2WUHA

Crystal structure of the ddr2 discoidin domain bound to a triple- helical collagen peptide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
163
Chain Sequence
NPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Insight Into Collagen Recognition by Discoidin Domain Receptor 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor/peptide
molecule keywords DISCOIDIN DOMAIN RECEPTOR 2
total genus 37
structure length 163
sequence length 163
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wuhA00
2QQKA 4MADA 5IFTA 1GNYA 1OT5A 3WF3A 5G05L 4M4PA 1JZ8A 1W9SA 2W94A 4KMQA 2VMFA 3LEKA 3WQBA 2QQNA 4GZ9A 1GUIA 1CZVA 2X05A 2W1WA 2VR4A 1GOHA 1JZ7A 3IAPA 3IAQA 1T2XA 3FHQA 3K46A 4RN5A 4E8CA 3WNNA 2LW8A 3LPFA 2W5FA 4LKSA 2BGOA 1TG7A 2JKXA 5LA0A 3VD9A 3AC0A 1JZ3A 5B4NA 4PF1A 1K45A 2Y8KA 4A44A 1NKGA 1EUUA 2WN2A 2BGPA 3HOBA 2DCKA 2VCCA 2E33A 4BK4A 1JZ2A 2PQSA 1MPXA 2E31A 1L7RA 1UYYA 3VD7A 2XQXA 1W8OA 3ABZA 1JHJA 2VJXA 4QX0A 3I2IA 4D0QA 2ORXA 2WN3A 1JYNA 2YFZA 1PX4A 1GMMA 2W47A 4W4ZA 2VMDA 1F4HA 1ULOA 1OD3A 1UYXA 4P08A 2W95A 3EYPA 2QQJA 4AG4A 3THDA 2Y6HA 1WCQA 3I2FA 2V72A 4TXWA 3IDAA 2W3JA 2VL4A 4CUCA 2WABA 3C8XA 2HLEA 2WO3A 5DQ0A 4YPJA 1GOGA 2W1UA 2BZDA 3I2KA 2J1VA 3WSOA 2VMEA 5A1AA 1W9TA 2WO1A 4GWIA 3JXSA 4CU6A 3CIHA 5C70A 3DYPA 1DYOA 2V5DA 1UY1A 3UETA 4A3ZA 4DXTA 2WBKA 4BXSV 3C7EA 2V4VA 3MO4A 2WO2A 2J1TA 3J7HA 4QB1A 2VZSA 2OKXA 1CZSA 3IB3A 1RYYA 3OEBA 2W46A 2VQTA 1GOFA 2YFUA 4OUEA 1W99A 5J1XA 3ACIA 1J84A 2X10A 3ACHA 4OMDA 4DUXA 2VZPA 2YC4A 2WZ8A 5G04L 4QX3A 2ZEWA 3DYOA 1L7QA 4GWJA 4KWUA 4CU8A 1CIYA 2WDBA 2Y6GA 1JZ6A 4BK5A 3I3DA 3WF4A 2VZ3A 4A45A 1JU4A 4MOAA 1H6XA 3ACFA 3GGLA 3WEZA 4DUWA 1XC6A 1O8SA 1JU3A 1XNAA 4D8MA 2W1SA 3HNBM 5HPOA 5IYYA 1NAEA 3EB7A 3VDAA 3K4AA 3A21A 2ZEXA 2W9XA 1HN1A 1W0NA 2QQLA 2VC9A 4IUGA 1YQ2A 3A7QA 3GM8A 5LA2A 4DEVA 3WNLA 4CVUA 4QDRA 2ID4A 3SKJE 1PX3A 4ZXEA 4QAWA 3T0DA 3ETPA 2VM9A 4CU9A 2BBAA 1CX1A 3NJVA 4A41A 5IJRA 3W5NA 3CMGA 2ZEZA 1UWWA 3NQHA 4LQRA 2CDOA 1BHGA 3K4DA 2JD9A 2VOTA 4ARXA 5CYYA 3HN3A 5LA1A 2J1EA 3I3BA 1SDDB 3A22A 4MGQA 1H6YA 3NJXA 3C7GA 4A4AA 1JYVA 2WAOA 2X09A 2EIBA 1P8JA 2YC2A 1SHWB 4PT6A 3E1F1 4MGSA 4QX2A 5IHRA 2WQ8A 1NUKA 3K75B 4QPWA 3VDBA 1KGYA 1XNTA 3WNOA 4DEQA 3MUZ1 3ZM8A 2B9VA 2ZXQA 3WNPA 3LEIA 1JZ4A 2VZOA 5LCWL 4CUBA 3UESA 3U37A 2B4KA 4XUOA 3GXUA 5JXIA 1US3A 2EIDA 1UXZA 2RV9A 3C7OA 3HNYM 2DCJA 2QQMA 4JKMA 4QDQA 4CU7A 2J22A 5EJ1B 3T2PA 2ZEYA 2C26A 3CQOA 4L0PA 4ZZ8A 2W91A 3WF1A 3PUHA 1OH4A 2CDPA 4TTGA 1JI6A 2C9KA 3CDZB 2Y6JA 2XOMA 4XUQA 1US2A 2JDAA 2XONA 1O59A 4Z2AA 2VZUA 1R64A 1XPWA 2ORZA 2WYSA 3MV11 2Z4FA 2VO5A 3ECQA 4QDSA 5DMYA 5C71A 1TVGA 1OF3A 4P00B 4ZZ5A 3SKVA 4RYDA 1GQPA 4JX0A 1UZ0A 3VD3A 1O8PA 5FUIA 2Y64A 4MO3M 2LS6A 2HYXA 4XZUG 3I2JA 1PMHX 4W8JA 4XVHA 2W92A 3I2GA 2VZRA 3HEIA 3W5MA 2Y6LA 1UY0A 1UX7A 2VCAA 2VZVA 3I3EA 4LHSA 3PUIA 2J1SA 4QB2A 3THCA 3GDBA 3OGRA 4BDVB 3FN9A 3WF2A 3K77A 3C7HA 2VZ1A 4OMCA 3BN6A 4KI5M 2YB7A 5B4XA 3MV01 5JMOA 2VQUA 1D7PM 4CUAA 3VD5A 4M4RA 3HJRA 5JXGA 5F7UA 3CKHA 2J1RA 3C7FA 2BERA 4PQQA 1DLCA 1OF4A 3SEEA 5JR2A 3ACGA 3OB8A 3I97A 3CZUA 4DXRA 3D3AA 3T2QA 3LEGA 5DPNA 2JE8A 4A6OA 3T08A 2VMCA 5HXMA 2J1UA 3OGSA 2YG0A 2Y6KA 4LPLA 3OGVA 5JXJA 3I2HA 4DUVA 3VDCA 4ET7A 5JXHA 1LNSA 1WKYA 4UOJA 2W1QA 1K3IA 3FL7A 3IIIA 3DECA 3BGAA 5JUVA 2VZTA 4FI9A 2KD7A 4QB6A 3OG2A 3MUY1 2DDUA 2QBXA 1UY3A 3MBWA 4ZY9A 1DP0A 1F4AA 1UXXX 4OZOA 3HPNA 2E26A 1UMHA 4AAXA 1UY2A 1KEXA 3UNPA 3T0BA 3FHAA 5IFPA 2R7EB 2VTFA 4ARYA 4HG6B 3T09A 3P1IA 1K12A 5DN2A 4XUTA 1JYWA 3NNGA 4XUPA 2QQIA 1W9WA 3NRUA 3VD4A 3P6BA 1SG3A 4W50A 2WZEA 3WF0A 1JYXA 1NX9A 3A23A 2XHNA 2W87A 2EIEA 3LQCA 4UAPA 4JHZA 1IQDC 1JZ5A 5CZKA 1UY4A 2WUHA 3SEPA 4P02B 3F2ZA 1ULPA 4JKLA 3DYMA 1UYZA 3HNMA 2VZQA 1CZTA 4QX1A 3LE0A 5C7GA 2J7MA 2J1AA 1J83A 1UMIA 2E32A 4OYUA 1PMJX 4XURA 3WNMA 2C4XA 2RVAA 1I5PA 2VCBA 1EUTA 1W8NA 3K4ZA 3CZJA 3WNKA 3LPGA 4BJ0A 3T2OA 4E8DA 4P5YA 3OBAA 4DXSA 5I0DA 5EIYB 2L9LA 3T0AA 2QQOA 1GU3A 2WAAA 4A42A 4XUNA 2RJ2A 4UI9L 4JKKA 2EICA 1K42A 5EJZB 3OEAA
chains in the Genus database with same CATH superfamily
1SLIA 2QQKA 4QXBA 1DZTA 3H8OA 1GNYA 1UX6A 2VOKA 2XXZA 2Y26A 2XWJB 1UIJA 4Q1PA 2W0XA 4Q4V1 1V6IA 5G05L 1ND2A 3I7DA 1JZ8A 1NE4A 1E5HA 1W6OB 1W9SA 1PIV3 1POQA 1ZZCA 2TUNA 3WQ7A 4CDWA 3FE5A 4COZA 4HVQA 5J96B 1F8VA 1U5XA 3W59A 1PO13 2QQNA 3UYJA 1H8TC 3AZYA 2WC2A 2X05A 4S2DA 2XH6A 1MS8A 4XF9A 3JQWA 3T30A 3VBFA 1UU4A 4YM3A 5IVEA 3ZPOA 2IXKA 4CCLA 3ZXGA 5FYZA 1IS6A 1ZYBA 4I01A 4RN5A 1TNRA 2ZGRA 4B1MA 3CF6E 2LW8A 4XEZA 2K2SA 1GBGA 4XF4A 5D8AC 4K21A 1TG7A 1WD4A 2JKXA 2O14A 3AC0A 5IT6A 1JZ3A 1TNFA 2J42A 4CDWB 2HWE1 4FBFA 2RHPA 4CRQA 1EV13 5JLVA 3O1VA 1PGSA 5F39A 5FMOS 2ZX2A 3WZ1A 1CAVA 1EUUA 5CKNA 3DXUA 2E33A 1ODMA 3HQXA 4XAAA 3RMXA 3S6PA 4BK4A 2Q1FA 1MPXA 3R4UA 3W21A 1JZ2A 1UYYA 3MYXA 1MS9A 3ABZA 4XCBA 1CJPA 2JDPA 1JHJA 1C8M2 2B39A 4QX0A 4KG8A 5LB6A 4EWAA 4YVSA 2ORXA 1COV1 1A8DA 1PHMA 3KWVA 4XXAA 5KC6A 1GMMA 2PTMA 3W20A 1QU0A 2ATFA 4Q2FA 1EPZA 5L9RA 5BY5A 5FUNA 3VZMA 3QCWA 2Q8EA 2K46A 1OD3A 1PZ7A 4DO0A 3MDPA 4AG4A 4Y5SA 1DQ1A 2Y6HA 1WCQA 3KV4A 4Q1RA 3EHKA 3VBFB 5LRSA 2OZ6A 5FZ4A 2W3JA 1C4RA 2VL4A 3WDXA 3V0BA 1ZRFA 2BTVC 1IPKA 2D3RA 2BFUS 2BZDA 1AR62 2CWSA 5C3QA 3I2KA 2HH9A 3WSOA 1X9TA 4QX8A 5A1AA 1BYHA 4C90A 2Y38A 3RNSA 4FXKB 4BCUA 2Z5WA 4NRQA 4AEDB 5LEJA 2QDNA 3BPSA 1DYPA 4P9XA 3ZXLA 4AFMA 4IEPA 3TN91 4LXLA 4X8PA 3BTYA 3MEPA 4NHKA 1JBCA 2YY1A 2WBKA 4IXLA 4LBLA 4KWKA 4JGZC 3TB0A 3USUA 4AAPA 3ZSLA 1VBA3 4IQPA 3RQ0A 5FYSA 4FQ4A 1VBD2 1ND3B 5A32A 1UMZA 3MLLA 2GC0A 3N3HA 2ZZQA 2GDFA 4MHRA 2G9ZA 2FCTA 2OKXA 2RS12 1CZSA 1RJ8A 1UL9A 3IB3A 4AHZA 1XE0A 2TBVA 2HJIA 1B35C 3UV9A 1NY71 1RUD1 2Q8CA 1VBC2 2YFUA 2XB6C 4K9SA 4FPFA 3VV1A 2PHWA 1W2UA 3J7LA 4Q4W1 1J84A 3ACHA 5JIUA 3BI3A 4XDPA 4CDWC 2XJSA 1UAIA 5FZ6A 3GZTB 2F17A 2WZ8A 4ZPIA 5G04L 4QX3A 1W6NB 5ANNA 3D5OA 3RI8A 5FZIA 4I2OA 4GWJA 4KWJA 5A3NA 4XFIA 5GZGA 1J59A 3RGBA 4CDXB 4R4ZA 2DBIA 1S1AA 3ZYPA 4S2FA 3R4DB 3WF4A 1LOGA 1ZBA2 4LO8A 5FYUA 3ZFGB 4CXXA 3ORJA 3CBNA 4XE9A 1CWPA 4JCKA 2IZWA 5K7PA 3S5AA 4FPYA 2H6CA 3ROUA 1YWKA 2VW1A 3WEZA 4QT6A 4AEJA 2WA3A 4NVPA 1AYN2 1WWYA 4LO6B 4ZU7A 3QOPA 1JU3A 5FP8A 5E8AA 3TNQA 3TEZA 5H9PA 4JDNA 3V64A 3E5XA 2PHFA 4MG2A 5ACA3 5IYYA 2R041 1F35A 3JBG1 1V00A 5FIXA 3T1LA 4IGOA 1POV3 3VDAA 4QPIB 2D6OX 3A21A 1LOEA 2BU9A 2BJSA 2W9XA 1HN1A 4OI4A 4QX7A 1FPN3 2VC9A 2ZBJA 5T55A 1MR5A 4XW3A 1VRH2 3A7QA 5LA2A 2YROA 2BPA2 5A7NA 2ID4A 1OKOA 4YZ4A 3T2TA 2VU9A 4QAWA 3U75A 1MQTC 5GLUA 2W68A 1HJGA 2VM9A 2CTVA 1AR93 2FHRA 4P9IA 4N43C 4ZONA 4FPCA 5JSOA 4ASMB 2NYYA 1CX1A 2WZR2 1JOBA 3CLPA 4IETA 3CMGA 3IT8A 3QH6A 1HLCA 1QGLA 4GKYA 1UWWA 5EWSA 4NN0A 5FKCA 2D3PA 3VZKA 1YJKA 2JD9A 3K4DA 2VOTA 2NPIA 3GF6A 3USSA 4JGZA 4AW7A 5DUXA 1H2MA 2BNNA 4AVTA 2OX0A 4N43A 5LA1A 3AVSA 1H1AA 3IKWA 3I3BA 4LKFA 1Y4WA 4WVMB 2RDQA 4MGQA 1OFNA 3IMMA 1XNDA 1H6YA 2I45A 4N53C 4YVWB 1C1FA 4A4AA 3MF9A 1CAXB 1NA1C 4GB31 2SLIA 4Q4V2 1GR3A 3N35A 2E7TA 2UWCA 2VMGA 4HKWA 1OUXA 1SHWB 3NKTA 4NIAA 4PT6A 3E1F1 2I74A 5F8PA 5I0RA 2UWAA 3KZ4C 5IHRA 5EYXA 2BDRA 4Y1ZA 3JCIA 3KQRA 4QHBA 2WINB 2WQ8A 2AUYA 1UZYA 4R52A 1ULGA 4QPGB 2ZGMA 3K75B 1V6OA 3WR0A 1KGYA 2B42B 2JDMA 1XNTA 4R9BA 3WV6A 3ZYIB 4CEWB 1UIKA 1BQPA 1CAXA 4PBPA 3I49A 3LDBA 5GLWA 1PVC3 4FSJA 4H14A 4QU2A 4YFWA 2D5FA 3LEIA 1R092 4EROA 3FJSA 3M1HA 4JC1A 2WWUA 2ADDA 4HONA 4CUBA 1VBC1 1HRI1 3LKJA 3RJRA 4MGTA 4CYDA 1WMFA 2UWBA 1V70A 2X5IB 5A7OA 3TBDA 3GXUA 4RS5C 1US3A 5I8YA 2EIDA 3RZGA 1O7FA 4A6SA 1ZZ8A 2D3SA 3VKFC 3B94A 4RQPA 5F32A 2BP6A 4HVRA 2QQMA 5F3EA 4EN8B 2A71A 2ZGUA 1K5MB 3VKLA 1AR73 2J22A 4IEZA 5DAWA 1KFXL 1GZTA 1CQ9A 3RDIA 1G8WA 3CQOA 5KXDA 2UY9A 3PUAA 4ZZ8A 5IK5A 3NKGA 1LECA 2XBO3 3PHMA 3POFA 1YQ6A 4YGCA 2OA2A 5D8AA 5DABA 4QHZA 3HN1A 4LTAA 3KT4A 3UKNA 1RL3A 2C9KA 4JRLA 4YGBA 5FDBA 3FC0A 2A3YA 4XBNA 1US2A 2JDAA 2BV4A 4D6SA 1FMD2 1YI7A 1GV9A 2BWCA 4HZFA 5BXXA 2XONA 1ENQA 4Z2AA 4HANA 2Z79A 1WW4A 2JDHA 1C3HA 1XPWA 5CFDB 4CP0A 4Z07A 2BEOA 1W06A 5C3SA 3PMSA 2WS91 4HL0A 1BXHA 3ECQA 3TEXA 5C71A 1D4M1 1OF3A 4BIOA 4Y20B 2SBAA 5A6QA 4ZZ5A 2WZR1 1IHMA 5FFOC 2KM2A 2IFWA 1I1EA 5DG1A 3M3IA 4D6QA 3V0AB 4XF1A 2IXIA 1UZ0A 2EAAA 1QDCA 1LOFA 1ZZBA 1V6JA 2DVBA 3FUQA 3S5QA 3U14A 1OD5A 3T4HB 3PLQA 4LMFA 1CX4A 3N36A 4QXCA 2Y64A 3D4KA 3THTA 1PM4A 4QM9A 2F6BA 4AFBA 3U0ZA 2LRPA 3KT1A 4XHBA 4JQRA 2HYXA 2CHHA 3DXTA 4ISQA 1NA1B 4XZUG 1AR72 2FZ1A 3I2JA 3ST7A 3SC7X 1POV1 2ZCWA 4W8JA 4KU7A 1W8FA 2WS93 4AFCA 1QNWA 2VMIA 4LUKA 1DGWX 1OI6A 3BU7A 3IM0A 1QHDA 4HETA 5A7PA 2OUJA 4XFAA 5LY2A 2PLV3 1DZRA 3CO2A 5FOBB 4MXWB 4CCNA 1AR63 3LAGA 4QKBA 4UFKA 5JMCA 2EXIA 1PK6A 3KVBA 4AVVA 4CUGA 5FZOA 1CVNA 3DCQA 4IGQA 3VBHC 3THCA 4FO9A 4XXPA 4BDVB 3LSDA 4UFHA 4DXZA 3OUIA 4GALA 1TZOA 4GULA 1R1A1 3VUOA 1OA3A 3OGJA 4IEYA 1K5MC 2OT7A 1MS4A 2RDRA 3BN6A 4QHOA 2IXLA 1UQXA 3JD71 4N43B 1PK6C 4IEOA 3ME2A 4MHUA 3WVJA 1D7PM 1SPPA 2B7YA 3KF3A 5FPBA 4MGZE 5CAZA 3V56A 1HXS3 3HJRA 3N4MA 2RMU2 1XJAA 3N9PA 3C7FA 4UW4A 1MZ6A 1H9PA 1CESA 2BERA 5FJHA 5FXWA 5EXOA 4CDQA 3KGLA 4HVOA 2YU1A 2UURA 4K7JA 2XL7A 4AQ6A 2JENA 2PA7A 3N7LA 2VQ0A 1OXCA 1PO11 2RM22 3ZR5A 4YARA 3WP3A 2BBVA 3V0AA 2FDHA 3GBFA 1YFXA 1DIWA 1LR5A 2RJKA 2ZMLA 5J37A 5DDJ3 1RUI1 1G9BA 5DPNA 5A6ZA 1VAKA 2YHJA 2JE8A 1W6MA 5F6LB 5GALA 1I3HA 1VBD1 4IV1A 4YW4A 2VVFA 4RR3C 3WW4A 1O5LA 1IQAA 1RXGA 2P4EA 3OGSA 3I3QA 1GFF2 4E4HA 4DUVA 2Q1MA 3VDCA 2DTYA 4ET7A 5FJKA 2R072 2G19A 4MUVA 2RS31 2ENRA 2B5HA 2TEPA 4Q5OA 4URTA 4RHV1 2VZTA 4EZHA 2JE9A 4ONUA 2KD7A 4XQDA 1QIQA 4KG0A 3SCHA 5F2WA 1IOAA 3O0XA 4YNIA 3ZFEB 4CEWA 1O6UA 2XR4A 4E9KA 4ZY9A 5J36A 3RWKX 3ZFGA 5JOWA 2A5ZA 1F4AA 1RUJ1 3O12A 4LR4A 4QGMA 4FOWA 1B35B 2E26A 4N9IA 1UU6A 2WS92 3MLJA 2GNDA 3ZIWA 2P3IA 3ZFFA 4JTOA 5LA9A 3AKTA 1AYM2 3MLKA 4Y1UA 3RJ2X 3HT2A 3H0OA 3H7JA 4AR2A 4IL7A 4DMIA 3O1TA 1YHFA 2DU0A 4RGKA 1V9U3 3QD6A 3SHRA 1K12A 4NIDA 1LOCA 4CCCA 1BEV1 2NLRA 4RS5A 5EJ3A 1W9WA 4YYOA 4C0BA 4Q4Y3 5FZ8A 3GZAA 4W50A 3LDKA 4B8EA 3HAGA 3DUIA 4V2VA 3ILNA 4UBGA 3GCXA 2GSYA 3PNAA 4P14A 5HV0A 5M0TA 1NZIA 3O1MA 2A3XA 4B7KA 1UY4A 3SISA 4XDOA 2F4LA 3M8LA 1OUSA 3FLRA 5FBJA 1MEC2 4KNCA 2WZPP 1ULPA 2NMNA 4JKLA 5JR7B 4CDUC 5I8TA 1WCSA 5C9AB 2WIIB 4BU2A 1FATA 2ES3A 1CZTA 3LIHA 4YM0A 5C7GA 4WM7B 4GWNA 1UPIA 5KC5A 1T6BX 1KJLA 2FDGA 1J83A 3U10A 4OYUA 4L9BA 2PFWA 4QGLA 3BODA 3WNMA 5FY5A 3POJA 2JG9B 2VCBA 4EWEA 4GH4B 1MQTB 1W9YA 1RUC1 4E2GA 1PNFA 1H9WA 2A6VA 5AC91 1NLSA 1UOFA 1ZBA1 3WW2A 3WXPA 4X6RB 4INDA 4BJ0A 5AVAA 1W9FA 1R093 4E8DA 1JUHA 4GJYA 1QJX2 1ZRDA 2X5IC 2EXKA 5I0DA 4IDZA 3RYRA 3GALA 1IKQA 1F9KA 1O3TA 4X6QB 5FZAA 4IEQA 3RZMA 4MXVA 3P3PA 2L9LA 3PU3A 4IEUA 3T0AA 4H7MA 5LBEA 3AMNA 4F7ZA 1CIWA 1C5HA 1GU3A 1VB2A 1W90A 4PDWB 4A42A 4EE2A 3M7AA 1IG0A 3FFZA 2EICA 2WO7A 4Q0VA 1AR92 5DDJ1 2LALA 3M3EA 5EJZB 5J3UA 5HCHA 3U07A 1K42A 3KSCA 5IFTA 2XMLA 4U2AA 1VBD3 1W6PB 2CGNA 2WFPA 3WINE 4FTEA 3H1YA 1D4VB 1QQP2 1H8TB 1AL21 5HXVA 3WF3A 3ZR6A 3C2UA 1W2AX 3BVCA 2PHTA 2W94A 4MVTA 3IMNA 5IVBA 5L7OC 1XQNA 1S0CA 2XBO1 2W2IA 3FUOA 1HB3A 2DCZA 3LEKA 5FY4A 3SLIA 3ZKUA 3BUCA 3KD4A 5LZ6A 1BZWA 3KT7A 2DVGA 3R6SA 1B09A 1LGCA 2P3KA 2QQWA 2D6LX 1QF3A 4HPKA 2YUEA 3R05A 2VR4A 1JZ7A 1DZQA 3O1OA 1W05A 4UF0B 1KITA 1OOPB 1AXYA 2UYBA 4OQ9A 4CEYB 4RHV3 2BVVA 4R8HA 2IFRA 4E8CA 3WNNA 5F9TA 2ZKLA 4LKSA 2CGPA 3SH5A 4RGAA 1OOPC 2Q0AA 4Q4W2 4AHYA 5B4NA 3MW4A 2Y8KA 4HN0A 4A44A 4L2NA 2ADEA 4S2HA 1OSGA 3OJBA 2GALA 5DUWA 5FZDA 5GZEA 5FYHA 3IDCB 3VLBB 3OBZA 4W6YA 1LJ7A 1GZ9A 2YBPA 4IE5A 1VE0A 2E31A 1TEIA 2JDZA 4YRDA 5T52A 3LFMA 1JH5A 4KU8A 2VJXA 3WG4A 1N1VA 1O91A 3MIHA 2C9AA 1VP6A 4NO4A 4GA9A 4PI2A 1J3QA 1PX4A 2YFZA 4BHPA 2W47A 3AMPA 1RUJ3 2C6SA 3H42B 1F4HA 4GWMA 3ZDVA 2O0OA 3VBOB 2YXSA 5I0UA 5IW0A 1UYXA 3OTFA 5E88A 2QQJA 2WL1A 1M4WA 5IVJA 1C28A 3RI9A 2NMOA 3POYA 3DPRB 4XAEA 2FDIA 2WJSA 5FZFA 4FAHA 2W1UA 4AI1A 5A3LA 4P5HA 4EQVA 1RMU1 2ZHKA 2C5DA 2VMEA 1W9TA 1OVPA 2A75A 2WO1A 1RC6A 4GWIA 1J1LA 2JWPA 2YV8A 5FAXA 3CU7A 3O5SA 4YW7A 1IG3A 1HRV2 1ZBE1 1GP5A 2FQPA 1VBE1 3DYPA 2O8OA 4HXCA 3VDDB 3ZFGC 4BQWA 4OUMA 1CAUB 1ZX5A 2RR12 4Z92B 1FPN2 1S0BA 3CJIA 5H9RA 4AVCA 3VBUC 2P3YA 1ODNA 3TN92 5C8WA 5C9AC 1SBEA 1YIPA 3Q8AA 4RL7A 3PUQA 1VRH1 4Y5TA 1NE6A 4M00A 1TE1B 2JIJA 3DEMA 4QB1A 3HR9A 1E5RA 2VQAA 5AFEA 3OEBA 2V73A 4LHNA 3C3VA 4FQZA 4AFDA 3KV9A 3NAPA 4NRPA 1DQ0A 1BMV1 4DUXA 5DAXA 3UT0A 1OC1A 2P1BA 2P6HA 4BPZA 1FAYA 3OF1A 4FPEA 5FP9A 5CFCC 2CSGA 3O1UA 2R30A 1IKPA 1MS0A 4E2QA 5CG8A 1RVF3 2EXHA 3D0JA 5C4WC 5EPAA 1RUI3 1N3PA 3QLQA 4Y33A 5BUVA 3R4SA 1CIYA 4AVSA 2F4PA 1Q8VA 2DFBA 4TWTA 1PMIA 1VAVA 3DGTA 4FP3A 1Y9GA 1JZ6A 1PVC1 2YPJA 3M70A 5FZ9A 4BK5A 1ASJ3 2VZ3A 1JOJA 1DDLA 3KCYA 4MOAA 4AQTA 4B3NA 2X5IA 3VBRA 3ZN4A 4N8MA 4Y20A 1R091 3ACFA 1HB1A 5SV8A 4KGQA 2G9GA 1QXJA 5FPVA 1NXD1 1XNAA 3FHIB 4D8MA 2ETEA 2R1DA 1ZZ6A 1WCKA 4PCRA 5GZFA 1LEMA 1GNHA 2WZR3 3U1XA 3NNLA 2AACA 2W1SA 4V2WA 3ZFEC 5FZ1A 3H3ZA 3EB7A 3JB8A 4BA6A 5A6YA 2V09A 1NCRC 5F2SA 1CAWA 4RFRB 5I93A 4I0BA 1VBA2 4L8QA 5FO9B 3VBSA 1DBNA 3AZZA 2GNMA 5F3IA 1U5YA 4E4SA 1GANA 1QH6A 1VR3A 4LITA 1YQ2A 4J25A 3ZXDA 4CVUA 3WNLA 2PHRA 1O3SA 1OA4A 1W2OA 1H30A 4ZXEA 1XYPA 1AX2A 3LCPA 3P5BA 2VW2A 4FVVA 4HLTA 4BQ3A 4CDUA 3RYPA 2PLV1 4COUA 1R081 4XFFA 3K3NA 4IE4A 4QQPA 3L2HA 2QZ3A 1Q56A 3WUDA 5A3PA 2HYKA 5I91A 3KQ4B 3PTYA 1AVBA 4LQRA 4JZRA 1BHGA 3TOJA 1IGOA 4FOYA 3POEA 2ZHLA 1EV12 4LBQA 2CAUA 3K51A 3BALA 5CYYA 3ZXAC 1U0AA 1VBE2 4AVAA 1QOTA 3V65A 2BW8A 1ZRIA 5AVPA 1ASJ2 2GC3A 2FZ2A 4IERA 1D2SA 1SDDB 3PVNA 4IV3A 4QKDA 2ZPXA 1PO12 2PAKA 2RM21 1UNBA 3GJAA 4PLNA 4XJWA 5BNPB 1KD7A 4FPOB 5K0UA 5FO8B 2HWB3 3B9IA 3S7EA 3GZUC 2IVIB 5F5CA 3I2DA 4WVWA 4XF0A 5JOZA 2DCYA 3ZFFC 1T6GC 5IVVA 4MGSA 1ZREA 4QX2A 4PHZA 4ZU5A 2WR9A 4XOGA 1YQCA 3U4SA 2PHXA 1Z7S3 4NPLA 5FK7A 1A34A 1AL0G 1YLLA 4XJUA 2PHDA 4QPWA 5FPZA 3WDUA 3VDBA 3WNOA 2R071 3PMEA 2B9VA 1F31A 3KB5A 2YYOA 1U5IA 3O1PA 3VBRC 2DYCA 1JZ4A 4RFT0 3ILFA 2X29A 4NHLA 1ZBA3 2NQYA 1BCXA 4JGZB 4UT5A 1ENRA 1UF2C 1R1ZA 2JDYA 3H9AA 3NW4A 4GAZA 5E1RA 1Q43A 3IPVB 4GB33 2O1QA 3AM2A 5DZFA 2DCJA 4PDWC 1A78A 4RR3A 4U36A 2HEVF 4QDQA 2JKBA 3G6JB 5EJ1B 3T2PA 1X50A 3AJZA 4RGGA 2YBKA 4KQ7A 2ZEYA 2C26A 3DKWA 1VBE3 5FMCA 1LHOA 2BGCA 1QJX1 2LTNA 4L0PA 3I54A 3VKNA 5LW9A 3SMHA 1OOPA 1W3XA 5FY9A 3WP6A 1UOBA 3KLSA 3PUHA 2ZAAA 1G9FA 4R9DA 5JVVA 3RFRA 4TTGA 5DZGA 4R9AA 2Y6FA 3FBYA 2Y6JA 4ASKA 4F83A 3GBGA 3LA2A 1A3KA 1RUF2 4Y1VA 2CV6A 4D6RA 1AR91 1SFNA 2Z69A 1I6XA 2OIIA 1EAH2 2HWD2 3MHZA 1O59A 4GD4A 2WNUB 1MZEA 1R64A 1W6PA 1GLHA 2DVDA 1G6NA 4FPKA 4IESA 4ORFA 4OULA 2GP5A 4XJAA 5FQ0B 3RS6A 3ZN6B 3IN9A 2GNTA 1I5ZA 2B9UA 1FYUA 1PZ9A 1BK1A 2DCTA 1LHVA 2Z4FA 3J8F3 1HDKA 3OSDA 4QDSA 4L99A 4P00B 1KDMA 1O4TA 3ZSMA 1ULDA 1Z78A 4WM8C 2IUWA 1BEV3 4RYDA 4CCDA 1AR82 1J3PA 2XWBB 2VCMA 4JX0A 2Z42A 4BMBA 1FPN1 4UXAA 4HKOA 3VD3A 2NP0A 2GN3A 3O7OA 5FUIA 1X36A 3JD73 4M3CF 5KXEA 4UFIA 4P9LA 1ASJ1 4YG6A 1WBFA 2ZX0A 1W6NA 2QUOA 4YG3A 4GH4A 4KH9A 3AJYA 1BLZA 2UY8A 4TLFA 2VULA 5IAXA 4CXYA 1RHI3 3AL6A 3DPRA 4O65A 4LNVA 4XVHA 5TSWA 1JYTA 2JEMA 2MEV2 2W92A 3I2GA 5IATA 2ZGPA 2WNVA 4FPGA 4L97A 4PBOA 4XFBA 4YW6A 4LBKA 4AVBA 4WM7A 2KXLA 3W5MA 1JMUB 2P34A 1UW8A 4EZ4A 2WA4A 4QGNA 4KGGA 1SFPA 5FTTC 2Q8OA 4XQ4A 4LHSA 4QB2A 1ND3A 4CE8A 3AX4A 1O3RA 4PI0A 4NE9A 3OGRA 5C6CA 5GZDA 2ZGOA 3ASIA 3K77A 3WF2A 5A80A 3ZVXA 3C7HA 1UOJA 2XVGA 2JDUA 4XABA 4KI5M 5CKMA 2YB7A 4FPLA 2DV9A 5BV6A 4KWLA 2VTXJ 1C8NA 1SCRA 1UPSA 4AEDA 2AENA 1E57A 1QDOA 3VD5A 3O1RA 1CPMA 1N47A 1W8HA 2WLQA 4I0AA 5FREA 1VRH3 1OMIA 2R32A 2MPFA 4K1YA 1YCIA 4G3YC 2NN8A 4M3CB 5GLVA 5C5UA 2VOVA 1CD3G 2BVBA 2R0HA 3OYWA 4NWVA 5F5QA 4Z1VA 5JOXA 1VB4A 3V0BB 4BE3A 4BWOA 1DHKB 5JR2A 1Q8PA 5KBFA 2FCVA 2YC0A 5A3UA 3MPPG 1OQ1A 5EP9A 3FLPA 3CZUA 5FKBA 3WX5A 4DXRA 3D3AA 5I8SA 3CEWA 3N7KA 1NOVA 2ZGTA 5FZEA 2E53A 4LLFA 3LEGA 3T2QA 1Y9QA 1ZM1A 1COV2 2EXJA 4AL9A 4C1WA 4LLOA 1GNZA 2JICA 4A6OA 2O8QA 1IS4A 4BB3A 3T08A 1XNKA 3AZWA 2BQPA 2J1UA 5FWJA 5FZHA 4OI0A 5HI0A 5T3NA 1HV1A 3RZLA 4KBZA 3ZO0B 3O0VA 3KHBA 4IV3B 5F3CA 4YW3A 4WZCA 4DY5A 5JXHA 1QJU3 2W1QA 2RJLA 2Z2SB 3AP7A 2VNRA 4AK3A 1FOD3 2WNOA 3DECA 3RRDA 1WW6A 4EV0A 3N7JA 3BGAA 4DB5A 5JDBA 1CAVB 2C24A 3NV3A 4HK9A 3NWKA 4LBMA 4R4XA 1WW7A 4Y22B 4LBQB 4XIOA 4JGYB 4HBNA 3HIFA 3VKMA 1N3QA 2KR2A 2RS32 2VNVA 2XVKA 3OG2A 2V4AA 3MUY1 3NL1A 1REDA 2DDUA 4DOUA 1CONA 2DBNA 3NNFA 2DUOA 1QXPA 1XSQA 2CL2A 3LGRA 4ITCA 1ZBE3 2XL9A 1VRBA 1X7NA 5JZGB 5F37A 5FYYA 1UO9A 1UXXX 2P6CA 4OZOA 5APAA 1OLMA 3SCFA 3VBFC 1XSRA 4XCAA 3WT3A 1FOD1 1KEXA 1QOSA 1E5SA 2C1FA 1AL23 3MW2A 1VBB3 2PN5A 3S7IA 1DQ4A 2PMWB 4LE3A 4NOTA 2VXRA 2WFF2 4QPIA 1RUE3 1V6NA 2E7QA 2VTFA 4ISRA 3UKTA 3KHCA 2PAMA 5A7SA 3ZDSA 1A6CA 2XLAA 3H8UA 4XC9A 3NV4A 5DN2A 3DPRC 1TME2 3WP4A 1SZBA 2GMPA 1ENSA 1OA2A 2RS33 1R1A3 2QQIA 2WT0A 1HN0A 4XUPA 4Q0PA 1SPPB 1NCQC 3JUUA 4AF9A 2D6MA 3U78A 2XDVA 1SACA 3WF0A 2BFUL 1KDKA 4J6GA 2R16A 3ELNA 3B9CA 5FYMA 4FOVA 3LQCA 2VXJA 2QFEA 2VH9A 2EVXA 2OPKA 4JDMA 4JHZA 1UOGA 4UFLA 4XF3A 3VN4A 4FAGA 1TQ5A 5IK8A 4Q0UA 1N1SA 2H0BA 2WUHA 2FDJA 2IXJA 1HQNA 5T5OA 3ZXFA 1PGW1 3ZN6A 2W08A 1FV3A 1DF0A 1UYZA 4MXWA 2IWGB 2YPDA 1NCRB 2J7MA 4MGYE 4CCOA 1HW5A 1GWLA 2OQ7A 1IZ3A 2ET1A 4OHZA 1UMIA 2E32A 2RM23 2ZACA 3MIBA 1GP6A 1PMJX 2ARBA 4Q0QA 5FYTA 4XURA 2C4XA 3QH7A 5FK8A 3WDTA 2HEWF 1WLTA 1EUTA 3ZFFB 3WUCA 5ABJC 3H3LA 1V6MA 3B93A 5FLIA 1HV0A 3HBKA 3VB9A 1W6QA 4AI3A 3WY6A 4WVVA 1V0AA 4DXSA 1O4ZA 5KWRA 2FD8A 1QOOA 3USUB 2R073 3OUJA 3IPVA 1NY72 1RUD2 1SQ4A 2PYTA 3JD72 1LOFC 5EIYB 2FDFA 4LEJA 1G9AA 2Q8DA 3MIEA 4MYEA 1S2KA 1I9RA 3I59B 3KS7A 3NNMA 4ZU4A 1LKNA 1G86A 4XPVA 5LRRA 1BBT2 1HXS1 3APBA 4JKKA 5A33A 1GZCA 3OBRA 2ZGQA 4AGRA 2XHKA 1X8MA 3HBZA 5CFDA 5FZMA 2WWSA 3O14A 4I30A 4IE0A 4LIUA 4XTMA 5DAPA 4TYSA 1STMA 2YDEA 3J8F2 4EN0A 5A6XA 2VMFA 3PVOA 3VBSC 1PIV2 3MFCA 3VL8A 4XFCA 3WQBA 1MACA 4GZ9A 1W6MB 4X8NA 1F2NA 1CZVA 1FMD1 1FT9A 1GUIA 3ACLA 4URAA 2PLV2 1WA6X 1FOD2 4HSJA 3GYDA 4XFHA 1GOHA 2MEV1 4R9CA 2FDKA 4CDQC 1O4YA 1QKQA 5D8AB 2Y0IA 3IAQA 4WVZA 3ZSKA 1NCQB 3GZEA 3ZYRA 4QMAA 2Q1ZB 1FNZA 2HKXA 2RG4A 2ZS6B 3S30A 4DZGA 2W5FA 3VBOA 2BGOA 4Y4RA 1RINA 3D8CA 3VD9A 4PF1A 1JN2P 5L7OA 4NIGA 1K45A 5E6HA 4PLMA 5BNNB 4MV2A 3EBRA 3JBG2 1XE8A 2NM1A 1NKGA 3PJQA 2Q30A 2WN2A 3MZHA 1PIV1 4AWDA 3VDDC 2VY0A 3AP9A 2CU5A 2VCCA 3VBHA 3ZXJA 5J48A 1RUF1 4K6BA 1YQ8A 2MHFA 5C4WA 3WP5A 2JG8A 3VD7A 2B46X 1LGNA 1W8OA 2D44A 2XQXA 2PXJA 4K8RB 3ZMOA 4QKFA 5CFCA 4QPYA 1EAH3 2HWD3 5FZOB 1OLQA 3I2IA 5BNNA 3ZYFA 3TWIA 5L7OB 1ZA7A 2K0GA 1JYNA 1R1A2 1G7YA 4JGYC 2HBUA 4W4ZA 4YLZA 5CIRA 1O5UA 4TLGA 4XJZA 3AMMA 3OCPA 3ETQA 4M0HA 2ZGLA 5KHJA 2XPJA 1RUC3 3EYPA 3J26N 1RUH3 1LAJA 4UF0A 4LBJA 3THDA 5K0UB 4LHLA 1VAMA 1WLDA 2V72A 4TXWA 1YUDA 3IDAA 5JCTA 1H2KA 1ND2B 2H6BA 5CFCB 5JSPA 2WABA 1APNA 1D2QA 1VBA1 4OHVA 3C8XA 2HLEA 2VUDA 3M3CA 1U12A 1GOGA 5DQ0A 1Q5OA 4YPJA 2OYZA 2DUQA 4AEDC 4BQXA 3VZOA 1NCRA 5KHGA 2BWAA 4AI2A 4I09A 1WLCA 1W8WA 2IC1A 2WWJA 2XG3A 4N53A 3JXSA 4GMP0 4SBVA 4KL1A 4CU6A 2E51A 3VBRB 1DGWA 4XZPA 4YSFA 5IK7A 1LU1A 1X82A 2V5DA 3G7DA 3OBTA 4MX3A 1RHI2 3POGA 3UETA 4A3ZA 4D7SA 3GBWA 4BISA 5ACA1 2ZGKA 3LA7A 3S57A 1C57A 4H2AA 2V4VA 1J58A 2I2SA 1RUH1 3ITQA 2WO2A 4B7EA 1BBT1 1HXS2 2J1TA 3D6EA 1WLWA 3J7HA 4WM7C 2VZSA 5HCFA 4UFJA 1ZVFA 2A70A 1H0BA 2BYVE 4D94A 4BQ5A 2W46A 3UKVA 5FPUA 4OUEA 1W99A 3U11A 2FCUA 1MQTA 1DGLA 3ACIA 4E4ZA 3RVHA 5BNPC 4OMDA 2QQPA 4QQHA 1ZRCA 3AFGA 3UGGA 1JYCA 2VZPA 3PDQA 1ND2C 3POWA 1XNCA 4DFSA 3POBA 1GWKA 5H9SA 1QJFA 1Z7S1 4UW3A 2AR6A 1D4M3 5FCCA 4CU8A 1WD3A 2WDBA 2AEZA 1F15A 1QJU1 3SH3A 1ULEA 3CJIB 4ZS2A 1Y9MA 2BNOA 4FFIA 5FZGA 3GHMA 3I3DA 3SCGA 2WSUA 4AE2A 4QKNA 3W58A 1HB2A 2GC2A 1H6XA 1X9PA 2QQVA 1NT0A 4Y22A 3NJYA 5DUUA 2H0VA 1O8SA 1QNYA 5BYNA 4FP2A 4W65A 2LROA 1UN1A 4A7ZA 3NVCA 1SFYA 1QMJA 2EALA 2QQUA 2QCSB 5HPOA 4FCAA 1A8MA 1L3JA 2ZX1A 4GB32 3ZOIA 5FPLA 2Q5TA 4IEXA 4YGDA 4YZ5A 1HIXA 4NPMA 3VGIA 3EXUA 2QQLA 1WMEA 4QD2A 1QJX3 4NJ4A 4IUGA 4CEYC 1WCDJ 4Y24A 4AFAA 1LB2A 3GM8A 4Q4V3 5FZKA 2JECA 3F95A 3AK0A 4QX5A 4N90A 1TME3 2GH8A 3MIGA 2VBBA 3TEWA 2YGLA 4NHMA 4NROA 5ABJB 3ETPA 4K20A 3LWCA 1B35A 1FMD3 3E97A 4COVA 4CU9A 2BBAA 5I0SA 4XETA 4PF5A 5JZGA 2XJPA 4AHXA 4BMEA 1URXA 4A41A 1KQRA 4BH9A 4WVMA 2IXCA 3H3UA 4LK6A 2ZEZA 3TRSB 3NQHA 4O9EA 1ENXA 1D0GA 4OUSA 4CZSA 1NLQA 2Q4SA 4DNYA 1RUOA 3HN3A 1MEC1 3B69A 4E4DX 1JXNA 2WQZC 5KHKA 1W0OA 5T5JA 2IVJA 2J1EA 2R6QA 2JXAA 4DS0A 1PNGA 4Q8LA 5LK5A 2ILMA 4B1LA 5K8SA 3NJXA 3R0RA 3C7GA 5JOYA 5FP7A 5FY7A 1SLLA 3EO6A 1GKBA 5FZBA 4NIHA 2CGOA 3ALQA 2WAOA 1QJZA 1LGBA 3P3NA 2D43A 1Y43B 5C5TA 1P8JA 4CEYA 1LHWA 5FYCA 4NRMA 5D21A 4COYA 1WUVA 3ON7A 4BOWA 3T1MA 3JU9A 5FXVA 3HMYA 1LEDA 1NQDA 1W0PA 1O3QA 1BK0A 4GJZA 4RD7A 3WHTA 4YVSB 4XMAA 4BIFA 3OPZA 4DEQA 5AC93 1VIWB 3LSEA 3OYWB 2DUPA 4ASLA 1WA4A 4JGYA 2ZXQA 1NLRA 3WNPA 2OXBA 4TSVA 5FLHA 3DKQA 2XJRA 1RUD3 5LCWL 4Z82A 3WCSA 3UESA 1XNBA 3KM5A 2B4KA 4PDWA 4XBLA 3U37A 3AXDA 3FWEA 4XUOA 1LHNA 2GU9A 2VG9A 4Q8KA 3RPQA 1DG6A 4DPNA 5CG9A 1UXZA 2GH2A 3HNYM 5T54A 1ZNPA 5CNAA 4FTBA 5FPAA 1DFQA 3FZ3A 5EYYA 4CDXA 3PU8A 3NMBA 5LBFA 3LA3A 5LK7B 3PIJA 3WD5A 1PVXA 4BQ2A 2ZX4A 4PJYA 3KVAA 4AYUA 3Q8EA 3K48A 1OQEA 5FRAA 1SLTA 1QJU2 1OH4A 2CDPA 1S55A 3MIFA 3E6BA 1HRI2 4EJRA 1SMVA 1JI6A 1RMU3 1W8ZA 1EYBA 1VJ2A 4NMIA 2ZOEB 3T3YA 4P9WA 4G9SB 4XJ8A 3EJKA 1AZDA 4M3CA 1W6OA 2ZHNA 3WOGA 1FNYA 1SCSA 4CCKA 4ZKTB 1KJRA 4PIYA 5L9VA 1H8TA 3OPWA 4W6XA 4ATEA 1MS3A 1HQLA 2ORZA 2OW4A 4IEWA 3GCWA 2A7AA 2WYSA 1LCLA 1XU1A 3N9QA 3MV11 2VO5A 2XKPA 5FMDA 5DMYA 3T4VA 1TVGA 5K4LA 5CFDC 1AR71 4LKDA 5DG2A 4AI9A 1ZA4A 2RS11 3SKVA 4UWDA 2HWF1 1GQPA 2VUJA 5KXBA 4LE4A 1LULA 3WCRA 4MLOA 1KS5A 4Q26A 1RMU2 1UZVA 2VBDA 5CKQA 5FYBA 3ZSEA 1HRI3 5A3MA 1O8PA 2XJVA 1XXNA 4CA9A 5FOJB 1W39A 5C33A 2LS6A 2N7GA 1H1MA 2D6NA 1QJY3 1UKGA 2DTWA 2WNVB 5ERLA 5A7WB 3N9MA 4RA0A 1G9DA 3POIA 2CYFA 3GJBA 4UW6A 5A1LA 2ET7A 4M3CE 1J3RA 1KXGA 1YEWA 5C8CC 4CP9A 4WZFA 3HQUA 1MS5A 2D97A 3HEIA 1RUI2 2Y6LA 1ULCA 4B29A 1UY0A 1UX7A 3LD8A 1PO22 1DGRA 1Q8QA 2QZ2A 1WW5A 3PJYA 4JVAA 1Y3TA 4LK7A 2VZVA 1W2TA 1YFUA 4NAOA 4OZXA 5HV4A 3J9SA 3PUIA 5KHIA 2J1SA 5CADA 2YGMA 3ZFEA 4FFGA 3GDBA 2XVLA 3PTRB 5FR3A 1X33A 2AEYA 2XQRA 5FZLA 5T50A 1SLAA 2P37A 2ZMKA 5B4XA 4O61A 1OPOA 4CP2A 3AKPA 4F3JA 5JMOA 4CXWA 1RITA 1EPWA 1UZZA 4CUAA 4LOSA 2VUCA 1VBB2 3IZOA 1REFA 3ZYGA 4MGIE 1YO8A 3ZN5A 3WQ0A 3TN93 3CKHA 2DF7A 2UU8A 2WFF1 2EF6A 4JTNA 4YM1A 3TNPB 5F7UA 4NHXA 2R061 5E89A 5JZGC 4EWDA 1DLCA 4IV1B 4XFGA 1OF4A 4IW3A 4P9GA 4BLJA 4UBHA 1OLRA 1BJQA 3Q8FA 3SEEA 4YVWC 3ATGA 5C3OA 5FYVA 3OB8A 1YIFA 2WT1A 1S2BA 4LULA 1V9U2 4CDUB 1OKQA 2VVEA 4IE6A 2ZAHA 1HX6A 1L7LA 1RUG1 5SV5A 4CDQB 1RUH2 1EY2A 3NAPC 4Q4W3 2VOWA 3BTAA 3H8XA 5HXMA 1UYPA 2OPWA 1F5JA 2YG0A 2Y6KA 4LPLA 4D3WA 1YFWA 2XUMA 1LOBA 2BUKA 5GLZA 4QPGC 2IXHA 3UL2A 2XBO2 1PO23 2VVDA 3IIIA 4JHTA 4CPBD 3KGZA 1TMF2 4BZ4A 3Q9OA 2P5BA 1JUIA 3B01A 4PQ9A 3J4UH 5JI7A 5JUVA 3U4XA 4FI9A 3AYAA 3Q8BA 2D6PA 2AH2A 1H1IA 2BRTA 3RSJA 3MBWA 5FYIA 3HT1A 3BTZA 3LDRA 2P17A 1DP0A 2JB4A 2QTWB 5ABJA 5FO7B 5DUVA 1LRHA 3HPNA 4AAXA 2I07B 4XACA 1MZFA 1X8EA 3A0NA 3NJZA 3SXWA 3T0BA 1ONAA 5A1FA 3FHAA 4H55A 3RZHA 5IFPA 4NPRA 1XYNA 1R083 3J8F1 1EAH1 2HWD1 2PQQA 1R082 3MW3A 4QQOA 3J7MA 3T09A 5K9YA 5C8CA 3HWJA 3IIAA 3P1IA 3O1SA 1PGL2 2A3WA 2V5YA 3HQRA 1RUJ2 2CWMA 5BNOB 5FWEA 2VW0A 3NRUA 4PIZA 5CVRA 5JIAA 4K3UA 3VD4A 4IE7A 2P2KA 1RB8G 4JQTA 2WZEA 3WQ1A 5A33B 2VE1A 1JYXA 4TN7A 1NX9A 1Z0HA 2XHNA 5GJ6A 4XBQA 2LUWA 2W87A 4Z2WA 4K40A 5CISA 1PM7A 3B7MA 2XLFA 1IQDC 2AC1A 3AB0A 3PL0A 4W6WA 1RUG3 3VL9A 3K3OA 3RYKA 1TMF3 3JB4C 2HWF3 2VNOA 3URFA 4Q4X1 3SEPA 4AQSA 4P02B 4J1XA 4YFZA 5AC92 3F2ZA 4YZ3A 4F8AA 1MEC3 4HKLA 1VBB1 1RUF3 1VPHA 2R0FA 1ND3C 3MICA 1LTEA 3UJOA 3ZMNA 5BNOA 3BTXA 1WCUA 3BCWA 4QPIC 3LE0A 4QX1A 5T5LA 2KA3A 4XILA 3VBSB 4I3PA 4BQ1A 4MSVA 4AEKA 5C8CB 1CN1A 1NZCA 2GMMA 2HEYF 1NA1A 3HVDA 1D4M2 1I5PA 1S0GA 1ZZ9A 3K4ZA 2B45X 3PVEA 3WDVA 1ALYA 1OLME 4XHXA 2WLPA 3S0MA 2RMU3 4XTPA 4XQWA 4Q27A 2OQ6A 5CB7A 3T2OA 2JD4A 4GH4C 1WMXA 2E63A 2Y60A 4D69A 5BNNC 1LU2A 3FFQA 1H4GA 1EP0A 2JDKA 3INAA 3GHNA 5ANQA 3CJXA 2JG8C 3H1MA 2G4IA 5CBLA 5FLJA 2WAAA 3OD4A 4XUNA 1IPJA 2P3JA 5LBBA 1ACCA 3KCCA 2GZWA 3VBHB 4GMP3 1BMV2 2ARXA 1SLBA 2ZTNA 3OEAA 1RUC2 4JV4A 3ZX7A 4MADA 3UGHA 1N3OA 1OT5A 1QH7A 3B3QE 1Y7BA 4M4PA 1LESA 1SBDA 4KMQA 1W3VA 3WDYA 1JYIA 2R043 4AQ2A 2XJUA 5L19A 1QXRA 2XGXA 4UW5A 3VBOC 3CNAA 3E6DA 5J7MA 2W1WA 4EN9B 3IAPA 5FP3A 3UK9A 1YJLA 4N9HA 3UGFA 1T2XA 3FHQA 4NAMA 3K46A 1SDWA 4CEWC 3LPFA 3H8RA 4DRVA 3JQXA 2B8MA 3VBUA 5LA0A 2OVUA 2DVAA 5JPNB 4COWA 1GZWB 3KMHA 1AJKA 1OPMA 1OQDA 2RE9A 5DAQA 3N9NA 2E9QA 5AFBA 3OOXA 1S4CA 4META 2MNGA 3ZIXA 4AXOA 5KHHA 4A7KA 4N53B 5FPXA 4BM8A 1DCSA 2BGPA 2ZGSA 2DCKA 3HOBA 3MPBA 3AKSA 5FZ3A 2PQSA 4CCJA 4OHYA 4L11A 1GZWA 1L7RA 1H2LA 3VBUB 3POSA 4DINB 3AP4A 4D0QA 3LZZA 2E7AA 3EMRA 5F3GA 2R062 4C0HA 2WN3A 1ZRRA 4AEMA 4J1WA 2VMDA 5FP4A 1UCXA 4G4FA 1JODA 2WYFA 4LA3A 1UZWA 1QQP3 4Y26A 5CA6A 1ULOA 5IAVA 3IWZA 4A7YA 4B4PA 2GMEA 3PVBB 4P08A 3NV2A 5A3WA 3JBG3 2W95A 3OD0A 4QU1A 4AHWA 5KR7A 3IBMA 4WV8A 1QJY1 1OBNA 2R1BA 2VOXA 2HWF2 2HWC2 3I2FA 1CR7A 5EFUA 3VHNA 1FI2A 1LHUA 1XBFA 4CUCA 2VMHA 2QE3A 1POV0 2WO3A 3AKRA 5A7WA 1G9CA 4OVEA 4RHV2 2J1VA 5DXDA 1IS5A 1HQWA 1UU5A 5FZ7A 2ARAA 1ST8A 1NQJA 1AX1A 4WM8A 1AXZA 5FXZA 3Q8CA 4IV3C 2FBEA 3CIHA 4FFFA 4Q4Y1 4ZS3A 3OY8A 3WG1A 5C70A 1AX0A 3L9JT 1DYOA 1UY1A 3KV5A 1XOYA 3ZPYA 4DXTA 2XJTA 5FY0A 3PURA 2ZGNA 4BXSV 3AVRA 3C7EA 3H50A 2AZ5A 3MO4A 5D2AA 4LBNA 2LM3A 1H2NA 2WFF3 2XJQA 1XB9A 5A7QA 4YZ2A 4M0NA 1VALA 2HBTA 3AFKA 4XYXA 3WLUA 1NCQA 3FLTA 3DF0A 4CSWA 1RYYA 2ZX3A 1DQ6A 2ERFA 1YQ5A 2VQTA 5A3TA 1GOFA 2WT2A 2XUEA 1LOAA 3LF7A 3LOIA 5LEKA 5J1XA 1JOPA 1H8VA 4YG0A 5FZCA 2JG9A 2OUHA 2X10A 1J1TA 5DDJ2 3UJQA 2QDRA 4YVSC 5J09A 3MIDA 1VMHA 2CAVA 2YC4A 4Y3OA 2DWRA 2ZEWA 3FX3A 1YI9A 2C0ZA 1OURA 3DYOA 1L7QA 4BLIA 1JW6A 2A73B 1YNAA 4KWUA 3GNEA 3WG2A 1REEA 5FUPA 3WW1A 3PIGA 4O7XA 2Y6GA 4FTSA 1DYKA 3TAYA 2EIGA 4AGGA 4Y1XA 5IWFA 4OHWA 4A45A 1JU4A 1C8M1 3AYDA 4HN1A 1Q8SA 3WNXA 2NZ9A 1AYN3 1NXMA 4DRRA 1AR83 1Q8OA 1SEFA 2CNAA 4OFGA 4DQAA 3GGLA 4LO7A 2WRAA 4DUWA 1COV3 1XC6A 2CY6A 4GMP1 3BYWA 3VKOA 5FY8A 2WSVA 2JB8A 1HJFA 3HNBM 2WNUA 4Q29A 4AOCA 2VD7A 4GQ7A 4JRAA 1NAEA 5BPXA 3THPA 1WGPA 2ZABA 3K4AA 1RJ7A 1RVF1 4XMIA 4I0WB 2ZEXA 4ATFA 2EA7A 1W0NA 3VZNA 4K1ZA 1GQGA 3BIWE 5T5PA 3BPZA 4BXFA 2FMDA 4CP1A 4DEVA 5ISLA 3SNMA 2Y34A 4QDRA 1IPSA 2JG9C 2VBPA 1PX3A 4GXLA 5IUQA 3SKJE 5BNOC 3M3OA 4FXGB 1DQ2A 3T0DA 4LORA 2DURA 4RQPC 1HB4A 4LOTA 4SLIA 1S0IA 2E6VA 5JPMB 4Y1YA 3NJVA 1RTVA 5IJRA 2PELA 3W5NA 1QEXA 3AYCA 3D0SA 4LT5A 1KRIA 1QQP1 1AL22 2CDOA 1KFUL 1BVVA 1WMDA 4ARXA 1CGPA 1RUNA 3BOWA 4MZUA 4E2SA 1AHSA 1C1LA 3TEYA 1D0HA 4RS5B 5FY1A 2BNMA 2FMYA 1S0DA 2JJ6A 1SBFA 1DQ5A 1S2EA 3A22A 4NIIA 5EQUA 4B4QA 4EYUA 1LODA 1YFYA 2GNBA 1CPNA 2VTXA 3M2MA 3EQEA 1DU3D 3OUHA 5A70A 1JYVA 2X09A 1MZ5A 1V6KA 1AUYA 2DVFA 2EIBA 2D7FA 2YC2A 4O9GA 2ZKNA 3AL5A 5FZ0A 2D40A 5CU1A 4HSLA 5F1RA 4Q4Y2 5FBZA 3LFIA 3ZYJB 3AP6A 3RZJA 2VGDA 2ZMNA 1UKRA 1NUKA 1W2NA 2HWC3 2DFCA 1ZZ7A 2PHUA 3ZYBA 1GICA 4QXHA 4CCMA 3MUZ1 4L92A 3ZM8A 2A6WA 4ZHNA 3A4UA 2GP3A 2G9FA 3L2YA 1AYM3 1GSLA 1JTZX 1OVSA 2VZOA 2VPVA 1XYOA 4N7IA 3RZKA 3E6CC 2RDNA 5IK4A 4MH0E 2WQ4A 5JXIA 1GP4A 3N9LA 3E5UA 4QQLA 2RV9A 3C7OA 2Y33A 3ES4A 5F6KA 4B4RA 1KS4A 4JKMA 4CU7A 1QY4A 4IV1C 1RUE1 3LIGA 2G1MA 4AGVA 4E27A 1RGSA 5CEHA 4IGPA 3BIEA 1W03A 1PVC2 2XKOA 3AMQA 2W91A 4CP9B 4CTEA 3SITA 4C1XA 5FQ0A 2QNKA 4UYBA 3MI8A 3WF1A 1AF9A 4P9JA 1XU2A 4Q4X3 1DGRN 2BOJA 3BB6A 1GWMA 3M4FA 1S0JA 3N7MA 3CDZB 2XOMA 4UFMA 4XUQA 2OZJA 5LWBA 1W28A 1AR81 5LBCA 5IVYA 1HRV1 1ZBE2 5L73A 3JZVA 2VZUA 4FPHA 5C9AA 1RIRA 1NYWA 3W9AA 1V9U1 2RS51 3RMYA 3CJIC 2K9ZA 3MFAA 3IDEA 3LOBA 2D5HA 4OHXA 3ZLIA 4YM2A 1HKDA 1H4HA 2GC1A 1W8TA 1K5MA 1OH3A 3CHXA 3M3QA 4HFSA 1NG0A 4FPJA 3FBMA 4LBOA 2VAUA 2TNFA 5BNQA 4BYYA 3I4IA 2QVSB 4IEVA 3VHOA 4ZXKA 5IVCA 4FOQA 1PK6B 1MVEA 3OY8B 4OI2A 4WM8B 1TMF1 4YW1A 4DIQA 4MO3M 2AYHA 4MGKE 5IVFA 2YMZA 4Z8BA 5FMOL 2HWB2 3AXEA 4XIKA 5DZEA 3AZVA 2D98A 1AJOA 4AI8A 1AYN1 4EN6B 3AZXA 1V6LA 3ILRA 3VHRA 1N1TA 1EV11 1PMHX 5GKAC 3FMGA 4QQ2A 2RDSA 4M01A 4A3XA 4YZ1A 4DY3A 2R042 3H1WA 2VZRA 4FFHA 5HCAA 4C8DA 3OGGA 4NWWA 4D7YA 4YWAA 4GIQA 3N9OA 2VCAA 1QWRA 2EAKA 2ZZJA 3NV1A 3QBQA 3WG3A 4RR3B 3DV8A 2D6KA 3I3EA 5LASA 1VBC3 4XDQA 3DL3A 4GKXA 3AYEA 3RWNA 3ZSJA 1RHI1 3RZZA 1PO21 2YZ4A 4FT8A 4QWNA 1CAUA 4PLOA 3FN9A 4YW5A 5HBAA 2HWB1 5GLTA 2VZ1A 4OMCA 3VZLA 1BBT3 4NHYA 2RMU1 2A6XA 4QM8A 1YYNA 3MV01 3OPTA 3VHPA 2RR13 2VQUA 2WKKA 1Z7S2 4XJ9A 2XLGA 2VNGA 3D82A 4NUBA 2ZHMA 4LA2A 3I8TA 4M4RA 5JXGA 1VLNA 5F5AA 2J1RA 2ZA9A 4HT1T 1XE7A 3WDWA 3BU0A 5KXCA 3VZJA 4QXKA 2W39A 2WNVC 4PQQA 3X29B 3I3MA 3ACGA 3KV6A 5D1IA 4I3GA 1IS3A 3I97A 2HWE3 3SH4A 4Y4YA 2VECA 4V1PA 5GM0A 4KBBA 4K8FA 4YGEA 1BKZA 4JAAA 3MGUA 3NNJA 4OCTA 4CDXC 5BNPA 5JAXA 2VMCA 2RR11 4RQPB 1E5IA 2PAEA 4HMZA 2WNUC 3OGVA 1RUG2 2RS13 5JXJA 2RS52 3I2HA 3ES1A 4Q4X2 2AGSA 1LNSA 1WKYA 2JG8B 4UOJA 2X53S 5F5IA 3RG0A 5C4WB 1K3IA 3FL7A 4LIVA 4NR1A 4CPBA 5B2GB 3LB9A 3ZXEA 2A1XA 5EV7A 1S0EA 3O0WA 1YXWA 1S0FA 1RXFA 2R063 1W04A 3CL1A 3NO8A 1ULFA 2A6YA 4QB6A 3TYJA 2DU1A 5I0TA 5FXXA 2WNEA 4EN7B 1M06G 1C8M3 2QBXA 1N1YA 1UY3A 3PUSA 5FV3A 1FXZA 1AXKA 4QPGA 2QJVA 2D93A 1VMFA 5J98B 2VUAA 4P9YA 5C3RA 1QJY2 4AZZA 1BVP1 1UMHA 2GN7A 1UY2A 1FV2A 1CJDA 4CCEA 5ACA2 5JI9A 1MVQA 4LJHA 4S2GA 4D7TA 3UNPA 1LENA 2PHLA 4PIXA 3IDBB 4ES9A 2R7EB 1CAWB 4HPKB 2AREA 1W8UA 3BKZA 3J7NA 1GQHA 1BEV2 4ARYA 4HG6B 4JDOA 3MF6A 1VMJA 5LY1A 1WZXA 2W52A 3NAPB 4YVWA 2HWE2 4XUTA 3AMHA 3B02A 1JYWA 5JWPA 1HRV3 4BQYA 2Y0OA 3NNGA 4WBBA 1SLCA 2GAUA 3I2OA 3P6BA 1SG3A 2JE7A 2X8KA 5A3OA 4H3WA 5C3PA 1PGL1 1RVF2 4OQ8A 3AKQA 5EZWA 3B00A 4YW2A 3A23A 5A32B 3I59A 1XRUA 3A0KA 3LEMA 2EIEA 4LBQD 4UAPA 3ZYHA 2OS2A 2RS53 1JZ5A 2MEV3 2R49A 4OI1A 1F5FA 5CZKA 2YU2A 4LHKA 3SQOA 4I02A 3VDDA 3WHUA 4Y5Z0 4Q0SA 3BOPA 1Q3EA 1TME1 1W6QB 3WW3A 3DYMA 1RUE2 5HCBA 5L9BA 3HNMA 4HOOA 2VZQA 1JHNA 5L36A 2A6ZA 1JS9A 3HD8B 1C5IA 4LO5B 2J1AA 3B5LB 1YC61 1OHFA 5K0UC 4ES8A 2JIGA 4HK8A 4C91A 2RVAA 5JSRA 4H7LA 1MS1A 5DAVA 4BQ4A 3H7YA 5E16A 1WBLA 1W8NA 4LKEA 3DN7A 3NSTA 1AR61 1U5ZA 3CZJA 4OLLA 4A2UA 2ARCA 1PGW2 3WNKA 3LPGA 1GYKA 1OFSA 2BOIA 1FX5A 1K5JA 1AYM1 2ZJCA 3OBAA 2HWC1 3KF5A 4LO4B 4P5YA 5H9QA 1QJEA 3K2OA 3QACA 2UYAA 3AP5A 4AI0A 1PZ8A 3ENRA 1UD1A 5EHDA 5GZCA 4N7UA 2JX9A 2QKDA 3ZKYA 3ZXKA 2JDNA 2QQOA 1DLLA 4TZDA 5LATA 3KCXA 3E5QA 1YRZA 2RJ2A 4UI9L 4LUMA 4RSUA 2YBSA 5FMBA
chains in the Genus database with same CATH topology
2QQKA 4MADA 5IFTA 1GNYA 1OT5A 3WF3A 5G05L 4M4PA 1JZ8A 1W9SA 2W94A 4KMQA 2VMFA 3LEKA 3WQBA 2QQNA 4GZ9A 1GUIA 1CZVA 2X05A 2W1WA 2VR4A 1GOHA 1JZ7A 3IAPA 3IAQA 1T2XA 3FHQA 3K46A 4RN5A 4E8CA 3WNNA 2LW8A 3LPFA 2W5FA 4LKSA 2BGOA 1TG7A 2JKXA 5LA0A 3VD9A 3AC0A 1JZ3A 5B4NA 4PF1A 1K45A 2Y8KA 4A44A 1NKGA 1EUUA 2WN2A 2BGPA 3HOBA 2DCKA 2VCCA 2E33A 4BK4A 1JZ2A 2PQSA 1MPXA 2E31A 1L7RA 1UYYA 3VD7A 2XQXA 1W8OA 3ABZA 1JHJA 2VJXA 4QX0A 3I2IA 4D0QA 2ORXA 2WN3A 1JYNA 2YFZA 1PX4A 1GMMA 2W47A 4W4ZA 2VMDA 1F4HA 1ULOA 1OD3A 1UYXA 4P08A 2W95A 3EYPA 2QQJA 4AG4A 3THDA 2Y6HA 1WCQA 3I2FA 2V72A 4TXWA 3IDAA 2W3JA 2VL4A 4CUCA 2WABA 3C8XA 2HLEA 2WO3A 5DQ0A 4YPJA 1GOGA 2W1UA 2BZDA 3I2KA 2J1VA 3WSOA 2VMEA 5A1AA 1W9TA 2WO1A 4GWIA 3JXSA 4CU6A 3CIHA 5C70A 3DYPA 1DYOA 2V5DA 1UY1A 3UETA 4A3ZA 4DXTA 2WBKA 4BXSV 3C7EA 2V4VA 3MO4A 2WO2A 2J1TA 3J7HA 4QB1A 2VZSA 2OKXA 1CZSA 3IB3A 1RYYA 3OEBA 2W46A 2VQTA 1GOFA 2YFUA 4OUEA 1W99A 5J1XA 3ACIA 1J84A 2X10A 3ACHA 4OMDA 4DUXA 2VZPA 2YC4A 2WZ8A 5G04L 4QX3A 2ZEWA 3DYOA 1L7QA 4GWJA 4KWUA 4CU8A 1CIYA 2WDBA 2Y6GA 1JZ6A 4BK5A 3I3DA 3WF4A 2VZ3A 4A45A 1JU4A 4MOAA 1H6XA 3ACFA 3GGLA 3WEZA 4DUWA 1XC6A 1O8SA 1JU3A 1XNAA 4D8MA 2W1SA 3HNBM 5HPOA 5IYYA 1NAEA 3EB7A 3VDAA 3K4AA 3A21A 2ZEXA 2W9XA 1HN1A 1W0NA 2QQLA 2VC9A 4IUGA 1YQ2A 3A7QA 3GM8A 5LA2A 4DEVA 3WNLA 4CVUA 4QDRA 2ID4A 3SKJE 1PX3A 4ZXEA 4QAWA 3T0DA 3ETPA 2VM9A 4CU9A 2BBAA 1CX1A 3NJVA 4A41A 5IJRA 3W5NA 3CMGA 2ZEZA 1UWWA 3NQHA 4LQRA 2CDOA 1BHGA 3K4DA 2JD9A 2VOTA 4ARXA 5CYYA 3HN3A 5LA1A 2J1EA 3I3BA 1SDDB 3A22A 4MGQA 1H6YA 3NJXA 3C7GA 4A4AA 1JYVA 2WAOA 2X09A 2EIBA 1P8JA 2YC2A 1SHWB 4PT6A 3E1F1 4MGSA 4QX2A 5IHRA 2WQ8A 1NUKA 3K75B 4QPWA 3VDBA 1KGYA 1XNTA 3WNOA 4DEQA 3MUZ1 3ZM8A 2B9VA 2ZXQA 3WNPA 3LEIA 1JZ4A 2VZOA 5LCWL 4CUBA 3UESA 3U37A 2B4KA 4XUOA 3GXUA 5JXIA 1US3A 2EIDA 1UXZA 2RV9A 3C7OA 3HNYM 2DCJA 2QQMA 4JKMA 4QDQA 4CU7A 2J22A 5EJ1B 3T2PA 2ZEYA 2C26A 3CQOA 4L0PA 4ZZ8A 2W91A 3WF1A 3PUHA 1OH4A 2CDPA 4TTGA 1JI6A 2C9KA 3CDZB 2Y6JA 2XOMA 4XUQA 1US2A 2JDAA 2XONA 1O59A 4Z2AA 2VZUA 1R64A 1XPWA 2ORZA 2WYSA 3MV11 2Z4FA 2VO5A 3ECQA 4QDSA 5DMYA 5C71A 1TVGA 1OF3A 4P00B 4ZZ5A 3SKVA 4RYDA 1GQPA 4JX0A 1UZ0A 3VD3A 1O8PA 5FUIA 2Y64A 4MO3M 2LS6A 2HYXA 4XZUG 3I2JA 1PMHX 4W8JA 4XVHA 2W92A 3I2GA 2VZRA 3HEIA 3W5MA 2Y6LA 1UY0A 1UX7A 2VCAA 2VZVA 3I3EA 4LHSA 3PUIA 2J1SA 4QB2A 3THCA 3GDBA 3OGRA 4BDVB 3FN9A 3WF2A 3K77A 3C7HA 2VZ1A 4OMCA 3BN6A 4KI5M 2YB7A 5B4XA 3MV01 5JMOA 2VQUA 1D7PM 4CUAA 3VD5A 4M4RA 3HJRA 5JXGA 5F7UA 3CKHA 2J1RA 3C7FA 2BERA 4PQQA 1DLCA 1OF4A 3SEEA 5JR2A 3ACGA 3OB8A 3I97A 3CZUA 4DXRA 3D3AA 3T2QA 3LEGA 5DPNA 2JE8A 4A6OA 3T08A 2VMCA 5HXMA 2J1UA 3OGSA 2YG0A 2Y6KA 4LPLA 3OGVA 5JXJA 3I2HA 4DUVA 3VDCA 4ET7A 5JXHA 1LNSA 1WKYA 4UOJA 2W1QA 1K3IA 3FL7A 3IIIA 3DECA 3BGAA 5JUVA 2VZTA 4FI9A 2KD7A 4QB6A 3OG2A 3MUY1 2DDUA 2QBXA 1UY3A 3MBWA 4ZY9A 1DP0A 1F4AA 1UXXX 4OZOA 3HPNA 2E26A 1UMHA 4AAXA 1UY2A 1KEXA 3UNPA 3T0BA 3FHAA 5IFPA 2R7EB 2VTFA 4ARYA 4HG6B 3T09A 3P1IA 1K12A 5DN2A 4XUTA 1JYWA 3NNGA 4XUPA 2QQIA 1W9WA 3NRUA 3VD4A 3P6BA 1SG3A 4W50A 2WZEA 3WF0A 1JYXA 1NX9A 3A23A 2XHNA 2W87A 2EIEA 3LQCA 4UAPA 4JHZA 1IQDC 1JZ5A 5CZKA 1UY4A 2WUHA 3SEPA 4P02B 3F2ZA 1ULPA 4JKLA 3DYMA 1UYZA 3HNMA 2VZQA 1CZTA 4QX1A 3LE0A 5C7GA 2J7MA 2J1AA 1J83A 1UMIA 2E32A 4OYUA 1PMJX 4XURA 3WNMA 2C4XA 2RVAA 1I5PA 2VCBA 1EUTA 1W8NA 3K4ZA 3CZJA 3WNKA 3LPGA 4BJ0A 3T2OA 4E8DA 4P5YA 3OBAA 4DXSA 5I0DA 5EIYB 2L9LA 3T0AA 2QQOA 1GU3A 2WAAA 4A42A 4XUNA 2RJ2A 4UI9L 4JKKA 2EICA 1K42A 5EJZB 3OEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQK A;  4MAD A;  5IFT A;  1GNY A;  1OT5 A;  3WF3 A;  5G05 L;  4M4P A;  1JZ8 A;  1W9S A;  2W94 A;  4KMQ A;  2VMF A;  3LEK A;  3WQB A;  2QQN A;  4GZ9 A;  1GUI A;  1CZV A;  2X05 A;  2W1W A;  2VR4 A;  1GOH A;  1JZ7 A;  3IAP A;  3IAQ A;  1T2X A;  3FHQ A;  3K46 A;  4RN5 A;  4E8C A;  3WNN A;  2LW8 A;  3LPF A;  2W5F A;  4LKS A;  2BGO A;  1TG7 A;  2JKX A;  5LA0 A;  3VD9 A;  3AC0 A;  1JZ3 A;  5B4N A;  4PF1 A;  1K45 A;  2Y8K A;  4A44 A;  1NKG A;  1EUU A;  2WN2 A;  2BGP A;  3HOB A;  2DCK A;  2VCC A;  2E33 A;  4BK4 A;  1JZ2 A;  2PQS A;  1MPX A;  2E31 A;  1L7R A;  1UYY A;  3VD7 A;  2XQX A;  1W8O A;  3ABZ A;  1JHJ A;  2VJX A;  4QX0 A;  3I2I A;  4D0Q A;  2ORX A;  2WN3 A;  1JYN A;  2YFZ A;  1PX4 A;  1GMM A;  2W47 A;  4W4Z A;  2VMD A;  1F4H A;  1ULO A;  1OD3 A;  1UYX A;  4P08 A;  2W95 A;  3EYP A;  2QQJ A;  4AG4 A;  3THD A;  2Y6H A;  1WCQ A;  3I2F A;  2V72 A;  4TXW A;  3IDA A;  2W3J A;  2VL4 A;  4CUC A;  2WAB A;  3C8X A;  2HLE A;  2WO3 A;  5DQ0 A;  4YPJ A;  1GOG A;  2W1U A;  2BZD A;  3I2K A;  2J1V A;  3WSO A;  2VME A;  5A1A A;  1W9T A;  2WO1 A;  4GWI A;  3JXS A;  4CU6 A;  3CIH A;  5C70 A;  3DYP A;  1DYO A;  2V5D A;  1UY1 A;  3UET A;  4A3Z A;  4DXT A;  2WBK A;  4BXS V;  3C7E A;  2V4V A;  3MO4 A;  2WO2 A;  2J1T A;  3J7H A;  4QB1 A;  2VZS A;  2OKX A;  1CZS A;  3IB3 A;  1RYY A;  3OEB A;  2W46 A;  2VQT A;  1GOF A;  2YFU A;  4OUE A;  1W99 A;  5J1X A;  3ACI A;  1J84 A;  2X10 A;  3ACH A;  4OMD A;  4DUX A;  2VZP A;  2YC4 A;  2WZ8 A;  5G04 L;  4QX3 A;  2ZEW A;  3DYO A;  1L7Q A;  4GWJ A;  4KWU A;  4CU8 A;  1CIY A;  2WDB A;  2Y6G A;  1JZ6 A;  4BK5 A;  3I3D A;  3WF4 A;  2VZ3 A;  4A45 A;  1JU4 A;  4MOA A;  1H6X A;  3ACF A;  3GGL A;  3WEZ A;  4DUW A;  1XC6 A;  1O8S A;  1JU3 A;  1XNA A;  4D8M A;  2W1S A;  3HNB M;  5HPO A;  5IYY A;  1NAE A;  3EB7 A;  3VDA A;  3K4A A;  3A21 A;  2ZEX A;  2W9X A;  1HN1 A;  1W0N A;  2QQL A;  2VC9 A;  4IUG A;  1YQ2 A;  3A7Q A;  3GM8 A;  5LA2 A;  4DEV A;  3WNL A;  4CVU A;  4QDR A;  2ID4 A;  3SKJ E;  1PX3 A;  4ZXE A;  4QAW A;  3T0D A;  3ETP A;  2VM9 A;  4CU9 A;  2BBA A;  1CX1 A;  3NJV A;  4A41 A;  5IJR A;  3W5N A;  3CMG A;  2ZEZ A;  1UWW A;  3NQH A;  4LQR A;  2CDO A;  1BHG A;  3K4D A;  2JD9 A;  2VOT A;  4ARX A;  5CYY A;  3HN3 A;  5LA1 A;  2J1E A;  3I3B A;  1SDD B;  3A22 A;  4MGQ A;  1H6Y A;  3NJX A;  3C7G A;  4A4A A;  1JYV A;  2WAO A;  2X09 A;  2EIB A;  1P8J A;  2YC2 A;  1SHW B;  4PT6 A;  3E1F 1;  4MGS A;  4QX2 A;  5IHR A;  2WQ8 A;  1NUK A;  3K75 B;  4QPW A;  3VDB A;  1KGY A;  1XNT A;  3WNO A;  4DEQ A;  3MUZ 1;  3ZM8 A;  2B9V A;  2ZXQ A;  3WNP A;  3LEI A;  1JZ4 A;  2VZO A;  5LCW L;  4CUB A;  3UES A;  3U37 A;  2B4K A;  4XUO A;  3GXU A;  5JXI A;  1US3 A;  2EID A;  1UXZ A;  2RV9 A;  3C7O A;  3HNY M;  2DCJ A;  2QQM A;  4JKM A;  4QDQ A;  4CU7 A;  2J22 A;  5EJ1 B;  3T2P A;  2ZEY A;  2C26 A;  3CQO A;  4L0P A;  4ZZ8 A;  2W91 A;  3WF1 A;  3PUH A;  1OH4 A;  2CDP A;  4TTG A;  1JI6 A;  2C9K A;  3CDZ B;  2Y6J A;  2XOM A;  4XUQ A;  1US2 A;  2JDA A;  2XON A;  1O59 A;  4Z2A A;  2VZU A;  1R64 A;  1XPW A;  2ORZ A;  2WYS A;  3MV1 1;  2Z4F A;  2VO5 A;  3ECQ A;  4QDS A;  5DMY A;  5C71 A;  1TVG A;  1OF3 A;  4P00 B;  4ZZ5 A;  3SKV A;  4RYD A;  1GQP A;  4JX0 A;  1UZ0 A;  3VD3 A;  1O8P A;  5FUI A;  2Y64 A;  4MO3 M;  2LS6 A;  2HYX A;  4XZU G;  3I2J A;  1PMH X;  4W8J A;  4XVH A;  2W92 A;  3I2G A;  2VZR A;  3HEI A;  3W5M A;  2Y6L A;  1UY0 A;  1UX7 A;  2VCA A;  2VZV A;  3I3E A;  4LHS A;  3PUI A;  2J1S A;  4QB2 A;  3THC A;  3GDB A;  3OGR A;  4BDV B;  3FN9 A;  3WF2 A;  3K77 A;  3C7H A;  2VZ1 A;  4OMC A;  3BN6 A;  4KI5 M;  2YB7 A;  5B4X A;  3MV0 1;  5JMO A;  2VQU A;  1D7P M;  4CUA A;  3VD5 A;  4M4R A;  3HJR A;  5JXG A;  5F7U A;  3CKH A;  2J1R A;  3C7F A;  2BER A;  4PQQ A;  1DLC A;  1OF4 A;  3SEE A;  5JR2 A;  3ACG A;  3OB8 A;  3I97 A;  3CZU A;  4DXR A;  3D3A A;  3T2Q A;  3LEG A;  5DPN A;  2JE8 A;  4A6O A;  3T08 A;  2VMC A;  5HXM A;  2J1U A;  3OGS A;  2YG0 A;  2Y6K A;  4LPL A;  3OGV A;  5JXJ A;  3I2H A;  4DUV A;  3VDC A;  4ET7 A;  5JXH A;  1LNS A;  1WKY A;  4UOJ A;  2W1Q A;  1K3I A;  3FL7 A;  3III A;  3DEC A;  3BGA A;  5JUV A;  2VZT A;  4FI9 A;  2KD7 A;  4QB6 A;  3OG2 A;  3MUY 1;  2DDU A;  2QBX A;  1UY3 A;  3MBW A;  4ZY9 A;  1DP0 A;  1F4A A;  1UXX X;  4OZO A;  3HPN A;  2E26 A;  1UMH A;  4AAX A;  1UY2 A;  1KEX A;  3UNP A;  3T0B A;  3FHA A;  5IFP A;  2R7E B;  2VTF A;  4ARY A;  4HG6 B;  3T09 A;  3P1I A;  1K12 A;  5DN2 A;  4XUT A;  1JYW A;  3NNG A;  4XUP A;  2QQI A;  1W9W A;  3NRU A;  3VD4 A;  3P6B A;  1SG3 A;  4W50 A;  2WZE A;  3WF0 A;  1JYX A;  1NX9 A;  3A23 A;  2XHN A;  2W87 A;  2EIE A;  3LQC A;  4UAP A;  4JHZ A;  1IQD C;  1JZ5 A;  5CZK A;  1UY4 A;  2WUH A;  3SEP A;  4P02 B;  3F2Z A;  1ULP A;  4JKL A;  3DYM A;  1UYZ A;  3HNM A;  2VZQ A;  1CZT A;  4QX1 A;  3LE0 A;  5C7G A;  2J7M A;  2J1A A;  1J83 A;  1UMI A;  2E32 A;  4OYU A;  1PMJ X;  4XUR A;  3WNM A;  2C4X A;  2RVA A;  1I5P A;  2VCB A;  1EUT A;  1W8N A;  3K4Z A;  3CZJ A;  3WNK A;  3LPG A;  4BJ0 A;  3T2O A;  4E8D A;  4P5Y A;  3OBA A;  4DXS A;  5I0D A;  5EIY B;  2L9L A;  3T0A A;  2QQO A;  1GU3 A;  2WAA A;  4A42 A;  4XUN A;  2RJ2 A;  4UI9 L;  4JKK A;  2EIC A;  1K42 A;  5EJZ B;  3OEA A; 
#chains in the Genus database with same CATH topology
 1SLI A;  2QQK A;  4QXB A;  1DZT A;  3H8O A;  1GNY A;  1UX6 A;  2VOK A;  2XXZ A;  2Y26 A;  2XWJ B;  1UIJ A;  4Q1P A;  2W0X A;  4Q4V 1;  1V6I A;  5G05 L;  1ND2 A;  3I7D A;  1JZ8 A;  1NE4 A;  1E5H A;  1W6O B;  1W9S A;  1PIV 3;  1POQ A;  1ZZC A;  2TUN A;  3WQ7 A;  4CDW A;  3FE5 A;  4COZ A;  4HVQ A;  5J96 B;  1F8V A;  1U5X A;  3W59 A;  1PO1 3;  2QQN A;  3UYJ A;  1H8T C;  3AZY A;  2WC2 A;  2X05 A;  4S2D A;  2XH6 A;  1MS8 A;  4XF9 A;  3JQW A;  3T30 A;  3VBF A;  1UU4 A;  4YM3 A;  5IVE A;  3ZPO A;  2IXK A;  4CCL A;  3ZXG A;  5FYZ A;  1IS6 A;  1ZYB A;  4I01 A;  4RN5 A;  1TNR A;  2ZGR A;  4B1M A;  3CF6 E;  2LW8 A;  4XEZ A;  2K2S A;  1GBG A;  4XF4 A;  5D8A C;  4K21 A;  1TG7 A;  1WD4 A;  2JKX A;  2O14 A;  3AC0 A;  5IT6 A;  1JZ3 A;  1TNF A;  2J42 A;  4CDW B;  2HWE 1;  4FBF A;  2RHP A;  4CRQ A;  1EV1 3;  5JLV A;  3O1V A;  1PGS A;  5F39 A;  5FMO S;  2ZX2 A;  3WZ1 A;  1CAV A;  1EUU A;  5CKN A;  3DXU A;  2E33 A;  1ODM A;  3HQX A;  4XAA A;  3RMX A;  3S6P A;  4BK4 A;  2Q1F A;  1MPX A;  3R4U A;  3W21 A;  1JZ2 A;  1UYY A;  3MYX A;  1MS9 A;  3ABZ A;  4XCB A;  1CJP A;  2JDP A;  1JHJ A;  1C8M 2;  2B39 A;  4QX0 A;  4KG8 A;  5LB6 A;  4EWA A;  4YVS A;  2ORX A;  1COV 1;  1A8D A;  1PHM A;  3KWV A;  4XXA A;  5KC6 A;  1GMM A;  2PTM A;  3W20 A;  1QU0 A;  2ATF A;  4Q2F A;  1EPZ A;  5L9R A;  5BY5 A;  5FUN A;  3VZM A;  3QCW A;  2Q8E A;  2K46 A;  1OD3 A;  1PZ7 A;  4DO0 A;  3MDP A;  4AG4 A;  4Y5S A;  1DQ1 A;  2Y6H A;  1WCQ A;  3KV4 A;  4Q1R A;  3EHK A;  3VBF B;  5LRS A;  2OZ6 A;  5FZ4 A;  2W3J A;  1C4R A;  2VL4 A;  3WDX A;  3V0B A;  1ZRF A;  2BTV C;  1IPK A;  2D3R A;  2BFU S;  2BZD A;  1AR6 2;  2CWS A;  5C3Q A;  3I2K A;  2HH9 A;  3WSO A;  1X9T A;  4QX8 A;  5A1A A;  1BYH A;  4C90 A;  2Y38 A;  3RNS A;  4FXK B;  4BCU A;  2Z5W A;  4NRQ A;  4AED B;  5LEJ A;  2QDN A;  3BPS A;  1DYP A;  4P9X A;  3ZXL A;  4AFM A;  4IEP A;  3TN9 1;  4LXL A;  4X8P A;  3BTY A;  3MEP A;  4NHK A;  1JBC A;  2YY1 A;  2WBK A;  4IXL A;  4LBL A;  4KWK A;  4JGZ C;  3TB0 A;  3USU A;  4AAP A;  3ZSL A;  1VBA 3;  4IQP A;  3RQ0 A;  5FYS A;  4FQ4 A;  1VBD 2;  1ND3 B;  5A32 A;  1UMZ A;  3MLL A;  2GC0 A;  3N3H A;  2ZZQ A;  2GDF A;  4MHR A;  2G9Z A;  2FCT A;  2OKX A;  2RS1 2;  1CZS A;  1RJ8 A;  1UL9 A;  3IB3 A;  4AHZ A;  1XE0 A;  2TBV A;  2HJI A;  1B35 C;  3UV9 A;  1NY7 1;  1RUD 1;  2Q8C A;  1VBC 2;  2YFU A;  2XB6 C;  4K9S A;  4FPF A;  3VV1 A;  2PHW A;  1W2U A;  3J7L A;  4Q4W 1;  1J84 A;  3ACH A;  5JIU A;  3BI3 A;  4XDP A;  4CDW C;  2XJS A;  1UAI A;  5FZ6 A;  3GZT B;  2F17 A;  2WZ8 A;  4ZPI A;  5G04 L;  4QX3 A;  1W6N B;  5ANN A;  3D5O A;  3RI8 A;  5FZI A;  4I2O A;  4GWJ A;  4KWJ A;  5A3N A;  4XFI A;  5GZG A;  1J59 A;  3RGB A;  4CDX B;  4R4Z A;  2DBI A;  1S1A A;  3ZYP A;  4S2F A;  3R4D B;  3WF4 A;  1LOG A;  1ZBA 2;  4LO8 A;  5FYU A;  3ZFG B;  4CXX A;  3ORJ A;  3CBN A;  4XE9 A;  1CWP A;  4JCK A;  2IZW A;  5K7P A;  3S5A A;  4FPY A;  2H6C A;  3ROU A;  1YWK A;  2VW1 A;  3WEZ A;  4QT6 A;  4AEJ A;  2WA3 A;  4NVP A;  1AYN 2;  1WWY A;  4LO6 B;  4ZU7 A;  3QOP A;  1JU3 A;  5FP8 A;  5E8A A;  3TNQ A;  3TEZ A;  5H9P A;  4JDN A;  3V64 A;  3E5X A;  2PHF A;  4MG2 A;  5ACA 3;  5IYY A;  2R04 1;  1F35 A;  3JBG 1;  1V00 A;  5FIX A;  3T1L A;  4IGO A;  1POV 3;  3VDA A;  4QPI B;  2D6O X;  3A21 A;  1LOE A;  2BU9 A;  2BJS A;  2W9X A;  1HN1 A;  4OI4 A;  4QX7 A;  1FPN 3;  2VC9 A;  2ZBJ A;  5T55 A;  1MR5 A;  4XW3 A;  1VRH 2;  3A7Q A;  5LA2 A;  2YRO A;  2BPA 2;  5A7N A;  2ID4 A;  1OKO A;  4YZ4 A;  3T2T A;  2VU9 A;  4QAW A;  3U75 A;  1MQT C;  5GLU A;  2W68 A;  1HJG A;  2VM9 A;  2CTV A;  1AR9 3;  2FHR A;  4P9I A;  4N43 C;  4ZON A;  4FPC A;  5JSO A;  4ASM B;  2NYY A;  1CX1 A;  2WZR 2;  1JOB A;  3CLP A;  4IET A;  3CMG A;  3IT8 A;  3QH6 A;  1HLC A;  1QGL A;  4GKY A;  1UWW A;  5EWS A;  4NN0 A;  5FKC A;  2D3P A;  3VZK A;  1YJK A;  2JD9 A;  3K4D A;  2VOT A;  2NPI A;  3GF6 A;  3USS A;  4JGZ A;  4AW7 A;  5DUX A;  1H2M A;  2BNN A;  4AVT A;  2OX0 A;  4N43 A;  5LA1 A;  3AVS A;  1H1A A;  3IKW A;  3I3B A;  4LKF A;  1Y4W A;  4WVM B;  2RDQ A;  4MGQ A;  1OFN A;  3IMM A;  1XND A;  1H6Y A;  2I45 A;  4N53 C;  4YVW B;  1C1F A;  4A4A A;  3MF9 A;  1CAX B;  1NA1 C;  4GB3 1;  2SLI A;  4Q4V 2;  1GR3 A;  3N35 A;  2E7T A;  2UWC A;  2VMG A;  4HKW A;  1OUX A;  1SHW B;  3NKT A;  4NIA A;  4PT6 A;  3E1F 1;  2I74 A;  5F8P A;  5I0R A;  2UWA A;  3KZ4 C;  5IHR A;  5EYX A;  2BDR A;  4Y1Z A;  3JCI A;  3KQR A;  4QHB A;  2WIN B;  2WQ8 A;  2AUY A;  1UZY A;  4R52 A;  1ULG A;  4QPG B;  2ZGM A;  3K75 B;  1V6O A;  3WR0 A;  1KGY A;  2B42 B;  2JDM A;  1XNT A;  4R9B A;  3WV6 A;  3ZYI B;  4CEW B;  1UIK A;  1BQP A;  1CAX A;  4PBP A;  3I49 A;  3LDB A;  5GLW A;  1PVC 3;  4FSJ A;  4H14 A;  4QU2 A;  4YFW A;  2D5F A;  3LEI A;  1R09 2;  4ERO A;  3FJS A;  3M1H A;  4JC1 A;  2WWU A;  2ADD A;  4HON A;  4CUB A;  1VBC 1;  1HRI 1;  3LKJ A;  3RJR A;  4MGT A;  4CYD A;  1WMF A;  2UWB A;  1V70 A;  2X5I B;  5A7O A;  3TBD A;  3GXU A;  4RS5 C;  1US3 A;  5I8Y A;  2EID A;  3RZG A;  1O7F A;  4A6S A;  1ZZ8 A;  2D3S A;  3VKF C;  3B94 A;  4RQP A;  5F32 A;  2BP6 A;  4HVR A;  2QQM A;  5F3E A;  4EN8 B;  2A71 A;  2ZGU A;  1K5M B;  3VKL A;  1AR7 3;  2J22 A;  4IEZ A;  5DAW A;  1KFX L;  1GZT A;  1CQ9 A;  3RDI A;  1G8W A;  3CQO A;  5KXD A;  2UY9 A;  3PUA A;  4ZZ8 A;  5IK5 A;  3NKG A;  1LEC A;  2XBO 3;  3PHM A;  3POF A;  1YQ6 A;  4YGC A;  2OA2 A;  5D8A A;  5DAB A;  4QHZ A;  3HN1 A;  4LTA A;  3KT4 A;  3UKN A;  1RL3 A;  2C9K A;  4JRL A;  4YGB A;  5FDB A;  3FC0 A;  2A3Y A;  4XBN A;  1US2 A;  2JDA A;  2BV4 A;  4D6S A;  1FMD 2;  1YI7 A;  1GV9 A;  2BWC A;  4HZF A;  5BXX A;  2XON A;  1ENQ A;  4Z2A A;  4HAN A;  2Z79 A;  1WW4 A;  2JDH A;  1C3H A;  1XPW A;  5CFD B;  4CP0 A;  4Z07 A;  2BEO A;  1W06 A;  5C3S A;  3PMS A;  2WS9 1;  4HL0 A;  1BXH A;  3ECQ A;  3TEX A;  5C71 A;  1D4M 1;  1OF3 A;  4BIO A;  4Y20 B;  2SBA A;  5A6Q A;  4ZZ5 A;  2WZR 1;  1IHM A;  5FFO C;  2KM2 A;  2IFW A;  1I1E A;  5DG1 A;  3M3I A;  4D6Q A;  3V0A B;  4XF1 A;  2IXI A;  1UZ0 A;  2EAA A;  1QDC A;  1LOF A;  1ZZB A;  1V6J A;  2DVB A;  3FUQ A;  3S5Q A;  3U14 A;  1OD5 A;  3T4H B;  3PLQ A;  4LMF A;  1CX4 A;  3N36 A;  4QXC A;  2Y64 A;  3D4K A;  3THT A;  1PM4 A;  4QM9 A;  2F6B A;  4AFB A;  3U0Z A;  2LRP A;  3KT1 A;  4XHB A;  4JQR A;  2HYX A;  2CHH A;  3DXT A;  4ISQ A;  1NA1 B;  4XZU G;  1AR7 2;  2FZ1 A;  3I2J A;  3ST7 A;  3SC7 X;  1POV 1;  2ZCW A;  4W8J A;  4KU7 A;  1W8F A;  2WS9 3;  4AFC A;  1QNW A;  2VMI A;  4LUK A;  1DGW X;  1OI6 A;  3BU7 A;  3IM0 A;  1QHD A;  4HET A;  5A7P A;  2OUJ A;  4XFA A;  5LY2 A;  2PLV 3;  1DZR A;  3CO2 A;  5FOB B;  4MXW B;  4CCN A;  1AR6 3;  3LAG A;  4QKB A;  4UFK A;  5JMC A;  2EXI A;  1PK6 A;  3KVB A;  4AVV A;  4CUG A;  5FZO A;  1CVN A;  3DCQ A;  4IGQ A;  3VBH C;  3THC A;  4FO9 A;  4XXP A;  4BDV B;  3LSD A;  4UFH A;  4DXZ A;  3OUI A;  4GAL A;  1TZO A;  4GUL A;  1R1A 1;  3VUO A;  1OA3 A;  3OGJ A;  4IEY A;  1K5M C;  2OT7 A;  1MS4 A;  2RDR A;  3BN6 A;  4QHO A;  2IXL A;  1UQX A;  3JD7 1;  4N43 B;  1PK6 C;  4IEO A;  3ME2 A;  4MHU A;  3WVJ A;  1D7P M;  1SPP A;  2B7Y A;  3KF3 A;  5FPB A;  4MGZ E;  5CAZ A;  3V56 A;  1HXS 3;  3HJR A;  3N4M A;  2RMU 2;  1XJA A;  3N9P A;  3C7F A;  4UW4 A;  1MZ6 A;  1H9P A;  1CES A;  2BER A;  5FJH A;  5FXW A;  5EXO A;  4CDQ A;  3KGL A;  4HVO A;  2YU1 A;  2UUR A;  4K7J A;  2XL7 A;  4AQ6 A;  2JEN A;  2PA7 A;  3N7L A;  2VQ0 A;  1OXC A;  1PO1 1;  2RM2 2;  3ZR5 A;  4YAR A;  3WP3 A;  2BBV A;  3V0A A;  2FDH A;  3GBF A;  1YFX A;  1DIW A;  1LR5 A;  2RJK A;  2ZML A;  5J37 A;  5DDJ 3;  1RUI 1;  1G9B A;  5DPN A;  5A6Z A;  1VAK A;  2YHJ A;  2JE8 A;  1W6M A;  5F6L B;  5GAL A;  1I3H A;  1VBD 1;  4IV1 A;  4YW4 A;  2VVF A;  4RR3 C;  3WW4 A;  1O5L A;  1IQA A;  1RXG A;  2P4E A;  3OGS A;  3I3Q A;  1GFF 2;  4E4H A;  4DUV A;  2Q1M A;  3VDC A;  2DTY A;  4ET7 A;  5FJK A;  2R07 2;  2G19 A;  4MUV A;  2RS3 1;  2ENR A;  2B5H A;  2TEP A;  4Q5O A;  4URT A;  4RHV 1;  2VZT A;  4EZH A;  2JE9 A;  4ONU A;  2KD7 A;  4XQD A;  1QIQ A;  4KG0 A;  3SCH A;  5F2W A;  1IOA A;  3O0X A;  4YNI A;  3ZFE B;  4CEW A;  1O6U A;  2XR4 A;  4E9K A;  4ZY9 A;  5J36 A;  3RWK X;  3ZFG A;  5JOW A;  2A5Z A;  1F4A A;  1RUJ 1;  3O12 A;  4LR4 A;  4QGM A;  4FOW A;  1B35 B;  2E26 A;  4N9I A;  1UU6 A;  2WS9 2;  3MLJ A;  2GND A;  3ZIW A;  2P3I A;  3ZFF A;  4JTO A;  5LA9 A;  3AKT A;  1AYM 2;  3MLK A;  4Y1U A;  3RJ2 X;  3HT2 A;  3H0O A;  3H7J A;  4AR2 A;  4IL7 A;  4DMI A;  3O1T A;  1YHF A;  2DU0 A;  4RGK A;  1V9U 3;  3QD6 A;  3SHR A;  1K12 A;  4NID A;  1LOC A;  4CCC A;  1BEV 1;  2NLR A;  4RS5 A;  5EJ3 A;  1W9W A;  4YYO A;  4C0B A;  4Q4Y 3;  5FZ8 A;  3GZA A;  4W50 A;  3LDK A;  4B8E A;  3HAG A;  3DUI A;  4V2V A;  3ILN A;  4UBG A;  3GCX A;  2GSY A;  3PNA A;  4P14 A;  5HV0 A;  5M0T A;  1NZI A;  3O1M A;  2A3X A;  4B7K A;  1UY4 A;  3SIS A;  4XDO A;  2F4L A;  3M8L A;  1OUS A;  3FLR A;  5FBJ A;  1MEC 2;  4KNC A;  2WZP P;  1ULP A;  2NMN A;  4JKL A;  5JR7 B;  4CDU C;  5I8T A;  1WCS A;  5C9A B;  2WII B;  4BU2 A;  1FAT A;  2ES3 A;  1CZT A;  3LIH A;  4YM0 A;  5C7G A;  4WM7 B;  4GWN A;  1UPI A;  5KC5 A;  1T6B X;  1KJL A;  2FDG A;  1J83 A;  3U10 A;  4OYU A;  4L9B A;  2PFW A;  4QGL A;  3BOD A;  3WNM A;  5FY5 A;  3POJ A;  2JG9 B;  2VCB A;  4EWE A;  4GH4 B;  1MQT B;  1W9Y A;  1RUC 1;  4E2G A;  1PNF A;  1H9W A;  2A6V A;  5AC9 1;  1NLS A;  1UOF A;  1ZBA 1;  3WW2 A;  3WXP A;  4X6R B;  4IND A;  4BJ0 A;  5AVA A;  1W9F A;  1R09 3;  4E8D A;  1JUH A;  4GJY A;  1QJX 2;  1ZRD A;  2X5I C;  2EXK A;  5I0D A;  4IDZ A;  3RYR A;  3GAL A;  1IKQ A;  1F9K A;  1O3T A;  4X6Q B;  5FZA A;  4IEQ A;  3RZM A;  4MXV A;  3P3P A;  2L9L A;  3PU3 A;  4IEU A;  3T0A A;  4H7M A;  5LBE A;  3AMN A;  4F7Z A;  1CIW A;  1C5H A;  1GU3 A;  1VB2 A;  1W90 A;  4PDW B;  4A42 A;  4EE2 A;  3M7A A;  1IG0 A;  3FFZ A;  2EIC A;  2WO7 A;  4Q0V A;  1AR9 2;  5DDJ 1;  2LAL A;  3M3E A;  5EJZ B;  5J3U A;  5HCH A;  3U07 A;  1K42 A;  3KSC A;  5IFT A;  2XML A;  4U2A A;  1VBD 3;  1W6P B;  2CGN A;  2WFP A;  3WIN E;  4FTE A;  3H1Y A;  1D4V B;  1QQP 2;  1H8T B;  1AL2 1;  5HXV A;  3WF3 A;  3ZR6 A;  3C2U A;  1W2A X;  3BVC A;  2PHT A;  2W94 A;  4MVT A;  3IMN A;  5IVB A;  5L7O C;  1XQN A;  1S0C A;  2XBO 1;  2W2I A;  3FUO A;  1HB3 A;  2DCZ A;  3LEK A;  5FY4 A;  3SLI A;  3ZKU A;  3BUC A;  3KD4 A;  5LZ6 A;  1BZW A;  3KT7 A;  2DVG A;  3R6S A;  1B09 A;  1LGC A;  2P3K A;  2QQW A;  2D6L X;  1QF3 A;  4HPK A;  2YUE A;  3R05 A;  2VR4 A;  1JZ7 A;  1DZQ A;  3O1O A;  1W05 A;  4UF0 B;  1KIT A;  1OOP B;  1AXY A;  2UYB A;  4OQ9 A;  4CEY B;  4RHV 3;  2BVV A;  4R8H A;  2IFR A;  4E8C A;  3WNN A;  5F9T A;  2ZKL A;  4LKS A;  2CGP A;  3SH5 A;  4RGA A;  1OOP C;  2Q0A A;  4Q4W 2;  4AHY A;  5B4N A;  3MW4 A;  2Y8K A;  4HN0 A;  4A44 A;  4L2N A;  2ADE A;  4S2H A;  1OSG A;  3OJB A;  2GAL A;  5DUW A;  5FZD A;  5GZE A;  5FYH A;  3IDC B;  3VLB B;  3OBZ A;  4W6Y A;  1LJ7 A;  1GZ9 A;  2YBP A;  4IE5 A;  1VE0 A;  2E31 A;  1TEI A;  2JDZ A;  4YRD A;  5T52 A;  3LFM A;  1JH5 A;  4KU8 A;  2VJX A;  3WG4 A;  1N1V A;  1O91 A;  3MIH A;  2C9A A;  1VP6 A;  4NO4 A;  4GA9 A;  4PI2 A;  1J3Q A;  1PX4 A;  2YFZ A;  4BHP A;  2W47 A;  3AMP A;  1RUJ 3;  2C6S A;  3H42 B;  1F4H A;  4GWM A;  3ZDV A;  2O0O A;  3VBO B;  2YXS A;  5I0U A;  5IW0 A;  1UYX A;  3OTF A;  5E88 A;  2QQJ A;  2WL1 A;  1M4W A;  5IVJ A;  1C28 A;  3RI9 A;  2NMO A;  3POY A;  3DPR B;  4XAE A;  2FDI A;  2WJS A;  5FZF A;  4FAH A;  2W1U A;  4AI1 A;  5A3L A;  4P5H A;  4EQV A;  1RMU 1;  2ZHK A;  2C5D A;  2VME A;  1W9T A;  1OVP A;  2A75 A;  2WO1 A;  1RC6 A;  4GWI A;  1J1L A;  2JWP A;  2YV8 A;  5FAX A;  3CU7 A;  3O5S A;  4YW7 A;  1IG3 A;  1HRV 2;  1ZBE 1;  1GP5 A;  2FQP A;  1VBE 1;  3DYP A;  2O8O A;  4HXC A;  3VDD B;  3ZFG C;  4BQW A;  4OUM A;  1CAU B;  1ZX5 A;  2RR1 2;  4Z92 B;  1FPN 2;  1S0B A;  3CJI A;  5H9R A;  4AVC A;  3VBU C;  2P3Y A;  1ODN A;  3TN9 2;  5C8W A;  5C9A C;  1SBE A;  1YIP A;  3Q8A A;  4RL7 A;  3PUQ A;  1VRH 1;  4Y5T A;  1NE6 A;  4M00 A;  1TE1 B;  2JIJ A;  3DEM A;  4QB1 A;  3HR9 A;  1E5R A;  2VQA A;  5AFE A;  3OEB A;  2V73 A;  4LHN A;  3C3V A;  4FQZ A;  4AFD A;  3KV9 A;  3NAP A;  4NRP A;  1DQ0 A;  1BMV 1;  4DUX A;  5DAX A;  3UT0 A;  1OC1 A;  2P1B A;  2P6H A;  4BPZ A;  1FAY A;  3OF1 A;  4FPE A;  5FP9 A;  5CFC C;  2CSG A;  3O1U A;  2R30 A;  1IKP A;  1MS0 A;  4E2Q A;  5CG8 A;  1RVF 3;  2EXH A;  3D0J A;  5C4W C;  5EPA A;  1RUI 3;  1N3P A;  3QLQ A;  4Y33 A;  5BUV A;  3R4S A;  1CIY A;  4AVS A;  2F4P A;  1Q8V A;  2DFB A;  4TWT A;  1PMI A;  1VAV A;  3DGT A;  4FP3 A;  1Y9G A;  1JZ6 A;  1PVC 1;  2YPJ A;  3M70 A;  5FZ9 A;  4BK5 A;  1ASJ 3;  2VZ3 A;  1JOJ A;  1DDL A;  3KCY A;  4MOA A;  4AQT A;  4B3N A;  2X5I A;  3VBR A;  3ZN4 A;  4N8M A;  4Y20 A;  1R09 1;  3ACF A;  1HB1 A;  5SV8 A;  4KGQ A;  2G9G A;  1QXJ A;  5FPV A;  1NXD 1;  1XNA A;  3FHI B;  4D8M A;  2ETE A;  2R1D A;  1ZZ6 A;  1WCK A;  4PCR A;  5GZF A;  1LEM A;  1GNH A;  2WZR 3;  3U1X A;  3NNL A;  2AAC A;  2W1S A;  4V2W A;  3ZFE C;  5FZ1 A;  3H3Z A;  3EB7 A;  3JB8 A;  4BA6 A;  5A6Y A;  2V09 A;  1NCR C;  5F2S A;  1CAW A;  4RFR B;  5I93 A;  4I0B A;  1VBA 2;  4L8Q A;  5FO9 B;  3VBS A;  1DBN A;  3AZZ A;  2GNM A;  5F3I A;  1U5Y A;  4E4S A;  1GAN A;  1QH6 A;  1VR3 A;  4LIT A;  1YQ2 A;  4J25 A;  3ZXD A;  4CVU A;  3WNL A;  2PHR A;  1O3S A;  1OA4 A;  1W2O A;  1H30 A;  4ZXE A;  1XYP A;  1AX2 A;  3LCP A;  3P5B A;  2VW2 A;  4FVV A;  4HLT A;  4BQ3 A;  4CDU A;  3RYP A;  2PLV 1;  4COU A;  1R08 1;  4XFF A;  3K3N A;  4IE4 A;  4QQP A;  3L2H A;  2QZ3 A;  1Q56 A;  3WUD A;  5A3P A;  2HYK A;  5I91 A;  3KQ4 B;  3PTY A;  1AVB A;  4LQR A;  4JZR A;  1BHG A;  3TOJ A;  1IGO A;  4FOY A;  3POE A;  2ZHL A;  1EV1 2;  4LBQ A;  2CAU A;  3K51 A;  3BAL A;  5CYY A;  3ZXA C;  1U0A A;  1VBE 2;  4AVA A;  1QOT A;  3V65 A;  2BW8 A;  1ZRI A;  5AVP A;  1ASJ 2;  2GC3 A;  2FZ2 A;  4IER A;  1D2S A;  1SDD B;  3PVN A;  4IV3 A;  4QKD A;  2ZPX A;  1PO1 2;  2PAK A;  2RM2 1;  1UNB A;  3GJA A;  4PLN A;  4XJW A;  5BNP B;  1KD7 A;  4FPO B;  5K0U A;  5FO8 B;  2HWB 3;  3B9I A;  3S7E A;  3GZU C;  2IVI B;  5F5C A;  3I2D A;  4WVW A;  4XF0 A;  5JOZ A;  2DCY A;  3ZFF C;  1T6G C;  5IVV A;  4MGS A;  1ZRE A;  4QX2 A;  4PHZ A;  4ZU5 A;  2WR9 A;  4XOG A;  1YQC A;  3U4S A;  2PHX A;  1Z7S 3;  4NPL A;  5FK7 A;  1A34 A;  1AL0 G;  1YLL A;  4XJU A;  2PHD A;  4QPW A;  5FPZ A;  3WDU A;  3VDB A;  3WNO A;  2R07 1;  3PME A;  2B9V A;  1F31 A;  3KB5 A;  2YYO A;  1U5I A;  3O1P A;  3VBR C;  2DYC A;  1JZ4 A;  4RFT 0;  3ILF A;  2X29 A;  4NHL A;  1ZBA 3;  2NQY A;  1BCX A;  4JGZ B;  4UT5 A;  1ENR A;  1UF2 C;  1R1Z A;  2JDY A;  3H9A A;  3NW4 A;  4GAZ A;  5E1R A;  1Q43 A;  3IPV B;  4GB3 3;  2O1Q A;  3AM2 A;  5DZF A;  2DCJ A;  4PDW C;  1A78 A;  4RR3 A;  4U36 A;  2HEV F;  4QDQ A;  2JKB A;  3G6J B;  5EJ1 B;  3T2P A;  1X50 A;  3AJZ A;  4RGG A;  2YBK A;  4KQ7 A;  2ZEY A;  2C26 A;  3DKW A;  1VBE 3;  5FMC A;  1LHO A;  2BGC A;  1QJX 1;  2LTN A;  4L0P A;  3I54 A;  3VKN A;  5LW9 A;  3SMH A;  1OOP A;  1W3X A;  5FY9 A;  3WP6 A;  1UOB A;  3KLS A;  3PUH A;  2ZAA A;  1G9F A;  4R9D A;  5JVV A;  3RFR A;  4TTG A;  5DZG A;  4R9A A;  2Y6F A;  3FBY A;  2Y6J A;  4ASK A;  4F83 A;  3GBG A;  3LA2 A;  1A3K A;  1RUF 2;  4Y1V A;  2CV6 A;  4D6R A;  1AR9 1;  1SFN A;  2Z69 A;  1I6X A;  2OII A;  1EAH 2;  2HWD 2;  3MHZ A;  1O59 A;  4GD4 A;  2WNU B;  1MZE A;  1R64 A;  1W6P A;  1GLH A;  2DVD A;  1G6N A;  4FPK A;  4IES A;  4ORF A;  4OUL A;  2GP5 A;  4XJA A;  5FQ0 B;  3RS6 A;  3ZN6 B;  3IN9 A;  2GNT A;  1I5Z A;  2B9U A;  1FYU A;  1PZ9 A;  1BK1 A;  2DCT A;  1LHV A;  2Z4F A;  3J8F 3;  1HDK A;  3OSD A;  4QDS A;  4L99 A;  4P00 B;  1KDM A;  1O4T A;  3ZSM A;  1ULD A;  1Z78 A;  4WM8 C;  2IUW A;  1BEV 3;  4RYD A;  4CCD A;  1AR8 2;  1J3P A;  2XWB B;  2VCM A;  4JX0 A;  2Z42 A;  4BMB A;  1FPN 1;  4UXA A;  4HKO A;  3VD3 A;  2NP0 A;  2GN3 A;  3O7O A;  5FUI A;  1X36 A;  3JD7 3;  4M3C F;  5KXE A;  4UFI A;  4P9L A;  1ASJ 1;  4YG6 A;  1WBF A;  2ZX0 A;  1W6N A;  2QUO A;  4YG3 A;  4GH4 A;  4KH9 A;  3AJY A;  1BLZ A;  2UY8 A;  4TLF A;  2VUL A;  5IAX A;  4CXY A;  1RHI 3;  3AL6 A;  3DPR A;  4O65 A;  4LNV A;  4XVH A;  5TSW A;  1JYT A;  2JEM A;  2MEV 2;  2W92 A;  3I2G A;  5IAT A;  2ZGP A;  2WNV A;  4FPG A;  4L97 A;  4PBO A;  4XFB A;  4YW6 A;  4LBK A;  4AVB A;  4WM7 A;  2KXL A;  3W5M A;  1JMU B;  2P34 A;  1UW8 A;  4EZ4 A;  2WA4 A;  4QGN A;  4KGG A;  1SFP A;  5FTT C;  2Q8O A;  4XQ4 A;  4LHS A;  4QB2 A;  1ND3 A;  4CE8 A;  3AX4 A;  1O3R A;  4PI0 A;  4NE9 A;  3OGR A;  5C6C A;  5GZD A;  2ZGO A;  3ASI A;  3K77 A;  3WF2 A;  5A80 A;  3ZVX A;  3C7H A;  1UOJ A;  2XVG A;  2JDU A;  4XAB A;  4KI5 M;  5CKM A;  2YB7 A;  4FPL A;  2DV9 A;  5BV6 A;  4KWL A;  2VTX J;  1C8N A;  1SCR A;  1UPS A;  4AED A;  2AEN A;  1E57 A;  1QDO A;  3VD5 A;  3O1R A;  1CPM A;  1N47 A;  1W8H A;  2WLQ A;  4I0A A;  5FRE A;  1VRH 3;  1OMI A;  2R32 A;  2MPF A;  4K1Y A;  1YCI A;  4G3Y C;  2NN8 A;  4M3C B;  5GLV A;  5C5U A;  2VOV A;  1CD3 G;  2BVB A;  2R0H A;  3OYW A;  4NWV A;  5F5Q A;  4Z1V A;  5JOX A;  1VB4 A;  3V0B B;  4BE3 A;  4BWO A;  1DHK B;  5JR2 A;  1Q8P A;  5KBF A;  2FCV A;  2YC0 A;  5A3U A;  3MPP G;  1OQ1 A;  5EP9 A;  3FLP A;  3CZU A;  5FKB A;  3WX5 A;  4DXR A;  3D3A A;  5I8S A;  3CEW A;  3N7K A;  1NOV A;  2ZGT A;  5FZE A;  2E53 A;  4LLF A;  3LEG A;  3T2Q A;  1Y9Q A;  1ZM1 A;  1COV 2;  2EXJ A;  4AL9 A;  4C1W A;  4LLO A;  1GNZ A;  2JIC A;  4A6O A;  2O8Q A;  1IS4 A;  4BB3 A;  3T08 A;  1XNK A;  3AZW A;  2BQP A;  2J1U A;  5FWJ A;  5FZH A;  4OI0 A;  5HI0 A;  5T3N A;  1HV1 A;  3RZL A;  4KBZ A;  3ZO0 B;  3O0V A;  3KHB A;  4IV3 B;  5F3C A;  4YW3 A;  4WZC A;  4DY5 A;  5JXH A;  1QJU 3;  2W1Q A;  2RJL A;  2Z2S B;  3AP7 A;  2VNR A;  4AK3 A;  1FOD 3;  2WNO A;  3DEC A;  3RRD A;  1WW6 A;  4EV0 A;  3N7J A;  3BGA A;  4DB5 A;  5JDB A;  1CAV B;  2C24 A;  3NV3 A;  4HK9 A;  3NWK A;  4LBM A;  4R4X A;  1WW7 A;  4Y22 B;  4LBQ B;  4XIO A;  4JGY B;  4HBN A;  3HIF A;  3VKM A;  1N3Q A;  2KR2 A;  2RS3 2;  2VNV A;  2XVK A;  3OG2 A;  2V4A A;  3MUY 1;  3NL1 A;  1RED A;  2DDU A;  4DOU A;  1CON A;  2DBN A;  3NNF A;  2DUO A;  1QXP A;  1XSQ A;  2CL2 A;  3LGR A;  4ITC A;  1ZBE 3;  2XL9 A;  1VRB A;  1X7N A;  5JZG B;  5F37 A;  5FYY A;  1UO9 A;  1UXX X;  2P6C A;  4OZO A;  5APA A;  1OLM A;  3SCF A;  3VBF C;  1XSR A;  4XCA A;  3WT3 A;  1FOD 1;  1KEX A;  1QOS A;  1E5S A;  2C1F A;  1AL2 3;  3MW2 A;  1VBB 3;  2PN5 A;  3S7I A;  1DQ4 A;  2PMW B;  4LE3 A;  4NOT A;  2VXR A;  2WFF 2;  4QPI A;  1RUE 3;  1V6N A;  2E7Q A;  2VTF A;  4ISR A;  3UKT A;  3KHC A;  2PAM A;  5A7S A;  3ZDS A;  1A6C A;  2XLA A;  3H8U A;  4XC9 A;  3NV4 A;  5DN2 A;  3DPR C;  1TME 2;  3WP4 A;  1SZB A;  2GMP A;  1ENS A;  1OA2 A;  2RS3 3;  1R1A 3;  2QQI A;  2WT0 A;  1HN0 A;  4XUP A;  4Q0P A;  1SPP B;  1NCQ C;  3JUU A;  4AF9 A;  2D6M A;  3U78 A;  2XDV A;  1SAC A;  3WF0 A;  2BFU L;  1KDK A;  4J6G A;  2R16 A;  3ELN A;  3B9C A;  5FYM A;  4FOV A;  3LQC A;  2VXJ A;  2QFE A;  2VH9 A;  2EVX A;  2OPK A;  4JDM A;  4JHZ A;  1UOG A;  4UFL A;  4XF3 A;  3VN4 A;  4FAG A;  1TQ5 A;  5IK8 A;  4Q0U A;  1N1S A;  2H0B A;  2WUH A;  2FDJ A;  2IXJ A;  1HQN A;  5T5O A;  3ZXF A;  1PGW 1;  3ZN6 A;  2W08 A;  1FV3 A;  1DF0 A;  1UYZ A;  4MXW A;  2IWG B;  2YPD A;  1NCR B;  2J7M A;  4MGY E;  4CCO A;  1HW5 A;  1GWL A;  2OQ7 A;  1IZ3 A;  2ET1 A;  4OHZ A;  1UMI A;  2E32 A;  2RM2 3;  2ZAC A;  3MIB A;  1GP6 A;  1PMJ X;  2ARB A;  4Q0Q A;  5FYT A;  4XUR A;  2C4X A;  3QH7 A;  5FK8 A;  3WDT A;  2HEW F;  1WLT A;  1EUT A;  3ZFF B;  3WUC A;  5ABJ C;  3H3L A;  1V6M A;  3B93 A;  5FLI A;  1HV0 A;  3HBK A;  3VB9 A;  1W6Q A;  4AI3 A;  3WY6 A;  4WVV A;  1V0A A;  4DXS A;  1O4Z A;  5KWR A;  2FD8 A;  1QOO A;  3USU B;  2R07 3;  3OUJ A;  3IPV A;  1NY7 2;  1RUD 2;  1SQ4 A;  2PYT A;  3JD7 2;  1LOF C;  5EIY B;  2FDF A;  4LEJ A;  1G9A A;  2Q8D A;  3MIE A;  4MYE A;  1S2K A;  1I9R A;  3I59 B;  3KS7 A;  3NNM A;  4ZU4 A;  1LKN A;  1G86 A;  4XPV A;  5LRR A;  1BBT 2;  1HXS 1;  3APB A;  4JKK A;  5A33 A;  1GZC A;  3OBR A;  2ZGQ A;  4AGR A;  2XHK A;  1X8M A;  3HBZ A;  5CFD A;  5FZM A;  2WWS A;  3O14 A;  4I30 A;  4IE0 A;  4LIU A;  4XTM A;  5DAP A;  4TYS A;  1STM A;  2YDE A;  3J8F 2;  4EN0 A;  5A6X A;  2VMF A;  3PVO A;  3VBS C;  1PIV 2;  3MFC A;  3VL8 A;  4XFC A;  3WQB A;  1MAC A;  4GZ9 A;  1W6M B;  4X8N A;  1F2N A;  1CZV A;  1FMD 1;  1FT9 A;  1GUI A;  3ACL A;  4URA A;  2PLV 2;  1WA6 X;  1FOD 2;  4HSJ A;  3GYD A;  4XFH A;  1GOH A;  2MEV 1;  4R9C A;  2FDK A;  4CDQ C;  1O4Y A;  1QKQ A;  5D8A B;  2Y0I A;  3IAQ A;  4WVZ A;  3ZSK A;  1NCQ B;  3GZE A;  3ZYR A;  4QMA A;  2Q1Z B;  1FNZ A;  2HKX A;  2RG4 A;  2ZS6 B;  3S30 A;  4DZG A;  2W5F A;  3VBO A;  2BGO A;  4Y4R A;  1RIN A;  3D8C A;  3VD9 A;  4PF1 A;  1JN2 P;  5L7O A;  4NIG A;  1K45 A;  5E6H A;  4PLM A;  5BNN B;  4MV2 A;  3EBR A;  3JBG 2;  1XE8 A;  2NM1 A;  1NKG A;  3PJQ A;  2Q30 A;  2WN2 A;  3MZH A;  1PIV 1;  4AWD A;  3VDD C;  2VY0 A;  3AP9 A;  2CU5 A;  2VCC A;  3VBH A;  3ZXJ A;  5J48 A;  1RUF 1;  4K6B A;  1YQ8 A;  2MHF A;  5C4W A;  3WP5 A;  2JG8 A;  3VD7 A;  2B46 X;  1LGN A;  1W8O A;  2D44 A;  2XQX A;  2PXJ A;  4K8R B;  3ZMO A;  4QKF A;  5CFC A;  4QPY A;  1EAH 3;  2HWD 3;  5FZO B;  1OLQ A;  3I2I A;  5BNN A;  3ZYF A;  3TWI A;  5L7O B;  1ZA7 A;  2K0G A;  1JYN A;  1R1A 2;  1G7Y A;  4JGY C;  2HBU A;  4W4Z A;  4YLZ A;  5CIR A;  1O5U A;  4TLG A;  4XJZ A;  3AMM A;  3OCP A;  3ETQ A;  4M0H A;  2ZGL A;  5KHJ A;  2XPJ A;  1RUC 3;  3EYP A;  3J26 N;  1RUH 3;  1LAJ A;  4UF0 A;  4LBJ A;  3THD A;  5K0U B;  4LHL A;  1VAM A;  1WLD A;  2V72 A;  4TXW A;  1YUD A;  3IDA A;  5JCT A;  1H2K A;  1ND2 B;  2H6B A;  5CFC B;  5JSP A;  2WAB A;  1APN A;  1D2Q A;  1VBA 1;  4OHV A;  3C8X A;  2HLE A;  2VUD A;  3M3C A;  1U12 A;  1GOG A;  5DQ0 A;  1Q5O A;  4YPJ A;  2OYZ A;  2DUQ A;  4AED C;  4BQX A;  3VZO A;  1NCR A;  5KHG A;  2BWA A;  4AI2 A;  4I09 A;  1WLC A;  1W8W A;  2IC1 A;  2WWJ A;  2XG3 A;  4N53 A;  3JXS A;  4GMP 0;  4SBV A;  4KL1 A;  4CU6 A;  2E51 A;  3VBR B;  1DGW A;  4XZP A;  4YSF A;  5IK7 A;  1LU1 A;  1X82 A;  2V5D A;  3G7D A;  3OBT A;  4MX3 A;  1RHI 2;  3POG A;  3UET A;  4A3Z A;  4D7S A;  3GBW A;  4BIS A;  5ACA 1;  2ZGK A;  3LA7 A;  3S57 A;  1C57 A;  4H2A A;  2V4V A;  1J58 A;  2I2S A;  1RUH 1;  3ITQ A;  2WO2 A;  4B7E A;  1BBT 1;  1HXS 2;  2J1T A;  3D6E A;  1WLW A;  3J7H A;  4WM7 C;  2VZS A;  5HCF A;  4UFJ A;  1ZVF A;  2A70 A;  1H0B A;  2BYV E;  4D94 A;  4BQ5 A;  2W46 A;  3UKV A;  5FPU A;  4OUE A;  1W99 A;  3U11 A;  2FCU A;  1MQT A;  1DGL A;  3ACI A;  4E4Z A;  3RVH A;  5BNP C;  4OMD A;  2QQP A;  4QQH A;  1ZRC A;  3AFG A;  3UGG A;  1JYC A;  2VZP A;  3PDQ A;  1ND2 C;  3POW A;  1XNC A;  4DFS A;  3POB A;  1GWK A;  5H9S A;  1QJF A;  1Z7S 1;  4UW3 A;  2AR6 A;  1D4M 3;  5FCC A;  4CU8 A;  1WD3 A;  2WDB A;  2AEZ A;  1F15 A;  1QJU 1;  3SH3 A;  1ULE A;  3CJI B;  4ZS2 A;  1Y9M A;  2BNO A;  4FFI A;  5FZG A;  3GHM A;  3I3D A;  3SCG A;  2WSU A;  4AE2 A;  4QKN A;  3W58 A;  1HB2 A;  2GC2 A;  1H6X A;  1X9P A;  2QQV A;  1NT0 A;  4Y22 A;  3NJY A;  5DUU A;  2H0V A;  1O8S A;  1QNY A;  5BYN A;  4FP2 A;  4W65 A;  2LRO A;  1UN1 A;  4A7Z A;  3NVC A;  1SFY A;  1QMJ A;  2EAL A;  2QQU A;  2QCS B;  5HPO A;  4FCA A;  1A8M A;  1L3J A;  2ZX1 A;  4GB3 2;  3ZOI A;  5FPL A;  2Q5T A;  4IEX A;  4YGD A;  4YZ5 A;  1HIX A;  4NPM A;  3VGI A;  3EXU A;  2QQL A;  1WME A;  4QD2 A;  1QJX 3;  4NJ4 A;  4IUG A;  4CEY C;  1WCD J;  4Y24 A;  4AFA A;  1LB2 A;  3GM8 A;  4Q4V 3;  5FZK A;  2JEC A;  3F95 A;  3AK0 A;  4QX5 A;  4N90 A;  1TME 3;  2GH8 A;  3MIG A;  2VBB A;  3TEW A;  2YGL A;  4NHM A;  4NRO A;  5ABJ B;  3ETP A;  4K20 A;  3LWC A;  1B35 A;  1FMD 3;  3E97 A;  4COV A;  4CU9 A;  2BBA A;  5I0S A;  4XET A;  4PF5 A;  5JZG A;  2XJP A;  4AHX A;  4BME A;  1URX A;  4A41 A;  1KQR A;  4BH9 A;  4WVM A;  2IXC A;  3H3U A;  4LK6 A;  2ZEZ A;  3TRS B;  3NQH A;  4O9E A;  1ENX A;  1D0G A;  4OUS A;  4CZS A;  1NLQ A;  2Q4S A;  4DNY A;  1RUO A;  3HN3 A;  1MEC 1;  3B69 A;  4E4D X;  1JXN A;  2WQZ C;  5KHK A;  1W0O A;  5T5J A;  2IVJ A;  2J1E A;  2R6Q A;  2JXA A;  4DS0 A;  1PNG A;  4Q8L A;  5LK5 A;  2ILM A;  4B1L A;  5K8S A;  3NJX A;  3R0R A;  3C7G A;  5JOY A;  5FP7 A;  5FY7 A;  1SLL A;  3EO6 A;  1GKB A;  5FZB A;  4NIH A;  2CGO A;  3ALQ A;  2WAO A;  1QJZ A;  1LGB A;  3P3N A;  2D43 A;  1Y43 B;  5C5T A;  1P8J A;  4CEY A;  1LHW A;  5FYC A;  4NRM A;  5D21 A;  4COY A;  1WUV A;  3ON7 A;  4BOW A;  3T1M A;  3JU9 A;  5FXV A;  3HMY A;  1LED A;  1NQD A;  1W0P A;  1O3Q A;  1BK0 A;  4GJZ A;  4RD7 A;  3WHT A;  4YVS B;  4XMA A;  4BIF A;  3OPZ A;  4DEQ A;  5AC9 3;  1VIW B;  3LSE A;  3OYW B;  2DUP A;  4ASL A;  1WA4 A;  4JGY A;  2ZXQ A;  1NLR A;  3WNP A;  2OXB A;  4TSV A;  5FLH A;  3DKQ A;  2XJR A;  1RUD 3;  5LCW L;  4Z82 A;  3WCS A;  3UES A;  1XNB A;  3KM5 A;  2B4K A;  4PDW A;  4XBL A;  3U37 A;  3AXD A;  3FWE A;  4XUO A;  1LHN A;  2GU9 A;  2VG9 A;  4Q8K A;  3RPQ A;  1DG6 A;  4DPN A;  5CG9 A;  1UXZ A;  2GH2 A;  3HNY M;  5T54 A;  1ZNP A;  5CNA A;  4FTB A;  5FPA A;  1DFQ A;  3FZ3 A;  5EYY A;  4CDX A;  3PU8 A;  3NMB A;  5LBF A;  3LA3 A;  5LK7 B;  3PIJ A;  3WD5 A;  1PVX A;  4BQ2 A;  2ZX4 A;  4PJY A;  3KVA A;  4AYU A;  3Q8E A;  3K48 A;  1OQE A;  5FRA A;  1SLT A;  1QJU 2;  1OH4 A;  2CDP A;  1S55 A;  3MIF A;  3E6B A;  1HRI 2;  4EJR A;  1SMV A;  1JI6 A;  1RMU 3;  1W8Z A;  1EYB A;  1VJ2 A;  4NMI A;  2ZOE B;  3T3Y A;  4P9W A;  4G9S B;  4XJ8 A;  3EJK A;  1AZD A;  4M3C A;  1W6O A;  2ZHN A;  3WOG A;  1FNY A;  1SCS A;  4CCK A;  4ZKT B;  1KJR A;  4PIY A;  5L9V A;  1H8T A;  3OPW A;  4W6X A;  4ATE A;  1MS3 A;  1HQL A;  2ORZ A;  2OW4 A;  4IEW A;  3GCW A;  2A7A A;  2WYS A;  1LCL A;  1XU1 A;  3N9Q A;  3MV1 1;  2VO5 A;  2XKP A;  5FMD A;  5DMY A;  3T4V A;  1TVG A;  5K4L A;  5CFD C;  1AR7 1;  4LKD A;  5DG2 A;  4AI9 A;  1ZA4 A;  2RS1 1;  3SKV A;  4UWD A;  2HWF 1;  1GQP A;  2VUJ A;  5KXB A;  4LE4 A;  1LUL A;  3WCR A;  4MLO A;  1KS5 A;  4Q26 A;  1RMU 2;  1UZV A;  2VBD A;  5CKQ A;  5FYB A;  3ZSE A;  1HRI 3;  5A3M A;  1O8P A;  2XJV A;  1XXN A;  4CA9 A;  5FOJ B;  1W39 A;  5C33 A;  2LS6 A;  2N7G A;  1H1M A;  2D6N A;  1QJY 3;  1UKG A;  2DTW A;  2WNV B;  5ERL A;  5A7W B;  3N9M A;  4RA0 A;  1G9D A;  3POI A;  2CYF A;  3GJB A;  4UW6 A;  5A1L A;  2ET7 A;  4M3C E;  1J3R A;  1KXG A;  1YEW A;  5C8C C;  4CP9 A;  4WZF A;  3HQU A;  1MS5 A;  2D97 A;  3HEI A;  1RUI 2;  2Y6L A;  1ULC A;  4B29 A;  1UY0 A;  1UX7 A;  3LD8 A;  1PO2 2;  1DGR A;  1Q8Q A;  2QZ2 A;  1WW5 A;  3PJY A;  4JVA A;  1Y3T A;  4LK7 A;  2VZV A;  1W2T A;  1YFU A;  4NAO A;  4OZX A;  5HV4 A;  3J9S A;  3PUI A;  5KHI A;  2J1S A;  5CAD A;  2YGM A;  3ZFE A;  4FFG A;  3GDB A;  2XVL A;  3PTR B;  5FR3 A;  1X33 A;  2AEY A;  2XQR A;  5FZL A;  5T50 A;  1SLA A;  2P37 A;  2ZMK A;  5B4X A;  4O61 A;  1OPO A;  4CP2 A;  3AKP A;  4F3J A;  5JMO A;  4CXW A;  1RIT A;  1EPW A;  1UZZ A;  4CUA A;  4LOS A;  2VUC A;  1VBB 2;  3IZO A;  1REF A;  3ZYG A;  4MGI E;  1YO8 A;  3ZN5 A;  3WQ0 A;  3TN9 3;  3CKH A;  2DF7 A;  2UU8 A;  2WFF 1;  2EF6 A;  4JTN A;  4YM1 A;  3TNP B;  5F7U A;  4NHX A;  2R06 1;  5E89 A;  5JZG C;  4EWD A;  1DLC A;  4IV1 B;  4XFG A;  1OF4 A;  4IW3 A;  4P9G A;  4BLJ A;  4UBH A;  1OLR A;  1BJQ A;  3Q8F A;  3SEE A;  4YVW C;  3ATG A;  5C3O A;  5FYV A;  3OB8 A;  1YIF A;  2WT1 A;  1S2B A;  4LUL A;  1V9U 2;  4CDU B;  1OKQ A;  2VVE A;  4IE6 A;  2ZAH A;  1HX6 A;  1L7L A;  1RUG 1;  5SV5 A;  4CDQ B;  1RUH 2;  1EY2 A;  3NAP C;  4Q4W 3;  2VOW A;  3BTA A;  3H8X A;  5HXM A;  1UYP A;  2OPW A;  1F5J A;  2YG0 A;  2Y6K A;  4LPL A;  4D3W A;  1YFW A;  2XUM A;  1LOB A;  2BUK A;  5GLZ A;  4QPG C;  2IXH A;  3UL2 A;  2XBO 2;  1PO2 3;  2VVD A;  3III A;  4JHT A;  4CPB D;  3KGZ A;  1TMF 2;  4BZ4 A;  3Q9O A;  2P5B A;  1JUI A;  3B01 A;  4PQ9 A;  3J4U H;  5JI7 A;  5JUV A;  3U4X A;  4FI9 A;  3AYA A;  3Q8B A;  2D6P A;  2AH2 A;  1H1I A;  2BRT A;  3RSJ A;  3MBW A;  5FYI A;  3HT1 A;  3BTZ A;  3LDR A;  2P17 A;  1DP0 A;  2JB4 A;  2QTW B;  5ABJ A;  5FO7 B;  5DUV A;  1LRH A;  3HPN A;  4AAX A;  2I07 B;  4XAC A;  1MZF A;  1X8E A;  3A0N A;  3NJZ A;  3SXW A;  3T0B A;  1ONA A;  5A1F A;  3FHA A;  4H55 A;  3RZH A;  5IFP A;  4NPR A;  1XYN A;  1R08 3;  3J8F 1;  1EAH 1;  2HWD 1;  2PQQ A;  1R08 2;  3MW3 A;  4QQO A;  3J7M A;  3T09 A;  5K9Y A;  5C8C A;  3HWJ A;  3IIA A;  3P1I A;  3O1S A;  1PGL 2;  2A3W A;  2V5Y A;  3HQR A;  1RUJ 2;  2CWM A;  5BNO B;  5FWE A;  2VW0 A;  3NRU A;  4PIZ A;  5CVR A;  5JIA A;  4K3U A;  3VD4 A;  4IE7 A;  2P2K A;  1RB8 G;  4JQT A;  2WZE A;  3WQ1 A;  5A33 B;  2VE1 A;  1JYX A;  4TN7 A;  1NX9 A;  1Z0H A;  2XHN A;  5GJ6 A;  4XBQ A;  2LUW A;  2W87 A;  4Z2W A;  4K40 A;  5CIS A;  1PM7 A;  3B7M A;  2XLF A;  1IQD C;  2AC1 A;  3AB0 A;  3PL0 A;  4W6W A;  1RUG 3;  3VL9 A;  3K3O A;  3RYK A;  1TMF 3;  3JB4 C;  2HWF 3;  2VNO A;  3URF A;  4Q4X 1;  3SEP A;  4AQS A;  4P02 B;  4J1X A;  4YFZ A;  5AC9 2;  3F2Z A;  4YZ3 A;  4F8A A;  1MEC 3;  4HKL A;  1VBB 1;  1RUF 3;  1VPH A;  2R0F A;  1ND3 C;  3MIC A;  1LTE A;  3UJO A;  3ZMN A;  5BNO A;  3BTX A;  1WCU A;  3BCW A;  4QPI C;  3LE0 A;  4QX1 A;  5T5L A;  2KA3 A;  4XIL A;  3VBS B;  4I3P A;  4BQ1 A;  4MSV A;  4AEK A;  5C8C B;  1CN1 A;  1NZC A;  2GMM A;  2HEY F;  1NA1 A;  3HVD A;  1D4M 2;  1I5P A;  1S0G A;  1ZZ9 A;  3K4Z A;  2B45 X;  3PVE A;  3WDV A;  1ALY A;  1OLM E;  4XHX A;  2WLP A;  3S0M A;  2RMU 3;  4XTP A;  4XQW A;  4Q27 A;  2OQ6 A;  5CB7 A;  3T2O A;  2JD4 A;  4GH4 C;  1WMX A;  2E63 A;  2Y60 A;  4D69 A;  5BNN C;  1LU2 A;  3FFQ A;  1H4G A;  1EP0 A;  2JDK A;  3INA A;  3GHN A;  5ANQ A;  3CJX A;  2JG8 C;  3H1M A;  2G4I A;  5CBL A;  5FLJ A;  2WAA A;  3OD4 A;  4XUN A;  1IPJ A;  2P3J A;  5LBB A;  1ACC A;  3KCC A;  2GZW A;  3VBH B;  4GMP 3;  1BMV 2;  2ARX A;  1SLB A;  2ZTN A;  3OEA A;  1RUC 2;  4JV4 A;  3ZX7 A;  4MAD A;  3UGH A;  1N3O A;  1OT5 A;  1QH7 A;  3B3Q E;  1Y7B A;  4M4P A;  1LES A;  1SBD A;  4KMQ A;  1W3V A;  3WDY A;  1JYI A;  2R04 3;  4AQ2 A;  2XJU A;  5L19 A;  1QXR A;  2XGX A;  4UW5 A;  3VBO C;  3CNA A;  3E6D A;  5J7M A;  2W1W A;  4EN9 B;  3IAP A;  5FP3 A;  3UK9 A;  1YJL A;  4N9H A;  3UGF A;  1T2X A;  3FHQ A;  4NAM A;  3K46 A;  1SDW A;  4CEW C;  3LPF A;  3H8R A;  4DRV A;  3JQX A;  2B8M A;  3VBU A;  5LA0 A;  2OVU A;  2DVA A;  5JPN B;  4COW A;  1GZW B;  3KMH A;  1AJK A;  1OPM A;  1OQD A;  2RE9 A;  5DAQ A;  3N9N A;  2E9Q A;  5AFB A;  3OOX A;  1S4C A;  4MET A;  2MNG A;  3ZIX A;  4AXO A;  5KHH A;  4A7K A;  4N53 B;  5FPX A;  4BM8 A;  1DCS A;  2BGP A;  2ZGS A;  2DCK A;  3HOB A;  3MPB A;  3AKS A;  5FZ3 A;  2PQS A;  4CCJ A;  4OHY A;  4L11 A;  1GZW A;  1L7R A;  1H2L A;  3VBU B;  3POS A;  4DIN B;  3AP4 A;  4D0Q A;  3LZZ A;  2E7A A;  3EMR A;  5F3G A;  2R06 2;  4C0H A;  2WN3 A;  1ZRR A;  4AEM A;  4J1W A;  2VMD A;  5FP4 A;  1UCX A;  4G4F A;  1JOD A;  2WYF A;  4LA3 A;  1UZW A;  1QQP 3;  4Y26 A;  5CA6 A;  1ULO A;  5IAV A;  3IWZ A;  4A7Y A;  4B4P A;  2GME A;  3PVB B;  4P08 A;  3NV2 A;  5A3W A;  3JBG 3;  2W95 A;  3OD0 A;  4QU1 A;  4AHW A;  5KR7 A;  3IBM A;  4WV8 A;  1QJY 1;  1OBN A;  2R1B A;  2VOX A;  2HWF 2;  2HWC 2;  3I2F A;  1CR7 A;  5EFU A;  3VHN A;  1FI2 A;  1LHU A;  1XBF A;  4CUC A;  2VMH A;  2QE3 A;  1POV 0;  2WO3 A;  3AKR A;  5A7W A;  1G9C A;  4OVE A;  4RHV 2;  2J1V A;  5DXD A;  1IS5 A;  1HQW A;  1UU5 A;  5FZ7 A;  2ARA A;  1ST8 A;  1NQJ A;  1AX1 A;  4WM8 A;  1AXZ A;  5FXZ A;  3Q8C A;  4IV3 C;  2FBE A;  3CIH A;  4FFF A;  4Q4Y 1;  4ZS3 A;  3OY8 A;  3WG1 A;  5C70 A;  1AX0 A;  3L9J T;  1DYO A;  1UY1 A;  3KV5 A;  1XOY A;  3ZPY A;  4DXT A;  2XJT A;  5FY0 A;  3PUR A;  2ZGN A;  4BXS V;  3AVR A;  3C7E A;  3H50 A;  2AZ5 A;  3MO4 A;  5D2A A;  4LBN A;  2LM3 A;  1H2N A;  2WFF 3;  2XJQ A;  1XB9 A;  5A7Q A;  4YZ2 A;  4M0N A;  1VAL A;  2HBT A;  3AFK A;  4XYX A;  3WLU A;  1NCQ A;  3FLT A;  3DF0 A;  4CSW A;  1RYY A;  2ZX3 A;  1DQ6 A;  2ERF A;  1YQ5 A;  2VQT A;  5A3T A;  1GOF A;  2WT2 A;  2XUE A;  1LOA A;  3LF7 A;  3LOI A;  5LEK A;  5J1X A;  1JOP A;  1H8V A;  4YG0 A;  5FZC A;  2JG9 A;  2OUH A;  2X10 A;  1J1T A;  5DDJ 2;  3UJQ A;  2QDR A;  4YVS C;  5J09 A;  3MID A;  1VMH A;  2CAV A;  2YC4 A;  4Y3O A;  2DWR A;  2ZEW A;  3FX3 A;  1YI9 A;  2C0Z A;  1OUR A;  3DYO A;  1L7Q A;  4BLI A;  1JW6 A;  2A73 B;  1YNA A;  4KWU A;  3GNE A;  3WG2 A;  1REE A;  5FUP A;  3WW1 A;  3PIG A;  4O7X A;  2Y6G A;  4FTS A;  1DYK A;  3TAY A;  2EIG A;  4AGG A;  4Y1X A;  5IWF A;  4OHW A;  4A45 A;  1JU4 A;  1C8M 1;  3AYD A;  4HN1 A;  1Q8S A;  3WNX A;  2NZ9 A;  1AYN 3;  1NXM A;  4DRR A;  1AR8 3;  1Q8O A;  1SEF A;  2CNA A;  4OFG A;  4DQA A;  3GGL A;  4LO7 A;  2WRA A;  4DUW A;  1COV 3;  1XC6 A;  2CY6 A;  4GMP 1;  3BYW A;  3VKO A;  5FY8 A;  2WSV A;  2JB8 A;  1HJF A;  3HNB M;  2WNU A;  4Q29 A;  4AOC A;  2VD7 A;  4GQ7 A;  4JRA A;  1NAE A;  5BPX A;  3THP A;  1WGP A;  2ZAB A;  3K4A A;  1RJ7 A;  1RVF 1;  4XMI A;  4I0W B;  2ZEX A;  4ATF A;  2EA7 A;  1W0N A;  3VZN A;  4K1Z A;  1GQG A;  3BIW E;  5T5P A;  3BPZ A;  4BXF A;  2FMD A;  4CP1 A;  4DEV A;  5ISL A;  3SNM A;  2Y34 A;  4QDR A;  1IPS A;  2JG9 C;  2VBP A;  1PX3 A;  4GXL A;  5IUQ A;  3SKJ E;  5BNO C;  3M3O A;  4FXG B;  1DQ2 A;  3T0D A;  4LOR A;  2DUR A;  4RQP C;  1HB4 A;  4LOT A;  4SLI A;  1S0I A;  2E6V A;  5JPM B;  4Y1Y A;  3NJV A;  1RTV A;  5IJR A;  2PEL A;  3W5N A;  1QEX A;  3AYC A;  3D0S A;  4LT5 A;  1KRI A;  1QQP 1;  1AL2 2;  2CDO A;  1KFU L;  1BVV A;  1WMD A;  4ARX A;  1CGP A;  1RUN A;  3BOW A;  4MZU A;  4E2S A;  1AHS A;  1C1L A;  3TEY A;  1D0H A;  4RS5 B;  5FY1 A;  2BNM A;  2FMY A;  1S0D A;  2JJ6 A;  1SBF A;  1DQ5 A;  1S2E A;  3A22 A;  4NII A;  5EQU A;  4B4Q A;  4EYU A;  1LOD A;  1YFY A;  2GNB A;  1CPN A;  2VTX A;  3M2M A;  3EQE A;  1DU3 D;  3OUH A;  5A70 A;  1JYV A;  2X09 A;  1MZ5 A;  1V6K A;  1AUY A;  2DVF A;  2EIB A;  2D7F A;  2YC2 A;  4O9G A;  2ZKN A;  3AL5 A;  5FZ0 A;  2D40 A;  5CU1 A;  4HSL A;  5F1R A;  4Q4Y 2;  5FBZ A;  3LFI A;  3ZYJ B;  3AP6 A;  3RZJ A;  2VGD A;  2ZMN A;  1UKR A;  1NUK A;  1W2N A;  2HWC 3;  2DFC A;  1ZZ7 A;  2PHU A;  3ZYB A;  1GIC A;  4QXH A;  4CCM A;  3MUZ 1;  4L92 A;  3ZM8 A;  2A6W A;  4ZHN A;  3A4U A;  2GP3 A;  2G9F A;  3L2Y A;  1AYM 3;  1GSL A;  1JTZ X;  1OVS A;  2VZO A;  2VPV A;  1XYO A;  4N7I A;  3RZK A;  3E6C C;  2RDN A;  5IK4 A;  4MH0 E;  2WQ4 A;  5JXI A;  1GP4 A;  3N9L A;  3E5U A;  4QQL A;  2RV9 A;  3C7O A;  2Y33 A;  3ES4 A;  5F6K A;  4B4R A;  1KS4 A;  4JKM A;  4CU7 A;  1QY4 A;  4IV1 C;  1RUE 1;  3LIG A;  2G1M A;  4AGV A;  4E27 A;  1RGS A;  5CEH A;  4IGP A;  3BIE A;  1W03 A;  1PVC 2;  2XKO A;  3AMQ A;  2W91 A;  4CP9 B;  4CTE A;  3SIT A;  4C1X A;  5FQ0 A;  2QNK A;  4UYB A;  3MI8 A;  3WF1 A;  1AF9 A;  4P9J A;  1XU2 A;  4Q4X 3;  1DGR N;  2BOJ A;  3BB6 A;  1GWM A;  3M4F A;  1S0J A;  3N7M A;  3CDZ B;  2XOM A;  4UFM A;  4XUQ A;  2OZJ A;  5LWB A;  1W28 A;  1AR8 1;  5LBC A;  5IVY A;  1HRV 1;  1ZBE 2;  5L73 A;  3JZV A;  2VZU A;  4FPH A;  5C9A A;  1RIR A;  1NYW A;  3W9A A;  1V9U 1;  2RS5 1;  3RMY A;  3CJI C;  2K9Z A;  3MFA A;  3IDE A;  3LOB A;  2D5H A;  4OHX A;  3ZLI A;  4YM2 A;  1HKD A;  1H4H A;  2GC1 A;  1W8T A;  1K5M A;  1OH3 A;  3CHX A;  3M3Q A;  4HFS A;  1NG0 A;  4FPJ A;  3FBM A;  4LBO A;  2VAU A;  2TNF A;  5BNQ A;  4BYY A;  3I4I A;  2QVS B;  4IEV A;  3VHO A;  4ZXK A;  5IVC A;  4FOQ A;  1PK6 B;  1MVE A;  3OY8 B;  4OI2 A;  4WM8 B;  1TMF 1;  4YW1 A;  4DIQ A;  4MO3 M;  2AYH A;  4MGK E;  5IVF A;  2YMZ A;  4Z8B A;  5FMO L;  2HWB 2;  3AXE A;  4XIK A;  5DZE A;  3AZV A;  2D98 A;  1AJO A;  4AI8 A;  1AYN 1;  4EN6 B;  3AZX A;  1V6L A;  3ILR A;  3VHR A;  1N1T A;  1EV1 1;  1PMH X;  5GKA C;  3FMG A;  4QQ2 A;  2RDS A;  4M01 A;  4A3X A;  4YZ1 A;  4DY3 A;  2R04 2;  3H1W A;  2VZR A;  4FFH A;  5HCA A;  4C8D A;  3OGG A;  4NWW A;  4D7Y A;  4YWA A;  4GIQ A;  3N9O A;  2VCA A;  1QWR A;  2EAK A;  2ZZJ A;  3NV1 A;  3QBQ A;  3WG3 A;  4RR3 B;  3DV8 A;  2D6K A;  3I3E A;  5LAS A;  1VBC 3;  4XDQ A;  3DL3 A;  4GKX A;  3AYE A;  3RWN A;  3ZSJ A;  1RHI 1;  3RZZ A;  1PO2 1;  2YZ4 A;  4FT8 A;  4QWN A;  1CAU A;  4PLO A;  3FN9 A;  4YW5 A;  5HBA A;  2HWB 1;  5GLT A;  2VZ1 A;  4OMC A;  3VZL A;  1BBT 3;  4NHY A;  2RMU 1;  2A6X A;  4QM8 A;  1YYN A;  3MV0 1;  3OPT A;  3VHP A;  2RR1 3;  2VQU A;  2WKK A;  1Z7S 2;  4XJ9 A;  2XLG A;  2VNG A;  3D82 A;  4NUB A;  2ZHM A;  4LA2 A;  3I8T A;  4M4R A;  5JXG A;  1VLN A;  5F5A A;  2J1R A;  2ZA9 A;  4HT1 T;  1XE7 A;  3WDW A;  3BU0 A;  5KXC A;  3VZJ A;  4QXK A;  2W39 A;  2WNV C;  4PQQ A;  3X29 B;  3I3M A;  3ACG A;  3KV6 A;  5D1I A;  4I3G A;  1IS3 A;  3I97 A;  2HWE 3;  3SH4 A;  4Y4Y A;  2VEC A;  4V1P A;  5GM0 A;  4KBB A;  4K8F A;  4YGE A;  1BKZ A;  4JAA A;  3MGU A;  3NNJ A;  4OCT A;  4CDX C;  5BNP A;  5JAX A;  2VMC A;  2RR1 1;  4RQP B;  1E5I A;  2PAE A;  4HMZ A;  2WNU C;  3OGV A;  1RUG 2;  2RS1 3;  5JXJ A;  2RS5 2;  3I2H A;  3ES1 A;  4Q4X 2;  2AGS A;  1LNS A;  1WKY A;  2JG8 B;  4UOJ A;  2X53 S;  5F5I A;  3RG0 A;  5C4W B;  1K3I A;  3FL7 A;  4LIV A;  4NR1 A;  4CPB A;  5B2G B;  3LB9 A;  3ZXE A;  2A1X A;  5EV7 A;  1S0E A;  3O0W A;  1YXW A;  1S0F A;  1RXF A;  2R06 3;  1W04 A;  3CL1 A;  3NO8 A;  1ULF A;  2A6Y A;  4QB6 A;  3TYJ A;  2DU1 A;  5I0T A;  5FXX A;  2WNE A;  4EN7 B;  1M06 G;  1C8M 3;  2QBX A;  1N1Y A;  1UY3 A;  3PUS A;  5FV3 A;  1FXZ A;  1AXK A;  4QPG A;  2QJV A;  2D93 A;  1VMF A;  5J98 B;  2VUA A;  4P9Y A;  5C3R A;  1QJY 2;  4AZZ A;  1BVP 1;  1UMH A;  2GN7 A;  1UY2 A;  1FV2 A;  1CJD A;  4CCE A;  5ACA 2;  5JI9 A;  1MVQ A;  4LJH A;  4S2G A;  4D7T A;  3UNP A;  1LEN A;  2PHL A;  4PIX A;  3IDB B;  4ES9 A;  2R7E B;  1CAW B;  4HPK B;  2ARE A;  1W8U A;  3BKZ A;  3J7N A;  1GQH A;  1BEV 2;  4ARY A;  4HG6 B;  4JDO A;  3MF6 A;  1VMJ A;  5LY1 A;  1WZX A;  2W52 A;  3NAP B;  4YVW A;  2HWE 2;  4XUT A;  3AMH A;  3B02 A;  1JYW A;  5JWP A;  1HRV 3;  4BQY A;  2Y0O A;  3NNG A;  4WBB A;  1SLC A;  2GAU A;  3I2O A;  3P6B A;  1SG3 A;  2JE7 A;  2X8K A;  5A3O A;  4H3W A;  5C3P A;  1PGL 1;  1RVF 2;  4OQ8 A;  3AKQ A;  5EZW A;  3B00 A;  4YW2 A;  3A23 A;  5A32 B;  3I59 A;  1XRU A;  3A0K A;  3LEM A;  2EIE A;  4LBQ D;  4UAP A;  3ZYH A;  2OS2 A;  2RS5 3;  1JZ5 A;  2MEV 3;  2R49 A;  4OI1 A;  1F5F A;  5CZK A;  2YU2 A;  4LHK A;  3SQO A;  4I02 A;  3VDD A;  3WHU A;  4Y5Z 0;  4Q0S A;  3BOP A;  1Q3E A;  1TME 1;  1W6Q B;  3WW3 A;  3DYM A;  1RUE 2;  5HCB A;  5L9B A;  3HNM A;  4HOO A;  2VZQ A;  1JHN A;  5L36 A;  2A6Z A;  1JS9 A;  3HD8 B;  1C5I A;  4LO5 B;  2J1A A;  3B5L B;  1YC6 1;  1OHF A;  5K0U C;  4ES8 A;  2JIG A;  4HK8 A;  4C91 A;  2RVA A;  5JSR A;  4H7L A;  1MS1 A;  5DAV A;  4BQ4 A;  3H7Y A;  5E16 A;  1WBL A;  1W8N A;  4LKE A;  3DN7 A;  3NST A;  1AR6 1;  1U5Z A;  3CZJ A;  4OLL A;  4A2U A;  2ARC A;  1PGW 2;  3WNK A;  3LPG A;  1GYK A;  1OFS A;  2BOI A;  1FX5 A;  1K5J A;  1AYM 1;  2ZJC A;  3OBA A;  2HWC 1;  3KF5 A;  4LO4 B;  4P5Y A;  5H9Q A;  1QJE A;  3K2O A;  3QAC A;  2UYA A;  3AP5 A;  4AI0 A;  1PZ8 A;  3ENR A;  1UD1 A;  5EHD A;  5GZC A;  4N7U A;  2JX9 A;  2QKD A;  3ZKY A;  3ZXK A;  2JDN A;  2QQO A;  1DLL A;  4TZD A;  5LAT A;  3KCX A;  3E5Q A;  1YRZ A;  2RJ2 A;  4UI9 L;  4LUM A;  4RSU A;  2YBS A;  5FMB A; 
#chains in the Genus database with same CATH homology
 2QQK A;  4MAD A;  5IFT A;  1GNY A;  1OT5 A;  3WF3 A;  5G05 L;  4M4P A;  1JZ8 A;  1W9S A;  2W94 A;  4KMQ A;  2VMF A;  3LEK A;  3WQB A;  2QQN A;  4GZ9 A;  1GUI A;  1CZV A;  2X05 A;  2W1W A;  2VR4 A;  1GOH A;  1JZ7 A;  3IAP A;  3IAQ A;  1T2X A;  3FHQ A;  3K46 A;  4RN5 A;  4E8C A;  3WNN A;  2LW8 A;  3LPF A;  2W5F A;  4LKS A;  2BGO A;  1TG7 A;  2JKX A;  5LA0 A;  3VD9 A;  3AC0 A;  1JZ3 A;  5B4N A;  4PF1 A;  1K45 A;  2Y8K A;  4A44 A;  1NKG A;  1EUU A;  2WN2 A;  2BGP A;  3HOB A;  2DCK A;  2VCC A;  2E33 A;  4BK4 A;  1JZ2 A;  2PQS A;  1MPX A;  2E31 A;  1L7R A;  1UYY A;  3VD7 A;  2XQX A;  1W8O A;  3ABZ A;  1JHJ A;  2VJX A;  4QX0 A;  3I2I A;  4D0Q A;  2ORX A;  2WN3 A;  1JYN A;  2YFZ A;  1PX4 A;  1GMM A;  2W47 A;  4W4Z A;  2VMD A;  1F4H A;  1ULO A;  1OD3 A;  1UYX A;  4P08 A;  2W95 A;  3EYP A;  2QQJ A;  4AG4 A;  3THD A;  2Y6H A;  1WCQ A;  3I2F A;  2V72 A;  4TXW A;  3IDA A;  2W3J A;  2VL4 A;  4CUC A;  2WAB A;  3C8X A;  2HLE A;  2WO3 A;  5DQ0 A;  4YPJ A;  1GOG A;  2W1U A;  2BZD A;  3I2K A;  2J1V A;  3WSO A;  2VME A;  5A1A A;  1W9T A;  2WO1 A;  4GWI A;  3JXS A;  4CU6 A;  3CIH A;  5C70 A;  3DYP A;  1DYO A;  2V5D A;  1UY1 A;  3UET A;  4A3Z A;  4DXT A;  2WBK A;  4BXS V;  3C7E A;  2V4V A;  3MO4 A;  2WO2 A;  2J1T A;  3J7H A;  4QB1 A;  2VZS A;  2OKX A;  1CZS A;  3IB3 A;  1RYY A;  3OEB A;  2W46 A;  2VQT A;  1GOF A;  2YFU A;  4OUE A;  1W99 A;  5J1X A;  3ACI A;  1J84 A;  2X10 A;  3ACH A;  4OMD A;  4DUX A;  2VZP A;  2YC4 A;  2WZ8 A;  5G04 L;  4QX3 A;  2ZEW A;  3DYO A;  1L7Q A;  4GWJ A;  4KWU A;  4CU8 A;  1CIY A;  2WDB A;  2Y6G A;  1JZ6 A;  4BK5 A;  3I3D A;  3WF4 A;  2VZ3 A;  4A45 A;  1JU4 A;  4MOA A;  1H6X A;  3ACF A;  3GGL A;  3WEZ A;  4DUW A;  1XC6 A;  1O8S A;  1JU3 A;  1XNA A;  4D8M A;  2W1S A;  3HNB M;  5HPO A;  5IYY A;  1NAE A;  3EB7 A;  3VDA A;  3K4A A;  3A21 A;  2ZEX A;  2W9X A;  1HN1 A;  1W0N A;  2QQL A;  2VC9 A;  4IUG A;  1YQ2 A;  3A7Q A;  3GM8 A;  5LA2 A;  4DEV A;  3WNL A;  4CVU A;  4QDR A;  2ID4 A;  3SKJ E;  1PX3 A;  4ZXE A;  4QAW A;  3T0D A;  3ETP A;  2VM9 A;  4CU9 A;  2BBA A;  1CX1 A;  3NJV A;  4A41 A;  5IJR A;  3W5N A;  3CMG A;  2ZEZ A;  1UWW A;  3NQH A;  4LQR A;  2CDO A;  1BHG A;  3K4D A;  2JD9 A;  2VOT A;  4ARX A;  5CYY A;  3HN3 A;  5LA1 A;  2J1E A;  3I3B A;  1SDD B;  3A22 A;  4MGQ A;  1H6Y A;  3NJX A;  3C7G A;  4A4A A;  1JYV A;  2WAO A;  2X09 A;  2EIB A;  1P8J A;  2YC2 A;  1SHW B;  4PT6 A;  3E1F 1;  4MGS A;  4QX2 A;  5IHR A;  2WQ8 A;  1NUK A;  3K75 B;  4QPW A;  3VDB A;  1KGY A;  1XNT A;  3WNO A;  4DEQ A;  3MUZ 1;  3ZM8 A;  2B9V A;  2ZXQ A;  3WNP A;  3LEI A;  1JZ4 A;  2VZO A;  5LCW L;  4CUB A;  3UES A;  3U37 A;  2B4K A;  4XUO A;  3GXU A;  5JXI A;  1US3 A;  2EID A;  1UXZ A;  2RV9 A;  3C7O A;  3HNY M;  2DCJ A;  2QQM A;  4JKM A;  4QDQ A;  4CU7 A;  2J22 A;  5EJ1 B;  3T2P A;  2ZEY A;  2C26 A;  3CQO A;  4L0P A;  4ZZ8 A;  2W91 A;  3WF1 A;  3PUH A;  1OH4 A;  2CDP A;  4TTG A;  1JI6 A;  2C9K A;  3CDZ B;  2Y6J A;  2XOM A;  4XUQ A;  1US2 A;  2JDA A;  2XON A;  1O59 A;  4Z2A A;  2VZU A;  1R64 A;  1XPW A;  2ORZ A;  2WYS A;  3MV1 1;  2Z4F A;  2VO5 A;  3ECQ A;  4QDS A;  5DMY A;  5C71 A;  1TVG A;  1OF3 A;  4P00 B;  4ZZ5 A;  3SKV A;  4RYD A;  1GQP A;  4JX0 A;  1UZ0 A;  3VD3 A;  1O8P A;  5FUI A;  2Y64 A;  4MO3 M;  2LS6 A;  2HYX A;  4XZU G;  3I2J A;  1PMH X;  4W8J A;  4XVH A;  2W92 A;  3I2G A;  2VZR A;  3HEI A;  3W5M A;  2Y6L A;  1UY0 A;  1UX7 A;  2VCA A;  2VZV A;  3I3E A;  4LHS A;  3PUI A;  2J1S A;  4QB2 A;  3THC A;  3GDB A;  3OGR A;  4BDV B;  3FN9 A;  3WF2 A;  3K77 A;  3C7H A;  2VZ1 A;  4OMC A;  3BN6 A;  4KI5 M;  2YB7 A;  5B4X A;  3MV0 1;  5JMO A;  2VQU A;  1D7P M;  4CUA A;  3VD5 A;  4M4R A;  3HJR A;  5JXG A;  5F7U A;  3CKH A;  2J1R A;  3C7F A;  2BER A;  4PQQ A;  1DLC A;  1OF4 A;  3SEE A;  5JR2 A;  3ACG A;  3OB8 A;  3I97 A;  3CZU A;  4DXR A;  3D3A A;  3T2Q A;  3LEG A;  5DPN A;  2JE8 A;  4A6O A;  3T08 A;  2VMC A;  5HXM A;  2J1U A;  3OGS A;  2YG0 A;  2Y6K A;  4LPL A;  3OGV A;  5JXJ A;  3I2H A;  4DUV A;  3VDC A;  4ET7 A;  5JXH A;  1LNS A;  1WKY A;  4UOJ A;  2W1Q A;  1K3I A;  3FL7 A;  3III A;  3DEC A;  3BGA A;  5JUV A;  2VZT A;  4FI9 A;  2KD7 A;  4QB6 A;  3OG2 A;  3MUY 1;  2DDU A;  2QBX A;  1UY3 A;  3MBW A;  4ZY9 A;  1DP0 A;  1F4A A;  1UXX X;  4OZO A;  3HPN A;  2E26 A;  1UMH A;  4AAX A;  1UY2 A;  1KEX A;  3UNP A;  3T0B A;  3FHA A;  5IFP A;  2R7E B;  2VTF A;  4ARY A;  4HG6 B;  3T09 A;  3P1I A;  1K12 A;  5DN2 A;  4XUT A;  1JYW A;  3NNG A;  4XUP A;  2QQI A;  1W9W A;  3NRU A;  3VD4 A;  3P6B A;  1SG3 A;  4W50 A;  2WZE A;  3WF0 A;  1JYX A;  1NX9 A;  3A23 A;  2XHN A;  2W87 A;  2EIE A;  3LQC A;  4UAP A;  4JHZ A;  1IQD C;  1JZ5 A;  5CZK A;  1UY4 A;  2WUH A;  3SEP A;  4P02 B;  3F2Z A;  1ULP A;  4JKL A;  3DYM A;  1UYZ A;  3HNM A;  2VZQ A;  1CZT A;  4QX1 A;  3LE0 A;  5C7G A;  2J7M A;  2J1A A;  1J83 A;  1UMI A;  2E32 A;  4OYU A;  1PMJ X;  4XUR A;  3WNM A;  2C4X A;  2RVA A;  1I5P A;  2VCB A;  1EUT A;  1W8N A;  3K4Z A;  3CZJ A;  3WNK A;  3LPG A;  4BJ0 A;  3T2O A;  4E8D A;  4P5Y A;  3OBA A;  4DXS A;  5I0D A;  5EIY B;  2L9L A;  3T0A A;  2QQO A;  1GU3 A;  2WAA A;  4A42 A;  4XUN A;  2RJ2 A;  4UI9 L;  4JKK A;  2EIC A;  1K42 A;  5EJZ B;  3OEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...