2WUSR

Bacterial actin mreb assembles in complex with cell shape protein rodz
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
SEKWKELGETFRKKREERRITLLDASLFTNINPSKLKRIEEGDLKGLDAEVYIKSYIKRYSEFLELSPDEMLKLYEEGKEEVAEEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial Actin Mreb Assembles in Complex with Cell Shape Protein Rodz.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural protein
molecule keywords ROD SHAPE-DETERMINING PROTEIN MREB
total genus 33
structure length 87
sequence length 87
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF13413 HTH_25 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2wusR00
2R1JL 1IC8A 4GQMA 4J1XA 1JWLA 3VK0A 1ZS4A 2PIJA 4X4BA 1PRVA 1SQ8A 1WH6A 3G7DA 1NEQA 1EFAA 2WIUB 2AXUA 3OQOA 2B5AA 2GRLA 1ADRA 2LYPA 3MLFA 1WIZA 3LISA 4YG1A 1R69A 1RZRD 1UXDA 3KJXA 2PUGA 3R1FA 4MCTA 3QWGA 2ICPA 4IA8A 2KZ8A 2OR1L 1Y9QA 2JVLA 1WH8A 2PUAA 4NDWA 3GN5B 2KPJA 3SCGA 1ZUGA 4J1WA 2O49A 1DW9A 2L49A 2PPXA 2LYLA 1QPZA 1BDIA 1DWKA 2GRMA 2XI8A 4YG4A 5A7LA 2XSDC 1LMB3 2GZUA 1X57A 4I6TA 3QQ6A 4YBAA 3TRBA 3SCHA 1QP7A 2A6CA 4PU3C 2PUBA 3D1NI 2HINA 2PE5A 3GN5A 3OP9A 1GT0C 1CQTA 3FMYA 2BNNA 2WUSR 4MCXA 2AWIA 1R63A 3KZ3A 4Y42A 3OQMA 1QQAA 1NERA 4JQDA 1LCCA 1XWRA 3FYMA 1CJGA 2IVGA 4I6UA 3QF3A 4Z5CA 2PUDA 1ZVVA 4I8TA 1ZAYA 2HSGA 3HZIB 3ZHMA 3O9XA 1O4XA 2IU7A 4JCYA 3CECA 2LYQA 3FYAA 3BS3A 3SCFA 1YSEA 1LCDA 2PUEA 2OFYA 3CROL 4YARA 4X4GA 1LQCA 2XJ3A 3EUSA 4Z5HA 2LYJA 3ZKCA 2PUCA 4FBIA 5K98B 4IVZA 1UXCA 2IUOA 3G5GA 4IWRA 1ZZBA 4X4HA 3BD1A 4X4EA 1JFSA 1B0NA 1ZPQA 1UTXA 3KXAA 4YG7B 2BJCA 2LCVA 4X4CA 2JCGA 2FJRA 4Z59A 2L8NA 3JXDL 1RPEL 3BDNA 1RIOA 3F51A 3ZHIA 2AXVA 2R63A 4GHJA 1ZZ9A 2H8RA 3U3WA 2BNMA 2IVQA 2CROA 2EBYA 3OMTA 1JH9A 1RZRA 1PRAA 2XCJA 3UFDA 2IV1A 3GBFA 3QYXA 3B7HA 3IVPA 2KEJA 1VPWA 1WETA 2IVBA 1JFTA 1OSLA 4Z5DA 4PU4C 1E3OC 1AU7A 2KEIA 1PRUA 2XIUA 3LFPA 1ZZCA 4X4IA 3H5TA 1S7EA 3PXPA 1OCTC 1RZSA 3JXBC 1ZZ7A 2AW6A 2MQKA 3RZZA 1L1MA 1X2LA 2EWTA 2PUFA 2CSFA 1ZZ6A 2LYKA 3CLCA 2ICTA 4PU8A 4F8DA 1PERL 2D5VA 2O38A 1PNRA 1QP0A 2LYRA 1QP4A 2BNOA 1Y7YA 2AUWA 1QQBA 3L1PA 3OQNA 3JXCL 3DNVB 1LLIA 1BDHA 2EF8A 1ZZ8A 4Z58A 4OB4A 4X4DA 3S8QA 4I6RA 2MEZA 2KEKA 2AXZA 4X4FA 4O8BA 1POUA 2LYSA 1HF0A 3F6WA 2O4AA 3F52A 4PU7A 4FN3A 4JCXA
chains in the Genus database with same CATH superfamily
1IC8A 3VK0A 5DT2A 1SQ8A 1EFAA 3KJXA 2PUGA 2ICPA 4IA8A 2KZ8A 1ZUGA 4YG4A 5A7LA 2GZUA 4ER5A 1X57A 4ER0A 3TRBA 3A9YA 4WVLA 2PE5A 3GN5A 1CQTA 3FMYA 1QQAA 4Y42A 3OQMA 2AWIA 3TELA 3ZPXA 1LCCA 1QZXA 4I8TA 1ZVVA 1O4XA 4JCYA 3SCFA 3BS3A 1LCDA 1YSEA 3EUSA 2JQEA 2J7WA 1ZZBA 1B0NA 2BJCA 4X4CA 2JCGA 1RIOA 3U3WA 1PRAA 2IV1A 3GBFA 1WETA 3IVPA 1MFQC 1E3OC 1AU7A 2XIUA 3LFPA 3H5TA 3JXBC 4EK9A 4F8DA 1PERL 5DRTA 1QP4A 3L1PA 3JXCL 2HCSA 1ZZ8A 4X4DA 3S8QA 4I6RA 3NROA 3SX0A 4FN3A 4GQMA 1JWLA 2PIJA 1PRVA 5GAHi 1WH6A 3G7DA 2PXUA 3LQXA 2AXUA 4YG1A 1R69A 4MCTA 2FFHA 3DM5A 1Y9QA 2KPJA 4ER3A 3A9XA 4J1WA 2MXDA 2O49A 1DW9A 3R09A 1QPZA 1DWKA 5GAGi 2GRMA 2XSDC 2LNMA 3QQ6A 2LLVA 4YBAA 1QP7A 2A6CA 2PUBA 1GT0C 2BNNA 2WUSR 4MCXA 1R63A 3KZ3A 4HRAA 1NERA 2XXQA 5DTRA 3HZIB 3ZHMA 2IU7A 2PXPA 5DTMA 3FYAA 2PUEA 3CROL 4YARA 4X4GA 2XJ3A 3QOWA 3ZKCA 4FBIA 5K98B 2PXQA 2IUOA 3KL4A 3G5GA 2XXAA 4EKGA 4X4EA 3KXAA 1UTXA 4YG7B 1RPEL 5JUWA 3BDNA 3F51A 3ZHIA 4GHJA 2R63A 2BNMA 3OMTA 3QYXA 1VPWA 2KEJA 2M4HA 1PRUA 3PXPA 4EQZA 1ZZ7A 2AW6A 2MQKA 2LYKA 2ICTA 4PU8A 2AUWA 3DNVB 2EF8A 3OKZA 2PXFA 4O8BA 1POUA 4JCXA 2R1JL 2PXLA 1DULA 4EKIA 3VWSA 4ER7A 1NW3A 2WIUB 2LLWA 2B5AA 2GRLA 1WIZA 5DTQA 4EZIA 3R1FA 2OR1L 4ER6A 2JVLA 1WH8A 3TFLA 4NDWA 3NDBB 3SCGA 2PPXA 2LYLA 3A9ZA 1LMB3 3PE5A 3MEJA 3GUUA 3D1NI 2HINA 3OP9A 4JQDA 1XWRA 2IVGA 4I6UA 3GZDC 3QF3A 1ZAYA 2HSGA 5DSXA 3CECA 3ME5A 1LQCA 4OBMA 1UXCA 4X4HA 2V3CC 1ZPQA 2LCVA 2PXDA 2FJRA 2CROA 2EBYA 1RZRA 2XCJA 2H8RA 4Z5DA 1OCTC 1S7EA 1RZSA 2YBDA 2PXVA 1L1MA 1X2LA 1ZZ6A 2PXEA 2D5VA 1QP0A 2LYRA 1QQBA 1LLIA 5DRYA 2KEKA 2AXZA 4X4FA 2LYSA 1HF0A 3F6WA 2O4AA 4PU7A 4J1XA 1ZS4A 3GZCA 4X4BA 2ODRD 1NEQA 3GZDA 3OQOA 1ADRA 2LYPA 3MLFA 3LISA 1RZRD 1UXDA 3QWGA 1QB2A 2PUAA 1U2ZA 3GN5B 2L49A 3NZLA 1BDIA 2XI8A 2PXTA 4I6TA 3OWQA 3SCHA 4PU3C 2L1PA 3FYMA 1CJGA 4Z5CA 2PUDA 3QFIA 4DE8A 2HCNA 4DE9A 3O9XA 2LYQA 2OFYA 3SR4A 4Z5HA 2LYJA 2PUCA 2XXPA 4IVZA 4IWRA 3BD1A 1JFSA 4Z59A 2L8NA 3JXDL 3NXHA 2AXVA 1ZZ9A 1HQ1A 2VEOA 2IVQA 2HFZA 1JH9A 3TEPA 3UFDA 3B7HA 2IVBA 3QOXA 1OSLA 1JFTA 4PU4C 2KEIA 1ZZCA 2PXBA 4X4IA 3M9LA 3RZZA 3G0TA 2EWTA 2PUFA 2CSFA 3CLCA 2O38A 1PNRA 2BNOA 1Y7YA 4Q2JA 3OQNA 1BDHA 4Z58A 4OB4A 3UWPA 2MEZA 2PXKA 2J7UA 3F52A
chains in the Genus database with same CATH topology
2R1JL 1IC8A 4GQMA 4J1XA 1JWLA 3VK0A 1ZS4A 2PIJA 4X4BA 1PRVA 1SQ8A 1WH6A 3G7DA 1NEQA 1EFAA 2WIUB 2AXUA 3OQOA 2B5AA 2GRLA 1ADRA 2LYPA 3MLFA 1WIZA 3LISA 4YG1A 1R69A 1RZRD 1UXDA 3KJXA 2PUGA 3R1FA 4MCTA 3QWGA 2ICPA 4IA8A 2KZ8A 2OR1L 1Y9QA 2JVLA 1WH8A 2PUAA 4NDWA 3GN5B 2KPJA 3SCGA 1ZUGA 4J1WA 2O49A 1DW9A 2L49A 2PPXA 2LYLA 1QPZA 1BDIA 1DWKA 2GRMA 2XI8A 4YG4A 5A7LA 2XSDC 1LMB3 2GZUA 1X57A 4I6TA 3QQ6A 4YBAA 3TRBA 3SCHA 1QP7A 2A6CA 4PU3C 2PUBA 3D1NI 2HINA 2PE5A 3GN5A 3OP9A 1GT0C 1CQTA 3FMYA 2BNNA 2WUSR 4MCXA 2AWIA 1R63A 3KZ3A 4Y42A 3OQMA 1QQAA 1NERA 4JQDA 1LCCA 1XWRA 3FYMA 1CJGA 2IVGA 4I6UA 3QF3A 4Z5CA 2PUDA 1ZVVA 4I8TA 1ZAYA 2HSGA 3HZIB 3ZHMA 3O9XA 1O4XA 2IU7A 4JCYA 3CECA 2LYQA 3FYAA 3BS3A 3SCFA 1YSEA 1LCDA 2PUEA 2OFYA 3CROL 4YARA 4X4GA 1LQCA 2XJ3A 3EUSA 4Z5HA 2LYJA 3ZKCA 2PUCA 4FBIA 5K98B 4IVZA 1UXCA 2IUOA 3G5GA 4IWRA 1ZZBA 4X4HA 3BD1A 4X4EA 1JFSA 1B0NA 1ZPQA 1UTXA 3KXAA 4YG7B 2BJCA 2LCVA 4X4CA 2JCGA 2FJRA 4Z59A 2L8NA 3JXDL 1RPEL 3BDNA 1RIOA 3F51A 3ZHIA 2AXVA 2R63A 4GHJA 1ZZ9A 2H8RA 3U3WA 2BNMA 2IVQA 2CROA 2EBYA 3OMTA 1JH9A 1RZRA 1PRAA 2XCJA 3UFDA 2IV1A 3GBFA 3QYXA 3B7HA 3IVPA 2KEJA 1VPWA 1WETA 2IVBA 1JFTA 1OSLA 4Z5DA 4PU4C 1E3OC 1AU7A 2KEIA 1PRUA 2XIUA 3LFPA 1ZZCA 4X4IA 3H5TA 1S7EA 3PXPA 1OCTC 1RZSA 3JXBC 1ZZ7A 2AW6A 2MQKA 3RZZA 1L1MA 1X2LA 2EWTA 2PUFA 2CSFA 1ZZ6A 2LYKA 3CLCA 2ICTA 4PU8A 4F8DA 1PERL 2D5VA 2O38A 1PNRA 1QP0A 2LYRA 1QP4A 2BNOA 1Y7YA 2AUWA 1QQBA 3L1PA 3OQNA 3JXCL 3DNVB 1LLIA 1BDHA 2EF8A 1ZZ8A 4Z58A 4OB4A 4X4DA 3S8QA 4I6RA 2MEZA 2KEKA 2AXZA 4X4FA 4O8BA 1POUA 2LYSA 1HF0A 3F6WA 2O4AA 3F52A 4PU7A 4FN3A 4JCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R1J L;  1IC8 A;  4GQM A;  4J1X A;  1JWL A;  3VK0 A;  1ZS4 A;  2PIJ A;  4X4B A;  1PRV A;  1SQ8 A;  1WH6 A;  3G7D A;  1NEQ A;  1EFA A;  2WIU B;  2AXU A;  3OQO A;  2B5A A;  2GRL A;  1ADR A;  2LYP A;  3MLF A;  1WIZ A;  3LIS A;  4YG1 A;  1R69 A;  1RZR D;  1UXD A;  3KJX A;  2PUG A;  3R1F A;  4MCT A;  3QWG A;  2ICP A;  4IA8 A;  2KZ8 A;  2OR1 L;  1Y9Q A;  2JVL A;  1WH8 A;  2PUA A;  4NDW A;  3GN5 B;  2KPJ A;  3SCG A;  1ZUG A;  4J1W A;  2O49 A;  1DW9 A;  2L49 A;  2PPX A;  2LYL A;  1QPZ A;  1BDI A;  1DWK A;  2GRM A;  2XI8 A;  4YG4 A;  5A7L A;  2XSD C;  1LMB 3;  2GZU A;  1X57 A;  4I6T A;  3QQ6 A;  4YBA A;  3TRB A;  3SCH A;  1QP7 A;  2A6C A;  4PU3 C;  2PUB A;  3D1N I;  2HIN A;  2PE5 A;  3GN5 A;  3OP9 A;  1GT0 C;  1CQT A;  3FMY A;  2BNN A;  2WUS R;  4MCX A;  2AWI A;  1R63 A;  3KZ3 A;  4Y42 A;  3OQM A;  1QQA A;  1NER A;  4JQD A;  1LCC A;  1XWR A;  3FYM A;  1CJG A;  2IVG A;  4I6U A;  3QF3 A;  4Z5C A;  2PUD A;  1ZVV A;  4I8T A;  1ZAY A;  2HSG A;  3HZI B;  3ZHM A;  3O9X A;  1O4X A;  2IU7 A;  4JCY A;  3CEC A;  2LYQ A;  3FYA A;  3BS3 A;  3SCF A;  1YSE A;  1LCD A;  2PUE A;  2OFY A;  3CRO L;  4YAR A;  4X4G A;  1LQC A;  2XJ3 A;  3EUS A;  4Z5H A;  2LYJ A;  3ZKC A;  2PUC A;  4FBI A;  5K98 B;  4IVZ A;  1UXC A;  2IUO A;  3G5G A;  4IWR A;  1ZZB A;  4X4H A;  3BD1 A;  4X4E A;  1JFS A;  1B0N A;  1ZPQ A;  1UTX A;  3KXA A;  4YG7 B;  2BJC A;  2LCV A;  4X4C A;  2JCG A;  2FJR A;  4Z59 A;  2L8N A;  3JXD L;  1RPE L;  3BDN A;  1RIO A;  3F51 A;  3ZHI A;  2AXV A;  2R63 A;  4GHJ A;  1ZZ9 A;  2H8R A;  3U3W A;  2BNM A;  2IVQ A;  2CRO A;  2EBY A;  3OMT A;  1JH9 A;  1RZR A;  1PRA A;  2XCJ A;  3UFD A;  2IV1 A;  3GBF A;  3QYX A;  3B7H A;  3IVP A;  2KEJ A;  1VPW A;  1WET A;  2IVB A;  1JFT A;  1OSL A;  4Z5D A;  4PU4 C;  1E3O C;  1AU7 A;  2KEI A;  1PRU A;  2XIU A;  3LFP A;  1ZZC A;  4X4I A;  3H5T A;  1S7E A;  3PXP A;  1OCT C;  1RZS A;  3JXB C;  1ZZ7 A;  2AW6 A;  2MQK A;  3RZZ A;  1L1M A;  1X2L A;  2EWT A;  2PUF A;  2CSF A;  1ZZ6 A;  2LYK A;  3CLC A;  2ICT A;  4PU8 A;  4F8D A;  1PER L;  2D5V A;  2O38 A;  1PNR A;  1QP0 A;  2LYR A;  1QP4 A;  2BNO A;  1Y7Y A;  2AUW A;  1QQB A;  3L1P A;  3OQN A;  3JXC L;  3DNV B;  1LLI A;  1BDH A;  2EF8 A;  1ZZ8 A;  4Z58 A;  4OB4 A;  4X4D A;  3S8Q A;  4I6R A;  2MEZ A;  2KEK A;  2AXZ A;  4X4F A;  4O8B A;  1POU A;  2LYS A;  1HF0 A;  3F6W A;  2O4A A;  3F52 A;  4PU7 A;  4FN3 A;  4JCX A; 
#chains in the Genus database with same CATH topology
 1IC8 A;  3VK0 A;  5DT2 A;  1SQ8 A;  1EFA A;  3KJX A;  2PUG A;  2ICP A;  4IA8 A;  2KZ8 A;  1ZUG A;  4YG4 A;  5A7L A;  2GZU A;  4ER5 A;  1X57 A;  4ER0 A;  3TRB A;  3A9Y A;  4WVL A;  2PE5 A;  3GN5 A;  1CQT A;  3FMY A;  1QQA A;  4Y42 A;  3OQM A;  2AWI A;  3TEL A;  3ZPX A;  1LCC A;  1QZX A;  4I8T A;  1ZVV A;  1O4X A;  4JCY A;  3SCF A;  3BS3 A;  1LCD A;  1YSE A;  3EUS A;  2JQE A;  2J7W A;  1ZZB A;  1B0N A;  2BJC A;  4X4C A;  2JCG A;  1RIO A;  3U3W A;  1PRA A;  2IV1 A;  3GBF A;  1WET A;  3IVP A;  1MFQ C;  1E3O C;  1AU7 A;  2XIU A;  3LFP A;  3H5T A;  3JXB C;  4EK9 A;  4F8D A;  1PER L;  5DRT A;  1QP4 A;  3L1P A;  3JXC L;  2HCS A;  1ZZ8 A;  4X4D A;  3S8Q A;  4I6R A;  3NRO A;  3SX0 A;  4FN3 A;  4GQM A;  1JWL A;  2PIJ A;  1PRV A;  5GAH i;  1WH6 A;  3G7D A;  2PXU A;  3LQX A;  2AXU A;  4YG1 A;  1R69 A;  4MCT A;  2FFH A;  3DM5 A;  1Y9Q A;  2KPJ A;  4ER3 A;  3A9X A;  4J1W A;  2MXD A;  2O49 A;  1DW9 A;  3R09 A;  1QPZ A;  1DWK A;  5GAG i;  2GRM A;  2XSD C;  2LNM A;  3QQ6 A;  2LLV A;  4YBA A;  1QP7 A;  2A6C A;  2PUB A;  1GT0 C;  2BNN A;  2WUS R;  4MCX A;  1R63 A;  3KZ3 A;  4HRA A;  1NER A;  2XXQ A;  5DTR A;  3HZI B;  3ZHM A;  2IU7 A;  2PXP A;  5DTM A;  3FYA A;  2PUE A;  3CRO L;  4YAR A;  4X4G A;  2XJ3 A;  3QOW A;  3ZKC A;  4FBI A;  5K98 B;  2PXQ A;  2IUO A;  3KL4 A;  3G5G A;  2XXA A;  4EKG A;  4X4E A;  3KXA A;  1UTX A;  4YG7 B;  1RPE L;  5JUW A;  3BDN A;  3F51 A;  3ZHI A;  4GHJ A;  2R63 A;  2BNM A;  3OMT A;  3QYX A;  1VPW A;  2KEJ A;  2M4H A;  1PRU A;  3PXP A;  4EQZ A;  1ZZ7 A;  2AW6 A;  2MQK A;  2LYK A;  2ICT A;  4PU8 A;  2AUW A;  3DNV B;  2EF8 A;  3OKZ A;  2PXF A;  4O8B A;  1POU A;  4JCX A;  2R1J L;  2PXL A;  1DUL A;  4EKI A;  3VWS A;  4ER7 A;  1NW3 A;  2WIU B;  2LLW A;  2B5A A;  2GRL A;  1WIZ A;  5DTQ A;  4EZI A;  3R1F A;  2OR1 L;  4ER6 A;  2JVL A;  1WH8 A;  3TFL A;  4NDW A;  3NDB B;  3SCG A;  2PPX A;  2LYL A;  3A9Z A;  1LMB 3;  3PE5 A;  3MEJ A;  3GUU A;  3D1N I;  2HIN A;  3OP9 A;  4JQD A;  1XWR A;  2IVG A;  4I6U A;  3GZD C;  3QF3 A;  1ZAY A;  2HSG A;  5DSX A;  3CEC A;  3ME5 A;  1LQC A;  4OBM A;  1UXC A;  4X4H A;  2V3C C;  1ZPQ A;  2LCV A;  2PXD A;  2FJR A;  2CRO A;  2EBY A;  1RZR A;  2XCJ A;  2H8R A;  4Z5D A;  1OCT C;  1S7E A;  1RZS A;  2YBD A;  2PXV A;  1L1M A;  1X2L A;  1ZZ6 A;  2PXE A;  2D5V A;  1QP0 A;  2LYR A;  1QQB A;  1LLI A;  5DRY A;  2KEK A;  2AXZ A;  4X4F A;  2LYS A;  1HF0 A;  3F6W A;  2O4A A;  4PU7 A;  4J1X A;  1ZS4 A;  3GZC A;  4X4B A;  2ODR D;  1NEQ A;  3GZD A;  3OQO A;  1ADR A;  2LYP A;  3MLF A;  3LIS A;  1RZR D;  1UXD A;  3QWG A;  1QB2 A;  2PUA A;  1U2Z A;  3GN5 B;  2L49 A;  3NZL A;  1BDI A;  2XI8 A;  2PXT A;  4I6T A;  3OWQ A;  3SCH A;  4PU3 C;  2L1P A;  3FYM A;  1CJG A;  4Z5C A;  2PUD A;  3QFI A;  4DE8 A;  2HCN A;  4DE9 A;  3O9X A;  2LYQ A;  2OFY A;  3SR4 A;  4Z5H A;  2LYJ A;  2PUC A;  2XXP A;  4IVZ A;  4IWR A;  3BD1 A;  1JFS A;  4Z59 A;  2L8N A;  3JXD L;  3NXH A;  2AXV A;  1ZZ9 A;  1HQ1 A;  2VEO A;  2IVQ A;  2HFZ A;  1JH9 A;  3TEP A;  3UFD A;  3B7H A;  2IVB A;  3QOX A;  1OSL A;  1JFT A;  4PU4 C;  2KEI A;  1ZZC A;  2PXB A;  4X4I A;  3M9L A;  3RZZ A;  3G0T A;  2EWT A;  2PUF A;  2CSF A;  3CLC A;  2O38 A;  1PNR A;  2BNO A;  1Y7Y A;  4Q2J A;  3OQN A;  1BDH A;  4Z58 A;  4OB4 A;  3UWP A;  2MEZ A;  2PXK A;  2J7U A;  3F52 A; 
#chains in the Genus database with same CATH homology
 2R1J L;  1IC8 A;  4GQM A;  4J1X A;  1JWL A;  3VK0 A;  1ZS4 A;  2PIJ A;  4X4B A;  1PRV A;  1SQ8 A;  1WH6 A;  3G7D A;  1NEQ A;  1EFA A;  2WIU B;  2AXU A;  3OQO A;  2B5A A;  2GRL A;  1ADR A;  2LYP A;  3MLF A;  1WIZ A;  3LIS A;  4YG1 A;  1R69 A;  1RZR D;  1UXD A;  3KJX A;  2PUG A;  3R1F A;  4MCT A;  3QWG A;  2ICP A;  4IA8 A;  2KZ8 A;  2OR1 L;  1Y9Q A;  2JVL A;  1WH8 A;  2PUA A;  4NDW A;  3GN5 B;  2KPJ A;  3SCG A;  1ZUG A;  4J1W A;  2O49 A;  1DW9 A;  2L49 A;  2PPX A;  2LYL A;  1QPZ A;  1BDI A;  1DWK A;  2GRM A;  2XI8 A;  4YG4 A;  5A7L A;  2XSD C;  1LMB 3;  2GZU A;  1X57 A;  4I6T A;  3QQ6 A;  4YBA A;  3TRB A;  3SCH A;  1QP7 A;  2A6C A;  4PU3 C;  2PUB A;  3D1N I;  2HIN A;  2PE5 A;  3GN5 A;  3OP9 A;  1GT0 C;  1CQT A;  3FMY A;  2BNN A;  2WUS R;  4MCX A;  2AWI A;  1R63 A;  3KZ3 A;  4Y42 A;  3OQM A;  1QQA A;  1NER A;  4JQD A;  1LCC A;  1XWR A;  3FYM A;  1CJG A;  2IVG A;  4I6U A;  3QF3 A;  4Z5C A;  2PUD A;  1ZVV A;  4I8T A;  1ZAY A;  2HSG A;  3HZI B;  3ZHM A;  3O9X A;  1O4X A;  2IU7 A;  4JCY A;  3CEC A;  2LYQ A;  3FYA A;  3BS3 A;  3SCF A;  1YSE A;  1LCD A;  2PUE A;  2OFY A;  3CRO L;  4YAR A;  4X4G A;  1LQC A;  2XJ3 A;  3EUS A;  4Z5H A;  2LYJ A;  3ZKC A;  2PUC A;  4FBI A;  5K98 B;  4IVZ A;  1UXC A;  2IUO A;  3G5G A;  4IWR A;  1ZZB A;  4X4H A;  3BD1 A;  4X4E A;  1JFS A;  1B0N A;  1ZPQ A;  1UTX A;  3KXA A;  4YG7 B;  2BJC A;  2LCV A;  4X4C A;  2JCG A;  2FJR A;  4Z59 A;  2L8N A;  3JXD L;  1RPE L;  3BDN A;  1RIO A;  3F51 A;  3ZHI A;  2AXV A;  2R63 A;  4GHJ A;  1ZZ9 A;  2H8R A;  3U3W A;  2BNM A;  2IVQ A;  2CRO A;  2EBY A;  3OMT A;  1JH9 A;  1RZR A;  1PRA A;  2XCJ A;  3UFD A;  2IV1 A;  3GBF A;  3QYX A;  3B7H A;  3IVP A;  2KEJ A;  1VPW A;  1WET A;  2IVB A;  1JFT A;  1OSL A;  4Z5D A;  4PU4 C;  1E3O C;  1AU7 A;  2KEI A;  1PRU A;  2XIU A;  3LFP A;  1ZZC A;  4X4I A;  3H5T A;  1S7E A;  3PXP A;  1OCT C;  1RZS A;  3JXB C;  1ZZ7 A;  2AW6 A;  2MQK A;  3RZZ A;  1L1M A;  1X2L A;  2EWT A;  2PUF A;  2CSF A;  1ZZ6 A;  2LYK A;  3CLC A;  2ICT A;  4PU8 A;  4F8D A;  1PER L;  2D5V A;  2O38 A;  1PNR A;  1QP0 A;  2LYR A;  1QP4 A;  2BNO A;  1Y7Y A;  2AUW A;  1QQB A;  3L1P A;  3OQN A;  3JXC L;  3DNV B;  1LLI A;  1BDH A;  2EF8 A;  1ZZ8 A;  4Z58 A;  4OB4 A;  4X4D A;  3S8Q A;  4I6R A;  2MEZ A;  2KEK A;  2AXZ A;  4X4F A;  4O8B A;  1POU A;  2LYS A;  1HF0 A;  3F6W A;  2O4A A;  3F52 A;  4PU7 A;  4FN3 A;  4JCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...