4O65A 4TN7A 2JG9A 1X36A 2B45X 4LOTA 4XF9A 4YVWC 2RJKA 2VD7A 1RB8G 3CBNA 3D0SA 4YWAA 1CZVA 1NXMA 1OOPB 5ISLA 2GN7A 3R6SA 3U78A 4Q1PA 4DO0A 1O8PA 1UIKA 5FZ8A 5HV0A 5IW0A 4XHBA 4CDWC 4CSWA 2HWB1 2WL1A 3GJAA 1N47A 2VCMA 3VL9A 1IGOA 1AR91 3JQWA 4QXBA 2Z2SB 2VUDA 3AMNA 3S0MA 2VMHA 2UYAA 4JGZC 1N1SA 3H8XA 1UKRA 3J7NA 4AI9A 3R4SA 3NL1A 5IVBA 4A3XA 1W28A 2W2IA 4URTA 4YNIA 2I07B 3IM0A 4Q5OA 2FDGA 4QX0A 2GNDA 4YZ4A 3BTYA 2Q4SA 3KF5A 3M7AA 1GWKA 3RMXA 3P3NA 3IAPA 2R073 1POQA 3NJZA 1QH6A 4AEDB 3RJ2X 3PVEA 1WBFA 2WS91 1MS4A 1RGSA 4K3UA 3MW2A 3VDDB 1ZBA1 5DZFA 4NHMA 4DEQA 5F39A 1OD5A 2ZMNA 4N9IA 2Y6HA 4UW4A 4XJAA 5IATA 5HXMA 4WM8C 5IVFA 2XB6C 2VBBA 3VGIA 1HN0A 1DQ5A 2PLV1 3AJZA 5JCTA 2WFF3 3ENRA 4HT1T 2ORZA 4RFRB 4BQ1A 3ZFFA 4DRVA 3PVOA 2QDNA 3PVBB 1JYXA 3K46A 4GB32 5GKAC 5G04L 4FPEA 5JXHA 3ZKYA 2GC3A 1JOPA 4EWAA 1Z7S3 2VMGA 4ZHNA 4BWOA 2VNGA 2VTXA 3FC0A 1VBC1 3LEGA 1VLNA 4E4SA 1BBT1 1LULA 1V6JA 2ARAA 2RM21 3AX4A 3C2UA 3IPVB 4CDUA 3VBRB 3I2KA 4OHYA 1RHI2 4YVSB 3NJXA 3VBOC 4QU1A 1KDKA 2BVVA 2HWE1 3AMHA 5KBFA 4XILA 1RUH1 1IZ3A 5AFBA 2C5DA 2YC0A 4PBPA 2YU2A 4Q29A 1Q5OA 2OXBA 4Y1XA 4AHWA 1UXZA 5DABA 4LTAA 5C3QA 2VCCA 4OULA 2BWAA 1QJY1 4UBGA 4E2QA 1O7FA 5LWBA 3M70A 4B4QA 1DZTA 3J9SA 4HETA 5BNPB 1N1TA 2C0ZA 2ZGLA 4A42A 4XHXA 3BI3A 1RUF3 4X8PA 4KGQA 4N8MA 4IW3A 3UGHA 1PGL2 5FREA 2X8KA 4GIQA 1W6PA 4N53B 1QJU3 3U11A 4WVMB 1O3QA 1J59A 3LGRA 3LF7A 1G7YA 3PUIA 2UY8A 1A6CA 1KITA 3LA3A 5FZFA 1XQNA 2XH6A 5JI7A 3KCYA 1IG3A 4BE3A 5J37A 4B4RA 4AW7A 2RS53 4F8AA 1H1AA 1W6MB 1CX1A 2JG9B 4XABA 4AI2A 3LDRA 2O8QA 4HN1A 4L11A 2GH8A 3PLQA 4Y1UA 5LBFA 4DUWA 4EZ4A 3SEEA 3OGRA 2ARCA 2VQTA 2WZR1 2WNVA 1U5XA 2QBXA 3HIFA 4HZFA 5FUNA 1RIRA 4Q0UA 1CN1A 2R49A 3RZKA 3PUSA 1J3PA 3AL6A 3HT1A 1HV1A 1OUXA 4FPCA 1SZBA 5FZMA 1RUD2 5FMCA 2AR6A 5FZDA 2Y6FA 4XE9A 3FLRA 1CAXA 4Y1YA 2DVGA 2PTMA 4BMEA 3H7JA 4MZUA 4AVAA 3FBYA 1CAUA 2WT0A 2VW1A 3LOIA 5FJHA 5FLHA 3ZXDA 3T2TA 4NWVA 4A6OA 4W6YA 1YUDA 2A5ZA 1V9U2 3NW4A 4MG2A 3VB9A 2BTVC 2QQIA 1W05A 3WNKA 1GNZA 3THTA 5FZLA 4P00B 5T52A 3C7HA 1EPWA 2O0OA 4IE7A 2OIIA 3GM8A 3FLPA 3ST7A 4M00A 1D4VB 4FTBA 2VQAA 3RMYA 1UMZA 3BKZA 1OSGA 1SBFA 2BYVE 3ILRA 4RQPA 5FZEA 4CDXB 5JSOA 5FPVA 4Y24A 4AEMA 1FMD2 1HQLA 2YXSA 3OBAA 1VBB3 5F3IA 3ZN5A 4CU7A 3ZYBA 2ET7A 3HPNA 4LHNA 1UAIA 3ZFFB 4YZ2A 5L7OB 5I0RA 4Q26A 4ET7A 4D6SA 4DUXA 1REEA 4FPYA 4UOJA 4E8CA 4KU7A 2K0GA 4OMDA 3NAPC 5J96B 3ZPOA 2E51A 2V5YA 1A8DA 4ORFA 4ISRA 5JI9A 1D2SA 3C8XA 2JG8C 4FSJA 3W5NA 1UPIA 4JDOA 1MZ6A 1QJX3 3PNAA 5J7MA 3WD5A 1D4M2 5AVPA 1OVSA 2PFWA 2VQ0A 1QNWA 5LATA 3UL2A 3CQOA 1JXNA 1HDKA 2IXCA 1YO8A 3DXUA 4QPGC 4QXHA 2BV4A 5F2WA 1AX2A 1XRUA 2DBIA 4LO6B 4XJ9A 3TN93 4LULA 1B35A 3RJRA 1VP6A 1VBA2 4HPKA 2P3KA 2EIGA 3LDKA 4P9JA 1URXA 2YFUA 3K4AA 1J83A 3K3NA 2TUNA 2ZHNA 4RGAA 5C3SA 1OFSA 4XPVA 3U07A 1RUI1 2R32A 4YARA 2DDUA 2X5IA 4QPWA 4BQ4A 5APAA 2AGSA 4E2SA 1LEDA 1YEWA 5KXDA 1GOGA 3EYPA 4NOTA 1HB4A 1F5FA 1NY72 4IGPA 5FK7A 2AC1A 1KD7A 3SKVA 1OLME 4LBJA 4XXAA 3LOBA 3OGVA 2WUHA 4XURA 1PIV2 2VMDA 1WLDA 2XKOA 1ULCA 2WN3A 4KL1A 4JCKA 3VD4A 5FXXA 1JYWA 5KHHA 1CAWB 1W06A 1OUSA 4Q0SA 4B3NA 3W5MA 3PJQA 3V0BA 1MQTC 2LRPA 2RMU2 2E6VA 4DQAA 2PAEA 4QDSA 3HWJA 5M0TA 4AGRA 3BB6A 1EV12 1RUJ2 3T08A 2WNVB 3J8F2 1XJAA 3JU9A 2ZZQA 2W1QA 2BBVA 2A1XA 2JICA 5BXXA 1DZQA 2QTWB 3FUQA 1LJ7A 2VECA 1VB2A 4P08A 4D7TA 1LOBA 1XNCA 2E26A 3UYJA 4EQVA 3WNPA 3F2ZA 3I2GA 2JDMA 1F5JA 1YI7A 2VW2A 2NQYA 4R52A 2IXJA 1FPN2 1ACCA 2HJIA 2R30A 5FK8A 1TMF1 1CAUB 2CL2A 1Y9QA 3ABZA 4JQTA 3PTRB 4JGZA 4OCTA 5FBZA 5H9PA 4AHXA 3RZHA 5FZ4A 1F8VA 1PGSA 1RHI3 3KHBA 4FQZA 5F5AA 1DQ4A 4LJHA 4MUVA 4QDQA 4AQSA 5AC91 4IE6A 2VUCA 1JOBA 1RVF1 4FAHA 1WGPA 3ZXJA 5DAWA 2AEZA 1LECA 3M1HA 3OUHA 4MX3A 2D5FA 5LZ6A 3V0AB 1HQNA 3ZPYA 2VUJA 4KWJA 3PU8A 1MS1A 2A71A 1ULOA 4RHV1 5FZGA 4CUGA 2GNBA 4XAEA 1GQHA 2E33A 2W9XA 3POGA 4QM8A 5C33A 1LGCA 4P9IA 1ULFA 1VPHA 2GDFA 1R083 3D8CA 3WG2A 3T0DA 2BGCA 4WM8A 3ZXLA 2G9ZA 4EE2A 2OVUA 3OD0A 1VRH1 1GV9A 4XFGA 3RRDA 1JOJA 4IEZA 4QT6A 1NCRC 3SMHA 3MZHA 1UXXX 5A32A 2XVLA 3I49A 1LKNA 1SFNA 2FBEA 2FMYA 5DUVA 4OUSA 4CEYC 1Y43B 1GZTA 3WVJA 3I97A 2PHDA 5ACA1 2ZGRA 2Q1ZB 1UMHA 4Y26A 4GJZA 2WFPA 5FY5A 2HWB2 5T54A 3I3MA 2BNOA 3VBOA 2WO1A 3M3QA 1B35B 3WF0A 3MF6A 3LIHA 4JDNA 4QQ2A 1QDCA 2OS2A 1LHOA 3CZUA 3LCPA 1ZZ6A 2XWBB 3VDDC 3AXDA 1RUG1 2P17A 1XNTA 2X5IB 3EXUA 3A21A 5DXDA 1R091 2BP6A 2WLPA 2Q1MA 1ZA7A 1PZ9A 1ENRA 2V4AA 3N7JA 3CKHA 4FFFA 2A6ZA 1ZRIA 5IJRA 2QUOA 5DG2A 3DKWA 4PI2A 4C91A 1W3XA 3RZLA 2PXJA 5FO8B 1SG3A 4QWNA 4RYDA 3VKOA 5KXCA 5KHJA 1V9U3 1PO21 4PLMA 1JZ6A 3TEXA 2E7AA 2IZWA 4DINB 3J26N 2ZGOA 3OBRA 1RC6A 3IDEA 1DLLA 1H0BA 1GQGA 1SQ4A 3KGZA 3WP5A 1UYYA 2Y0OA 5JAXA 4UFIA 2PLV2 4UXAA 3T2OA 1HJFA 2ZMLA 2W91A 3VD5A 1XU2A 3AM2A 1WLTA 2WQZC 3CZJA 3NV1A 1FMD3 4UT5A 2WWSA 4G3YC 4XOGA 4YZ3A 5A3TA 1KGYA 1QU0A 4OFGA 5FZOA 3JCIA 1OA2A 4R9BA 5IFTA 3TAYA 5HXVA 5E8AA 2R1DA 2ZX1A 1KDMA 1S0CA 4R9AA 5FOJB 4BPZA 3RQ0A 1UU4A 4CDWB 2IVIB 4ARXA 2VMEA 3DEMA 2V73A 1HRV3 5BNOC 1H2KA 1NE4A 5BV6A 3AL5A 3CJIC 1RUH2 4O9EA 2ZMKA 1PHMA 4KNCA 5JIUA 4JGZB 4XIKA 1CJPA 3ON7A 3A23A 1GWMA 1D4M3 3I2HA 4BA6A 3N9MA 5FAXA 2RJ2A 1QJY2 1RTVA 1OMIA 4BLJA 1AXKA 2WINB 4QD2A 4BB3A 3OOXA 1W6NA 2VZSA 4D7YA 4I09A 1X82A 4NE9A 1CQ9A 2DU1A 4NPRA 4JKKA 5LW9A 4NRQA 2VZQA 1WBLA 1CZSA 2HWF1 4QDRA 4F7ZA 4FCAA 3GCWA 3K4DA 2R16A 2J42A 3KV5A 1VBD1 2EXIA 4COVA 4XMIA 1NA1A 4J25A 4NAMA 4AVTA 4Y5Z0 2LS6A 2RDQA 3AB0A 2XLGA 3CO2A 3T1MA 4IEUA 1NG0A 1AXYA 4LR4A 4NPLA 2TEPA 3IDAA 4WM8B 5DN2A 1JYNA 1JZ8A 3D6EA 5FMOL 1AYN3 3RGBA 1UU5A 4XEZA 4WV8A 4XFCA 3ILNA 1PIV3 3O12A 2ETEA 4IDZA 1C1FA 5JPMB 1C5IA 2VNVA 2JDKA 5A32B 3NAPA 3AC0A 5FZ7A 5JXIA 4MGKE 5DDJ2 3ZSJA 2XHNA 1UN1A 5EXOA 5B2GB 2CAUA 4GQ7A 4AI3A 5J48A 2JG8A 2Y33A 4XBQA 1J1LA 5ERLA 4GH4C 1ZRDA 2CU5A 1IS5A 3HEIA 2BERA 1PO11 3C7GA 3VBOB 4LBQD 4XJ8A 1DQ6A 5GZEA 1G9FA 3IDCB 2SBAA 3BGAA 5T55A 1KS4A 3GZUC 1FYUA 1IOAA 4PCRA 2AEYA 5FRAA 1XYNA 5GZCA 3C7EA 5L73A 4UF0A 3B01A 4LE4A 5FYBA 1PMJX 2UWBA 4TXWA 4Y5TA 3VL8A 3R4UA 3WNNA 1NX9A 3N35A 3B69A 1NZCA 4AFCA 2EALA 1PMHX 3HT2A 5CNAA 2ET1A 5F3GA 1FPN3 2W1SA 4YW5A 2X29A 3T3YA 1DG6A 1SCSA 3OBTA 3J4UH 5FIXA 2ZEWA 4QPIC 2O8OA 2A3YA 1MS9A 5KXBA 4BIOA 4GZ9A 1XYPA 3U37A 5LA1A 5J98B 5JVVA 4DXTA 4CDUC 4H7LA 1CIWA 2VR4A 5E16A 4OI0A 5FY8A 2BVBA 3ZMOA 3RYPA 1A8MA 5JZGC 2IXKA 1G86A 1SLTA 1UZYA 2OW4A 4COZA 3WG3A 1SBDA 3WNOA 1OVPA 3B5LB 1MQTA 2QVSB 4MGSA 1OXCA 2P37A 4QB2A 5CFCC 3RWKX 5K9YA 1HB1A 2XXZA 3MIGA 4P9XA 1OD3A 5F3EA 4D6RA 2QQKA 4WBBA 5FZOB 3MGUA 1NQJA 1ZBE2 3AP7A 3SLIA 5L9RA 3N7KA 5C5TA 1J58A 5JOXA 4NHKA 3GF6A 3GHMA 5FXVA 3K48A 1DP0A 2WIIB 5LK7B 2OQ7A 3J7HA 5A3OA 4KWUA 2GH2A 1N3QA 3ZO0B 3B9IA 4FI9A 1I6XA 5DAQA 4XMAA 3ZYHA 4E2GA 3WW3A 1TME3 2ZZJA 3J7MA 3DGTA 3ZYJB 2GSYA 4ES8A 1V6IA 1V6OA 1IHMA 4GWIA 4UAPA 1Y9GA 2W92A 1W6NB 1UZ0A 4YM1A 2KA3A 1BXHA 2WA3A 3LIGA 4LA3A 1FT9A 3ZDSA 3NQHA 2GNTA 2PA7A 2A3WA 4QQHA 4XDOA 3KV4A 4Y4YA 4BQXA 2EA7A 3ACGA 1F31A 4P5HA 1NA1B 4EV0A 2P3YA 2KR2A 5A70A 2RS13 3ALQA 2DUQA 5JMOA 2IFRA 3BTZA 2ZACA 4ASKA 5CG9A 3E1F1 1QKQA 1W90A 2ID4A 4ZKTB 2VVFA 3EBRA 4XFFA 3VHRA 1C8M1 3HNMA 2P3IA 3CDZB 2P6CA 5LCWL 1GBGA 1W2OA 2RV9A 4IERA 4L9BA 5IVJA 1S0DA 3NAPB 3P6BA 1PGW1 3CLPA 2VL4A 4H55A 2Y6JA 4NHLA 2N7GA 4YZ5A 1UZZA 4OHXA 1AL21 2JG8B 4V2WA 2PMWB 4L0PA 1UYPA 4I0WB 3BOWA 2X05A 1SPPA 1WW4A 2PLV3 5A33A 4CEYA 3SC7X 1GANA 3GGLA 3LA2A 1O4ZA 4QPGB 3K4ZA 1SLIA 3M3CA 3J7LA 5KWRA 4RQPC 5FPXA 1L7LA 1LNSA 1X8MA 2ZA9A 1YFYA 4X6RB 1TMF2 4NIIA 4UF0B 3UGFA 2YMZA 5HCFA 1ZX5A 4A4AA 1SFYA 4EWDA 1POV0 4L97A 2YGLA 4AR2A 3FZ3A 4H3WA 5T50A 3ZXAC 4XQDA 2VGDA 4QB6A 3FFQA 4IEQA 5B4XA 5AC92 1RVF2 1ENQA 4LBNA 2TNFA 4ASLA 4BJ0A 4AOCA 5FO7B 4XVHA 1RUNA 2LROA 4F3JA 1GZCA 5A80A 1CAVA 4CPBA 1HN1A 1UO9A 5CAZA 1M06G 2JWPA 4RHV2 3WF2A 2CSGA 5JXJA 3S57A 2WC2A 2A3XA 4Q1RA 1US2A 1UYZA 2EXJA 3IWZA 3WW2A 4CU6A 1QOOA 2BGOA 2BEOA 3C7FA 1ZM1A 1W0NA 1OQ1A 1MQTB 4LA2A 4B4PA 1CVNA 3PURA 1QNYA 3OCPA 4YM3A 3RZMA 2WSVA 1LR5A 5I8SA 1OLRA 1BEV1 1U12A 1S0GA 2OQ6A 3ELNA 2P1BA 4A44A 3BU0A 2IXLA 5IYYA 2DVDA 2X5IC 5HCAA 1KEXA 4AG4A 1DDLA 4LPLA 3TOJA 4XUNA 1PVC3 5FXWA 3WQ0A 3ROUA 1QXPA 2J1VA 3H8UA 3S5QA 1O59A 1HJGA 1YNAA 1VRBA 3MF9A 1NXD1 2JDPA 4KGGA 4Q4X3 4QX8A 3FL7A 1FOD1 3LQCA 1Y9MA 4GMP3 4BK5A 1GUIA 1PNGA 1SFPA 1ULEA 2QQLA 2ZHKA 4UFKA 3CJIA 1FV2A 2VO5A 2YYOA 4SLIA 4RFT0 5DDJ3 3RVHA 4BIFA 5IT6A 3A22A 1ST8A 2G9GA 4RR3A 4D7SA 3OD4A 3RZZA 3ASIA 3CHXA 4MLOA 2DU0A 3QACA 1W2TA 1HQWA 1R092 2A75A 3TRSB 4E4ZA 5FPUA 3N3HA 4IE5A 4ONUA 3KD4A 2BPA2 2EAKA 2Y0IA 5DAPA 1QGLA 2DCZA 4HN0A 2JDNA 2I45A 4DS0A 1ND3C 1YI9A 4UBHA 2YG0A 4CZSA 3MPBA 2DTYA 3U4XA 2D6NA 4AAPA 3JB8A 1YRZA 4Q4W2 1H2MA 2XR4A 1REFA 4W50A 2J1EA 2GMMA 1UY1A 2A73B 2WYSA 1Z78A 1PO22 1RUC1 2R7EB 3AMQA 1LB2A 1YQCA 3KV6A 4D8MA 1C1LA 3WF4A 5A1LA 1BK0A 3LFIA 1C4RA 1ZYBA 2PHWA 4Z07A 2CTVA 2V5DA 3W21A 1DU3D 1UW8A 4K1YA 5I91A 2NMNA 2VVEA 2K9ZA 1TVGA 5CEHA 3LFMA 4KBBA 1V6LA 4BXFA 1S2EA 5CA6A 1K5JA 3AP6A 4FPLA 3WW4A 4ASMB 1R1A1 3LPGA 1WWYA 1NCRB 2A7AA 1CR7A 2JB8A 4QHBA 3C3VA 5T5LA 3AYEA 3THCA 2DCKA 2D3PA 3CNAA 3C7OA 3DYOA 4DXSA 4NROA 3VUOA 1ASJ1 4YW7A 5A33B 4CEYB 2C4XA 4LKFA 1AR81 5I0TA 3RYKA 2XL7A 4GH4A 4S2HA 4NO4A 1BKZA 2Y26A 3VZNA 1G9BA 2VM9A 4JRLA 1HXS2 1QWRA 4M3CF 4AQTA 2W1WA 1AVBA 5TSWA 4LKSA 1ZBE3 4B8EA 1H8TC 3M2MA 4XTPA 1DQ1A 4K21A 2JDAA 1SLLA 4R4ZA 3HBZA 4LO7A 2WNOA 3JBG2 4TSVA 3VZKA 5C3RA 1Q8VA 3FE5A 3VD9A 4OQ8A 2VZOA 1EAH2 2ZAAA 1OF4A 3I4IA 4WZCA 3TEYA 1YFWA 3TYJA 4AGGA 3AP5A 4P02B 2ILMA 1JS9A 2VOVA 3KB5A 1RJ7A 2WKKA 1CAVB 3I2IA 5D8AC 3EO6A 3CF6E 4TZDA 4YG3A 5F6KA 4QPIA 2HWF2 4PF1A 4YZ1A 2WNEA 4FOVA 5F1RA 3H3UA 4Q0QA 4ZPIA 1VBD2 4QGNA 4YM0A 2L9LA 5IWFA 2RHPA 1GP5A 1PZ7A 3GALA 5ANQA 1COV1 3UJOA 2ENRA 3WP4A 2JE7A 5FYYA 4JAAA 3AJYA 3VZOA 5FZ9A 5IVYA 5JZGA 2WQ4A 4AYUA 2QQUA 5CVRA 1LHUA 1WA4A 2WABA 2VMIA 3LZZA 2XKPA 1MR5A 4O9GA 5FPBA 2BFUS 5CFCA 5L36A 3O1PA 4GALA 2VCAA 2MEV1 4ITCA 4NJ4A 4W8JA 2HWC3 2OZ6A 3WV6A 4CEWC 3D5OA 4LHKA 1X8EA 4XFBA 1PO12 5IK5A 1QXJA 2R0HA 3WNMA 1RMU3 2NM1A 5BNOB 1E5RA 5BY5A 3N9OA 1EUTA 2ZOEB 3CJIB 1WW5A 4GXLA 4MHUA 4YGCA 4M01A 2XONA 2YBSA 1QY4A 3BYWA 4GMP0 4P14A 4YPJA 1DBNA 3GZAA 4KU8A 5CU1A 1OH3A 3O1SA 3NNJA 1VAVA 1XXNA 3AZVA 3DN7A 3PUAA 4D6QA 4PJYA 2XBO1 2EF6A 4XFAA 1PX4A 3EJKA 4AWDA 4OHVA 1ZZ8A 4NAOA 3THPA 2GMEA 2HLEA 4AI8A 3SEPA 5FZBA 2RS33 3USSA 3TEZA 2EAAA 4XJUA 2NN8A 4FFIA 1GNHA 4ZXEA 3DPRC 2Y8KA 4LIUA 4LT5A 1ZZ9A 2VJXA 5JUVA 1FV3A 3GYDA 1GR3A 4XQ4A 5EJZB 1PMIA 4Q0VA 3MHZA 4ZZ5A 3DL3A 2W1UA 4KG0A 4QXCA 4PLOA 4MVTA 1Q43A 4C8DA 1WMEA 1ULPA 3FHAA 4CCKA 5IFPA 1JHJA 3MLKA 3I54A 3JQXA 3UJQA 5J1XA 2FDHA 4M0NA 4Y1ZA 1W8WA 2C24A 1LU2A 2A6XA 2WO7A 2PELA 5A7OA 2X09A 3HAGA 2W87A 2QE3A 4AQ6A 2CY6A 4IGQA 4P9LA 5FYIA 4Q4V2 4XDQA 1VR3A 1UF2C 4SBVA 2D93A 3AMMA 2V09A 4GH4B 4OUEA 4Q2FA 2EIBA 4ZU4A 1D2QA 3KCCA 4I2OA 4R9CA 1NZIA 1KXGA 3HNYM 3KMHA 1VAKA 1YLLA 1XNAA 1X50A 1Q56A 3POBA 1RXGA 4I0BA 3NNFA 1NA1C 4Q4Y2 4R4XA 3H0OA 2ARXA 2F6BA 3PMSA 3ZX7A 4COWA 5BNNC 1AR73 3POEA 2YC2A 4MXVA 3Q8BA 5F7UA 3B94A 2Y60A 1XPWA 1ZZCA 5CKMA 2D6LX 5ABJC 4YGEA 1LESA 5CZKA 2PHLA 5LA0A 1GICA 4YRDA 5D1IA 3UGGA 4DY3A 1IG0A 2IC1A 2QKDA 2Q8DA 2XUMA 4N43A 4HKWA 1UY2A 1F4AA 3WQBA 2FCVA 1TEIA 4QPIB 5FFOC 3VBSA 3CU7A 1CWPA 3FBMA 2WZEA 4RS5A 2GC2A 1RYYA 5FZCA 3UETA 2Y6GA 4AK3A 4CDUB 2Z42A 1GZWA 1I5PA 3GXUA 3KVBA 1FATA 4DOUA 4QHOA 1AHSA 4MOAA 5CIRA 5JZGB 3FN9A 1L3JA 2A6VA 3E5XA 4Q4W3 5FP7A 2VOWA 2HWD1 1C8M2 2QQWA 2ADDA 3BPSA 4Y5SA 5J36A 4Y3OA 1XE7A 4XUPA 3N9LA 3UESA 5CFCB 5CKNA 4ARYA 2ZEYA 1H2NA 1PGW2 4M3CA 3ZN4A 4META 4LNVA 3B7MA 3PMEA 2NP0A 2UYBA 3MFAA 3SXWA 2R071 4UYBA 2V4VA 5F8PA 3NJYA 4AQ2A 4FPFA 4RSUA 1AL22 1W8UA 5DAVA 4CUAA 1UCXA 5A3PA 1QQP1 2VTXJ 2IVJA 2R062 2A6YA 4NIAA 1NKGA 1MS0A 4COYA 1RUOA 5A7QA 3MUY1 1W6PB 3ZDVA 3RYRA 4IEPA 1JU3A 1FNYA 1OC1A 5LB6A 2WFF1 5CKQA 2B46X 2XQXA 5FOBB 2FDFA 1UY4A 5FUPA 2BW8A 2GAUA 5DUWA 2JDYA 3ACLA 5FKCA 1AXZA 5FUIA 3HD8B 5GLWA 1HXS3 4JV4A 3B3QE 2AH2A 2EICA 2OUHA 5F5IA 1N1VA 1W8NA 2JENA 5FYZA 5GLTA 5JDBA 4AVBA 2JIJA 1BJQA 2VUAA 2XGXA 4XJWA 1ND3A 4INDA 5A7SA 3UKTA 1LOCA 5A6ZA 3JBG3 3N9PA 4C0BA 3K75B 2BOJA 5FV3A 5L19A 1YIFA 1U5IA 3AKTA 2WDBA 1EAH3 3ES4A 3PU3A 4NRMA 4FVVA 2IUWA 4K7JA 1O91A 2D43A 2DUPA 2ZGPA 3ZSMA 4LK6A 1MACA 5F37A 2EXHA 3WHUA 1IPSA 4K8RB 2ADEA 4GB33 1CAXB 5EJ1B 4JHZA 4AI0A 2YUEA 2DF7A 2HWF3 4LBMA 3FX3A 4MGZE 2ZX0A 4JHTA 3LSDA 4KI5M 4D94A 1F9KA 1JZ3A 3ZYRA 1BEV2 2VU9A 4CCLA 2DVFA 2NPIA 4AZZA 1RUF1 3M4FA 3O1RA 1QOSA 2AREA 1GMMA 1QJU1 4A7ZA 4QKNA 5BNQA 5FQ0A 3BTXA 1MVQA 2XJPA 3DUIA 1W04A 2UY9A 2P3JA 1WLWA 1SDWA 3FJSA 3R0RA 1FOD2 1AYM1 1VBE2 4RQPB 4XQWA 1VE0A 1JN2P 4PBOA 5JLVA 2UWAA 1K5MC 2JE8A 2RS51 4LMFA 3IMMA 5FTTC 5CBLA 1H8TA 2WAAA 4NIDA 4OLLA 2C1FA 3MBWA 3OY8A 1PO13 3B02A 1AJOA 4GWJA 1YQ5A 3ZXGA 5K8SA 1LGNA 4N43B 2H6BA 3WCRA 5T3NA 3VBSB 1G6NA 3VN4A 4G4FA 4ZZ8A 3WDXA 1DGLA 4RS5B 5D8AA 2JECA 2OKXA 3S6PA 2FHRA 3PVNA 4FAGA 1EP0A 1DIWA 1GWLA 4QU2A 5FZHA 3KGLA 2AACA 2JIGA 1A3KA 1NAEA 1RUC2 2VCBA 1SMVA 4FPJA 3V56A 3P1IA 1ALYA 4GJYA 4RD7A 4EROA 4NR1A 1BMV1 3O14A 2OPWA 2Y64A 4CP9A 1MS8A 1H8VA 1OHFA 2ES3A 4A41A 4GA9A 1AR92 3BN6A 4HPKB 4EN9B 4HL0A 4M3CB 3VHPA 3BIWE 1W9SA 1X7NA 4PIYA 5IAXA 1QEXA 1W8FA 4CCJA 4OUMA 2W39A 3H42B 1U0AA 4BH9A 4KQ7A 2BZDA 1RUD3 4MADA 2RDSA 3HBKA 4YG0A 5EFUA 3UV9A 1I5ZA 2DVBA 1AR82 3DXTA 4B7EA 4CEWA 4FXKB 3VKLA 1VBB1 5EJ3A 2W52A 2QQPA 4A3ZA 3PL0A 1RINA 5CG8A 3U14A 1TZOA 2HYXA 3AZZA 2JKBA 4AAXA 2WS92 4Q4V3 5BYNA 3ZIWA 2WRAA 3SHRA 4DZGA 3MLJA 5I93A 1ZBA2 4AVSA 4YGBA 1QJZA 3Q8AA 4N7UA 4IV3A 3V0BB 4HONA 4P5YA 4XZUG 1NLRA 2G9FA 2YDEA 2W0XA 3W9AA 5FPAA 1NOVA 3OPWA 4K6BA 3MPPG 4ZONA 1UX7A 3RS6A 1ND3B 1QJX1 4Q4Y3 1XE8A 4N7IA 4GAZA 4AXOA 4WM7C 4XC9A 1OF3A 1DYPA 3H1MA 2ZJCA 4XCBA 4TWTA 5FYVA 3UNPA 1S0EA 2VBPA 2DV9A 2E7QA 2HYKA 3DPRA 2RR11 3TN91 1MVEA 1VBC2 1O3TA 1UMIA 1BBT2 1STMA 1X9TA 2RM22 5BPXA 5CISA 1SDDB 1H1IA 1H9WA 3S5AA 5EZWA 1U5ZA 2BU9A 4FOQA 3S7IA 3T2PA 5A3UA 5FO9B 4IEYA 1OLMA 2C6SA 2QNKA 2VXRA 4Y20A 2HWE2 3HN1A 1WA6X 3ZR5A 4I01A 4JC1A 4NHYA 4NWWA 5IHRA 4RR3C 2ZGKA 2XJQA 3RFRA 2QJVA 4N90A 4XF0A 4HK9A 4BQWA 2WO3A 4PF5A 2MEV2 4DUVA 1WMFA 3NSTA 4FP3A 4HVQA 5FQ0B 3WDWA 3HJRA 1LTEA 2VZUA 2XPJA 1VBA3 3OUJA 2VMCA 3I59A 3QOPA 4R8HA 1SLCA 1OURA 1XNDA 3HQUA 5A1FA 3OGJA 1WLCA 2ARBA 2PN5A 5IK8A 1H8TB 3OYWA 1QHDA 4KBZA 3POWA 3CL1A 5BNNA 3WF3A 4P9WA 2E63A 3VKNA 1Q8OA 2J7MA 2XBO2 2R063 1BK1A 3SCGA 3T0AA 5ABJA 4OVEA 1YC61 3ZSKA 4DPNA 1AR61 4LK7A 2BNMA 2J1RA 1I9RA 4QGMA 3ZXEA 2HBTA 5JSRA 2W94A 4P9GA 2A70A 2WT2A 5D8AB 2ZX2A 3ACIA 3QH7A 4UFMA 4WVWA 2RG4A 2OZJA 4ATFA 4CCNA 2D7FA 2RJLA 4IE4A 4CCEA 4FXGB 2WZR2 5FY4A 3OG2A 3BVCA 1GFF2 4QX1A 5LRRA 4Y1VA 3WDUA 5FMDA 3USUA 4OI2A 4QQPA 2RMU3 4E9KA 1LRHA 5EYXA 4CP9B 2H6CA 4GKXA 1RHI1 4OYUA 2PHFA 2NYYA 1S55A 1Y4WA 1EV13 2C9AA 3I7DA 1RUJ3 5FZ1A 3R4DB 3OBZA 3J8F3 3LEMA 3SH5A 1BYHA 1W39A 2W47A 3E6DA 2J1UA 2FD8A 1GP4A 5JR2A 2WSUA 5C5UA 4DIQA 3NKGA 2D6KA 3PUQA 1H30A 4K1ZA 3LB9A 5E88A 4CA9A 1F4HA 3F95A 3VD3A 1EUUA 2UURA 2ZGQA 4CEWB 4NIGA 1CD3G 4CU8A 1J3QA 1DGWX 3NNMA 4I30A 3EMRA 3AK0A 4RA0A 3KQ4B 5GLZA 2XJUA 2D40A 3T2QA 5JMCA 1R081 4ZS3A 1Q8QA 1C8NA 3GDBA 3ME2A 4BQYA 2Q0AA 1PK6C 2PHRA 2VOTA 3NVCA 3WEZA 4CDQC 1PZ8A 5C6CA 4ZU7A 3T09A 4IEXA 3MO4A 2DBNA 2E7TA 4K20A 5G05L 4A45A 3KSCA 5JSPA 1WCKA 2YROA 4C1XA 1C28A 3OF1A 2D3RA 2VE1A 3POFA 4O7XA 3KT1A 5DZGA 5C8CC 1VBE3 5T5JA 2JD9A 2W68A 4TLGA 4QHZA 3WF1A 2VC9A 4IEOA 4BM8A 3V65A 3GZTB 1NCQA 4YYOA 5GZFA 3ZSEA 4XDPA 3DPRB 1FXZA 3KT4A 1XB9A 4MSVA 4U36A 1Q8SA 4JZRA 1AJKA 4FPKA 5FYCA 3WUCA 2MPFA 2F4LA 4BK4A 4PDWA 2PYTA 2ORXA 2R041 3I3QA 4L8QA 4Q27A 1UWWA 4Y20B 1OFNA 1H4HA 2PHUA 2BRTA 5A7PA 2EXKA 3MICA 4A6SA 5LBEA 4JTNA 1BQPA 2HWD2 3AZXA 3P3PA 2YBPA 4K8FA 1ND2C 3KT7A 2ZGNA 1E5IA 2CAVA 2R072 5L9BA 1J3RA 1RUI2 3WLUA 2HWB3 2GU9A 1CPNA 1MS3A 2AYHA 4FOYA 1TE1B 3PIJA 1V9U1 1CZTA 1JUIA 1OI6A 4HKOA 1AR93 1QQP2 4CYDA 1S4CA 2QDRA 3WDTA 3IKWA 3A7QA 3AYDA 3M3OA 1XYOA 1AX1A 3RDIA 2XWJB 4O61A 3SH4A 4S2GA 1IKQA 4F83A 2CV6A 1QOTA 5BNNB 2J1TA 4XAAA 4HKLA 3MW3A 2OA2A 5CB7A 2MNGA 1K5MA 2G19A 4DMIA 4EN6B 3VBUC 5ABJB 1FMD1 1ONAA 2HEYF 5LA2A 3SKJE 1HB3A 4EWEA 1S1AA 5LEJA 4AHZA 5CYYA 5FWJA 3M3EA 2FZ2A 1JBCA 5F5CA 5KC5A 1V00A 4YGDA 2WS93 4XBLA 2VH9A 4TYSA 4IV1C 1HB2A 2OT7A 1ZBA3 1HRV1 3KVAA 5EP9A 5DQ0A 4OHZA 3VBHC 3VZJA 3WHTA 1JZ2A 1AL0G 4D3WA 3WW1A 1CJDA 3USUB 2Z5WA 2XG3A 3DYPA 3U10A 2Q5TA 4OZOA 4CVUA 1DQ0A 3LEIA 3H3LA 5IK7A 1WD3A 2VNOA 3FLTA 5FYUA 2IXIA 3MV11 2DVAA 2W95A 3WP3A 3BPZA 5D2AA 3MV01 3VBFC 1X33A 2XDVA 5T5OA 2F17A 3ZFEC 4BCUA 2P34A 3QLQA 1VBC3 2CGNA 4AL9A 5DPNA 1BBT3 1O4TA 4BDVB 2RM23 5IUQA 3U1XA 1RUF2 2B7YA 2CDPA 2X10A 4W6XA 2WYFA 3ZSLA 5A7NA 2PAKA 3O0XA 2HWE3 2QQOA 1RUH3 1UQXA 4KWLA 4N43C 3TB0A 3GCXA 1PX3A 1XBFA 3H1YA 3JB4C 3NKTA 3VBSC 3BTAA 4RS5C 2AENA 4HMZA 1AYM2 3LD8A 2DURA 1AYN1 3POJA 1QJY3 2MEV3 2YV8A 1RUE1 3LWCA 2RS52 4LORA 5KHKA 1PIV1 1O6UA 3T4VA 4I0AA 5FYSA 1IPJA 3W58A 2NLRA 5E6HA 2KXLA 2YFZA 1PM4A 3BOPA 4PLNA 4LXLA 2Y34A 3POYA 3T0BA 2CNAA 1ZRRA 1H4GA 2FMDA 1XNKA 1DGWA 2WN2A 2Q30A 1NCQB 5LK5A 1GZ9A 2D6OX 4H14A 4LEJA 1VRH2 3TWIA 3OEBA 3G6JB 2Y6LA 3IZOA 2AUYA 4WM7A 3K2OA 3LSEA 4I02A 1DF0A 1C57A 4LHLA 4PDWB 1YHFA 3IMNA 3WP6A 3BALA 1POV1 1GKBA 2BNNA 3I3DA 4QXKA 5ACA2 4PHZA 1BMV2 4Q0PA 3I2JA 3VBRA 3DF0A 1QF3A 1QJFA 1US3A 4XBNA 2FDJA 3WT3A 1Z0HA 2WWUA 3TBDA 1UPSA 2WZR3 1T2XA 3MEPA 4YW1A 1FPN1 5FP3A 3WG4A 5A1AA 5KXEA 4ES9A 1MEC1 1RUG2 3BIEA 1B09A 2TBVA 4UFHA 1SLBA 1W6OA 4MH0E 3SCFA 3H1WA 5EIYB 3KHCA 1U5YA 4LKEA 4YW3A 3ZXFA 3KQRA 1E5HA 1MS5A 3IDBB 4JTOA 1VBB2 3WG1A 4JRAA 3K51A 5BNPA 1S0BA 1WZXA 4IQPA 1UL9A 4NUBA 2OUJA 1K5MB 4CXYA 4Y4RA 1DQ2A 4BHPA 5JR7B 3ACHA 5IAVA 5FYMA 4CP0A 1UOBA 5FCCA 1LOFC 3NO8A 4BQ2A 2W5FA 3JZVA 4Y22A 4TLFA 3MUZ1 3HN3A 1N3PA 1W6QA 4P9YA 5EWSA 3JD71 3NJVA 2XMLA 4PIXA 4R9DA 2D98A 2ZTNA 5H9QA 4HXCA 4DXZA 1FAYA 4CTEA 2ZGMA 3M3IA 4XFIA 5LEKA 2JB4A 1W6MA 1F35A 4Z2AA 2E53A 3LA7A 1SPPB 1TME1 3TN92 4CXXA 2RR12 3B9CA 3QH6A 3E6BA 5FYTA 2JEMA 5FXZA 1IPKA 5GLUA 4BXSV 5IVCA 3I2OA 4J6GA 3ZYPA 1GOFA 2VBDA 5FMOS 5C71A 2VQUA 5DUUA 1AF9A 3QCWA 3T1LA 2WR9A 3OSDA 1XC6A 2QFEA 4IEVA 4LUMA 2GC0A 3ZM8A 2A6WA 1YQ2A 2Y6KA 4MO3M 5DMYA 1SACA 1KS5A 3PIGA 4QQLA 4AGVA 4COUA 5KR7A 2ZKLA 1UY0A 2RS11 2NZ9A 4LQRA 2HWD3 4LLFA 2O1QA 2GMPA 5F32A 5I8YA 3A0KA 5EYYA 3D4KA 1H6XA 1RUI3 3OUIA 5IVEA 5KHIA 1PK6A 4QAWA 2JD4A 3D82A 4CDQA 1NE6A 3ZFGA 1QQP3 5AFEA 1H6YA 1QH7A 4LO5B 2XL9A 3N9QA 4URAA 3GBWA 4CDXA 1K45A 1YWKA 4M3CE 1QDOA 4FOWA 4HSJA 1AR62 2FCTA 5C8CA 3E5UA 4H2AA 4EN7B 4B1MA 1IS6A 2RVAA 2XUEA 1WCSA 3HMYA 4WM7B 4XUOA 5HV4A 1PM7A 1X9PA 1OBNA 3CJXA 2Q8EA 2ZGUA 5L7OA 5FY7A 2D44A 3KLSA 3PJYA 4XTMA 4Q8LA 5FP4A 3T4HB 2DUOA 3WDVA 4LIVA 2X53S 1W2UA 4CCDA 3T30A 2J22A 1ODNA 1OPOA 2ERFA 4CUCA 4XACA 4QX2A 4XF3A 1W9FA 4RR3B 3URFA 5LRSA 2WAOA 1ND2A 4IV3C 2JDZA 1CPMA 2DFBA 4W4ZA 1W6OB 3LAGA 4BMBA 2ZS6B 1D0GA 4J1WA 3E5QA 4MGQA 5C9AA 4XZPA 3GBFA 1XSQA 4XYXA 4DFSA 1W0OA 4L92A 1UOGA 1TMF3 5CFDC 4M4PA 5SV5A 2PHTA 1S2BA 1NYWA 1R082 4FP2A 2JDUA 3RSJA 3ETPA 1V70A 2BJSA 3ATGA 3LPFA 2ZXQA 5FZKA 1G8WA 1IS4A 2DCTA 1JW6A 1W8HA 2YHJA 5F6LB 1OT5A 3WY6A 5AC93 1DCSA 4DB5A 1JZ4A 1RVF3 5KHGA 3ZKUA 1GNYA 1MPXA 4Y22B 1OQEA 4QMAA 2JKXA 3VBUA 1WCDJ 2XQRA 1MZEA 2YB7A 1W6QB 1EY2A 2F4PA 5A3WA 4E27A 4ZS2A 2QQJA 4FTEA 1UD1A 1CAWA 1AYM3 1UKGA 1UY3A 2LM3A 1S0FA 1PVC1 2Z4FA 4AI1A 4BU2A 2Z79A 4Q8KA 2ZBJA 4RHV3 2K46A 1EPZA 2P5BA 2VY0A 3O0VA 2VAUA 2BWCA 4IV1A 4Q4X1 3WNLA 3O5SA 4GMP1 4NPMA 1CONA 3VBHA 4PQQA 5DDJ1 3WNXA 5J3UA 2ZHMA 1QMJA 3BUCA 1KFUL 4IGOA 4DRRA 3MDPA 3OPZA 4EYUA 2R042 2HBUA 1HRI1 1VRH3 3VDBA 2VVDA 2DCJA 1WW6A 5BUVA 1MZFA 4B29A 1O8SA 1QJEA 4S2FA 5SV8A 2DTWA 4RN5A 5LASA 4XJZA 5FBJA 3VBFA 3MLLA 2DFCA 3V64A 2K2SA 1YXWA 2H0VA 3AXEA 3ZFEA 3WDYA 2Q1FA 2ZABA 5ACA3 4IL7A 4GD4A 3AFGA 4I3PA 1W3VA 5A3NA 5IVVA 1VAMA 4Z8BA 3CMGA 3DECA 4RGKA 5JXGA 4UW5A 5GALA 1J84A 2QCSB 4LBLA 1RUG3 3Q8EA 1PK6B 4LBQA 2WNUC 3LE0A 1CESA 4NVPA 4CDQB 2QQVA 1R093 5LBBA 5T5PA 3WINE 3ZFGB 4YSFA 3V0AA 4AVVA 4CP2A 2YBKA 4JGYC 2JE9A 1HKDA 4HVRA 3SISA 2ZCWA 4EJRA 5C8CB 3OB8A 4AHYA 5FZ3A 1NT0A 3FWEA 2VXJA 1GU3A 1OQDA 3WSOA 4FTSA 5JOZA 1PO23 1H9PA 2JXAA 3POSA 1DGRA 4YLZA 1HRV2 4QPYA 5JOYA 3SH3A 1JYIA 4MYEA 1W2AX 3KCXA 1JU4A 4GWMA 3INAA 1ZBE1 3NV3A 4L99A 2FDIA 2G4IA 2GZWA 3KM5A 3R05A 3UK9A 1N1YA 2GP5A 1PVXA 2D5HA 3UKNA 5I0SA 3LKJA 2Y38A 3DYMA 3ZR6A 3MIHA 4CPBD 1C5HA 1H2LA 1JODA 4B7KA 1WUVA 3FMGA 4LOSA 2QZ2A 1OA3A 4YW2A 3O0WA 1ZRFA 2P2KA 1OH4A 1RL3A 1ND2B 2RR13 4QKDA 4XETA 4ZXKA 3SNMA 1BVP1 4AFDA 1LHNA 4IXLA 1G9DA 1FNZA 5LY1A 4FO9A 4AF9A 1ZZBA 5FWEA 5C9AB 3PUHA 2VMFA 4Y33A 1ULGA 3MW4A 1Z7S1 5F5QA 3G7DA 3O1UA 1DFQA 1R1ZA 2WJSA 3WOGA 3H9AA 1OLQA 2IWGB 1NCQC 1GSLA 2PQQA 1LAJA 1DGRN 1I3HA 2VG9A 4JQRA 5DAXA 1LODA 4KWKA 1AYN2 5FY9A 1RUE2 2ZKNA 3QBQA 1ENSA 3OTFA 4PDWC 4PIZA 5I0UA 2RE9A 2WZ8A 3VBUB 1LOFA 1JYCA 2HWC1 3IBMA 4BYYA 4RL7A 2AZ5A 2D3SA 2W3JA 1JMUB 3ZLIA 4ATEA 1E57A 1VBD3 2UU8A 3AKPA 2YGMA 4IV1B 3JUUA 3ZVXA 1CX4A 1IQDC 1RMU1 3RZGA 3VBHB 3CEWA 3NWKA 1RJ8A 2QQMA 3SQOA 3BU7A 2E9QA 2VNRA 5J09A 4YVWA 4LBOA 1W2NA 5K0UC 1AR63 2RDRA 3APBA 1PNFA 4LKDA 3P5BA 2JX9A 1ZNPA 2XVKA 5FZIA 4LLOA 1IQAA 1SBEA 3IT8A 2FDKA 2HEWF 1NLSA 5I0DA 2DYCA 1KJRA 2PQSA 2YY1A 1SLAA 5C4WC 5C8WA 4QM9A 2Q8OA 2VULA 3VBFB 4CDWA 1UOFA 3TNQA 3VDAA 1ZREA 3ZFEB 5GLVA 3OEAA 4AFAA 4WVZA 4XCAA 3GZEA 1W99A 2RS31 4QX3A 1ODMA 5FP9A 3WQ1A 2G1MA 1MEC2 3AZWA 4JKMA 5D21A 2WBKA 3ZN6A 4OI1A 4ISQA 3VHNA 3HNBM 2VOXA 2FZ1A 5HCHA 5JPNB 4QB1A 1TQ5A 2CGOA 3IIAA 2LTNA 1Y3TA 2E32A 4LO8A 4LBQB 3PDQA 3WXPA 2QQNA 4YW6A 5ANNA 2VZ3A 4FFGA 3QD6A 2R6QA 1GZWB 4LUKA 1UZWA 3H8OA 3RZJA 1A78A 4H7MA 1JYVA 4EN8B 1H1MA 3I2DA 2KD7A 1OOPC 4IETA 1JH5A 2C26A 5FY1A 1VMJA 3K3OA 5GZGA 1Q3EA 4HVOA 3O1MA 1V6NA 5DZEA 1J1TA 3MIFA 3AP9A 4AE2A 3H8RA 1JYTA 3DKQA 3JD72 5LA9A 1R1A2 3O1TA 3NNLA 5FZAA 1TG7A 1YIPA 3FFZA 3VKFC 1WKYA 1S0JA 1WCQA 3KF3A 4IE0A 5EV7A 1ASJ2 1TME2 4YFZA 4JKLA 2ZX4A 1GQPA 1AR71 3ZXKA 2BGPA 1XOYA 3M8LA 4XUTA 2OX0A 4NHXA 3LDBA 3WR0A 2R0FA 4CRQA 3DCQA 2P6HA 4MXWA 4BOWA 2Q8CA 4MGIE 3AKRA 2ZEXA 3D0JA 4AEDC 1Q8PA 2H0BA 3ZMNA 3MYXA 1JZ7A 5JWPA 2VPVA 4K9SA 4IEWA 3U75A 4KH9A 1XNBA 2R043 5E89A 2B39A 5IK4A 2GP3A 3UT0A 1K42A 2XLAA 1AUYA 1DYOA 4UFJA 4Z1VA 5HPOA 1GOHA 2RS12 5I8TA 5EPAA 2BQPA 2D6PA 2IFWA 2GALA 4FPHA 2CWMA 1REDA 3N7MA 2BUKA 2D6MA 2BOIA 1YJLA 2CWSA 5CFDA 5FDBA 3KS7A 3OGGA 4HANA 4UWDA 4L2NA 4Q4W1 2KM2A 4DNYA 1YFXA 3PHMA 1FX5A 2DWRA 2WQ8A 2B8MA 1O3SA 1W9YA 5DUXA 3SITA 4W65A 1W03A 2C9KA 2ZX3A 1COV2 1D0HA 1LCLA 3I3EA 4V1PA 5A7WA 3ITQA 3S30A 4J1XA 3VBRC 1GLHA 1HLCA 2DCYA 4FFHA 1W8TA 4HOOA 4YVSC 3ZYFA 1OPMA 3RWNA 3VZLA 1AX0A 1LOAA 3E97A 3AFKA 3NMBA 4D69A 5FZ0A 3N36A 4YVWB 3FHIB 3EQEA 5EHDA 2WLQA 3E6CC 4RGGA 4ZU5A 3Q8FA 1C8M3 1K12A 4XW3A 2YPDA 3MFCA 4UW6A 1QIQA 5BNPC 1TNFA 1WCUA 4QGLA 4OHWA 1GP6A 4DY5A 1HXS1 5C3OA 2QZ3A 5A6QA 1LU1A 1AL23 2YZ4A 3AP4A 4CU9A 4QQOA 5L9VA 4PT6A 3OY8B 2P4EA 1LGBA 2VZ1A 3AYAA 4N53C 4CCCA 3ZN6B 2EVXA 4MGTA 3JBG1 4GKYA 1BZWA 2OYZA 2XJRA 5LBCA 1O5UA 3HOBA 1EAH1 1YFUA 1NQDA 4HFSA 4HBNA 3RPQA 4HLTA 3WQ7A 3RG0A 4GB31 1SHWB 2JG9C 4AEKA 4C0HA 2I2SA 4HK8A 3I8TA 1D7PM 1UU6A 2WNUA 5DG1A 3X29B 1T6GC 5A3MA 1CGPA 5FLJA 2O14A 2WZPP 5EQUA 4Z92B 4JGYA 4AVCA 5A6YA 1LENA 2W08A 1VIWB 1W8ZA 3ZOIA 4CE8A 2JJ6A 3LEKA 5FPZA 1PVC2 3B00A 4JVAA 3ILFA 1RUE3 2OPKA 2ZGTA 1VB4A 2XLFA 4BLIA 3IAQA 3OJBA 1LHVA 1OA4A 4Q4X2 1LHWA 1XU1A 2IXHA 1DZRA 3HR9A 3L2HA 1JUHA 2Z69A 4KMQA 4XIOA 3RNSA 1F15A 1MZ5A 4E4DX 3O1OA 2ZAHA 2YU1A 1JI6A 3H7YA 1BEV3 1HRI2 4MXWB 4EN0A 3NV2A 4BZ4A 5F9TA 2FQPA 2HKXA 4QPGA 1PGL1 4B1LA 1C3HA 3Q8CA 3ZFGC 2W46A 4FBFA 5KC6A 3AYCA 3MI8A 1POV3 4IV3B 4CDXC 3KV9A 4A7KA 2I74A 4W6WA 5HBAA 4YFWA 1BVVA 2E31A 4FT8A 4MHRA 3VD7A 3D3AA 3JXSA 1FOD3 4I3GA 3WX5A 1XSRA 4UI9L 3BCWA 3EHKA 1OKQA 4OMCA 2WT1A 3ZFFC 5CFDB 5L7OC 4AFMA 4LBKA 5HCBA 4G9SB 1XE0A 4A2UA 5HI0A 1MEC3 4X6QB 1LEMA 5C3PA 2JDHA 4QKBA 4BISA 1YYNA 2XJTA 2BFUL 4YM2A 5F2SA 3A0NA 3ZYIB 5A7WB 2PAMA 4DXRA 1WMDA 3AKSA 1V0AA 1YCIA 2XJVA 1I1EA 1DLCA 1O5LA 1W8OA 3AVSA 4NRPA 1RUD1 1E5SA 2R1BA 4QX5A 1O3RA 1BLZA 2WWJA 4V2VA 2PHXA 2ZHLA 1V6MA 2LW8A 1UOJA 4OI4A 1BHGA 1RUC3 1KRIA 4QKFA 3THDA 4BQ5A 3UKVA 5FLIA 4KG8A 5C9AC 3ETQA 4LE3A 4Q4V1 5K0UA 2GNMA 1TNRA 5H9RA 3OGSA 3VKMA 5FPLA 3I59B 1HX6A 3K77A 4Z2WA 3JD73 5GZDA 2VZVA 3VHOA 3AKQA 1R1A3 4FQ4A 2J1AA 4IUGA 3DV8A 4YW4A 4CCOA 1G9CA 3OYWB 5C4WA 4OZXA 3N7LA 2YPJA 2XVGA 4XF1A 1IS3A 2MHFA 1ASJ3 1NLQA 1SCRA 2WFF2 4Q4Y1 5GM0A 3B93A 1AR83 1W9WA 5FY0A 1DHKB 4EZHA 2SLIA 1AZDA 3W20A 3GNEA 3H50A 2CHHA 1DYKA 1Z7S2 5FZ6A 1YQ8A 3GBGA 4XXPA 4C1WA 4XUQA 3N4MA 2FCUA 3KWVA 3IN9A 2ZEZA 2V72A 3FUOA 1RITA 3OPTA 4NN0A 2WNUB 2BBAA 4M4RA 5GJ6A 3WZ1A 4Z82A 5E1RA 4D0QA 2WNVC 3AMPA 1W9TA 4JGYB 1P8JA 1JHNA 1FI2A 1ZA4A 1T6BX 1SEFA 2BDRA 1S0IA 2D97A 2NMOA 4E4HA 3TNPB 1D4M1 1OOPA 4CP1A 5FYHA 2CYFA 3EB7A 3VZMA 4DEVA 1ZZ7A 3O7OA 2HEVF 2HWC2 4MV2A 3L2YA 2LALA 5JOWA 4E8DA 1VALA 3N9NA 3NNGA 2VZPA 3WCSA 1VBA1 1VMHA 1QXRA 3KZ4C 1RMU2 5K7PA 1COV3 3AVRA 5FP8A 4FPOB 1RXFA 4JX0A 2VZTA 5FR3A 1NCRA 2EIEA 3ES1A 3ORJA 2B5HA 4IESA 4N9HA 3W59A 1ZVFA 1UYXA 1QJU2 2GC1A 1LOEA 4XF4A 3RI9A 4A7YA 2R061 1UZVA 1NY71 3L9JT 1UIJA 2VW0A 2WA4A 3I2FA 5LY2A 3ACFA 3RI8A 1KQRA 1WMXA 4CCMA 2RS32 4AEDA 3WUDA 4C90A 4YG6A 1WD4A 3IIIA 2VTFA 5JIAA 4AEJA 1LOGA 3POIA 1YQ6A 4S2DA 1ULDA 3VDDA 2HH9A 1JTZX 1GYKA
chains in the Genus database with same CATH topology
1JZ3A 4W4ZA 2CDOA 2B4KA 4MGQA 1NUKA 5C70A 3AC0A 1GMMA 3VDCA 5JXIA 4CUBA 2XHNA 4M4PA 3ETPA 3HEIA 2BERA 3LPFA 2ZXQA 3C7GA 1OT5A 4TTGA 1L7QA 1JZ4A 1GNYA 1MPXA 2JE8A 1L7RA 2JKXA 2WAAA 4ZY9A 3BGAA 2YB7A 3MBWA 1R64A 2QQJA 3C7EA 4GWJA 1UY3A 2Z4FA 2B9VA 1PMJX 4TXWA 3IB3A 3WNNA 1NX9A 3I3BA 1PMHX 2YC4A 3CIHA 3WNLA 4ZZ8A 5C7GA 2J1SA 2W1SA 4PQQA 2OKXA 4HG6B 2ZEWA 1K3IA 3FHQA 3ECQA 2EIDA 1NAEA 2VCBA 3P1IA 4GZ9A 3U37A 5LA1A 3VDBA 2DCJA 4DXTA 1O8SA 2VR4A 2Y64A 4RN5A 4A41A 3NRUA 3BN6A 4LHSA 1W9SA 3WNOA 2VZRA 4MGSA 4QB2A 3CMGA 1OD3A 3DECA 2XOMA 1JZ5A 2WO2A 2BZDA 1CIYA 2QQKA 4MADA 5JXGA 1J84A 3LE0A 4A3ZA 1DP0A 1CZVA 3J7HA 4KWUA 2HYXA 1O8PA 4FI9A 4AAXA 3OB8A 4P5YA 4XZUG 1GU3A 4GWIA 3WSOA 4UAPA 1UX7A 2W92A 1UZ0A 1OF3A 3NQHA 1JU4A 3UNPA 4QX0A 3ACGA 3IAPA 1UMIA 3DYMA 1SDDB 5JMOA 3T2PA 1OH4A 3E1F1 2ID4A 4DEQA 5IHRA 3HNMA 2Y6HA 3CDZB 5HXMA 3PUHA 2VMFA 5LCWL 2RV9A 3P6BA 2WO3A 2ORZA 2VL4A 4DUVA 2Y6JA 1JYXA 3K46A 3HJRA 5G04L 2VZUA 5JXHA 4L0PA 2X05A 2VMCA 3LEGA 3GGLA 3K4ZA 3I2KA 2WZ8A 3NJXA 3WF3A 1LNSA 2J7MA 4A4AA 3T0AA 2W3JA 2J1RA 1UXZA 4QB6A 2VCCA 1IQDC 2W94A 5B4XA 2QQMA 3ACIA 4BJ0A 4XVHA 4A42A 3OG2A 4QX1A 1HN1A 5I0DA 2PQSA 3WF2A 5JXJA 3VDAA 1US2A 4OYUA 1UYZA 3OEAA 4CU6A 2BGOA 1W99A 4QX3A 3PUIA 3C7FA 2W47A 1W0NA 2J1UA 4JKMA 5JR2A 2WBKA 3HNBM 1F4HA 3VD3A 1EUUA 4A44A 4QB1A 4CU8A 5IYYA 1CX1A 1KEXA 2E32A 4AG4A 4LPLA 2QQNA 4XUNA 4DUWA 3SEEA 3OGRA 2VQTA 2VZ3A 2J1VA 2QBXA 3T2QA 3GDBA 1O59A 1JYVA 2VOTA 3WEZA 3FL7A 3LQCA 2KD7A 4BK5A 1GUIA 2QQLA 3T09A 2C26A 3MO4A 2VO5A 4A45A 5G05L 3A22A 2JD9A 1TG7A 4A6OA 3WF1A 2VC9A 1WKYA 1WCQA 2YG0A 4JKLA 2QQIA 3WNKA 1GQPA 4P00B 2BGPA 3C7HA 4BK4A 4XUTA 4W50A 2J1EA 2WYSA 1UY1A 3GM8A 2R7EB 2ORXA 1UWWA 4D8MA 3WF4A 2ZEXA 2V5DA 3OBAA 1JZ7A 1TVGA 4CU7A 3HPNA 1K42A 1DYOA 5HPOA 1GOHA 3LPGA 4ET7A 4DUXA 4UOJA 4E8CA 3THCA 1CZTA 2DCKA 4OMDA 3C7OA 3DYOA 4DXSA 2C4XA 3A7QA 3C8XA 3W5NA 2WQ8A 2VM9A 2C9KA 2J1TA 2W1WA 3CQOA 3I3EA 4LKSA 2JDAA 5LA2A 3SKJE 5CYYA 3VD9A 2YFUA 3K4AA 1J83A 2VZOA 1OF4A 2DDUA 4QPWA 4P02B 5DQ0A 3I2IA 1JZ2A 1GOGA 1K12A 3EYPA 3DYPA 4CVUA 4PF1A 4OZOA 3LEIA 2L9LA 3SKVA 3OGVA 2WUHA 4XURA 3MV11 2VMDA 2W95A 2WN3A 4CU9A 3MV01 4PT6A 3VD4A 2VZ1A 1JYWA 3W5MA 5DPNA 4BDVB 2WABA 3HOBA 2CDPA 2X10A 4QDSA 2VCAA 2QQOA 4W8JA 3T08A 1SHWB 1PX3A 2W1QA 1D7PM 3WNMA 1EUTA 4P08A 2E26A 4YPJA 2XONA 3WNPA 3F2ZA 3I2GA 3LEKA 2YFZA 3T0BA 3ABZA 1PX4A 2WN2A 3IAQA 2HLEA 3SEPA 3OEBA 4QDQA 2Y6LA 4KMQA 4ZXEA 2Y8KA 1JI6A 2VJXA 5JUVA 3I3DA 5EJZB 1ULOA 4ZZ5A 2W1UA 3I2JA 1US3A 2W46A 2E33A 2W9XA 1ULPA 3FHAA 5IFPA 5A1AA 1T2XA 1JHJA 5J1XA 3T0DA 2E31A 3VD7A 3D3AA 3JXSA 4UI9L 2X09A 4OMCA 2W87A 5EIYB 1UXXX 4OUEA 2EIBA 3HNYM 3I97A 1UMHA 1XNAA 3ACHA 4DXRA 2WO1A 3WF0A 1DLCA 2YC2A 1W8OA 2W5FA 5F7UA 1XPWA 3CZUA 3MUZ1 2LW8A 3HN3A 5CZKA 1BHGA 1XNTA 3THDA 5LA0A 3NJVA 3A21A 1UY2A 1F4AA 3WQBA 4Z2AA 3CKHA 3OGSA 2WZEA 5IJRA 3K77A 1RYYA 2VZVA 3UETA 2Y6GA 2J1AA 4IUGA 4BXSV 1I5PA 1SG3A 3GXUA 4RYDA 1GOFA 5C71A 2VQUA 1JZ6A 4MOAA 3FN9A 1W9WA 1XC6A 3ZM8A 1YQ2A 2Y6KA 4MO3M 5DMYA 4XUPA 1UYYA 3UESA 3T2OA 2ZEYA 4ARYA 4XUQA 2W91A 3VD5A 1UY0A 2V4VA 2ZEZA 3CZJA 4LQRA 2V72A 1KGYA 4CUAA 2BBAA 4M4RA 5IFTA 4D0QA 1NKGA 1W9TA 1P8JA 1H6XA 3MUY1 4QAWA 4ARXA 2VMEA 1JU3A 1H6YA 3EB7A 4DEVA 2XQXA 1UY4A 1K45A 4E8DA 3NNGA 3A23A 2VZPA 5FUIA 3I2HA 5B4NA 2RVAA 4XUOA 2RJ2A 2EICA 1W8NA 4JX0A 2VZTA 2EIEA 2VZSA 1UYXA 3K75B 4JKKA 2WDBA 2J22A 2VZQA 1CZSA 4QDRA 3K4DA 3I2FA 3ACFA 4CUCA 2LS6A 4QX2A 5EJ1B 4JHZA 3IIIA 2VTFA 1JYNA 3IDAA 5DN2A 1JZ8A 4KI5M 2WAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZ3 A;  4W4Z A;  2CDO A;  2B4K A;  4MGQ A;  1NUK A;  5C70 A;  3AC0 A;  1GMM A;  3VDC A;  5JXI A;  4CUB A;  2XHN A;  4M4P A;  3ETP A;  3HEI A;  2BER A;  3LPF A;  2ZXQ A;  3C7G A;  1OT5 A;  4TTG A;  1L7Q A;  1JZ4 A;  1GNY A;  1MPX A;  2JE8 A;  1L7R A;  2JKX A;  2WAA A;  4ZY9 A;  3BGA A;  2YB7 A;  3MBW A;  1R64 A;  2QQJ A;  3C7E A;  4GWJ A;  1UY3 A;  2Z4F A;  2B9V A;  1PMJ X;  4TXW A;  3IB3 A;  3WNN A;  1NX9 A;  3I3B A;  1PMH X;  2YC4 A;  3CIH A;  3WNL A;  4ZZ8 A;  5C7G A;  2J1S A;  2W1S A;  4PQQ A;  2OKX A;  4HG6 B;  2ZEW A;  1K3I A;  3FHQ A;  3ECQ A;  2EID A;  1NAE A;  2VCB A;  3P1I A;  4GZ9 A;  3U37 A;  5LA1 A;  3VDB A;  2DCJ A;  4DXT A;  1O8S A;  2VR4 A;  2Y64 A;  4RN5 A;  4A41 A;  3NRU A;  3BN6 A;  4LHS A;  1W9S A;  3WNO A;  2VZR A;  4MGS A;  4QB2 A;  3CMG A;  1OD3 A;  3DEC A;  2XOM A;  1JZ5 A;  2WO2 A;  2BZD A;  1CIY A;  2QQK A;  4MAD A;  5JXG A;  1J84 A;  3LE0 A;  4A3Z A;  1DP0 A;  1CZV A;  3J7H A;  4KWU A;  2HYX A;  1O8P A;  4FI9 A;  4AAX A;  3OB8 A;  4P5Y A;  4XZU G;  1GU3 A;  4GWI A;  3WSO A;  4UAP A;  1UX7 A;  2W92 A;  1UZ0 A;  1OF3 A;  3NQH A;  1JU4 A;  3UNP A;  4QX0 A;  3ACG A;  3IAP A;  1UMI A;  3DYM A;  1SDD B;  5JMO A;  3T2P A;  1OH4 A;  3E1F 1;  2ID4 A;  4DEQ A;  5IHR A;  3HNM A;  2Y6H A;  3CDZ B;  5HXM A;  3PUH A;  2VMF A;  5LCW L;  2RV9 A;  3P6B A;  2WO3 A;  2ORZ A;  2VL4 A;  4DUV A;  2Y6J A;  1JYX A;  3K46 A;  3HJR A;  5G04 L;  2VZU A;  5JXH A;  4L0P A;  2X05 A;  2VMC A;  3LEG A;  3GGL A;  3K4Z A;  3I2K A;  2WZ8 A;  3NJX A;  3WF3 A;  1LNS A;  2J7M A;  4A4A A;  3T0A A;  2W3J A;  2J1R A;  1UXZ A;  4QB6 A;  2VCC A;  1IQD C;  2W94 A;  5B4X A;  2QQM A;  3ACI A;  4BJ0 A;  4XVH A;  4A42 A;  3OG2 A;  4QX1 A;  1HN1 A;  5I0D A;  2PQS A;  3WF2 A;  5JXJ A;  3VDA A;  1US2 A;  4OYU A;  1UYZ A;  3OEA A;  4CU6 A;  2BGO A;  1W99 A;  4QX3 A;  3PUI A;  3C7F A;  2W47 A;  1W0N A;  2J1U A;  4JKM A;  5JR2 A;  2WBK A;  3HNB M;  1F4H A;  3VD3 A;  1EUU A;  4A44 A;  4QB1 A;  4CU8 A;  5IYY A;  1CX1 A;  1KEX A;  2E32 A;  4AG4 A;  4LPL A;  2QQN A;  4XUN A;  4DUW A;  3SEE A;  3OGR A;  2VQT A;  2VZ3 A;  2J1V A;  2QBX A;  3T2Q A;  3GDB A;  1O59 A;  1JYV A;  2VOT A;  3WEZ A;  3FL7 A;  3LQC A;  2KD7 A;  4BK5 A;  1GUI A;  2QQL A;  3T09 A;  2C26 A;  3MO4 A;  2VO5 A;  4A45 A;  5G05 L;  3A22 A;  2JD9 A;  1TG7 A;  4A6O A;  3WF1 A;  2VC9 A;  1WKY A;  1WCQ A;  2YG0 A;  4JKL A;  2QQI A;  3WNK A;  1GQP A;  4P00 B;  2BGP A;  3C7H A;  4BK4 A;  4XUT A;  4W50 A;  2J1E A;  2WYS A;  1UY1 A;  3GM8 A;  2R7E B;  2ORX A;  1UWW A;  4D8M A;  3WF4 A;  2ZEX A;  2V5D A;  3OBA A;  1JZ7 A;  1TVG A;  4CU7 A;  3HPN A;  1K42 A;  1DYO A;  5HPO A;  1GOH A;  3LPG A;  4ET7 A;  4DUX A;  4UOJ A;  4E8C A;  3THC A;  1CZT A;  2DCK A;  4OMD A;  3C7O A;  3DYO A;  4DXS A;  2C4X A;  3A7Q A;  3C8X A;  3W5N A;  2WQ8 A;  2VM9 A;  2C9K A;  2J1T A;  2W1W A;  3CQO A;  3I3E A;  4LKS A;  2JDA A;  5LA2 A;  3SKJ E;  5CYY A;  3VD9 A;  2YFU A;  3K4A A;  1J83 A;  2VZO A;  1OF4 A;  2DDU A;  4QPW A;  4P02 B;  5DQ0 A;  3I2I A;  1JZ2 A;  1GOG A;  1K12 A;  3EYP A;  3DYP A;  4CVU A;  4PF1 A;  4OZO A;  3LEI A;  2L9L A;  3SKV A;  3OGV A;  2WUH A;  4XUR A;  3MV1 1;  2VMD A;  2W95 A;  2WN3 A;  4CU9 A;  3MV0 1;  4PT6 A;  3VD4 A;  2VZ1 A;  1JYW A;  3W5M A;  5DPN A;  4BDV B;  2WAB A;  3HOB A;  2CDP A;  2X10 A;  4QDS A;  2VCA A;  2QQO A;  4W8J A;  3T08 A;  1SHW B;  1PX3 A;  2W1Q A;  1D7P M;  3WNM A;  1EUT A;  4P08 A;  2E26 A;  4YPJ A;  2XON A;  3WNP A;  3F2Z A;  3I2G A;  3LEK A;  2YFZ A;  3T0B A;  3ABZ A;  1PX4 A;  2WN2 A;  3IAQ A;  2HLE A;  3SEP A;  3OEB A;  4QDQ A;  2Y6L A;  4KMQ A;  4ZXE A;  2Y8K A;  1JI6 A;  2VJX A;  5JUV A;  3I3D A;  5EJZ B;  1ULO A;  4ZZ5 A;  2W1U A;  3I2J A;  1US3 A;  2W46 A;  2E33 A;  2W9X A;  1ULP A;  3FHA A;  5IFP A;  5A1A A;  1T2X A;  1JHJ A;  5J1X A;  3T0D A;  2E31 A;  3VD7 A;  3D3A A;  3JXS A;  4UI9 L;  2X09 A;  4OMC A;  2W87 A;  5EIY B;  1UXX X;  4OUE A;  2EIB A;  3HNY M;  3I97 A;  1UMH A;  1XNA A;  3ACH A;  4DXR A;  2WO1 A;  3WF0 A;  1DLC A;  2YC2 A;  1W8O A;  2W5F A;  5F7U A;  1XPW A;  3CZU A;  3MUZ 1;  2LW8 A;  3HN3 A;  5CZK A;  1BHG A;  1XNT A;  3THD A;  5LA0 A;  3NJV A;  3A21 A;  1UY2 A;  1F4A A;  3WQB A;  4Z2A A;  3CKH A;  3OGS A;  2WZE A;  5IJR A;  3K77 A;  1RYY A;  2VZV A;  3UET A;  2Y6G A;  2J1A A;  4IUG A;  4BXS V;  1I5P A;  1SG3 A;  3GXU A;  4RYD A;  1GOF A;  5C71 A;  2VQU A;  1JZ6 A;  4MOA A;  3FN9 A;  1W9W A;  1XC6 A;  3ZM8 A;  1YQ2 A;  2Y6K A;  4MO3 M;  5DMY A;  4XUP A;  1UYY A;  3UES A;  3T2O A;  2ZEY A;  4ARY A;  4XUQ A;  2W91 A;  3VD5 A;  1UY0 A;  2V4V A;  2ZEZ A;  3CZJ A;  4LQR A;  2V72 A;  1KGY A;  4CUA A;  2BBA A;  4M4R A;  5IFT A;  4D0Q A;  1NKG A;  1W9T A;  1P8J A;  1H6X A;  3MUY 1;  4QAW A;  4ARX A;  2VME A;  1JU3 A;  1H6Y A;  3EB7 A;  4DEV A;  2XQX A;  1UY4 A;  1K45 A;  4E8D A;  3NNG A;  3A23 A;  2VZP A;  5FUI A;  3I2H A;  5B4N A;  2RVA A;  4XUO A;  2RJ2 A;  2EIC A;  1W8N A;  4JX0 A;  2VZT A;  2EIE A;  2VZS A;  1UYX A;  3K75 B;  4JKK A;  2WDB A;  2J22 A;  2VZQ A;  1CZS A;  4QDR A;  3K4D A;  3I2F A;  3ACF A;  4CUC A;  2LS6 A;  4QX2 A;  5EJ1 B;  4JHZ A;  3III A;  2VTF A;  1JYN A;  3IDA A;  5DN2 A;  1JZ8 A;  4KI5 M;  2WAO A; 
#chains in the Genus database with same CATH topology
 2VOK A;  4X8N A;  2CDO A;  2B4K A;  2ATF A;  2RMU 1;  3MIB A;  1NUK A;  4PI0 A;  5C70 A;  1ZRC A;  3GHN A;  2B42 B;  3U0Z A;  4MGY E;  3H3Z A;  3MIE A;  3VDC A;  5A3L A;  1F2N A;  2XBO 3;  4LIT A;  1EV1 1;  3GJB A;  3HVD A;  1RUJ 1;  4CUB A;  3J8F 1;  4K40 A;  3MID A;  1HV0 A;  3Q9O A;  4UFL A;  5FMB A;  1WW7 A;  1HIX A;  4LO4 B;  1EYB A;  4JDM A;  1APN A;  4TTG A;  1L7Q A;  5FJK A;  3S7E A;  5B4N A;  3IPV A;  3HQR A;  1YJK A;  1N3O A;  2RDN A;  4XFH A;  2ZPX A;  1L7R A;  4ZY9 A;  1O4Y A;  3NV4 A;  4WVV A;  4YVS A;  4GWN A;  1UX6 A;  2XJS A;  1R64 A;  1B35 C;  1G9A A;  4M0H A;  3BOD A;  2LUW A;  4NMI A;  4FPG A;  2B9U A;  2B9V A;  3SCH A;  3IB3 A;  4CXW A;  4QX7 A;  2CGP A;  3I3B A;  5K0U B;  1VJ2 A;  3O1V A;  1A34 A;  2YC4 A;  3CIH A;  4PQ9 A;  5C7G A;  5F3C A;  2GN3 A;  2J1S A;  5AVA A;  4U2A A;  1AR7 2;  1ENX A;  4HG6 B;  4OQ9 A;  1VMF A;  1K3I A;  1KFX L;  3FHQ A;  1V6K A;  4HSL A;  5C4W B;  3ECQ A;  2EID A;  5FKB A;  2XHK A;  4WZF A;  1VBE 1;  5BNO A;  1UNB A;  3TEW A;  4GUL A;  3AZY A;  4BQ3 A;  3VLB B;  4AFB A;  3NRU A;  4N53 A;  1IKP A;  4NIH A;  1HW5 A;  4WVM A;  4LHS A;  1HRI 3;  1M4W A;  1OKO A;  1W0P A;  1S2K A;  2UWC A;  3VV1 A;  2VZR A;  5H9S A;  3ZIX A;  5A6X A;  3ZYG A;  3U4S A;  1QJX 2;  3A4U A;  3HQX A;  5CAD A;  2ZGS A;  5K4L A;  3PTY A;  2XOM A;  1JZ5 A;  2WO2 A;  1CIY A;  1BCX A;  1Y7B A;  4UW3 A;  1KJL A;  4O65 A;  4TN7 A;  2JG9 A;  1X36 A;  2B45 X;  4LOT A;  4XF9 A;  4YVW C;  2RJK A;  2VD7 A;  1RB8 G;  3CBN A;  3D0S A;  4YWA A;  1CZV A;  1NXM A;  1OOP B;  5ISL A;  2GN7 A;  3R6S A;  3U78 A;  4Q1P A;  4DO0 A;  1O8P A;  1UIK A;  5FZ8 A;  5HV0 A;  5IW0 A;  4XHB A;  4CDW C;  4CSW A;  2HWB 1;  2WL1 A;  3GJA A;  1N47 A;  2VCM A;  3VL9 A;  1IGO A;  1AR9 1;  3JQW A;  4QXB A;  2Z2S B;  2VUD A;  3AMN A;  3S0M A;  2VMH A;  2UYA A;  4JGZ C;  1N1S A;  3H8X A;  1UKR A;  3J7N A;  4AI9 A;  3R4S A;  3NL1 A;  5IVB A;  4A3X A;  1W28 A;  2W2I A;  4URT A;  4YNI A;  2I07 B;  3IM0 A;  4Q5O A;  2FDG A;  4QX0 A;  2GND A;  4YZ4 A;  3BTY A;  2Q4S A;  3KF5 A;  3M7A A;  1GWK A;  3RMX A;  3P3N A;  3IAP A;  2R07 3;  1POQ A;  3NJZ A;  1QH6 A;  4AED B;  3RJ2 X;  3PVE A;  1WBF A;  2WS9 1;  1MS4 A;  1RGS A;  4K3U A;  3MW2 A;  3VDD B;  1ZBA 1;  5DZF A;  4NHM A;  4DEQ A;  5F39 A;  1OD5 A;  2ZMN A;  4N9I A;  2Y6H A;  4UW4 A;  4XJA A;  5IAT A;  5HXM A;  4WM8 C;  5IVF A;  2XB6 C;  2VBB A;  3VGI A;  1HN0 A;  1DQ5 A;  2PLV 1;  3AJZ A;  5JCT A;  2WFF 3;  3ENR A;  4HT1 T;  2ORZ A;  4RFR B;  4BQ1 A;  3ZFF A;  4DRV A;  3PVO A;  2QDN A;  3PVB B;  1JYX A;  3K46 A;  4GB3 2;  5GKA C;  5G04 L;  4FPE A;  5JXH A;  3ZKY A;  2GC3 A;  1JOP A;  4EWA A;  1Z7S 3;  2VMG A;  4ZHN A;  4BWO A;  2VNG A;  2VTX A;  3FC0 A;  1VBC 1;  3LEG A;  1VLN A;  4E4S A;  1BBT 1;  1LUL A;  1V6J A;  2ARA A;  2RM2 1;  3AX4 A;  3C2U A;  3IPV B;  4CDU A;  3VBR B;  3I2K A;  4OHY A;  1RHI 2;  4YVS B;  3NJX A;  3VBO C;  4QU1 A;  1KDK A;  2BVV A;  2HWE 1;  3AMH A;  5KBF A;  4XIL A;  1RUH 1;  1IZ3 A;  5AFB A;  2C5D A;  2YC0 A;  4PBP A;  2YU2 A;  4Q29 A;  1Q5O A;  2OXB A;  4Y1X A;  4AHW A;  1UXZ A;  5DAB A;  4LTA A;  5C3Q A;  2VCC A;  4OUL A;  2BWA A;  1QJY 1;  4UBG A;  4E2Q A;  1O7F A;  5LWB A;  3M70 A;  4B4Q A;  1DZT A;  3J9S A;  4HET A;  5BNP B;  1N1T A;  2C0Z A;  2ZGL A;  4A42 A;  4XHX A;  3BI3 A;  1RUF 3;  4X8P A;  4KGQ A;  4N8M A;  4IW3 A;  3UGH A;  1PGL 2;  5FRE A;  2X8K A;  4GIQ A;  1W6P A;  4N53 B;  1QJU 3;  3U11 A;  4WVM B;  1O3Q A;  1J59 A;  3LGR A;  3LF7 A;  1G7Y A;  3PUI A;  2UY8 A;  1A6C A;  1KIT A;  3LA3 A;  5FZF A;  1XQN A;  2XH6 A;  5JI7 A;  3KCY A;  1IG3 A;  4BE3 A;  5J37 A;  4B4R A;  4AW7 A;  2RS5 3;  4F8A A;  1H1A A;  1W6M B;  1CX1 A;  2JG9 B;  4XAB A;  4AI2 A;  3LDR A;  2O8Q A;  4HN1 A;  4L11 A;  2GH8 A;  3PLQ A;  4Y1U A;  5LBF A;  4DUW A;  4EZ4 A;  3SEE A;  3OGR A;  2ARC A;  2VQT A;  2WZR 1;  2WNV A;  1U5X A;  2QBX A;  3HIF A;  4HZF A;  5FUN A;  1RIR A;  4Q0U A;  1CN1 A;  2R49 A;  3RZK A;  3PUS A;  1J3P A;  3AL6 A;  3HT1 A;  1HV1 A;  1OUX A;  4FPC A;  1SZB A;  5FZM A;  1RUD 2;  5FMC A;  2AR6 A;  5FZD A;  2Y6F A;  4XE9 A;  3FLR A;  1CAX A;  4Y1Y A;  2DVG A;  2PTM A;  4BME A;  3H7J A;  4MZU A;  4AVA A;  3FBY A;  1CAU A;  2WT0 A;  2VW1 A;  3LOI A;  5FJH A;  5FLH A;  3ZXD A;  3T2T A;  4NWV A;  4A6O A;  4W6Y A;  1YUD A;  2A5Z A;  1V9U 2;  3NW4 A;  4MG2 A;  3VB9 A;  2BTV C;  2QQI A;  1W05 A;  3WNK A;  1GNZ A;  3THT A;  5FZL A;  4P00 B;  5T52 A;  3C7H A;  1EPW A;  2O0O A;  4IE7 A;  2OII A;  3GM8 A;  3FLP A;  3ST7 A;  4M00 A;  1D4V B;  4FTB A;  2VQA A;  3RMY A;  1UMZ A;  3BKZ A;  1OSG A;  1SBF A;  2BYV E;  3ILR A;  4RQP A;  5FZE A;  4CDX B;  5JSO A;  5FPV A;  4Y24 A;  4AEM A;  1FMD 2;  1HQL A;  2YXS A;  3OBA A;  1VBB 3;  5F3I A;  3ZN5 A;  4CU7 A;  3ZYB A;  2ET7 A;  3HPN A;  4LHN A;  1UAI A;  3ZFF B;  4YZ2 A;  5L7O B;  5I0R A;  4Q26 A;  4ET7 A;  4D6S A;  4DUX A;  1REE A;  4FPY A;  4UOJ A;  4E8C A;  4KU7 A;  2K0G A;  4OMD A;  3NAP C;  5J96 B;  3ZPO A;  2E51 A;  2V5Y A;  1A8D A;  4ORF A;  4ISR A;  5JI9 A;  1D2S A;  3C8X A;  2JG8 C;  4FSJ A;  3W5N A;  1UPI A;  4JDO A;  1MZ6 A;  1QJX 3;  3PNA A;  5J7M A;  3WD5 A;  1D4M 2;  5AVP A;  1OVS A;  2PFW A;  2VQ0 A;  1QNW A;  5LAT A;  3UL2 A;  3CQO A;  1JXN A;  1HDK A;  2IXC A;  1YO8 A;  3DXU A;  4QPG C;  4QXH A;  2BV4 A;  5F2W A;  1AX2 A;  1XRU A;  2DBI A;  4LO6 B;  4XJ9 A;  3TN9 3;  4LUL A;  1B35 A;  3RJR A;  1VP6 A;  1VBA 2;  4HPK A;  2P3K A;  2EIG A;  3LDK A;  4P9J A;  1URX A;  2YFU A;  3K4A A;  1J83 A;  3K3N A;  2TUN A;  2ZHN A;  4RGA A;  5C3S A;  1OFS A;  4XPV A;  3U07 A;  1RUI 1;  2R32 A;  4YAR A;  2DDU A;  2X5I A;  4QPW A;  4BQ4 A;  5APA A;  2AGS A;  4E2S A;  1LED A;  1YEW A;  5KXD A;  1GOG A;  3EYP A;  4NOT A;  1HB4 A;  1F5F A;  1NY7 2;  4IGP A;  5FK7 A;  2AC1 A;  1KD7 A;  3SKV A;  1OLM E;  4LBJ A;  4XXA A;  3LOB A;  3OGV A;  2WUH A;  4XUR A;  1PIV 2;  2VMD A;  1WLD A;  2XKO A;  1ULC A;  2WN3 A;  4KL1 A;  4JCK A;  3VD4 A;  5FXX A;  1JYW A;  5KHH A;  1CAW B;  1W06 A;  1OUS A;  4Q0S A;  4B3N A;  3W5M A;  3PJQ A;  3V0B A;  1MQT C;  2LRP A;  2RMU 2;  2E6V A;  4DQA A;  2PAE A;  4QDS A;  3HWJ A;  5M0T A;  4AGR A;  3BB6 A;  1EV1 2;  1RUJ 2;  3T08 A;  2WNV B;  3J8F 2;  1XJA A;  3JU9 A;  2ZZQ A;  2W1Q A;  2BBV A;  2A1X A;  2JIC A;  5BXX A;  1DZQ A;  2QTW B;  3FUQ A;  1LJ7 A;  2VEC A;  1VB2 A;  4P08 A;  4D7T A;  1LOB A;  1XNC A;  2E26 A;  3UYJ A;  4EQV A;  3WNP A;  3F2Z A;  3I2G A;  2JDM A;  1F5J A;  1YI7 A;  2VW2 A;  2NQY A;  4R52 A;  2IXJ A;  1FPN 2;  1ACC A;  2HJI A;  2R30 A;  5FK8 A;  1TMF 1;  1CAU B;  2CL2 A;  1Y9Q A;  3ABZ A;  4JQT A;  3PTR B;  4JGZ A;  4OCT A;  5FBZ A;  5H9P A;  4AHX A;  3RZH A;  5FZ4 A;  1F8V A;  1PGS A;  1RHI 3;  3KHB A;  4FQZ A;  5F5A A;  1DQ4 A;  4LJH A;  4MUV A;  4QDQ A;  4AQS A;  5AC9 1;  4IE6 A;  2VUC A;  1JOB A;  1RVF 1;  4FAH A;  1WGP A;  3ZXJ A;  5DAW A;  2AEZ A;  1LEC A;  3M1H A;  3OUH A;  4MX3 A;  2D5F A;  5LZ6 A;  3V0A B;  1HQN A;  3ZPY A;  2VUJ A;  4KWJ A;  3PU8 A;  1MS1 A;  2A71 A;  1ULO A;  4RHV 1;  5FZG A;  4CUG A;  2GNB A;  4XAE A;  1GQH A;  2E33 A;  2W9X A;  3POG A;  4QM8 A;  5C33 A;  1LGC A;  4P9I A;  1ULF A;  1VPH A;  2GDF A;  1R08 3;  3D8C A;  3WG2 A;  3T0D A;  2BGC A;  4WM8 A;  3ZXL A;  2G9Z A;  4EE2 A;  2OVU A;  3OD0 A;  1VRH 1;  1GV9 A;  4XFG A;  3RRD A;  1JOJ A;  4IEZ A;  4QT6 A;  1NCR C;  3SMH A;  3MZH A;  1UXX X;  5A32 A;  2XVL A;  3I49 A;  1LKN A;  1SFN A;  2FBE A;  2FMY A;  5DUV A;  4OUS A;  4CEY C;  1Y43 B;  1GZT A;  3WVJ A;  3I97 A;  2PHD A;  5ACA 1;  2ZGR A;  2Q1Z B;  1UMH A;  4Y26 A;  4GJZ A;  2WFP A;  5FY5 A;  2HWB 2;  5T54 A;  3I3M A;  2BNO A;  3VBO A;  2WO1 A;  3M3Q A;  1B35 B;  3WF0 A;  3MF6 A;  3LIH A;  4JDN A;  4QQ2 A;  1QDC A;  2OS2 A;  1LHO A;  3CZU A;  3LCP A;  1ZZ6 A;  2XWB B;  3VDD C;  3AXD A;  1RUG 1;  2P17 A;  1XNT A;  2X5I B;  3EXU A;  3A21 A;  5DXD A;  1R09 1;  2BP6 A;  2WLP A;  2Q1M A;  1ZA7 A;  1PZ9 A;  1ENR A;  2V4A A;  3N7J A;  3CKH A;  4FFF A;  2A6Z A;  1ZRI A;  5IJR A;  2QUO A;  5DG2 A;  3DKW A;  4PI2 A;  4C91 A;  1W3X A;  3RZL A;  2PXJ A;  5FO8 B;  1SG3 A;  4QWN A;  4RYD A;  3VKO A;  5KXC A;  5KHJ A;  1V9U 3;  1PO2 1;  4PLM A;  1JZ6 A;  3TEX A;  2E7A A;  2IZW A;  4DIN B;  3J26 N;  2ZGO A;  3OBR A;  1RC6 A;  3IDE A;  1DLL A;  1H0B A;  1GQG A;  1SQ4 A;  3KGZ A;  3WP5 A;  1UYY A;  2Y0O A;  5JAX A;  4UFI A;  2PLV 2;  4UXA A;  3T2O A;  1HJF A;  2ZML A;  2W91 A;  3VD5 A;  1XU2 A;  3AM2 A;  1WLT A;  2WQZ C;  3CZJ A;  3NV1 A;  1FMD 3;  4UT5 A;  2WWS A;  4G3Y C;  4XOG A;  4YZ3 A;  5A3T A;  1KGY A;  1QU0 A;  4OFG A;  5FZO A;  3JCI A;  1OA2 A;  4R9B A;  5IFT A;  3TAY A;  5HXV A;  5E8A A;  2R1D A;  2ZX1 A;  1KDM A;  1S0C A;  4R9A A;  5FOJ B;  4BPZ A;  3RQ0 A;  1UU4 A;  4CDW B;  2IVI B;  4ARX A;  2VME A;  3DEM A;  2V73 A;  1HRV 3;  5BNO C;  1H2K A;  1NE4 A;  5BV6 A;  3AL5 A;  3CJI C;  1RUH 2;  4O9E A;  2ZMK A;  1PHM A;  4KNC A;  5JIU A;  4JGZ B;  4XIK A;  1CJP A;  3ON7 A;  3A23 A;  1GWM A;  1D4M 3;  3I2H A;  4BA6 A;  3N9M A;  5FAX A;  2RJ2 A;  1QJY 2;  1RTV A;  1OMI A;  4BLJ A;  1AXK A;  2WIN B;  4QD2 A;  4BB3 A;  3OOX A;  1W6N A;  2VZS A;  4D7Y A;  4I09 A;  1X82 A;  4NE9 A;  1CQ9 A;  2DU1 A;  4NPR A;  4JKK A;  5LW9 A;  4NRQ A;  2VZQ A;  1WBL A;  1CZS A;  2HWF 1;  4QDR A;  4F7Z A;  4FCA A;  3GCW A;  3K4D A;  2R16 A;  2J42 A;  3KV5 A;  1VBD 1;  2EXI A;  4COV A;  4XMI A;  1NA1 A;  4J25 A;  4NAM A;  4AVT A;  4Y5Z 0;  2LS6 A;  2RDQ A;  3AB0 A;  2XLG A;  3CO2 A;  3T1M A;  4IEU A;  1NG0 A;  1AXY A;  4LR4 A;  4NPL A;  2TEP A;  3IDA A;  4WM8 B;  5DN2 A;  1JYN A;  1JZ8 A;  3D6E A;  5FMO L;  1AYN 3;  3RGB A;  1UU5 A;  4XEZ A;  4WV8 A;  4XFC A;  3ILN A;  1PIV 3;  3O12 A;  2ETE A;  4IDZ A;  1C1F A;  5JPM B;  1C5I A;  2VNV A;  2JDK A;  5A32 B;  3NAP A;  3AC0 A;  5FZ7 A;  5JXI A;  4MGK E;  5DDJ 2;  3ZSJ A;  2XHN A;  1UN1 A;  5EXO A;  5B2G B;  2CAU A;  4GQ7 A;  4AI3 A;  5J48 A;  2JG8 A;  2Y33 A;  4XBQ A;  1J1L A;  5ERL A;  4GH4 C;  1ZRD A;  2CU5 A;  1IS5 A;  3HEI A;  2BER A;  1PO1 1;  3C7G A;  3VBO B;  4LBQ D;  4XJ8 A;  1DQ6 A;  5GZE A;  1G9F A;  3IDC B;  2SBA A;  3BGA A;  5T55 A;  1KS4 A;  3GZU C;  1FYU A;  1IOA A;  4PCR A;  2AEY A;  5FRA A;  1XYN A;  5GZC A;  3C7E A;  5L73 A;  4UF0 A;  3B01 A;  4LE4 A;  5FYB A;  1PMJ X;  2UWB A;  4TXW A;  4Y5T A;  3VL8 A;  3R4U A;  3WNN A;  1NX9 A;  3N35 A;  3B69 A;  1NZC A;  4AFC A;  2EAL A;  1PMH X;  3HT2 A;  5CNA A;  2ET1 A;  5F3G A;  1FPN 3;  2W1S A;  4YW5 A;  2X29 A;  3T3Y A;  1DG6 A;  1SCS A;  3OBT A;  3J4U H;  5FIX A;  2ZEW A;  4QPI C;  2O8O A;  2A3Y A;  1MS9 A;  5KXB A;  4BIO A;  4GZ9 A;  1XYP A;  3U37 A;  5LA1 A;  5J98 B;  5JVV A;  4DXT A;  4CDU C;  4H7L A;  1CIW A;  2VR4 A;  5E16 A;  4OI0 A;  5FY8 A;  2BVB A;  3ZMO A;  3RYP A;  1A8M A;  5JZG C;  2IXK A;  1G86 A;  1SLT A;  1UZY A;  2OW4 A;  4COZ A;  3WG3 A;  1SBD A;  3WNO A;  1OVP A;  3B5L B;  1MQT A;  2QVS B;  4MGS A;  1OXC A;  2P37 A;  4QB2 A;  5CFC C;  3RWK X;  5K9Y A;  1HB1 A;  2XXZ A;  3MIG A;  4P9X A;  1OD3 A;  5F3E A;  4D6R A;  2QQK A;  4WBB A;  5FZO B;  3MGU A;  1NQJ A;  1ZBE 2;  3AP7 A;  3SLI A;  5L9R A;  3N7K A;  5C5T A;  1J58 A;  5JOX A;  4NHK A;  3GF6 A;  3GHM A;  5FXV A;  3K48 A;  1DP0 A;  2WII B;  5LK7 B;  2OQ7 A;  3J7H A;  5A3O A;  4KWU A;  2GH2 A;  1N3Q A;  3ZO0 B;  3B9I A;  4FI9 A;  1I6X A;  5DAQ A;  4XMA A;  3ZYH A;  4E2G A;  3WW3 A;  1TME 3;  2ZZJ A;  3J7M A;  3DGT A;  3ZYJ B;  2GSY A;  4ES8 A;  1V6I A;  1V6O A;  1IHM A;  4GWI A;  4UAP A;  1Y9G A;  2W92 A;  1W6N B;  1UZ0 A;  4YM1 A;  2KA3 A;  1BXH A;  2WA3 A;  3LIG A;  4LA3 A;  1FT9 A;  3ZDS A;  3NQH A;  2GNT A;  2PA7 A;  2A3W A;  4QQH A;  4XDO A;  3KV4 A;  4Y4Y A;  4BQX A;  2EA7 A;  3ACG A;  1F31 A;  4P5H A;  1NA1 B;  4EV0 A;  2P3Y A;  2KR2 A;  5A70 A;  2RS1 3;  3ALQ A;  2DUQ A;  5JMO A;  2IFR A;  3BTZ A;  2ZAC A;  4ASK A;  5CG9 A;  3E1F 1;  1QKQ A;  1W90 A;  2ID4 A;  4ZKT B;  2VVF A;  3EBR A;  4XFF A;  3VHR A;  1C8M 1;  3HNM A;  2P3I A;  3CDZ B;  2P6C A;  5LCW L;  1GBG A;  1W2O A;  2RV9 A;  4IER A;  4L9B A;  5IVJ A;  1S0D A;  3NAP B;  3P6B A;  1PGW 1;  3CLP A;  2VL4 A;  4H55 A;  2Y6J A;  4NHL A;  2N7G A;  4YZ5 A;  1UZZ A;  4OHX A;  1AL2 1;  2JG8 B;  4V2W A;  2PMW B;  4L0P A;  1UYP A;  4I0W B;  3BOW A;  2X05 A;  1SPP A;  1WW4 A;  2PLV 3;  5A33 A;  4CEY A;  3SC7 X;  1GAN A;  3GGL A;  3LA2 A;  1O4Z A;  4QPG B;  3K4Z A;  1SLI A;  3M3C A;  3J7L A;  5KWR A;  4RQP C;  5FPX A;  1L7L A;  1LNS A;  1X8M A;  2ZA9 A;  1YFY A;  4X6R B;  1TMF 2;  4NII A;  4UF0 B;  3UGF A;  2YMZ A;  5HCF A;  1ZX5 A;  4A4A A;  1SFY A;  4EWD A;  1POV 0;  4L97 A;  2YGL A;  4AR2 A;  3FZ3 A;  4H3W A;  5T50 A;  3ZXA C;  4XQD A;  2VGD A;  4QB6 A;  3FFQ A;  4IEQ A;  5B4X A;  5AC9 2;  1RVF 2;  1ENQ A;  4LBN A;  2TNF A;  4ASL A;  4BJ0 A;  4AOC A;  5FO7 B;  4XVH A;  1RUN A;  2LRO A;  4F3J A;  1GZC A;  5A80 A;  1CAV A;  4CPB A;  1HN1 A;  1UO9 A;  5CAZ A;  1M06 G;  2JWP A;  4RHV 2;  3WF2 A;  2CSG A;  5JXJ A;  3S57 A;  2WC2 A;  2A3X A;  4Q1R A;  1US2 A;  1UYZ A;  2EXJ A;  3IWZ A;  3WW2 A;  4CU6 A;  1QOO A;  2BGO A;  2BEO A;  3C7F A;  1ZM1 A;  1W0N A;  1OQ1 A;  1MQT B;  4LA2 A;  4B4P A;  1CVN A;  3PUR A;  1QNY A;  3OCP A;  4YM3 A;  3RZM A;  2WSV A;  1LR5 A;  5I8S A;  1OLR A;  1BEV 1;  1U12 A;  1S0G A;  2OQ6 A;  3ELN A;  2P1B A;  4A44 A;  3BU0 A;  2IXL A;  5IYY A;  2DVD A;  2X5I C;  5HCA A;  1KEX A;  4AG4 A;  1DDL A;  4LPL A;  3TOJ A;  4XUN A;  1PVC 3;  5FXW A;  3WQ0 A;  3ROU A;  1QXP A;  2J1V A;  3H8U A;  3S5Q A;  1O59 A;  1HJG A;  1YNA A;  1VRB A;  3MF9 A;  1NXD 1;  2JDP A;  4KGG A;  4Q4X 3;  4QX8 A;  3FL7 A;  1FOD 1;  3LQC A;  1Y9M A;  4GMP 3;  4BK5 A;  1GUI A;  1PNG A;  1SFP A;  1ULE A;  2QQL A;  2ZHK A;  4UFK A;  3CJI A;  1FV2 A;  2VO5 A;  2YYO A;  4SLI A;  4RFT 0;  5DDJ 3;  3RVH A;  4BIF A;  5IT6 A;  3A22 A;  1ST8 A;  2G9G A;  4RR3 A;  4D7S A;  3OD4 A;  3RZZ A;  3ASI A;  3CHX A;  4MLO A;  2DU0 A;  3QAC A;  1W2T A;  1HQW A;  1R09 2;  2A75 A;  3TRS B;  4E4Z A;  5FPU A;  3N3H A;  4IE5 A;  4ONU A;  3KD4 A;  2BPA 2;  2EAK A;  2Y0I A;  5DAP A;  1QGL A;  2DCZ A;  4HN0 A;  2JDN A;  2I45 A;  4DS0 A;  1ND3 C;  1YI9 A;  4UBH A;  2YG0 A;  4CZS A;  3MPB A;  2DTY A;  3U4X A;  2D6N A;  4AAP A;  3JB8 A;  1YRZ A;  4Q4W 2;  1H2M A;  2XR4 A;  1REF A;  4W50 A;  2J1E A;  2GMM A;  1UY1 A;  2A73 B;  2WYS A;  1Z78 A;  1PO2 2;  1RUC 1;  2R7E B;  3AMQ A;  1LB2 A;  1YQC A;  3KV6 A;  4D8M A;  1C1L A;  3WF4 A;  5A1L A;  1BK0 A;  3LFI A;  1C4R A;  1ZYB A;  2PHW A;  4Z07 A;  2CTV A;  2V5D A;  3W21 A;  1DU3 D;  1UW8 A;  4K1Y A;  5I91 A;  2NMN A;  2VVE A;  2K9Z A;  1TVG A;  5CEH A;  3LFM A;  4KBB A;  1V6L A;  4BXF A;  1S2E A;  5CA6 A;  1K5J A;  3AP6 A;  4FPL A;  3WW4 A;  4ASM B;  1R1A 1;  3LPG A;  1WWY A;  1NCR B;  2A7A A;  1CR7 A;  2JB8 A;  4QHB A;  3C3V A;  5T5L A;  3AYE A;  3THC A;  2DCK A;  2D3P A;  3CNA A;  3C7O A;  3DYO A;  4DXS A;  4NRO A;  3VUO A;  1ASJ 1;  4YW7 A;  5A33 B;  4CEY B;  2C4X A;  4LKF A;  1AR8 1;  5I0T A;  3RYK A;  2XL7 A;  4GH4 A;  4S2H A;  4NO4 A;  1BKZ A;  2Y26 A;  3VZN A;  1G9B A;  2VM9 A;  4JRL A;  1HXS 2;  1QWR A;  4M3C F;  4AQT A;  2W1W A;  1AVB A;  5TSW A;  4LKS A;  1ZBE 3;  4B8E A;  1H8T C;  3M2M A;  4XTP A;  1DQ1 A;  4K21 A;  2JDA A;  1SLL A;  4R4Z A;  3HBZ A;  4LO7 A;  2WNO A;  3JBG 2;  4TSV A;  3VZK A;  5C3R A;  1Q8V A;  3FE5 A;  3VD9 A;  4OQ8 A;  2VZO A;  1EAH 2;  2ZAA A;  1OF4 A;  3I4I A;  4WZC A;  3TEY A;  1YFW A;  3TYJ A;  4AGG A;  3AP5 A;  4P02 B;  2ILM A;  1JS9 A;  2VOV A;  3KB5 A;  1RJ7 A;  2WKK A;  1CAV B;  3I2I A;  5D8A C;  3EO6 A;  3CF6 E;  4TZD A;  4YG3 A;  5F6K A;  4QPI A;  2HWF 2;  4PF1 A;  4YZ1 A;  2WNE A;  4FOV A;  5F1R A;  3H3U A;  4Q0Q A;  4ZPI A;  1VBD 2;  4QGN A;  4YM0 A;  2L9L A;  5IWF A;  2RHP A;  1GP5 A;  1PZ7 A;  3GAL A;  5ANQ A;  1COV 1;  3UJO A;  2ENR A;  3WP4 A;  2JE7 A;  5FYY A;  4JAA A;  3AJY A;  3VZO A;  5FZ9 A;  5IVY A;  5JZG A;  2WQ4 A;  4AYU A;  2QQU A;  5CVR A;  1LHU A;  1WA4 A;  2WAB A;  2VMI A;  3LZZ A;  2XKP A;  1MR5 A;  4O9G A;  5FPB A;  2BFU S;  5CFC A;  5L36 A;  3O1P A;  4GAL A;  2VCA A;  2MEV 1;  4ITC A;  4NJ4 A;  4W8J A;  2HWC 3;  2OZ6 A;  3WV6 A;  4CEW C;  3D5O A;  4LHK A;  1X8E A;  4XFB A;  1PO1 2;  5IK5 A;  1QXJ A;  2R0H A;  3WNM A;  1RMU 3;  2NM1 A;  5BNO B;  1E5R A;  5BY5 A;  3N9O A;  1EUT A;  2ZOE B;  3CJI B;  1WW5 A;  4GXL A;  4MHU A;  4YGC A;  4M01 A;  2XON A;  2YBS A;  1QY4 A;  3BYW A;  4GMP 0;  4P14 A;  4YPJ A;  1DBN A;  3GZA A;  4KU8 A;  5CU1 A;  1OH3 A;  3O1S A;  3NNJ A;  1VAV A;  1XXN A;  3AZV A;  3DN7 A;  3PUA A;  4D6Q A;  4PJY A;  2XBO 1;  2EF6 A;  4XFA A;  1PX4 A;  3EJK A;  4AWD A;  4OHV A;  1ZZ8 A;  4NAO A;  3THP A;  2GME A;  2HLE A;  4AI8 A;  3SEP A;  5FZB A;  2RS3 3;  3USS A;  3TEZ A;  2EAA A;  4XJU A;  2NN8 A;  4FFI A;  1GNH A;  4ZXE A;  3DPR C;  2Y8K A;  4LIU A;  4LT5 A;  1ZZ9 A;  2VJX A;  5JUV A;  1FV3 A;  3GYD A;  1GR3 A;  4XQ4 A;  5EJZ B;  1PMI A;  4Q0V A;  3MHZ A;  4ZZ5 A;  3DL3 A;  2W1U A;  4KG0 A;  4QXC A;  4PLO A;  4MVT A;  1Q43 A;  4C8D A;  1WME A;  1ULP A;  3FHA A;  4CCK A;  5IFP A;  1JHJ A;  3MLK A;  3I54 A;  3JQX A;  3UJQ A;  5J1X A;  2FDH A;  4M0N A;  4Y1Z A;  1W8W A;  2C24 A;  1LU2 A;  2A6X A;  2WO7 A;  2PEL A;  5A7O A;  2X09 A;  3HAG A;  2W87 A;  2QE3 A;  4AQ6 A;  2CY6 A;  4IGQ A;  4P9L A;  5FYI A;  4Q4V 2;  4XDQ A;  1VR3 A;  1UF2 C;  4SBV A;  2D93 A;  3AMM A;  2V09 A;  4GH4 B;  4OUE A;  4Q2F A;  2EIB A;  4ZU4 A;  1D2Q A;  3KCC A;  4I2O A;  4R9C A;  1NZI A;  1KXG A;  3HNY M;  3KMH A;  1VAK A;  1YLL A;  1XNA A;  1X50 A;  1Q56 A;  3POB A;  1RXG A;  4I0B A;  3NNF A;  1NA1 C;  4Q4Y 2;  4R4X A;  3H0O A;  2ARX A;  2F6B A;  3PMS A;  3ZX7 A;  4COW A;  5BNN C;  1AR7 3;  3POE A;  2YC2 A;  4MXV A;  3Q8B A;  5F7U A;  3B94 A;  2Y60 A;  1XPW A;  1ZZC A;  5CKM A;  2D6L X;  5ABJ C;  4YGE A;  1LES A;  5CZK A;  2PHL A;  5LA0 A;  1GIC A;  4YRD A;  5D1I A;  3UGG A;  4DY3 A;  1IG0 A;  2IC1 A;  2QKD A;  2Q8D A;  2XUM A;  4N43 A;  4HKW A;  1UY2 A;  1F4A A;  3WQB A;  2FCV A;  1TEI A;  4QPI B;  5FFO C;  3VBS A;  3CU7 A;  1CWP A;  3FBM A;  2WZE A;  4RS5 A;  2GC2 A;  1RYY A;  5FZC A;  3UET A;  2Y6G A;  4AK3 A;  4CDU B;  2Z42 A;  1GZW A;  1I5P A;  3GXU A;  3KVB A;  1FAT A;  4DOU A;  4QHO A;  1AHS A;  4MOA A;  5CIR A;  5JZG B;  3FN9 A;  1L3J A;  2A6V A;  3E5X A;  4Q4W 3;  5FP7 A;  2VOW A;  2HWD 1;  1C8M 2;  2QQW A;  2ADD A;  3BPS A;  4Y5S A;  5J36 A;  4Y3O A;  1XE7 A;  4XUP A;  3N9L A;  3UES A;  5CFC B;  5CKN A;  4ARY A;  2ZEY A;  1H2N A;  1PGW 2;  4M3C A;  3ZN4 A;  4MET A;  4LNV A;  3B7M A;  3PME A;  2NP0 A;  2UYB A;  3MFA A;  3SXW A;  2R07 1;  4UYB A;  2V4V A;  5F8P A;  3NJY A;  4AQ2 A;  4FPF A;  4RSU A;  1AL2 2;  1W8U A;  5DAV A;  4CUA A;  1UCX A;  5A3P A;  1QQP 1;  2VTX J;  2IVJ A;  2R06 2;  2A6Y A;  4NIA A;  1NKG A;  1MS0 A;  4COY A;  1RUO A;  5A7Q A;  3MUY 1;  1W6P B;  3ZDV A;  3RYR A;  4IEP A;  1JU3 A;  1FNY A;  1OC1 A;  5LB6 A;  2WFF 1;  5CKQ A;  2B46 X;  2XQX A;  5FOB B;  2FDF A;  1UY4 A;  5FUP A;  2BW8 A;  2GAU A;  5DUW A;  2JDY A;  3ACL A;  5FKC A;  1AXZ A;  5FUI A;  3HD8 B;  5GLW A;  1HXS 3;  4JV4 A;  3B3Q E;  2AH2 A;  2EIC A;  2OUH A;  5F5I A;  1N1V A;  1W8N A;  2JEN A;  5FYZ A;  5GLT A;  5JDB A;  4AVB A;  2JIJ A;  1BJQ A;  2VUA A;  2XGX A;  4XJW A;  1ND3 A;  4IND A;  5A7S A;  3UKT A;  1LOC A;  5A6Z A;  3JBG 3;  3N9P A;  4C0B A;  3K75 B;  2BOJ A;  5FV3 A;  5L19 A;  1YIF A;  1U5I A;  3AKT A;  2WDB A;  1EAH 3;  3ES4 A;  3PU3 A;  4NRM A;  4FVV A;  2IUW A;  4K7J A;  1O91 A;  2D43 A;  2DUP A;  2ZGP A;  3ZSM A;  4LK6 A;  1MAC A;  5F37 A;  2EXH A;  3WHU A;  1IPS A;  4K8R B;  2ADE A;  4GB3 3;  1CAX B;  5EJ1 B;  4JHZ A;  4AI0 A;  2YUE A;  2DF7 A;  2HWF 3;  4LBM A;  3FX3 A;  4MGZ E;  2ZX0 A;  4JHT A;  3LSD A;  4KI5 M;  4D94 A;  1F9K A;  1JZ3 A;  3ZYR A;  1BEV 2;  2VU9 A;  4CCL A;  2DVF A;  2NPI A;  4AZZ A;  1RUF 1;  3M4F A;  3O1R A;  1QOS A;  2ARE A;  1GMM A;  1QJU 1;  4A7Z A;  4QKN A;  5BNQ A;  5FQ0 A;  3BTX A;  1MVQ A;  2XJP A;  3DUI A;  1W04 A;  2UY9 A;  2P3J A;  1WLW A;  1SDW A;  3FJS A;  3R0R A;  1FOD 2;  1AYM 1;  1VBE 2;  4RQP B;  4XQW A;  1VE0 A;  1JN2 P;  4PBO A;  5JLV A;  2UWA A;  1K5M C;  2JE8 A;  2RS5 1;  4LMF A;  3IMM A;  5FTT C;  5CBL A;  1H8T A;  2WAA A;  4NID A;  4OLL A;  2C1F A;  3MBW A;  3OY8 A;  1PO1 3;  3B02 A;  1AJO A;  4GWJ A;  1YQ5 A;  3ZXG A;  5K8S A;  1LGN A;  4N43 B;  2H6B A;  3WCR A;  5T3N A;  3VBS B;  1G6N A;  3VN4 A;  4G4F A;  4ZZ8 A;  3WDX A;  1DGL A;  4RS5 B;  5D8A A;  2JEC A;  2OKX A;  3S6P A;  2FHR A;  3PVN A;  4FAG A;  1EP0 A;  1DIW A;  1GWL A;  4QU2 A;  5FZH A;  3KGL A;  2AAC A;  2JIG A;  1A3K A;  1NAE A;  1RUC 2;  2VCB A;  1SMV A;  4FPJ A;  3V56 A;  3P1I A;  1ALY A;  4GJY A;  4RD7 A;  4ERO A;  4NR1 A;  1BMV 1;  3O14 A;  2OPW A;  2Y64 A;  4CP9 A;  1MS8 A;  1H8V A;  1OHF A;  2ES3 A;  4A41 A;  4GA9 A;  1AR9 2;  3BN6 A;  4HPK B;  4EN9 B;  4HL0 A;  4M3C B;  3VHP A;  3BIW E;  1W9S A;  1X7N A;  4PIY A;  5IAX A;  1QEX A;  1W8F A;  4CCJ A;  4OUM A;  2W39 A;  3H42 B;  1U0A A;  4BH9 A;  4KQ7 A;  2BZD A;  1RUD 3;  4MAD A;  2RDS A;  3HBK A;  4YG0 A;  5EFU A;  3UV9 A;  1I5Z A;  2DVB A;  1AR8 2;  3DXT A;  4B7E A;  4CEW A;  4FXK B;  3VKL A;  1VBB 1;  5EJ3 A;  2W52 A;  2QQP A;  4A3Z A;  3PL0 A;  1RIN A;  5CG8 A;  3U14 A;  1TZO A;  2HYX A;  3AZZ A;  2JKB A;  4AAX A;  2WS9 2;  4Q4V 3;  5BYN A;  3ZIW A;  2WRA A;  3SHR A;  4DZG A;  3MLJ A;  5I93 A;  1ZBA 2;  4AVS A;  4YGB A;  1QJZ A;  3Q8A A;  4N7U A;  4IV3 A;  3V0B B;  4HON A;  4P5Y A;  4XZU G;  1NLR A;  2G9F A;  2YDE A;  2W0X A;  3W9A A;  5FPA A;  1NOV A;  3OPW A;  4K6B A;  3MPP G;  4ZON A;  1UX7 A;  3RS6 A;  1ND3 B;  1QJX 1;  4Q4Y 3;  1XE8 A;  4N7I A;  4GAZ A;  4AXO A;  4WM7 C;  4XC9 A;  1OF3 A;  1DYP A;  3H1M A;  2ZJC A;  4XCB A;  4TWT A;  5FYV A;  3UNP A;  1S0E A;  2VBP A;  2DV9 A;  2E7Q A;  2HYK A;  3DPR A;  2RR1 1;  3TN9 1;  1MVE A;  1VBC 2;  1O3T A;  1UMI A;  1BBT 2;  1STM A;  1X9T A;  2RM2 2;  5BPX A;  5CIS A;  1SDD B;  1H1I A;  1H9W A;  3S5A A;  5EZW A;  1U5Z A;  2BU9 A;  4FOQ A;  3S7I A;  3T2P A;  5A3U A;  5FO9 B;  4IEY A;  1OLM A;  2C6S A;  2QNK A;  2VXR A;  4Y20 A;  2HWE 2;  3HN1 A;  1WA6 X;  3ZR5 A;  4I01 A;  4JC1 A;  4NHY A;  4NWW A;  5IHR A;  4RR3 C;  2ZGK A;  2XJQ A;  3RFR A;  2QJV A;  4N90 A;  4XF0 A;  4HK9 A;  4BQW A;  2WO3 A;  4PF5 A;  2MEV 2;  4DUV A;  1WMF A;  3NST A;  4FP3 A;  4HVQ A;  5FQ0 B;  3WDW A;  3HJR A;  1LTE A;  2VZU A;  2XPJ A;  1VBA 3;  3OUJ A;  2VMC A;  3I59 A;  3QOP A;  4R8H A;  1SLC A;  1OUR A;  1XND A;  3HQU A;  5A1F A;  3OGJ A;  1WLC A;  2ARB A;  2PN5 A;  5IK8 A;  1H8T B;  3OYW A;  1QHD A;  4KBZ A;  3POW A;  3CL1 A;  5BNN A;  3WF3 A;  4P9W A;  2E63 A;  3VKN A;  1Q8O A;  2J7M A;  2XBO 2;  2R06 3;  1BK1 A;  3SCG A;  3T0A A;  5ABJ A;  4OVE A;  1YC6 1;  3ZSK A;  4DPN A;  1AR6 1;  4LK7 A;  2BNM A;  2J1R A;  1I9R A;  4QGM A;  3ZXE A;  2HBT A;  5JSR A;  2W94 A;  4P9G A;  2A70 A;  2WT2 A;  5D8A B;  2ZX2 A;  3ACI A;  3QH7 A;  4UFM A;  4WVW A;  2RG4 A;  2OZJ A;  4ATF A;  4CCN A;  2D7F A;  2RJL A;  4IE4 A;  4CCE A;  4FXG B;  2WZR 2;  5FY4 A;  3OG2 A;  3BVC A;  1GFF 2;  4QX1 A;  5LRR A;  4Y1V A;  3WDU A;  5FMD A;  3USU A;  4OI2 A;  4QQP A;  2RMU 3;  4E9K A;  1LRH A;  5EYX A;  4CP9 B;  2H6C A;  4GKX A;  1RHI 1;  4OYU A;  2PHF A;  2NYY A;  1S55 A;  1Y4W A;  1EV1 3;  2C9A A;  3I7D A;  1RUJ 3;  5FZ1 A;  3R4D B;  3OBZ A;  3J8F 3;  3LEM A;  3SH5 A;  1BYH A;  1W39 A;  2W47 A;  3E6D A;  2J1U A;  2FD8 A;  1GP4 A;  5JR2 A;  2WSU A;  5C5U A;  4DIQ A;  3NKG A;  2D6K A;  3PUQ A;  1H30 A;  4K1Z A;  3LB9 A;  5E88 A;  4CA9 A;  1F4H A;  3F95 A;  3VD3 A;  1EUU A;  2UUR A;  2ZGQ A;  4CEW B;  4NIG A;  1CD3 G;  4CU8 A;  1J3Q A;  1DGW X;  3NNM A;  4I30 A;  3EMR A;  3AK0 A;  4RA0 A;  3KQ4 B;  5GLZ A;  2XJU A;  2D40 A;  3T2Q A;  5JMC A;  1R08 1;  4ZS3 A;  1Q8Q A;  1C8N A;  3GDB A;  3ME2 A;  4BQY A;  2Q0A A;  1PK6 C;  2PHR A;  2VOT A;  3NVC A;  3WEZ A;  4CDQ C;  1PZ8 A;  5C6C A;  4ZU7 A;  3T09 A;  4IEX A;  3MO4 A;  2DBN A;  2E7T A;  4K20 A;  5G05 L;  4A45 A;  3KSC A;  5JSP A;  1WCK A;  2YRO A;  4C1X A;  1C28 A;  3OF1 A;  2D3R A;  2VE1 A;  3POF A;  4O7X A;  3KT1 A;  5DZG A;  5C8C C;  1VBE 3;  5T5J A;  2JD9 A;  2W68 A;  4TLG A;  4QHZ A;  3WF1 A;  2VC9 A;  4IEO A;  4BM8 A;  3V65 A;  3GZT B;  1NCQ A;  4YYO A;  5GZF A;  3ZSE A;  4XDP A;  3DPR B;  1FXZ A;  3KT4 A;  1XB9 A;  4MSV A;  4U36 A;  1Q8S A;  4JZR A;  1AJK A;  4FPK A;  5FYC A;  3WUC A;  2MPF A;  2F4L A;  4BK4 A;  4PDW A;  2PYT A;  2ORX A;  2R04 1;  3I3Q A;  4L8Q A;  4Q27 A;  1UWW A;  4Y20 B;  1OFN A;  1H4H A;  2PHU A;  2BRT A;  5A7P A;  2EXK A;  3MIC A;  4A6S A;  5LBE A;  4JTN A;  1BQP A;  2HWD 2;  3AZX A;  3P3P A;  2YBP A;  4K8F A;  1ND2 C;  3KT7 A;  2ZGN A;  1E5I A;  2CAV A;  2R07 2;  5L9B A;  1J3R A;  1RUI 2;  3WLU A;  2HWB 3;  2GU9 A;  1CPN A;  1MS3 A;  2AYH A;  4FOY A;  1TE1 B;  3PIJ A;  1V9U 1;  1CZT A;  1JUI A;  1OI6 A;  4HKO A;  1AR9 3;  1QQP 2;  4CYD A;  1S4C A;  2QDR A;  3WDT A;  3IKW A;  3A7Q A;  3AYD A;  3M3O A;  1XYO A;  1AX1 A;  3RDI A;  2XWJ B;  4O61 A;  3SH4 A;  4S2G A;  1IKQ A;  4F83 A;  2CV6 A;  1QOT A;  5BNN B;  2J1T A;  4XAA A;  4HKL A;  3MW3 A;  2OA2 A;  5CB7 A;  2MNG A;  1K5M A;  2G19 A;  4DMI A;  4EN6 B;  3VBU C;  5ABJ B;  1FMD 1;  1ONA A;  2HEY F;  5LA2 A;  3SKJ E;  1HB3 A;  4EWE A;  1S1A A;  5LEJ A;  4AHZ A;  5CYY A;  5FWJ A;  3M3E A;  2FZ2 A;  1JBC A;  5F5C A;  5KC5 A;  1V00 A;  4YGD A;  2WS9 3;  4XBL A;  2VH9 A;  4TYS A;  4IV1 C;  1HB2 A;  2OT7 A;  1ZBA 3;  1HRV 1;  3KVA A;  5EP9 A;  5DQ0 A;  4OHZ A;  3VBH C;  3VZJ A;  3WHT A;  1JZ2 A;  1AL0 G;  4D3W A;  3WW1 A;  1CJD A;  3USU B;  2Z5W A;  2XG3 A;  3DYP A;  3U10 A;  2Q5T A;  4OZO A;  4CVU A;  1DQ0 A;  3LEI A;  3H3L A;  5IK7 A;  1WD3 A;  2VNO A;  3FLT A;  5FYU A;  2IXI A;  3MV1 1;  2DVA A;  2W95 A;  3WP3 A;  3BPZ A;  5D2A A;  3MV0 1;  3VBF C;  1X33 A;  2XDV A;  5T5O A;  2F17 A;  3ZFE C;  4BCU A;  2P34 A;  3QLQ A;  1VBC 3;  2CGN A;  4AL9 A;  5DPN A;  1BBT 3;  1O4T A;  4BDV B;  2RM2 3;  5IUQ A;  3U1X A;  1RUF 2;  2B7Y A;  2CDP A;  2X10 A;  4W6X A;  2WYF A;  3ZSL A;  5A7N A;  2PAK A;  3O0X A;  2HWE 3;  2QQO A;  1RUH 3;  1UQX A;  4KWL A;  4N43 C;  3TB0 A;  3GCX A;  1PX3 A;  1XBF A;  3H1Y A;  3JB4 C;  3NKT A;  3VBS C;  3BTA A;  4RS5 C;  2AEN A;  4HMZ A;  1AYM 2;  3LD8 A;  2DUR A;  1AYN 1;  3POJ A;  1QJY 3;  2MEV 3;  2YV8 A;  1RUE 1;  3LWC A;  2RS5 2;  4LOR A;  5KHK A;  1PIV 1;  1O6U A;  3T4V A;  4I0A A;  5FYS A;  1IPJ A;  3W58 A;  2NLR A;  5E6H A;  2KXL A;  2YFZ A;  1PM4 A;  3BOP A;  4PLN A;  4LXL A;  2Y34 A;  3POY A;  3T0B A;  2CNA A;  1ZRR A;  1H4G A;  2FMD A;  1XNK A;  1DGW A;  2WN2 A;  2Q30 A;  1NCQ B;  5LK5 A;  1GZ9 A;  2D6O X;  4H14 A;  4LEJ A;  1VRH 2;  3TWI A;  3OEB A;  3G6J B;  2Y6L A;  3IZO A;  2AUY A;  4WM7 A;  3K2O A;  3LSE A;  4I02 A;  1DF0 A;  1C57 A;  4LHL A;  4PDW B;  1YHF A;  3IMN A;  3WP6 A;  3BAL A;  1POV 1;  1GKB A;  2BNN A;  3I3D A;  4QXK A;  5ACA 2;  4PHZ A;  1BMV 2;  4Q0P A;  3I2J A;  3VBR A;  3DF0 A;  1QF3 A;  1QJF A;  1US3 A;  4XBN A;  2FDJ A;  3WT3 A;  1Z0H A;  2WWU A;  3TBD A;  1UPS A;  2WZR 3;  1T2X A;  3MEP A;  4YW1 A;  1FPN 1;  5FP3 A;  3WG4 A;  5A1A A;  5KXE A;  4ES9 A;  1MEC 1;  1RUG 2;  3BIE A;  1B09 A;  2TBV A;  4UFH A;  1SLB A;  1W6O A;  4MH0 E;  3SCF A;  3H1W A;  5EIY B;  3KHC A;  1U5Y A;  4LKE A;  4YW3 A;  3ZXF A;  3KQR A;  1E5H A;  1MS5 A;  3IDB B;  4JTO A;  1VBB 2;  3WG1 A;  4JRA A;  3K51 A;  5BNP A;  1S0B A;  1WZX A;  4IQP A;  1UL9 A;  4NUB A;  2OUJ A;  1K5M B;  4CXY A;  4Y4R A;  1DQ2 A;  4BHP A;  5JR7 B;  3ACH A;  5IAV A;  5FYM A;  4CP0 A;  1UOB A;  5FCC A;  1LOF C;  3NO8 A;  4BQ2 A;  2W5F A;  3JZV A;  4Y22 A;  4TLF A;  3MUZ 1;  3HN3 A;  1N3P A;  1W6Q A;  4P9Y A;  5EWS A;  3JD7 1;  3NJV A;  2XML A;  4PIX A;  4R9D A;  2D98 A;  2ZTN A;  5H9Q A;  4HXC A;  4DXZ A;  1FAY A;  4CTE A;  2ZGM A;  3M3I A;  4XFI A;  5LEK A;  2JB4 A;  1W6M A;  1F35 A;  4Z2A A;  2E53 A;  3LA7 A;  1SPP B;  1TME 1;  3TN9 2;  4CXX A;  2RR1 2;  3B9C A;  3QH6 A;  3E6B A;  5FYT A;  2JEM A;  5FXZ A;  1IPK A;  5GLU A;  4BXS V;  5IVC A;  3I2O A;  4J6G A;  3ZYP A;  1GOF A;  2VBD A;  5FMO S;  5C71 A;  2VQU A;  5DUU A;  1AF9 A;  3QCW A;  3T1L A;  2WR9 A;  3OSD A;  1XC6 A;  2QFE A;  4IEV A;  4LUM A;  2GC0 A;  3ZM8 A;  2A6W A;  1YQ2 A;  2Y6K A;  4MO3 M;  5DMY A;  1SAC A;  1KS5 A;  3PIG A;  4QQL A;  4AGV A;  4COU A;  5KR7 A;  2ZKL A;  1UY0 A;  2RS1 1;  2NZ9 A;  4LQR A;  2HWD 3;  4LLF A;  2O1Q A;  2GMP A;  5F32 A;  5I8Y A;  3A0K A;  5EYY A;  3D4K A;  1H6X A;  1RUI 3;  3OUI A;  5IVE A;  5KHI A;  1PK6 A;  4QAW A;  2JD4 A;  3D82 A;  4CDQ A;  1NE6 A;  3ZFG A;  1QQP 3;  5AFE A;  1H6Y A;  1QH7 A;  4LO5 B;  2XL9 A;  3N9Q A;  4URA A;  3GBW A;  4CDX A;  1K45 A;  1YWK A;  4M3C E;  1QDO A;  4FOW A;  4HSJ A;  1AR6 2;  2FCT A;  5C8C A;  3E5U A;  4H2A A;  4EN7 B;  4B1M A;  1IS6 A;  2RVA A;  2XUE A;  1WCS A;  3HMY A;  4WM7 B;  4XUO A;  5HV4 A;  1PM7 A;  1X9P A;  1OBN A;  3CJX A;  2Q8E A;  2ZGU A;  5L7O A;  5FY7 A;  2D44 A;  3KLS A;  3PJY A;  4XTM A;  4Q8L A;  5FP4 A;  3T4H B;  2DUO A;  3WDV A;  4LIV A;  2X53 S;  1W2U A;  4CCD A;  3T30 A;  2J22 A;  1ODN A;  1OPO A;  2ERF A;  4CUC A;  4XAC A;  4QX2 A;  4XF3 A;  1W9F A;  4RR3 B;  3URF A;  5LRS A;  2WAO A;  1ND2 A;  4IV3 C;  2JDZ A;  1CPM A;  2DFB A;  4W4Z A;  1W6O B;  3LAG A;  4BMB A;  2ZS6 B;  1D0G A;  4J1W A;  3E5Q A;  4MGQ A;  5C9A A;  4XZP A;  3GBF A;  1XSQ A;  4XYX A;  4DFS A;  1W0O A;  4L92 A;  1UOG A;  1TMF 3;  5CFD C;  4M4P A;  5SV5 A;  2PHT A;  1S2B A;  1NYW A;  1R08 2;  4FP2 A;  2JDU A;  3RSJ A;  3ETP A;  1V70 A;  2BJS A;  3ATG A;  3LPF A;  2ZXQ A;  5FZK A;  1G8W A;  1IS4 A;  2DCT A;  1JW6 A;  1W8H A;  2YHJ A;  5F6L B;  1OT5 A;  3WY6 A;  5AC9 3;  1DCS A;  4DB5 A;  1JZ4 A;  1RVF 3;  5KHG A;  3ZKU A;  1GNY A;  1MPX A;  4Y22 B;  1OQE A;  4QMA A;  2JKX A;  3VBU A;  1WCD J;  2XQR A;  1MZE A;  2YB7 A;  1W6Q B;  1EY2 A;  2F4P A;  5A3W A;  4E27 A;  4ZS2 A;  2QQJ A;  4FTE A;  1UD1 A;  1CAW A;  1AYM 3;  1UKG A;  1UY3 A;  2LM3 A;  1S0F A;  1PVC 1;  2Z4F A;  4AI1 A;  4BU2 A;  2Z79 A;  4Q8K A;  2ZBJ A;  4RHV 3;  2K46 A;  1EPZ A;  2P5B A;  2VY0 A;  3O0V A;  2VAU A;  2BWC A;  4IV1 A;  4Q4X 1;  3WNL A;  3O5S A;  4GMP 1;  4NPM A;  1CON A;  3VBH A;  4PQQ A;  5DDJ 1;  3WNX A;  5J3U A;  2ZHM A;  1QMJ A;  3BUC A;  1KFU L;  4IGO A;  4DRR A;  3MDP A;  3OPZ A;  4EYU A;  2R04 2;  2HBU A;  1HRI 1;  1VRH 3;  3VDB A;  2VVD A;  2DCJ A;  1WW6 A;  5BUV A;  1MZF A;  4B29 A;  1O8S A;  1QJE A;  4S2F A;  5SV8 A;  2DTW A;  4RN5 A;  5LAS A;  4XJZ A;  5FBJ A;  3VBF A;  3MLL A;  2DFC A;  3V64 A;  2K2S A;  1YXW A;  2H0V A;  3AXE A;  3ZFE A;  3WDY A;  2Q1F A;  2ZAB A;  5ACA 3;  4IL7 A;  4GD4 A;  3AFG A;  4I3P A;  1W3V A;  5A3N A;  5IVV A;  1VAM A;  4Z8B A;  3CMG A;  3DEC A;  4RGK A;  5JXG A;  4UW5 A;  5GAL A;  1J84 A;  2QCS B;  4LBL A;  1RUG 3;  3Q8E A;  1PK6 B;  4LBQ A;  2WNU C;  3LE0 A;  1CES A;  4NVP A;  4CDQ B;  2QQV A;  1R09 3;  5LBB A;  5T5P A;  3WIN E;  3ZFG B;  4YSF A;  3V0A A;  4AVV A;  4CP2 A;  2YBK A;  4JGY C;  2JE9 A;  1HKD A;  4HVR A;  3SIS A;  2ZCW A;  4EJR A;  5C8C B;  3OB8 A;  4AHY A;  5FZ3 A;  1NT0 A;  3FWE A;  2VXJ A;  1GU3 A;  1OQD A;  3WSO A;  4FTS A;  5JOZ A;  1PO2 3;  1H9P A;  2JXA A;  3POS A;  1DGR A;  4YLZ A;  1HRV 2;  4QPY A;  5JOY A;  3SH3 A;  1JYI A;  4MYE A;  1W2A X;  3KCX A;  1JU4 A;  4GWM A;  3INA A;  1ZBE 1;  3NV3 A;  4L99 A;  2FDI A;  2G4I A;  2GZW A;  3KM5 A;  3R05 A;  3UK9 A;  1N1Y A;  2GP5 A;  1PVX A;  2D5H A;  3UKN A;  5I0S A;  3LKJ A;  2Y38 A;  3DYM A;  3ZR6 A;  3MIH A;  4CPB D;  1C5H A;  1H2L A;  1JOD A;  4B7K A;  1WUV A;  3FMG A;  4LOS A;  2QZ2 A;  1OA3 A;  4YW2 A;  3O0W A;  1ZRF A;  2P2K A;  1OH4 A;  1RL3 A;  1ND2 B;  2RR1 3;  4QKD A;  4XET A;  4ZXK A;  3SNM A;  1BVP 1;  4AFD A;  1LHN A;  4IXL A;  1G9D A;  1FNZ A;  5LY1 A;  4FO9 A;  4AF9 A;  1ZZB A;  5FWE A;  5C9A B;  3PUH A;  2VMF A;  4Y33 A;  1ULG A;  3MW4 A;  1Z7S 1;  5F5Q A;  3G7D A;  3O1U A;  1DFQ A;  1R1Z A;  2WJS A;  3WOG A;  3H9A A;  1OLQ A;  2IWG B;  1NCQ C;  1GSL A;  2PQQ A;  1LAJ A;  1DGR N;  1I3H A;  2VG9 A;  4JQR A;  5DAX A;  1LOD A;  4KWK A;  1AYN 2;  5FY9 A;  1RUE 2;  2ZKN A;  3QBQ A;  1ENS A;  3OTF A;  4PDW C;  4PIZ A;  5I0U A;  2RE9 A;  2WZ8 A;  3VBU B;  1LOF A;  1JYC A;  2HWC 1;  3IBM A;  4BYY A;  4RL7 A;  2AZ5 A;  2D3S A;  2W3J A;  1JMU B;  3ZLI A;  4ATE A;  1E57 A;  1VBD 3;  2UU8 A;  3AKP A;  2YGM A;  4IV1 B;  3JUU A;  3ZVX A;  1CX4 A;  1IQD C;  1RMU 1;  3RZG A;  3VBH B;  3CEW A;  3NWK A;  1RJ8 A;  2QQM A;  3SQO A;  3BU7 A;  2E9Q A;  2VNR A;  5J09 A;  4YVW A;  4LBO A;  1W2N A;  5K0U C;  1AR6 3;  2RDR A;  3APB A;  1PNF A;  4LKD A;  3P5B A;  2JX9 A;  1ZNP A;  2XVK A;  5FZI A;  4LLO A;  1IQA A;  1SBE A;  3IT8 A;  2FDK A;  2HEW F;  1NLS A;  5I0D A;  2DYC A;  1KJR A;  2PQS A;  2YY1 A;  1SLA A;  5C4W C;  5C8W A;  4QM9 A;  2Q8O A;  2VUL A;  3VBF B;  4CDW A;  1UOF A;  3TNQ A;  3VDA A;  1ZRE A;  3ZFE B;  5GLV A;  3OEA A;  4AFA A;  4WVZ A;  4XCA A;  3GZE A;  1W99 A;  2RS3 1;  4QX3 A;  1ODM A;  5FP9 A;  3WQ1 A;  2G1M A;  1MEC 2;  3AZW A;  4JKM A;  5D21 A;  2WBK A;  3ZN6 A;  4OI1 A;  4ISQ A;  3VHN A;  3HNB M;  2VOX A;  2FZ1 A;  5HCH A;  5JPN B;  4QB1 A;  1TQ5 A;  2CGO A;  3IIA A;  2LTN A;  1Y3T A;  2E32 A;  4LO8 A;  4LBQ B;  3PDQ A;  3WXP A;  2QQN A;  4YW6 A;  5ANN A;  2VZ3 A;  4FFG A;  3QD6 A;  2R6Q A;  1GZW B;  4LUK A;  1UZW A;  3H8O A;  3RZJ A;  1A78 A;  4H7M A;  1JYV A;  4EN8 B;  1H1M A;  3I2D A;  2KD7 A;  1OOP C;  4IET A;  1JH5 A;  2C26 A;  5FY1 A;  1VMJ A;  3K3O A;  5GZG A;  1Q3E A;  4HVO A;  3O1M A;  1V6N A;  5DZE A;  1J1T A;  3MIF A;  3AP9 A;  4AE2 A;  3H8R A;  1JYT A;  3DKQ A;  3JD7 2;  5LA9 A;  1R1A 2;  3O1T A;  3NNL A;  5FZA A;  1TG7 A;  1YIP A;  3FFZ A;  3VKF C;  1WKY A;  1S0J A;  1WCQ A;  3KF3 A;  4IE0 A;  5EV7 A;  1ASJ 2;  1TME 2;  4YFZ A;  4JKL A;  2ZX4 A;  1GQP A;  1AR7 1;  3ZXK A;  2BGP A;  1XOY A;  3M8L A;  4XUT A;  2OX0 A;  4NHX A;  3LDB A;  3WR0 A;  2R0F A;  4CRQ A;  3DCQ A;  2P6H A;  4MXW A;  4BOW A;  2Q8C A;  4MGI E;  3AKR A;  2ZEX A;  3D0J A;  4AED C;  1Q8P A;  2H0B A;  3ZMN A;  3MYX A;  1JZ7 A;  5JWP A;  2VPV A;  4K9S A;  4IEW A;  3U75 A;  4KH9 A;  1XNB A;  2R04 3;  5E89 A;  2B39 A;  5IK4 A;  2GP3 A;  3UT0 A;  1K42 A;  2XLA A;  1AUY A;  1DYO A;  4UFJ A;  4Z1V A;  5HPO A;  1GOH A;  2RS1 2;  5I8T A;  5EPA A;  2BQP A;  2D6P A;  2IFW A;  2GAL A;  4FPH A;  2CWM A;  1RED A;  3N7M A;  2BUK A;  2D6M A;  2BOI A;  1YJL A;  2CWS A;  5CFD A;  5FDB A;  3KS7 A;  3OGG A;  4HAN A;  4UWD A;  4L2N A;  4Q4W 1;  2KM2 A;  4DNY A;  1YFX A;  3PHM A;  1FX5 A;  2DWR A;  2WQ8 A;  2B8M A;  1O3S A;  1W9Y A;  5DUX A;  3SIT A;  4W65 A;  1W03 A;  2C9K A;  2ZX3 A;  1COV 2;  1D0H A;  1LCL A;  3I3E A;  4V1P A;  5A7W A;  3ITQ A;  3S30 A;  4J1X A;  3VBR C;  1GLH A;  1HLC A;  2DCY A;  4FFH A;  1W8T A;  4HOO A;  4YVS C;  3ZYF A;  1OPM A;  3RWN A;  3VZL A;  1AX0 A;  1LOA A;  3E97 A;  3AFK A;  3NMB A;  4D69 A;  5FZ0 A;  3N36 A;  4YVW B;  3FHI B;  3EQE A;  5EHD A;  2WLQ A;  3E6C C;  4RGG A;  4ZU5 A;  3Q8F A;  1C8M 3;  1K12 A;  4XW3 A;  2YPD A;  3MFC A;  4UW6 A;  1QIQ A;  5BNP C;  1TNF A;  1WCU A;  4QGL A;  4OHW A;  1GP6 A;  4DY5 A;  1HXS 1;  5C3O A;  2QZ3 A;  5A6Q A;  1LU1 A;  1AL2 3;  2YZ4 A;  3AP4 A;  4CU9 A;  4QQO A;  5L9V A;  4PT6 A;  3OY8 B;  2P4E A;  1LGB A;  2VZ1 A;  3AYA A;  4N53 C;  4CCC A;  3ZN6 B;  2EVX A;  4MGT A;  3JBG 1;  4GKY A;  1BZW A;  2OYZ A;  2XJR A;  5LBC A;  1O5U A;  3HOB A;  1EAH 1;  1YFU A;  1NQD A;  4HFS A;  4HBN A;  3RPQ A;  4HLT A;  3WQ7 A;  3RG0 A;  4GB3 1;  1SHW B;  2JG9 C;  4AEK A;  4C0H A;  2I2S A;  4HK8 A;  3I8T A;  1D7P M;  1UU6 A;  2WNU A;  5DG1 A;  3X29 B;  1T6G C;  5A3M A;  1CGP A;  5FLJ A;  2O14 A;  2WZP P;  5EQU A;  4Z92 B;  4JGY A;  4AVC A;  5A6Y A;  1LEN A;  2W08 A;  1VIW B;  1W8Z A;  3ZOI A;  4CE8 A;  2JJ6 A;  3LEK A;  5FPZ A;  1PVC 2;  3B00 A;  4JVA A;  3ILF A;  1RUE 3;  2OPK A;  2ZGT A;  1VB4 A;  2XLF A;  4BLI A;  3IAQ A;  3OJB A;  1LHV A;  1OA4 A;  4Q4X 2;  1LHW A;  1XU1 A;  2IXH A;  1DZR A;  3HR9 A;  3L2H A;  1JUH A;  2Z69 A;  4KMQ A;  4XIO A;  3RNS A;  1F15 A;  1MZ5 A;  4E4D X;  3O1O A;  2ZAH A;  2YU1 A;  1JI6 A;  3H7Y A;  1BEV 3;  1HRI 2;  4MXW B;  4EN0 A;  3NV2 A;  4BZ4 A;  5F9T A;  2FQP A;  2HKX A;  4QPG A;  1PGL 1;  4B1L A;  1C3H A;  3Q8C A;  3ZFG C;  2W46 A;  4FBF A;  5KC6 A;  3AYC A;  3MI8 A;  1POV 3;  4IV3 B;  4CDX C;  3KV9 A;  4A7K A;  2I74 A;  4W6W A;  5HBA A;  4YFW A;  1BVV A;  2E31 A;  4FT8 A;  4MHR A;  3VD7 A;  3D3A A;  3JXS A;  1FOD 3;  4I3G A;  3WX5 A;  1XSR A;  4UI9 L;  3BCW A;  3EHK A;  1OKQ A;  4OMC A;  2WT1 A;  3ZFF C;  5CFD B;  5L7O C;  4AFM A;  4LBK A;  5HCB A;  4G9S B;  1XE0 A;  4A2U A;  5HI0 A;  1MEC 3;  4X6Q B;  1LEM A;  5C3P A;  2JDH A;  4QKB A;  4BIS A;  1YYN A;  2XJT A;  2BFU L;  4YM2 A;  5F2S A;  3A0N A;  3ZYI B;  5A7W B;  2PAM A;  4DXR A;  1WMD A;  3AKS A;  1V0A A;  1YCI A;  2XJV A;  1I1E A;  1DLC A;  1O5L A;  1W8O A;  3AVS A;  4NRP A;  1RUD 1;  1E5S A;  2R1B A;  4QX5 A;  1O3R A;  1BLZ A;  2WWJ A;  4V2V A;  2PHX A;  2ZHL A;  1V6M A;  2LW8 A;  1UOJ A;  4OI4 A;  1BHG A;  1RUC 3;  1KRI A;  4QKF A;  3THD A;  4BQ5 A;  3UKV A;  5FLI A;  4KG8 A;  5C9A C;  3ETQ A;  4LE3 A;  4Q4V 1;  5K0U A;  2GNM A;  1TNR A;  5H9R A;  3OGS A;  3VKM A;  5FPL A;  3I59 B;  1HX6 A;  3K77 A;  4Z2W A;  3JD7 3;  5GZD A;  2VZV A;  3VHO A;  3AKQ A;  1R1A 3;  4FQ4 A;  2J1A A;  4IUG A;  3DV8 A;  4YW4 A;  4CCO A;  1G9C A;  3OYW B;  5C4W A;  4OZX A;  3N7L A;  2YPJ A;  2XVG A;  4XF1 A;  1IS3 A;  2MHF A;  1ASJ 3;  1NLQ A;  1SCR A;  2WFF 2;  4Q4Y 1;  5GM0 A;  3B93 A;  1AR8 3;  1W9W A;  5FY0 A;  1DHK B;  4EZH A;  2SLI A;  1AZD A;  3W20 A;  3GNE A;  3H50 A;  2CHH A;  1DYK A;  1Z7S 2;  5FZ6 A;  1YQ8 A;  3GBG A;  4XXP A;  4C1W A;  4XUQ A;  3N4M A;  2FCU A;  3KWV A;  3IN9 A;  2ZEZ A;  2V72 A;  3FUO A;  1RIT A;  3OPT A;  4NN0 A;  2WNU B;  2BBA A;  4M4R A;  5GJ6 A;  3WZ1 A;  4Z82 A;  5E1R A;  4D0Q A;  2WNV C;  3AMP A;  1W9T A;  4JGY B;  1P8J A;  1JHN A;  1FI2 A;  1ZA4 A;  1T6B X;  1SEF A;  2BDR A;  1S0I A;  2D97 A;  2NMO A;  4E4H A;  3TNP B;  1D4M 1;  1OOP A;  4CP1 A;  5FYH A;  2CYF A;  3EB7 A;  3VZM A;  4DEV A;  1ZZ7 A;  3O7O A;  2HEV F;  2HWC 2;  4MV2 A;  3L2Y A;  2LAL A;  5JOW A;  4E8D A;  1VAL A;  3N9N A;  3NNG A;  2VZP A;  3WCS A;  1VBA 1;  1VMH A;  1QXR A;  3KZ4 C;  1RMU 2;  5K7P A;  1COV 3;  3AVR A;  5FP8 A;  4FPO B;  1RXF A;  4JX0 A;  2VZT A;  5FR3 A;  1NCR A;  2EIE A;  3ES1 A;  3ORJ A;  2B5H A;  4IES A;  4N9H A;  3W59 A;  1ZVF A;  1UYX A;  1QJU 2;  2GC1 A;  1LOE A;  4XF4 A;  3RI9 A;  4A7Y A;  2R06 1;  1UZV A;  1NY7 1;  3L9J T;  1UIJ A;  2VW0 A;  2WA4 A;  3I2F A;  5LY2 A;  3ACF A;  3RI8 A;  1KQR A;  1WMX A;  4CCM A;  2RS3 2;  4AED A;  3WUD A;  4C90 A;  4YG6 A;  1WD4 A;  3III A;  2VTF A;  5JIA A;  4AEJ A;  1LOG A;  3POI A;  1YQ6 A;  4S2D A;  1ULD A;  3VDD A;  2HH9 A;  1JTZ X;  1GYK A; 
#chains in the Genus database with same CATH homology
 1JZ3 A;  4W4Z A;  2CDO A;  2B4K A;  4MGQ A;  1NUK A;  5C70 A;  3AC0 A;  1GMM A;  3VDC A;  5JXI A;  4CUB A;  2XHN A;  4M4P A;  3ETP A;  3HEI A;  2BER A;  3LPF A;  2ZXQ A;  3C7G A;  1OT5 A;  4TTG A;  1L7Q A;  1JZ4 A;  1GNY A;  1MPX A;  2JE8 A;  1L7R A;  2JKX A;  2WAA A;  4ZY9 A;  3BGA A;  2YB7 A;  3MBW A;  1R64 A;  2QQJ A;  3C7E A;  4GWJ A;  1UY3 A;  2Z4F A;  2B9V A;  1PMJ X;  4TXW A;  3IB3 A;  3WNN A;  1NX9 A;  3I3B A;  1PMH X;  2YC4 A;  3CIH A;  3WNL A;  4ZZ8 A;  5C7G A;  2J1S A;  2W1S A;  4PQQ A;  2OKX A;  4HG6 B;  2ZEW A;  1K3I A;  3FHQ A;  3ECQ A;  2EID A;  1NAE A;  2VCB A;  3P1I A;  4GZ9 A;  3U37 A;  5LA1 A;  3VDB A;  2DCJ A;  4DXT A;  1O8S A;  2VR4 A;  2Y64 A;  4RN5 A;  4A41 A;  3NRU A;  3BN6 A;  4LHS A;  1W9S A;  3WNO A;  2VZR A;  4MGS A;  4QB2 A;  3CMG A;  1OD3 A;  3DEC A;  2XOM A;  1JZ5 A;  2WO2 A;  2BZD A;  1CIY A;  2QQK A;  4MAD A;  5JXG A;  1J84 A;  3LE0 A;  4A3Z A;  1DP0 A;  1CZV A;  3J7H A;  4KWU A;  2HYX A;  1O8P A;  4FI9 A;  4AAX A;  3OB8 A;  4P5Y A;  4XZU G;  1GU3 A;  4GWI A;  3WSO A;  4UAP A;  1UX7 A;  2W92 A;  1UZ0 A;  1OF3 A;  3NQH A;  1JU4 A;  3UNP A;  4QX0 A;  3ACG A;  3IAP A;  1UMI A;  3DYM A;  1SDD B;  5JMO A;  3T2P A;  1OH4 A;  3E1F 1;  2ID4 A;  4DEQ A;  5IHR A;  3HNM A;  2Y6H A;  3CDZ B;  5HXM A;  3PUH A;  2VMF A;  5LCW L;  2RV9 A;  3P6B A;  2WO3 A;  2ORZ A;  2VL4 A;  4DUV A;  2Y6J A;  1JYX A;  3K46 A;  3HJR A;  5G04 L;  2VZU A;  5JXH A;  4L0P A;  2X05 A;  2VMC A;  3LEG A;  3GGL A;  3K4Z A;  3I2K A;  2WZ8 A;  3NJX A;  3WF3 A;  1LNS A;  2J7M A;  4A4A A;  3T0A A;  2W3J A;  2J1R A;  1UXZ A;  4QB6 A;  2VCC A;  1IQD C;  2W94 A;  5B4X A;  2QQM A;  3ACI A;  4BJ0 A;  4XVH A;  4A42 A;  3OG2 A;  4QX1 A;  1HN1 A;  5I0D A;  2PQS A;  3WF2 A;  5JXJ A;  3VDA A;  1US2 A;  4OYU A;  1UYZ A;  3OEA A;  4CU6 A;  2BGO A;  1W99 A;  4QX3 A;  3PUI A;  3C7F A;  2W47 A;  1W0N A;  2J1U A;  4JKM A;  5JR2 A;  2WBK A;  3HNB M;  1F4H A;  3VD3 A;  1EUU A;  4A44 A;  4QB1 A;  4CU8 A;  5IYY A;  1CX1 A;  1KEX A;  2E32 A;  4AG4 A;  4LPL A;  2QQN A;  4XUN A;  4DUW A;  3SEE A;  3OGR A;  2VQT A;  2VZ3 A;  2J1V A;  2QBX A;  3T2Q A;  3GDB A;  1O59 A;  1JYV A;  2VOT A;  3WEZ A;  3FL7 A;  3LQC A;  2KD7 A;  4BK5 A;  1GUI A;  2QQL A;  3T09 A;  2C26 A;  3MO4 A;  2VO5 A;  4A45 A;  5G05 L;  3A22 A;  2JD9 A;  1TG7 A;  4A6O A;  3WF1 A;  2VC9 A;  1WKY A;  1WCQ A;  2YG0 A;  4JKL A;  2QQI A;  3WNK A;  1GQP A;  4P00 B;  2BGP A;  3C7H A;  4BK4 A;  4XUT A;  4W50 A;  2J1E A;  2WYS A;  1UY1 A;  3GM8 A;  2R7E B;  2ORX A;  1UWW A;  4D8M A;  3WF4 A;  2ZEX A;  2V5D A;  3OBA A;  1JZ7 A;  1TVG A;  4CU7 A;  3HPN A;  1K42 A;  1DYO A;  5HPO A;  1GOH A;  3LPG A;  4ET7 A;  4DUX A;  4UOJ A;  4E8C A;  3THC A;  1CZT A;  2DCK A;  4OMD A;  3C7O A;  3DYO A;  4DXS A;  2C4X A;  3A7Q A;  3C8X A;  3W5N A;  2WQ8 A;  2VM9 A;  2C9K A;  2J1T A;  2W1W A;  3CQO A;  3I3E A;  4LKS A;  2JDA A;  5LA2 A;  3SKJ E;  5CYY A;  3VD9 A;  2YFU A;  3K4A A;  1J83 A;  2VZO A;  1OF4 A;  2DDU A;  4QPW A;  4P02 B;  5DQ0 A;  3I2I A;  1JZ2 A;  1GOG A;  1K12 A;  3EYP A;  3DYP A;  4CVU A;  4PF1 A;  4OZO A;  3LEI A;  2L9L A;  3SKV A;  3OGV A;  2WUH A;  4XUR A;  3MV1 1;  2VMD A;  2W95 A;  2WN3 A;  4CU9 A;  3MV0 1;  4PT6 A;  3VD4 A;  2VZ1 A;  1JYW A;  3W5M A;  5DPN A;  4BDV B;  2WAB A;  3HOB A;  2CDP A;  2X10 A;  4QDS A;  2VCA A;  2QQO A;  4W8J A;  3T08 A;  1SHW B;  1PX3 A;  2W1Q A;  1D7P M;  3WNM A;  1EUT A;  4P08 A;  2E26 A;  4YPJ A;  2XON A;  3WNP A;  3F2Z A;  3I2G A;  3LEK A;  2YFZ A;  3T0B A;  3ABZ A;  1PX4 A;  2WN2 A;  3IAQ A;  2HLE A;  3SEP A;  3OEB A;  4QDQ A;  2Y6L A;  4KMQ A;  4ZXE A;  2Y8K A;  1JI6 A;  2VJX A;  5JUV A;  3I3D A;  5EJZ B;  1ULO A;  4ZZ5 A;  2W1U A;  3I2J A;  1US3 A;  2W46 A;  2E33 A;  2W9X A;  1ULP A;  3FHA A;  5IFP A;  5A1A A;  1T2X A;  1JHJ A;  5J1X A;  3T0D A;  2E31 A;  3VD7 A;  3D3A A;  3JXS A;  4UI9 L;  2X09 A;  4OMC A;  2W87 A;  5EIY B;  1UXX X;  4OUE A;  2EIB A;  3HNY M;  3I97 A;  1UMH A;  1XNA A;  3ACH A;  4DXR A;  2WO1 A;  3WF0 A;  1DLC A;  2YC2 A;  1W8O A;  2W5F A;  5F7U A;  1XPW A;  3CZU A;  3MUZ 1;  2LW8 A;  3HN3 A;  5CZK A;  1BHG A;  1XNT A;  3THD A;  5LA0 A;  3NJV A;  3A21 A;  1UY2 A;  1F4A A;  3WQB A;  4Z2A A;  3CKH A;  3OGS A;  2WZE A;  5IJR A;  3K77 A;  1RYY A;  2VZV A;  3UET A;  2Y6G A;  2J1A A;  4IUG A;  4BXS V;  1I5P A;  1SG3 A;  3GXU A;  4RYD A;  1GOF A;  5C71 A;  2VQU A;  1JZ6 A;  4MOA A;  3FN9 A;  1W9W A;  1XC6 A;  3ZM8 A;  1YQ2 A;  2Y6K A;  4MO3 M;  5DMY A;  4XUP A;  1UYY A;  3UES A;  3T2O A;  2ZEY A;  4ARY A;  4XUQ A;  2W91 A;  3VD5 A;  1UY0 A;  2V4V A;  2ZEZ A;  3CZJ A;  4LQR A;  2V72 A;  1KGY A;  4CUA A;  2BBA A;  4M4R A;  5IFT A;  4D0Q A;  1NKG A;  1W9T A;  1P8J A;  1H6X A;  3MUY 1;  4QAW A;  4ARX A;  2VME A;  1JU3 A;  1H6Y A;  3EB7 A;  4DEV A;  2XQX A;  1UY4 A;  1K45 A;  4E8D A;  3NNG A;  3A23 A;  2VZP A;  5FUI A;  3I2H A;  5B4N A;  2RVA A;  4XUO A;  2RJ2 A;  2EIC A;  1W8N A;  4JX0 A;  2VZT A;  2EIE A;  2VZS A;  1UYX A;  3K75 B;  4JKK A;  2WDB A;  2J22 A;  2VZQ A;  1CZS A;  4QDR A;  3K4D A;  3I2F A;  3ACF A;  4CUC A;  2LS6 A;  4QX2 A;  5EJ1 B;  4JHZ A;  3III A;  2VTF A;  1JYN A;  3IDA A;  5DN2 A;  1JZ8 A;  4KI5 M;  2WAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...