2WV8A

Complex of human dihydroorotate dehydrogenase with the inhibitor 221290
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE, MITOCHONDRIAL
publication title Inhibition of Human Dhodh by 4-Hydroxycoumarins, Fenamic Acids, and N-(Alkylcarbonyl)Anthranilic Acids Identified by Structure-Guided Fragment Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 138
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2wv8A00
4YL2A 3WFAA 3ABQA 2G97A 2PRLA 5CZJA 4UFIA 4M7TA 2ATSA 4K39A 5D02A 3F03K 4FEZA 4KWVA 2PRMA 1VLWA 4JDYA 5F2LA 2A85A 4NX0A 1UBSA 4ZVJA 4O1BA 1TYGA 5G4WA 3TR2A 1XBYA 4O13A 2ISSA 4PL2A 4MFEA 3S8HA 4XBSA 1FDJA 2JGQA 2QCCA 4JY9A 1WBJA 4M5PA 4O1CA 1TPB1 2A21A 3DI1A 4N4QA 1S3HA 5K4XA 3U2OA 5EL1A 4A29A 4LRTA 1GT8A 1A53A 1GYLA 4JGDA 3UWWA 3T7VA 4M19A 4JXCA 4S2BA 5LGZA 1HL2A 3HGOA 3FKKA 2XN2A 3G1FA 1R2SA 3CIXA 3G8RA 1ZFJA 3QMRA 3W7JA 5LNUA 3W7KA 5E1QA 4AHQA 1SW7A 1HG3A 2O7QA 4GUJA 2NWRA 3JRKA 3G1HA 1G4PA 3L9CA 4LS2A 3INPA 3QW4B 2QDGA 3P84A 1HTIA 1DV7A 3EB2A 4DO6A 5AHEA 2QJGA 1JULA 2GQAA 3STFA 4UCGA 3B0VC 3M44A 2YYTA 2CZ5A 4Z0JA 3DKJA 3LGEA 2YFOA 2Q8ZA 5HINA 3IGSA 3BLEA 1SW0A 5I3HA 2Q8LA 1K3UA 1VYPX 1LRQA 3SFKA 1SR9A 1SO4A 1WAUA 3L66A 1C29A 4K36A 1NEYA 3TXVA 4UMBA 2LLEA 5GVJA 3T78A 3IV3A 3NR0A 1WBHA 4PH6A 1UUOA 2DZVA 1F74A 1FWSA 3HGSA 3O07A 1F76A 3UY7A 1AL7A 1IF2A 2VFHA 4L4LA 5LNRA 1PHWA 2NV2A 1IXPA 3THQA 5F2MA 1VS1A 4RXGA 3CIWA 3MUXA 4OHQA 1ONRA 4FNPA 5AHMA 1EIXA 1SFJA 3BGGA 1Q6QA 3A9IA 3VCRA 3G1AA 4BK9A 3W2JA 1EP1A 2Z1BA 4UTHA 4W9TA 2ZRVA 1JQVA 3HPSA 2FTPA 3M47A 1IXNA 3RNDA 1LDCA 3N19B 3PM6A 4IMCA 5EA9A 3W7OA 1OX5A 3F4WA 1X6UA 5HMSA 4JTGA 4QNEA 3N3MA 3BPWA 1NF7A 3GXPA 3LERA 2YGYA 5I3GA 3H55A 2GPTA 3G18A 1QPRA 5I3KA 4MYAA 2A5HA 1FWTA 2Y7EA 3W75A 5CPOA 3C2EA 3W9ZA 3P5ZA 1EUAA 1TPVA 1LZOA 2B7PA 1GVFA 1QCWA 3LHWA 3NL3A 5D30A 2E5DA 3RFAA 1H60A 1SZGA 3PAJA 4Z0SA 4YMZA 2X1TA 2A6LA 3E0IA 3M41A 1AL8A 4XWUA 5FF2A 1YXCA 3TC7A 1O95A 5AYXA 2EAWA 3NGJA 2V2CA 3V1PA 3PUEA 1M7OA 2V8ZA 3TMQA 1M6JA 4BR1A 4HSNA 3R2GA 2B7OA 3E9AA 2BXVA 2RFGA 2FLIA 5HQEA 3H54A 1VRDA 3KVLA 3LCFA 3EX1A 1XUZA 4L4MA 2A7RA 1TMHA 5G2HA 3BVJA 3DFPA 4HKPA 3W2UA 1XXXA 1LBMA 1I45A 3KAOA 4FNTA 1FDZA 3C61A 4UTIA 4AMAA 1QO5A 2C14A 3TDFA 3TXZA 4GBUA 4FX7A 4JTLA 2V5BA 5D2VA 2BZNA 3C56A 2J24A 1MEWA 3A24A 1ME7A 1G69A 2V0TA 4AXKA 1YDOA 1W5PA 1DJNA 1ZAJA 5FF3A 4MUZA 1DOSA 1TPDA 2CZDA 4YCOA 1LRTA 1Z44A 3SW6A 4GXMA 3G1SA 3O6DA 1KM5A 2V81A 2F7FA 2E5BA 1TJPA 4ZMGA 1WOBA 1A5SA 2YFNA 4K38A 1B3OA 3P67A 2NX9A 3FYOA 4NJIA 3S6DA 2OZ0A 4D2JA 3GXTA 1OX4A 3PBUA 4JTKA 4NJGA 2Z6JA 3O15A 4RXFA 5DBUA 3QSTA 3PBWA 2TRSA 1OYAA 4QM1A 4UTWA 2VELA 1KV8A 1XC4A 3LTYA 2WSYA 3M1ZA 4CCEA 3RLVA 2QEZA 4QISA 1JCLA 3UWVA 1R30A 4QJ1A 3PY2A 4IMDA 2QCDB 3W1AA 3R5EA 3E96A 1BKSA 1NF0A 3L5LA 4ZQRA 3EKLA 3M7WA 4UR8A 4Y6GA 2GOUA 3CWOX 4MZ1A 4UTMA 5LNWA 4S1FA 5KZDA 1VC4A 2CU0A 4P61A 4XUGA 3NQ6A 3FIGA 5C54A 3P5YA 1F6KA 4UTTA 5CZTA 3EXRA 4O12A 3IVSA 2E77A 4O53A 1ZAIA 2JBMA 2VKZG 4EIVA 1OX4B 4Z1CA 1L9WA 3L5MA 5CGQA 1W5MA 1GPWA 4MFDA 4UMCA 5D32A 4KFPA 4N6FA 2ABBA 4M6VA 1RQHA 3BO9A 4N6EA 2P1FA 4TR9A 3DXIA 1F2JA 2YZRA 4JIQA 3DAQA 4DQWA 2Q3OA 2CZFA 4FX6M 2BWGA 4WOZA 3EWUA 3HO8A 4IPJA 3O63A 3DFTA 5HULA 4AVFA 1P5BA 4DO4A 1J2WA 1JRCA 4MVAA 4OV4A 5LSMA 3M0ZA 1FWNA 2EPHA 4I7UA 5EBUA 1BWKA 3LRLA 3P82A 4MZ8A 3LRMA 2WKJA 1YLVA 3C2FA 3MWAA 3NVTA 4JEQA 3W2LA 3M5YA 2WNQA 4GFSA 2EKCA 8TIMA 2A2IA 4B5NA 2A1YA 1JCJA 3FLUA 4S2CA 3VI2A 2FDSA 4MY8A 4JTUA 3BLFA 1WA3A 2CLIA 2H8ZA 5J5DA 1FDYA 1GZGA 3NM3A 3W1UA 4H4IA 3S9YA 1W3IA 3QPYA 1Q45A 1CI1A 1W5QA 5D38A 5EKYA 1DQXA 1H1ZA 3T55A 3ZWSA 3TMLA 4JYFA 2Y62A 3EKZA 4M6QA 1KTCA 2CW6A 2QUTA 3R13A 2AAMA 3EX4A 3I6RA 4NJKA 3V75A 1QFEA 3W72A 3W76A 3S5NA 2A7NA 3S42A 4O1AA 3Q37A 1CX9A 4I9AA 2NXGA 4IWWA 2NX1A 1HO4A 2A7PA 4E0CA 2GVGA 1RR2A 1B4KA 4BI6A 2ATMA 3KHJA 1X8FA 1FUYA 2VEMA 2NZLA 3W2MA 1TTPA 3W7CA 3WK3A 3N9SA 2FB3A 5F2GA 2NV1A 1T96A 4FNRA 3NQCA 3WJWA 3DBPA 1P4CA 5E93A 4KKXA 5DCBA 4Y90A 4JTFA 3IVTA 4WZHA 3BARA 4ZQNA 2KZHA 5KSWA 4N9EA 3KOFA 1JVNA 3L68A 2NUXA 3DFOA 3OIXA 4Q33A 3N14A 4AAJA 1XCFA 5L6UA 5TQLA 3S1UA 4HNNA 4JN6A 4FB7A 4E38A 3GKAA 2QCHA 3NL6A 2A4AA 5IBXC 1G7VA 2G95A 4QIUA 4YLWA 3G24A 1DBTA 5T26A 1YXDA 4FNSA 4LTSA 3TSDA 3LHVA 2VXNA 1K7XA 3TIMA 4MY9A 5AC7A 4O1DA 5HUPA 3UXDA 3E49A 5D33A 1SPQA 2OJPA 2H3BA 3MI6A 1P0NA 3W2NA 3P74A 3P61A 1ZCOA 3O06A 2ZZ7A 1XBVA 2Z2UA 1YTEA 4Z1DA 3TAKA 1B57A 1XM3A 3UQNA 4BWLA 3BK0A 5G4EA 1ZJIA 3W84A 4OQVA 1O94A 1B9BA 4QNWA 1ZHAA 3NEVA 3NOEA 2ZRYA 1TTJA 4HPXA 2Y7DA 5FF0A 3KX6A 4PEKA 4WQ6A 4Y8FA 1TPUA 3C6CA 5AB3A 3S0CA 1VR6A 3L2IA 4MYXA 3RU6A 4JNMA 4NUWA 1VPXA 4CCDA 3BW2A 1O4UA 2I14A 2E6FA 4IOTA 1JCXA 1SO3A 2F84A 3LCLA 1JCYA 4OT7A 1AW5A 5F4XA 1ALDA 5F1UA 1WOAA 3IIXA 1EX5A 2XN1A 2Y85A 4M7SA 3UWUA 3GNDA 3LV5A 1HFBA 5K7JA 3W7DA 3HQ1A 1NVMA 3G1VA 3R12A 3T40A 5KINA 4PCFA 3TC6A 1QPOA 2PE4A 2C3ZA 2ZZ4A 1W3TA 4UFLA 5G1TA 3UPWA 4Z1BA 3UWZA 1MEHA 3NQ2A 1QDSA 4PC8A 4QSHA 3QQ0A 2ZA3A 3W1PA 3HG3A 4JTEA 4XTIA 3FJ6A 2J9ZA 1L6SA 3SGZA 4IUOA 3OA3A 1H5YA 4O57A 1EWDA 3C0JA 2HS8A 4O52A 3DHDA 3EEGA 4LRSA 4LUIA 3ABRA 4NZFA 5D37A 3LV6A 4WXZA 1F7BA 3LX9A 3S5YA 1WDWA 4DXVA 4XKYB 3HJZA 3B0UX 5DY2A 5CPLA 1KM0A 3RMJA 2RDUA 3L0GA 1ADOA 1THFD 3HIJA 4AHOA 4CNNA 2QAPA 2QAFA 3TW6A 3W2KA 3VNDA 2I9EA 5CZSA 4PFMA 3HPXA 4TO8A 4ORIA 3W7HA 3W7LA 2XN0A 1DORA 2GJLA 3W1MA 4O11A 3BG9A 4CNOA 4AEOA 1D9EA 3KVMA 4GWEA 1TQXA 1VH7A 3S1VA 4R33A 5LKYA 4KWWA 3LI0A 2Y7FA 1LP6A 1GYNA 5TIMA 1QR7A 1KFEA 2NX3A 4WD0A 4K6AA 3W07A 2QUVA 5D2WA 1XBZA 3NQVA 1F05A 4X2RA 3EWYA 4CQ8A 3LXAA 4H6KA 3JR2A 4MKNA 5D03A 3GDKA 3PVFA 5F2IA 3SY5A 2ZZ3A 3M9YA 3TUUA 1KFLA 4LV4A 2QKFA 3G1YA 3BGJA 3QW3A 4LY8A 3LXBA 3W88A 3B8DA 2X1SA 3CM4A 3FEMA 4LVAA 5FI8A 4O0ZA 4NNAA 1VCVA 3EXTA 4LVDA 1GVSA 4O50A 2RHGA 4DPPA 2YSWA 4LS0A 4DF1A 5DBTA 5LHEA 3GK0A 4ICNA 5AHNA 5AC6A 3I7SA 4FIRA 5D2TA 1B4EA 4HT3A 2OT0A 4A2RA 4O15A 3TV8A 5AC8A 2OX1A 2Y89A 3TFXA 1TV7A 4EOUA 4K7VA 3O05A 4TMBA 3CTLA 2ZBTA 3NYZA 3LOTA 4UFHA 3C2RA 3LBCA 3M43A 1KBJA 2A0NA 4E2DA 3QM3A 3NNTA 4YXGA 3PB0A 1U83A 3PF3A 4WOQA 1F73A 2QCLA 1AMKA 4UTLA 5BRBA 3CEPA 3P8JA 2V5LA 3OVRA 1N7KA 3YPIA 4RK8A 1FCBA 1RZMA 2FPVA 4RJEA 4RKAA 4FXRA 3NZ1A 5EPDA 3LLDA 1J5TA 3EWXA 3LCHA 1JQXA 2E1DA 3GDRA 3GB6A 1SQ7A 3ZR4A 3DFNA 3UNDA 2Y7GA 3FJLA 1I2NA 5HNRA 1VLIA 2DZSA 3TAOA 2B7NA 3W7NA 1LTDA 2ZA1A 1R2RA 4IX2A 4GJ1A 4AF0B 3QH2A 1EUNA 3KRZA 4XTDA 4LVBA 3BW4A 3RF9A 1X1ZA 1W0MA 4RCXA 1I8JA 3F4NA 3PR2A 2VFGA 5C6MA 3C3NA 4NJHA 2QCMA 3SJ3A 1OFEA 4ZZ9A 3FOKA 2ZRWA 3Q58A 1PE1A 4DF2A 4PTNA 1SSDA 4N4PA 2CFFA 4UIOA 1TREA 2HS6A 2PC4A 3FKRA 1W5NA 3A5FA 5G2WA 1T0OA 4IMFA 2CLFA 2B4GA 3VE9A 4BI7A 1TTIA 4M6PA 5KTLA 2ZYFA 3UXAA 2QCDA 4LVFA 4K8EA 5DCEA 1WQ5A 3E02A 1K8YA 4N9CA 1U5JA 4CNPA 2VFDA 2J6XA 4ZQPA 3WJZA 3S5OA 2Q3RA 1GOXA 1Q6OA 4IXHA 4NU7A 5CPMA 3W1XA 1HUVA 1OG0A 4FNUA 4ORMA 1KA9F 5H91A 4MZYA 3L5AA 1TRIA 4TU1A 1TJRA 5CG7A 4OWGA 5HR6A 4FIQA 1W3NA 2J88A 3L67A 1N8FA 1JRBA 4HSOA 1EA0A 1FBAA 1KW1A 3LHYA 1CW2A 1KM2A 2Y6ZA 3MMTA 5K9DA 2ZTJA 2Y61A 1SO6A 4XQ6A 3P60A 1EEPA 1EP2A 4AWUA 5CSRA 5LNVA 3Q94A 3VKJA 1OFQA 4IMGA 3N9RA 4GC4A 3TSBA 3A22A 4I7VA 3G22A 3JS3A 1D3GA 3KVJA 1TB3A 5AFDA 1LOSA 3LCGA 3W1TA 1GVQA 3DKLA 3A23A 3S1XA 3USBA 1F6PA 4IX0A 3SECA 2V30A 3C2OA 3CHVA 3NL2A 3WK0A 2DJXA 2ZZ5A 1OX6A 1TCDA 1NAL1 1H63A 3M5ZA 2AGKA 2H6RA 1S5VA 3LTPA 3U6WA 4UTUA 1H62A 3M16A 4DEFA 1NFBA 4ADSA 3EX2A 3W7IA 1O60A 5FESA 2GJNA 1Q6RA 4HHPA 3NQEA 1EWEA 4YWIA 3T44A 1C9DA 1VHNA 3TCEA 4LW7A 5KZMA 2PURA 4O19A 3GIYA 3GAYA 4Q4KA 3LHTA 3W3OA 1KM3A 1MXSA 3NAVA 3MP3A 4WX2A 4BI5A 3W73A 1R46A 1G4TA 3GNNA 1LROA 3W87A 2WV8A 1VYRA 4FHAA 1FX6A 2RDWA 2ZZ1A 2ZTKA 3TW7A 3IIPA 4O0KA 4NQ1A 5G2IA 4NX5A 5EYWA 5LZLA 2B0MA 1A5CA 3UWYA 3W7EA 2CWNA 1X1OA 4NVTA 2OMAA 1YDVA 4DELA 3TQVA 2PCQA 3MW7A 1R2TA 3N34A 3ABOA 1ZAHA 3QFEA 3STCA 1TIMA 2RKXA 3B0PA 3PC0A 2FB2A 2G5WA 3W7RA 3LBMA 1ML1A 1FY6A 5HUOA 4I7WA 1PCKA 1NSJA 3UWQA 1YDNA 1SU5A 1Z48A 2YW4A 5DLCA 3W23A 2V2HA 3HOJA 1V7YA 1FCVA 1W8SA 3AJXA 4FXSA 1TPC1 5F4SA 1DJQA 1O5XA 4JX4A 3LI1A 1BWLA 2DORA 3WJSA 1D3HA 4A2SA 4MPQA 1SO5A 2E6YA 1TV5A 5K9CA 4LT9A 3W71A 3ELFA 1PL9A 4IGHA 3KVKA 1FXQA 5ABTA 4UR7A 3MYPA 4KFOA 1IXOA 2QCEA 3LXCA 2CLMA 4LU0A 4GRSA 4FNQA 3CEUA 1QNVA 3G3DA 4FF7A 4RLIA 1L2UA 1M7PA 3O6CA 5I3IA 2DP3A 2E09A 3BG5A 1HO1A 2CLEA 1SW3A 3I7QA 3B06A 3STGA 1S5WA 3EX3A 4OU1A 1KFCA 4R53A 4TIMA 3GYEA 3N2XA 1OFPA 2VOMA 3HMJG 1TSIA 3GKFA 4AWTA 4WY0B 2EHHA 2VFFA 4IPIA 4EF9A 2XFWA 2Z6IA 5CZ0A 2CLOA 3LHUA 3NPWA 4EVZA 1GVOA 2DZPA 4H3DA 1LLZA 1G4SA 1KM4A 3EWZA 3K30A 2DZXA 1OF6A 1LOQA 1VGAA 1EPXA 1ZALA 2CLLA 5D2XA 3TE9A 3WK1A 1QAPA 1RV8A 2E6DA 5D05A 3C52A 1KFJA 3G0SA 4JTHA 3QYQA 3WJYA 1ZNNA 2FJKA 1I2QA 3G1XA 5FF4A 1LBFA 3QC3A 3CQ0A 2D73A 3LCXA 2Z0IA 2VEPA 1OFAA 4LNYA 1E51A 2QF7A 4JTTA 4RX0A 3GXNA 2W0UA 3UPBA 4TX9A 3QEZA 5AN7A 1VJIA 3GVGA 1OYBA 1XDMA 2DU2A 1ICSA 2OCZA 3DU0A 1W56A 1QPNA 3P7YA 1LBLA 4FX8A 2YR1A 2C19A 1XKYA 1H7PA 1JUBA 2QR6A 3OEXA 1RQBA 5KZEA 3W70A 1GEQA 2YDAA 2ZZ2A 2H3DA 4EWND 3NPXA 4P2VA 3TNOA 2QCFA 2QCGA 3TQ0A 4JY8A 1K8XA 1TPWA 3LRKA 3UZ5A 2QUUA 2ZRZA 1C8VA 2ZDRA 4OV9A 3A5VA 2EF9A 4NJJA 4N9BA 3GX9A 4XKYA 3NQ8A 2TMDA 4AH7A 4XZ9A 5DXYA 4UC5A 4J9JA 1OF8A 4LWWA 2WO5A 5FEZA 4HPJA 3S5ZA 1AW2A 2BLEA 3EWBX 2Y63A 3MJYA 1LCOA 4OBTA 1W5OA 4K7YA 1OFRA 3SGUA 3O1NA 3ATZA 3L0KA 4E2BA 2V9DA 4LC6A 3MO7A 5FF7A 3M5VA 2GQ9A 3TJXA 2AQWA 1TPFA 1W1ZA 2NLIA 3DGRA 4QQ3A 4DF0A 1Q3NA 1JCMP 1XBXA 1V5XA 1T8XA 4QAIA 4O14A 3R89A 5SWUA 4HNVA 4RZ4A 4UTKA 5D09A 3PUDA 5G1YA 1VCFA 1AK5A 1OK4A 1QMLA 1GG0A 3NQDA 3W7GA 3SSJA 3NA8A 3TROA 4UFMA 3TA6A 4QITA 1TPH1 5A8GA 2R8WA 2YW3A 3NQMA 4WJEA 4DBEA 4O4VA 2ISWA 5C55A 2CLHA 3O6YX 2YYUA 3CC1A 4RZ5A 2HTMA 1PCWA 2WSQA 2ZRXA 2JKEA 5AHLA 1WX0A 3OG3A 3PBYA 2GUUA 3GLCA 2NUWA 3NQ7A 2JKAA 5AYYA 1XFBA 2DZWA 2WNZA 3W7MA 5HWJA 5HR7A 3MBDA 3AO0A 3TQKA 1Z42A 1R47A 1QWGA 1SZFA 2C1HA 3LLFA 3B05A 4O16A 3OHIA 3O8AA 3QSRA 4OGZA 1SUXA 4G1KA 4O8RA 3LHZA 4UTWC 2HSAA 3BG3A 3NPUA 3HG2A 3ZS4A 3PULA 2VFEA 1ZENA 4X3ZA 2UV8G 3SI9A 5C5YA 2JK2A 5IBXA 4NXKA 2VC6A 3QMTA 4GUHA 4JX6A 5KITA 3DFQA 1MO0A 2FIQA 1A50A 1PV8A 2GVJA 3PBVA 3QRHA 1H50A 3TX9A 1GWJA 1H7XA 3W22A 5J5RA 6TIMA 3W6YA 4AF0A 1K7FA 5DCDA 1YYAA 1JJKA 3G1DA 4A3UA 2C13A 3FYPA 1UASA 1OHLA 2NXHA 1XI3A 4UTTC 3BLIA 1F5ZA 1MEIA 4JR5A 4R34A 3W7PA 4Z08A 4GE8A 2YCEA 5MHBA 4BF9A 5F1VA 3PS7A 3W74A 3NL5A 3NQAA 4XBKA 1H51A 2WOQA 2Y70A 1GG1A 2Y88A 1VHCA 3PB2A 2O7SA 1DVJA 3IEBA 1PS9A 3STEA 5G5IA 2JKPA 4ONVA 1KV5A 4Y9AA 5K9XA 3VE7A 3WK2A 5E0KA 5LNSA 4Z1AA 3LB0A 5F4WA 5FEWA 3PUOA 1A5BA 1QOPA 4GNJA 1OVDA 2V2DA 5FEPA 1FXPA 1H7RA 3CB8A 2ABAA 2BTMA 3T4CA 3GZ3A 4MLJA 4UNLA 4C1KA 2VEKA 3CLMA 4UNKA 4ML9A 2CZEA 2R91A 1PIIA 1OFDA 1W31A 1OK6A 2J27A 3NQGA 4LC8A 5BMWA 4DO5A 1J4EA 4U28A 4ZQCA 4DBDA 5D2YA 1LM1A 3GDLA 3RK8A 3HF3A 5K2ZA 1YXYA 1G7UA 4LVGA 2WNNA 1LOLA 1H7OA 3IGUA 2ISVA 1I2RA 6ALDA 3F1QA 2ZRUA 4GUIA 1QPQA 1YADA 3PSVA 3MHGA 4LOCA 3GDMA 2FFCA 1BTMA 3BW3A 1YTDA 3A21A 3HB9A 1ZY9A 4ADUA 1KTNA 4ZQMA 3L0NA 2NWSA 2OT1A 4LUJA 1L6WA 1XUUA 4UXDA 1X7FA 2C15A 3NDOA 4IXXA 2YPIA 5AHFA 5AHIA 3S1WA 1UUMA 3G0XA 4O54A 3GR8A 4JS3A 4RZ6A 3DHFA 3P62A 3LDVA 3UYCA 2RH9A 2X30A 5CSSA 3NG3A 3KRUA 3W83A 1SSGA 3IRDA 5L9FA 1I4NA 4MLRA 4O10A 2B7QA 1KLYA 4A21A 1LORA 2C6QA 4NNCA 4AWSA 1KFBA 1A5AA 5LGXA 3OVQA 3MHFA 1JUKA 3DENA 5U4NA 1FWRA 2YX0A 4JX5A 4LV9A 3TKFA 1IIHA 4KFNA 4MJMA 2E68A 1BEUA 4O18A 4ALDA 4WXYA 1KFKA 2QCNA 2J9XA 3D0CA 5BOOA 3L65A 4LS1A 2BSLA 3W1NA 2QJIA 4MOZA 1WV2A 1K03A 4N2YA 3N73A 3HG5A 3HPZA 1P1XA 4JTJA 3LCIA 2I1OA 2P0OA 5DXXA 2WSRA 2X1UA 3IIVA 1OYCA 1JUEA 1YPIA 1M5WA 2WQPA 1GQNA 2VFIA 1TQJA 4X9SA 2QJHA 1PHQA 1S5TA 2W79A 2ZCGA 1EB3A 3E12A 1LYXA 2DJLA 3DZ1A 4K37A 2ZZ6A 4WY0F 4Q32A 3C2VA 1T99A 4BWLC 2JGYA 4N9DA 2X16A 3KXQA 3B4UA 2C0AA 1GVRA 4WUIA 5KMYA 2NXIA 2DZTA 1I2OA 3R8RA 2TSYA 3H53A 3QPZA 2NUYA 4N02A 3B03A 2J9YA 1EP3A 1SZEA 3W86A 1LLWA 4JDBA 3HGRA 4CCCA 3LCWA 3IGXA 3I68A 3EXSA 3SIZA 2X1RA 3W1QA 3PG8A 3PG9A 1IGSA 1OABA 2R14A 4O17A 3G8EA 2P10A 3HGJA 3PSWA 4NNBA 3EX6A 1TO3A 4UTJA 1H61A 3TFCA 3C4UA 5CPNA 3C8FA 3Q2DA 3M5XA 4HIBA 4MY1A 1KTBA 3CPRA 1DHPA 3OBKA 1WXJA 5AOUA 3GDTA 3QMSA 2FQIA 5IM51 1TV8A 4PA8A 4X22A 5HJLA 3W7QA 4K8HA 1MZHA 4MJZA 3MI2A 3CT7A 3W85A 1QOQA 5DELA 4ADTA 3VFLA 4FO4A 1H7WA 1W54A 2H90A 1SFLA 4AB4A 3QQ1A 1JCNA 4HN4A 1OJXA 2C18A 4UFKA 1DKWA 1AW1A 2BX7A 5I3FA 1Q6LA 3TJLA 4UMAA 4DPQA 3G0UA 2X2GA 3IVUA 1O5KA 1TTQA 3UY8A 1QO2A 3FFSA 3IIZA 1KM6A 3GAKA 4R7JA 4RV8A 1ICPA 4WY0A 1IIGA 4UUIA 1DL3A 5BMXA 1YTKA 4JIPA 1UCWA 2GVLA 3P81A 1VZWA 3LM7A 1YPFA 2VEIA 1RPXA 1K7EA 3KRSA 1G67A 1ME9A 3ZWTA 1FCUA 2IQTA 5EMUA 5A5WA 3N2MA 1DQWA 3BV4A 4HNUA 5C2XA 5AYZA 1GJPA 4NXSA 3G3MA 3GR7A 3THAA 3DI0A 4O28A 1SZNA 1VQTA 1FQ0A 1H1YA 1KBIA 1L6YA 2R94A 3P80A 4Y96A 1TPEA 3DFSA 3QF0A 2ZQ0A 4JTSA 3WJXA 3P8IA 1VCGA 2GQ8A 3FS2A 3U8GA 3DH7A 4U4MA 3L21A 5DY3A 3SZ8A 2G96A 4O4WA 1P0KA 5D04C 4CLMA 5HWMA 3NQFA 5U7SA 4JTIA 5I3JA 2TPSA 1PVNA 2EGZA 4PL1A 3TK7A 2TYSA 1XL9A 3FA5A 2CLKA 1GTEA 4AHPA 3W1RA 3MHUA 1H7NA 4MIMA 1K8ZA 3TH6A 3IIOA 3NM1A 3NZRA 1RVGA 2DZUA 1JR1A 4A22A 3MP5A 4HNTA 2W6RA 4GUFA 5CKSA 4EF8A 5BNKA 5DN1A 1Z41A 2E5CA 5FEXA 2WPBA 5LHFA 4YCPA 2WJZA 3ANYA 2ZFAA 4BFAA 3ZFHA 4IMEA 1KLZA 1FCQA 1GTHA 3I65A 1WYIA 4JYDA 2RDTA 3UD6A 1FWWA 1ME8A 4IJBA 4CQ9A 4PODA 4ZL1A 3NXFA 5BW6A 4POCA 1G4EA 4GUGA 2PRHA 4NT0A 2V82A 4JD4A 3OVPA 3TU9A 2QDHA 2YXGA 3NO5A 2ALDA 3B04A 4C1LA 3MBFA 5H2ZA 5K3VA 1UJPA 5HWNA 1XDLA 1VYSX 1MSSA 7TIMA 3MYOA 2H8XA 3I7RA 4IQLA 4TMCA 3QJAA 2C16A 1AG1O 3O16A 3LTSA 3MP4A 2FPTA 3QZEA 3KFTA 4JICA 1N55A 5K4ZA 1KM1A 1OFBA 3W1LA 3M6YA 3SR7A 3ATYA 3TSMA 1G6CA 1K02A 4JYEA 4NZJA 1TRDA 1UB3A 2FPYA 3HG4A 1ICQA 3UZJA 4RR4A 3CU2A 4OE7A 2HMCA 3RLUA 2ZA2A 2VENA 1I2PA 1RQEA 3ABSA 2E6AA 4UFJA 1OFOA 3NPVA 1IXQA 5TBOA 5EY5A 3PWAA 3MI3A 1W37A 3CWNA 1RD5A 1Y0EA 3EWWA 4ZQOA 2A6NA 4CQAA 3HBLA 1LRNA
chains in the Genus database with same CATH superfamily
3WFAA 1UD2A 3EYPA 3ZVIA 3FAXA 3VNJA 4D8AA 4LBUA 4OKDA 4FEZA 1D3CA 2PRMA 1VLWA 1C91A 4JDYA 4IP5A 2V3GA 5CPQA 1TYGA 2PWDA 4XUYA 1XBYA 3ARUA 4M82A 2DSWA 4M5PA 3UNTA 1DEDA 3PZUA 3AALA 4N4QA 1S3HA 1U5HA 4M19A 4YVXA 1HL2A 1JIBA 1D7KA 1BWVA 1R2SA 3G8RA 1BPLB 2EG7A 3W7JA 2PDQA 3CJPA 3JRKA 4OOUA 2F9RA 3E1F1 3L9CA 4GI9A 2XGIA 3INPA 3QW4B 3FHAA 1NTHA 1QRQA 2VZSA 2R1MA 2A3LA 1NU5A 2CZ5A 3DKJA 3MCNA 4MWAB 2YFOA 3NCOA 3IGSA 5I3HA 1LRQA 4PULA 1KKOA 5D8WA 2XSAA 3VD7A 4BEQA 5G4HC 1SO4A 4K36A 3DHUA 1XLBA 3MKCA 4R9XA 1NEYA 4IUGA 4Q8TA 3H6OA 1FP8A 1TJ2A 5GVJA 3T78A 4F40A 4GH3A 2CITA 3VNMA 2DZVA 1F74A 1FWSA 3ITYA 4L6HA 1X38A 1R87A 2J13A 2DQWA 4PMDA 3UY7A 4CD7A 1IF2A 3HZ3A 2OGYA 5JUVA 2VFHA 2YOCA 1M01A 4IT1A 5F2MA 3GG8A 1UR8A 3OB8A 3QOMA 1ONRA 4LGXA 4FNPA 7CGTA 1EIXA 1SFJA 4ZOEA 1F9CA 5J8LA 1Z3NA 4KW2A 3ZXWA 2O4MA 2Y1HA 2Z1BA 5F7UA 3HPSA 4PRRA 5GNZA 4IMCA 5I07A 5LA2A 4QNEA 3WMCA 3UCDA 1YBQB 3GNOA 5I3GA 2GPTA 4MYAA 4QTGA 4IZGA 1QUMA 1E43A 1EUAA 3F7JA 1TPVA 2ZX8A 2W27A 2OKOA 2O0TA 4GVHA 4ZE4A 1VPQA 5FAJA 3KEHA 1DXIA 3UJEA 4G9PA 4DJED 3M41A 3E0IA 5FF2A 4GYJA 1YXCA 3M0YA 3AIWA 3TC7A 5AYXA 1JCTA 1XLCA 1EDQA 5D8ZA 1GYMA 2GJXA 3R6IA 1KQYA 3TMQA 3OZOA 3ITLA 1P6WA 3AMDA 3QGAC 2BS9A 4JQ1A 2BXVA 1QHOA 2VVNA 1XICA 1XUZA 3G5EA 1TMHA 1HL9A 2RGLA 3WUGA 4HKPA 2PTWA 1DHKA 1I45A 3KAOA 4WHBA 4UTIA 1HKIA 2C14A 2EKGA 2BZNA 1R85A 3A24A 2V0TA 2XU2A 2ZXBA 1YDOA 2ZX7A 1QTWA 4MUZA 2F2HA 4G1NA 3S2MA 4L5ZA 1DOSA 2VRJA 2Z2AA 1QW7A 4YCOA 1LRTA 4H6EA 1WO2A 3FDGA 4F2TA 2WVTA 1KM5A 3FSUA 2VZUA 2GZXA 4ZMGA 3RLHA 1B3OA 4V27A 4DWDA 4DJEC 3S6DA 4NJIA 3W53A 3GXTA 3PBUA 2Z6JA 3O15A 4RXFA 3N2BA 1KCZA 1TE1A 3QSTA 4AX6A 1OYAA 4UZUA 3OTRA 1J5SA 1PIGA 2GWGA 3OPSA 2FKPA 2VVSA 4UB9A 4DI8A 1K6WA 2I56A 3PY2A 4R27A 3MB9A 1V3KA 3R5EA 3E96A 4LUTA 1XLGA 4JFUA 1OGSA 1YNPA 3L5LA 3M7WA 4P5UA 2UZ9A 1QBAA 4UTMA 5E5CA 1Y8BA 1QK0A 5JIWA 4XUGA 2X40A 1F6KA 4UTTA 1B9ZA 3EMZA 2IQ0A 2Z28A 3BLDA 4V15A 4EIVA 3UR5A 1JDDA 4JCMA 3BV7A 1W5MA 3R1ZA 3V5FA 4DYKA 1XCXA 3BSGA 5C2CA 1V02A 3DN5A 4TR9A 3E0FA 4RZBA 4JIQA 1IT0A 2OVLA 2BGNE 4DQWA 4FX6M 1R9ZA 3HO8A 1XLAA 4IPJA 4ACZB 3DFTA 5HULA 1P5BA 1S2WA 4L4OA 4I7UA 3WF4A 3RPDA 1BWKA 3LRLA 1PZ2A 3P82A 4MZ8A 3S6TA 4MDPA 3L4XA 3MWAA 3EA2A 1ESWA 4GC3A 4PUDA 1BXNA 2EKCA 4HZ8A 1TA3A 3KS5A 3WDPP 1HXJA 3FLUA 4EPDC 3VI2A 4H19A 5CBJA 1A5UA 4C6EA 3F4CA 2EJAA 2CLIA 2X09A 2H8ZA 5J5DA 1GZGA 1L8NA 3KP0A 3W1UA 1R7OA 1GZ1A 3FSTA 2KAUC 4YYFA 4FLRA 2FTWA 1FWAC 1ZP4A 3B8IA 4D8LA 3O0FA 3SQSA 3UYIA 4E4UA 4M6QA 1KTCA 4HK5A 4F8XA 2PSNA 2Q09A 3I6RA 4HJWA 1K4GA 3V75A 1JXKA 3HV9A 3HMCA 4H1ZA 4US5A 3CAWA 2REQA 3WNOA 4MTVA 1IQ8A 1O5RA 4IWWA 2NX1A 2A7PA 1E6SM 4B90A 2GVGA 1PYMA 4YTUA 1B4KA 1W9BM 2ATMA 3NGFA 5LYRA 2NZLA 3W2MA 2YCJA 2NQZA 3U7BA 1X97A 1HVQA 4IPLA 3ITOA 5F2GA 5A6LA 2R9RA 2VX6A 4QGCA 3NQCA 3WJWA 3DBPA 1P4CA 4P7RA 5E93A 4KT2A 4G7FA 4JTFA 3WDHA 4N9EA 2PB1A 4JPGA 2OYKA 5L6UA 5TQLA 3TYUA 1DXFA 3NL6A 1IEWA 4QIUA 2BBFA 4DZHA 1E4IA 3WLHA 4IISA 1A0CA 1SJDA 4MY9A 3E49A 3ONCA 2OODA 1SPQA 2WLZA 3MI6A 1WDQA 1XIMA 3VO0A 3O06A 4CKQA 2ZZ7A 2WXDM 4GQRA 4HA1A 1V6WA 2Q6ZA 1YTEA 1B57A 1XM3A 1HJXA 4QG9A 4NZ1A 4K2SA 1PKMA 3W84A 1SMAA 4FSAA 4DYJA 1ZHAA 1YKWA 3A47A 2G3MA 4TV6A 2HE5A 1TPUA 5M5DA 4H9YA 2PGRA 2ZXQA 5HQMA 3RILA 3L2IA 4MYXA 4W8BA 4DBWA 2XUCA 4DZAA 1UBPC 1EBHA 1V3IA 3BW2A 4C91A 4IOTA 2F84A 2VUNA 1UA3A 1Q8JA 3WFLA 2NQ9A 5HANA 1WOAA 4M7SA 3DG3A 3GNDA 3LV5A 3R12A 5KINA 2X1IA 2PE4A 3PPFA 4C6DA 3GTHA 1W3TA 4EAYA 2YLLA 5G1TA 4B91A 3UERA 4PC8A 4QSHA 3L4WA 3GW0A 2INFA 4C6KA 2VP8A 3VDBA 3QOKA 3AZTA 4NI8A 1AJ2A 3N15A 4IUOA 3SN4A 3COTA 2PDYA 4OOZA 1SJCA 3IS4A 2EPKX 2OZ8A 3ABRA 3AMKA 1F7BA 3DBNA 3S5YA 4C6IA 1XLJA 3B0UX 3B8UA 4NYUA 2WQDA 2VJXA 5CZKA 3HIJA 2CCRA 1DWFM 5JH2A 1VD6A 3TW6A 3W2KA 1EJUC 5CZSA 3HPXA 3W7HA 3W7LA 2XN0A 3CQJA 3H2MA 2Q01A 3BG9A 3N29A 3WLPA 2JALA 3WF1A 1TQXA 4XVEA 1VH7A 2GDVA 3S1VA 5CPSA 2HBVA 1RPKA 1NFGA 4HA0A 3VIHA 2CLPA 2PTDA 4DM2A 4MKNA 2H9AA 5F2IA 4QCEA 3SY5A 4F9DA 1UMYA 3TUUA 4LV4A 1E72M 1S5NA 1PX3A 2BVWA 3RN6A 2D2OA 5FI8A 4YVVA 4HNLA 4Q4OA 4V1YA 4ZTXA 1GVSA 1GOMA 4DPPA 2YSWA 4LS0A 3SCUA 1P43A 4LUSA 4FIRA 4JFWA 1GW9A 2ADAA 3WUFA 3W28A 4O15A 4G7EB 2OX1A 2Y89A 4Z42C 1UYQA 4CN6A 4HZ7A 3CTLA 1T8QA 4N7QA 3AWOA 3LBCA 2A3AA 1KBJA 4E2DA 3B40A 1C8QA 3NNTA 3Q67A 4QCFA 4UOJA 4X0VA 2HQAA 2E9MA 2QCLA 1EQPA 2OELA 1EC9A 4AIUA 3SUUA 4MGGA 3WDQA 3AU2A 2V5LA 4LAZA 2CXGA 4HA4A 1E6PA 1RZMA 2FPVA 1GKRA 1N8IA 4S38A 4RKAA 3GW3A 5EPDA 1GQLA 3EWXA 3SUSA 1RBOB 3ZR4A 3B8SA 3M4HA 3WQGA 2Y7GA 1I2NA 3T8LA 3FXYA 4KEMA 2DZSA 2B7NA 3W7NA 1LTDA 4GJ1A 9CGTA 1EUNA 4LVBA 2CEQA 1EL3A 1W0MA 4IIGA 3PR2A 2VFGA 2QGHA 1XYMA 4PBFA 1MFUA 4IICA 2QCMA 3QR0A 4PCPA 1TJ0A 4C7GA 2ZRWA 3M0MA 4DF2A 1SSDA 1UR4A 2PI6A 4UIOA 3SGGA 2PC4A 1W5NA 5G2WA 3IJQA 3NQBA 2CLFA 2B4GA 4TQTA 3VE9A 4BI7A 1TTIA 2E1WA 4M6PA 5KTLA 4DUWA 3L2LA 3NXLA 4HHHA 4LVFA 3BQ5A 4DZIA 3SRKA 4ZQPA 2GGGA 3WJZA 3H26A 4ZENA 3D3FA 3F4DA 4IXHA 2D0FA 1R7AA 1NDZA 1XW8A 3BTNA 4GI6A 1CTNA 1JI2A 1KFWA 2XIMA 1TIWA 3QV7A 1NIUA 4MZYA 2ONEA 1VJSA 4GYFA 1TRIA 4CU8A 1M7JA 1M68A 3HURA 5A95A 4BQ3A 2F2KA 3D3AA 3RR1A 1YRRA 4M8UA 2OO0A 1JRBA 4HSOA 5A8OA 3TC3A 3CQHA 1WZKA 2QS8A 1CW2A 2Y6ZA 4XQ6A 1EEPA 5A1AA 2WANA 1VB9A 2AL2B 3RAOA 1KXHA 4IMGA 4E3TA 3CAQA 4HNCA 2EG8A 3KCJA 2OWXA 3AXXA 1LOSA 4J3UA 1TWWA 3LNMA 3W1TA 4W84A 3K4DA 3S1XA 3MS8A 1UC5A 1DE6A 3CHVA 3NL2A 1OX6A 1CXLA 3CTTA 1NAL1 3CWHA 2PEVA 3JW7A 3U6WA 5FOOA 1Q7ZA 4DEFA 4ADSA 3EX2A 1VBHA 3RJXA 2GJNA 4EPKA 3NQEA 4LH8A 3PFMA 1C9DA 1VHNA 5KZMA 3EB3A 1KM3A 5IFPA 3ZM8A 5XINA 3ZVHA 2VR2A 3MP3A 4BI5A 4GGHA 3W73A 3URNA 4L9XA 4W8LA 1XLFA 2J62A 3V35A 2HCVA 4D9PA 1BQGA 5FJIA 3CNYA 3IIPA 3CV7A 4GVFA 2WHKA 4CEXC 3MV11 6PTDA 1A5CA 1VRXA 3UWYA 4HCLA 2CWNA 5AY7A 3VUPA 2XIBA 3TQVA 3UJSA 3F5KA 1V0LA 3UXLA 1MRAA 1PB0A 1RCXB 1HN1A 3VM7A 5FJUA 1EEXA 2G5WA 3MMDA 2YIHA 4NP7A 3K46A 1XYFA 1OADA 1BVNP 2PWUA 1T7LA 1LQAA 5JMUA 5TF0A 1H1NA 4BZYA 3W23A 3HOJA 3UG3A 3SURA 1FCVA 2V5JA 4FXSA 1E40A 1S5MA 3T6CA 7XIMA 5CAHA 5JU6A 3SCWA 3WJSA 1A49A 1D7FA 4BHYA 1SO5A 2PD9A 2INEA 3QV6A 4W93A 1UWSA 1J01A 1O6IA 1PL9A 2XISA 4IJCA 1QHPA 2QV4A 2WHJA 4KFOA 1VFFA 1IXOA 4H8UA 3MANA 4LU0A 4FNQA 2BY2A 1XH1A 1V4YA 4FF7A 1NH6A 4RLIA 1RUSA 3B9NA 1AFSA 2EPNA 1JAEA 2CLEA 3UXIA 3BAJA 1SW3A 4H6QA 3ME3A 4R53A 4TIMA 3GYEA 3AWNA 1US0A 3QZAA 4P8VA 3N2XA 3A4JA 1UPMB 3HMJG 4FPSA 4GNVA 3V1HA 3AU6A 3GHRA 3CL6A 3UG5A 5CZ0A 2PDNA 3RITA 2DZPA 4KERA 3EWZA 3K30A 4Q8QA 3REQA 1LOQA 1VGAA 1ZALA 4WR3A 3TE9A 4B3KA 1F8MA 4IQDA 3C52A 2EBNA 1E9LA 2W5FA 4JTHA 3QYQA 3WQ4A 3C0QA 4HOXA 2DQXA 4JFTA 2WB5A 3CQ0A 4Y8EA 1OCJA 2VEPA 3SB0A 3VGEA 3F2CA 3B8TA 1NWUA 3G77A 1JZ7A 1BYCA 4NRRA 1XLLA 2DU2A 1ICSA 2OCZA 4L65A 4URIA 3UGVA 1K70A 1LBLA 2QDEA 3S4TA 4RNJA 2PWGA 2C19A 3OEXA 1RQBA 1EF3A 3RPTA 2YBVA 2YDAA 3VILA 2H3DA 3NPXA 2QCFA 4DIAA 3TQ0A 4JY8A 1Z69A 5FKYA 2Y2WA 1UOKA 3UZ5A 1XSIA 2PBOA 4WGHA 2WKLA 2F6XA 4I9MA 3A5VA 4OV9A 2WMJA 3BXWA 4DJFA 4XKYA 4C6QA 2TMDA 4AH7A 3OP2A 3IJLA 1P7TB 4TX8A 1OF8A 5FEZA 5BXTA 3H23A 4GI4A 3MVTA 2DSVA 3UVAA 1AW2A 1E6ZA 3UG8A 5C9WA 4OBTA 4K7YA 1OFRA 3SGUA 4WSJA 3TNBA 4EWJA 1GOIA 3A4WA 4M29A 1TZ9A 3P3BA 3M5VA 2HDJA 3II1A 4C7FA 3W82A 4LFYA 1JZ4A 4DF0A 1Q7QA 3WD3A 1GUVA 4XAGA 1T8XA 4QAIA 1FFQA 1XYZA 1BSLA 2WC7A 3ARQA 1K9FA 3BURA 5G1YA 2OX4A 1OK4A 1XG4A 1IEVA 4RE2A 1UKQA 5A8GA 1B1YA 4ZO6A 4WJEA 3WDJA 3AMLA 2ISWA 3GTXA 2P5NA 2JF7A 2YYUA 4RZ5A 4UBPC 5CBIA 3OG3A 3PBYA 2GUUA 2BVDA 3GLCA 1CXFA 1KRCC 2JKAA 1UOZA 4A8IA 2Y5SA 2DZWA 2WNZA 3H8AA 3DUGA 3VYLA 1EXPA 3NUKA 5HWJA 3SCTA 5FCZA 1EF2A 1R47A 1SZFA 3KS6A 4O16A 3UU0A 4M51A 4KWUA 1G94A 2VX5A 2NVAA 4ZCWA 4IHCA 4UTWC 1Q6DA 2HSAA 1F3TA 2QIWA 3HM7A 2V3DA 3FXGA 2R82A 3PULA 4UNIA 4ZB0A 2VFEA 1ZENA 2G3FA 1RK5A 2JK2A 1UKPA 3QC0A 4JX6A 2DSKA 1J79A 5KITA 2J7HA 1NP2A 1XYLA 2GVJA 1VFUA 2QT3A 3GTIA 2HBXA 1FWDC 2C0HA 2DT0A 4GCAA 3QZ6A 5EGRA 4XVDA 2VL4A 3LU2A 4J27A 3W6YA 4AF0A 1K7FA 1CEOA 1YYAA 4L6DA 1U1HA 2ZXAA 4U2ZA 3GNPA 1BXCA 4GHRA 1CXIA 2YXXA 4GZIA 1F5ZA 2WHLA 2W3ZA 4Z08A 2PD5A 4PUNA 3MUZ1 2C8NA 1T5AA 3PS7A 1GG1A 5DX7A 2Y88A 1VHCA 3CYVA 2O7SA 4MB4A 4DN1A 1GJUA 3R25A 4CD4A 1C92A 2R24A 3VE7A 5FEWA 4Z2GA 4FALA 2CBJA 2QVNA 1QOPA 4JHOA 1OVDA 3MT1A 2V2DA 4D1JA 1H7RA 3CB8A 4QG6A 1BGAA 3GYCA 4UNLA 2ZUSA 1FA2A 4ML9A 2VEFA 4K1GA 1CLXA 4HYRA 2PWEA 1PIIA 1W31A 2P50A 3NQGA 4PCTA 4LC8A 3KBMA 4U10A 4ZQCA 1LM1A 3HF3A 4HHLA 2XVGA 1YXYA 3WQOA 2WNNA 2D3NA 2P3EA 2ISVA 3D46A 4M3PA 3F5JA 3U5YA 3F1QA 2D24A 1EZ2A 1R86A 3P2VA 1QPQA 3PSVA 3HPFA 4PUJA 4E2OA 3EOUA 3IPWA 2QF8A 2FFCA 1BTMA 1YTDA 3VIFA 3HB9A 1KTNA 2BGQA 3L0NA 4JIEA 5DF0A 1L6WA 3S2JA 3A3WA 4S3AA 3M0XA 4O54A 3P62A 3LQGA 3VIJA 3LDVA 4B2DA 4YWSA 3IK4A 4GO9A 4GK8A 1OWQA 1EGVA 5L9FA 4MLRA 1RA5A 4FAMA 3A4XA 3MO4A 1LORA 4AWSA 1Z7AA 3CAKA 2YL9A 3MHFA 3DENA 1C8YA 4QR6A 4AD1A 4DUXA 4MAZA 1PSCA 4MJMA 4XO7A 4O18A 4I5RA 4ROQA 4FA3A 2GJXB 1KFKA 1HNYA 3L65A 5HMFA 1DJXA 5LXXA 4ASTA 3LN3A 3CV1A 1WV2A 2IPFA 4ZTYA 1V7AA 4J7RA 5B80A 3VM5A 3LCIA 3H2OA 1HQTA 2X1UA 1OYCA 5FL1A 1RLCL 1UZHA 1DYSA 1J10A 1TMLA 2W79A 1A3WA 2ZCGA 4MWAD 1EB3A 2DJLA 4LPCA 2WSKA 2OYMA 3KXQA 5CC7A 3IACA 3MUAA 2Y5JA 4RDZA 4XD5A 5BXRA 1AJ0A 1I2OA 3UEQA 3TTEA 1H5VA 2J9YA 1SZEA 2QJMA 3W86A 2V3EA 1PX8A 4CCCA 3EXSA 3SIZA 4H7CA 1OABA 4CU7A 1ZBWA 4HP5A 2ZUNA 3HGJA 2J75A 4UTJA 4IGMA 4PMQA 1RJRA 1P6BA 3TFCA 1GEHA 3OZPA 3T2OA 3Q2DA 1CZ1A 3TN5A 1XX1A 4HIBA 4MY1A 4M81A 3OBKA 2PDWA 4KCWA 3GDTA 3QMSA 2FQIA 3LSCA 2ZX6A 5HJLA 2R6OA 4DWSA 5CXPA 4W7WA 2YXOA 8CGTA 2UY4A 4GABA 5I2UA 1B31A 1HVXA 1TZ7A 1M03A 3L4ZA 3U2EA 1XIJA 4YPJA 4MWAC 3EWDA 4AB4A 3MZ2A 3PPHA 1UIOA 5I3FA 4QAWA 4AISA 2XJ7A 4DPQA 3IVUA 3PPGA 1WDSA 1QI5A 4WY0A 4GACA 3TJIA 3GFXA 3MJMA 2HXTA 2ZWYA 3NSNA 1UCWA 4C6MA 5I5RA 1VZWA 1YPFA 4DUOA 1J93A 3VNYA 1NFPA 1XLMA 4FXFA 5EMUA 5A5WA 3N2MA 3VIMA 3BV4A 4EACA 2VC7A 1TZZA 1IWAA 3K4AA 3THAA 3DI0A 1IR2A 4QP0A 1KBIA 3P0WA 3DFSA 5A6BD 2ZQ0A 1TA3B 4UCFA 2ISFA 3UFYA 1ZJBA 1VCGA 3I4EA 3N6JA 1JL8A 1B30A 3U8GA 4GIEA 2PDUA 3NFUA 2G96A 3VXGA 4O4WA 1JYWA 3OODA 3C86A 3OLGA 4JTIA 4PL1A 4WKHA 3GDBA 4LYRA 2FFIA 1W1IE 3UJ2A 3JVAA 3PK7A 1NOFA 3E2RA 2RJGA 3IIOA 3NM1A 4Q8MA 1JR1A 2YA0A 4A22A 1I75A 3IAQA 4HNTA 2W6RA 3WNMA 4GUFA 4DBUA 5BNKA 5DN1A 1BGGA 4D6IA 2G8ZA 4YCPA 4JQ2A 2REQB 4E4FA 1W2VA 4BFAA 2XZ7A 1GTHA 1CDGA 1FWWA 4B9ZA 2OTDA 1IWPA 3G6MA 4ZL1A 3WLOA 3CPUA 4F0LA 4KRZA 2QUNA 3MBFA 3ARPA 1ONEA 4LALA 1R8LA 2IW0A 3AC0A 3MYOA 1AG1O 3O16A 3MP4A 3RX3A 1DWAM 3QZEA 4MG4A 2D1ZA 2C71A 3AMCA 3SR7A 2YKKA 5GQBA 3UP8A 3ZSSA 1TRDA 1XC6A 3UXKA 2XWDA 4RR4A 3H4WA 3RLUA 5CGMA 2FHFA 1TWDA 2OXNA 3VABA 1IZCA 1IXQA 4MNLA 5TBOA 7TAAA 1SVDA 5EY5A 4YYCA 4TTUA 3GFZA 3PWAA 1RD5A 1SMDA 2A6NA 2A3CA 5I78A 2B31A 4YL2A 3ABQA 2Z27A 4Q8UA 5CPTA 4K39A 5D02A 1ZP3A 1ITXA 1ADSA 4I8YA 3PZGA 2V69A 4PCSA 4AIEA 3M0IA 4ZVJA 4O1BA 4XSLA 2XGZA 2IMRA 3MSYA 2OSXA 1OY0A 5FJPA 3GG0A 1RY8A 1FDJA 3VNLA 2JGQA 3AISA 1LT8A 1GHSA 1WBJA 3M0JA 1TPB1 4AWEA 1ZBKA 2J7GA 3DI1A 4XD4A 5K4XA 4A29A 3CUXA 3CUFA 3UWWA 5IHSA 2I5IA 3CQIA 5BU6A 3SAZA 1ZFJA 5LNUA 4GIYA 4GUJA 2O7QA 4INFA 2NWRA 3FNDA 3CMGA 1QI3A 3G1HA 3DG7A 3MCOA 2QDGA 3P84A 4CUCA 3VIKA 3S1GA 3EB2A 4DO6A 3CUJA 4H8HA 4UCGA 2R1NA 2YYTA 5IDZA 3UW6A 1WXZA 1SW0A 4RNHA 2Q8LA 1PBGA 3CZEA 4XZHA 2WCSA 1M3UA 1Q65A 5FJJA 3W37A 3L66A 1GZJA 3S9IA 3EOLA 3ALFA 3WH7A 4NG3A 2DZBA 3TXVA 1UWAA 2Z26A 3LK6A 2YLAA 2DY3A 3BL3A 4JKMA 1J0KA 1WBHA 4ZOAA 4PH6A 1O1ZA 1UUOA 4AU0A 5ABFB 3SEPA 3HGSA 3O07A 5HA7A 1ZJAA 1F76A 4AD5A 2E28A 5HJYA 2WVVA 1H2JA 3I4KA 4JKLA 4DAIA 3E0WA 3WBAA 2NV2A 1OCQA 1OT2A 2V5DA 2BHZA 3CIWA 1KBKA 4Q8VA 5HNNA 5GJMA 3A9IA 2FZNA 3WN6A 3TYEA 4BK9A 4IGNA 2OZ3A 4Q8WA 4UOZA 1TX2A 1A5KC 3OOQA 2WC3A 1IXNA 2HE8A 1P6CA 3L2MA 3RNDA 3N19B 4NILA 3W4RA 4ZB2A 3W7OA 1OX5A 1IE7C 3UA4A 4E8DA 4D6DA 3LERA 1E15A 2H9AB 5AYBA 3KCOA 1FWTA 5IXEA 3W75A 5CPOA 3W9ZA 1RY0A 5I09A 3UPMA 3LM3A 3SCVA 1BYBA 2G3IA 3QYSA 1GVFA 1AH3A 1QCWA 4R9OA 2VC9A 5D30A 5BU9A 2E5DA 3EPOA 1G9HA 2J8TA 4YMZA 2A6LA 3PNZA 2V38A 4DY1A 1UA7A 4ERAA 3B9DA 2EQDA 4LUSB 1H41A 2I9UA 2EAWA 4GFIA 3R8HA 3PWGA 2V2CA 2BDQA 4J1OA 1CBGA 1KBLA 1M7OA 1JD9A 4R3UA 1M6JA 3PZTA 4BR1A 4V33A 4S39A 4O1FA 2B7OA 1PZ3A 3E9AA 2Y0FA 4XSMA 2BOEX 1RCOB 5HQEA 3QTPA 3KVLA 3LCFA 4HK7A 1IYXA 2A7RA 2DZAA 4I9TA 2VT0A 4D72A 3W2UA 1XXXA 1ZB5A 4JCLA 3W02A 1JGMA 1FDZA 3RO6A 4AMAA 1QO5A 3TDFA 4ML4A 4JTLA 2ZDSA 2V5BA 3C56A 2IPJA 4AXKA 3AS2A 1F3XA 3OW1A 1ZBCA 1XF0A 1DJNA 5FF3A 3DOPA 4EANA 1Q4NX 1Z44A 3SW6A 3K8KA 1HJUA 4A8NA 1FHLA 2J47A 2F7FA 2E5BA 2WBKA 1TJPA 1W3LA 3VA8A 1A5SA 4K38A 3AJ7A 1M53A 4D2JA 2OZ0A 4JTKA 4S3CA 2CXEA 3MCMA 3ZZ1A 1I1XA 4XKMA 2J79A 4D6EA 1XIHA 2ACQA 1XC4A 5EMYA 2V3FA 2WSYA 4CCEA 3T8QA 2QEZA 3RRAA 4QISA 3GU2A 3UWVA 1R30A 2HJPA 4IMDA 5H8PA 3GXMA 3W1AA 3WH8A 1EJVC 3QFWA 5AC4A 3AYVA 4IPNB 1YE4A 1NF0A 3UZXA 2VGGA 3LA4A 2WC4A 2EEXA 4GA8A 4Y6GA 3NOYA 4O8AA 3CWOX 5KZDA 2CU0A 1MUMA 3NQ6A 3RU8X 1KCXA 2OFJA 5C9XA 3EXRA 1SFSA 4O12A 4R7OA 2JBMA 4JAWA 4GIRA 1N8WA 4AC1X 1OX4B 4GIAA 2PZNA 4KFPA 4N6FA 2ABBA 4M6VA 1RQHA 3S9ZA 2OGJA 2W62A 4N6EA 3DXIA 2PDCA 1ITCA 4FXJA 1WKEA 3ZT7A 2Q3OA 3MUCA 3FAWA 2VZTA 3EWUA 3O63A 4GH1A 3BWWA 4MVAA 4OV4A 2EPHA 3POHA 5EBUA 4HU0A 3C2FA 3W2LA 4JEQA 2WNQA 3WNKA 1HGYA 3NDYA 4S2CA 2FDSA 2ZX5A 4JTUA 3BLFA 1WA3A 5A8NA 3NM3A 3O9NA 2PDJA 3S9YA 1Q45A 4XZWA 4ACYA 3KBWA 1CI1A 1A5MC 4IIBA 4I6KA 4RE0A 4C5ZA 3ZVHB 3G6LA 2E8ZA 3UVIA 3MC5A 2PDGA 2GL5A 4NJKA 1TR1A 1QFEA 3PBGA 3TWAA 4HJFA 2BOFX 1ODUA 1CX9A 2NXGA 1HO4A 4QROA 1FWFC 3E6EA 4BI6A 5JH1A 5LIUX 1X8FA 2VEMA 3PP7A 4LB4A 5JIPA 2NV1A 4FNRA 3AIUA 3C2YA 1NELA 4KKXA 3T9PA 5KSWA 3KOFA 1JVNA 3L68A 1XCFA 3AIBA 4JN6A 3GKAA 1G7VA 1E1EA 1U5VA 1DBTA 2J25A 5HNUA 5T26A 3AICA 5CEWA 3CQKA 3HTWA 3LHVA 4US6A 2VXNA 1K7XA 3TIMA 4O1DA 1I60A 3UXDA 2OQHA 5D33A 2OJPA 2H3BA 1QNPA 4J5NA 1W9UA 1Q6FA 1P0NA 3W2NA 4UR9A 1W9DM 4Z1DA 1IZKA 3UQNA 4BWLA 4DVOA 5G4EA 2PWVA 1UWRA 3THCA 1EYWA 3NEVA 3NOEA 2ZRYA 1TTJA 3Q45A 4FR1A 4PEKA 1V03A 3C6CA 3T1GA 5AB3A 1VR6A 3EA1A 2GVEA 3MSDA 4H9XA 3SSZA 4XZIA 2X0YA 4JNMA 2XH7A 4MNKA 1Q6EA 1LWHA 4H04A 1FFRA 2I14A 5A6SA 1ZTVA 2F6KA 3RM8A 1CLKA 1SO3A 3FX4A 3LCLA 3REQB 1AW5A 5F4XA 5F1UA 1U33A 2Y85A 3UWUA 3ZJ7A 4AYGA 5K7JA 4WDTA 3HQ1A 3G1VA 3T40A 4F66A 3TC6A 1J96A 5HQLA 4GZJA 4UFLA 2PU1A 4Z1BA 2QDDA 3PTQA 3W1PA 2GUYA 3FDKA 3FJNA 3HG3A 4B3LA 4Z2KA 3SGZA 4W5ZA 1OZQA 4D8ZA 4NL1A 2XFYA 2XH0A 3C0JA 3VZXA 3SCOA 1XQKA 5GJNA 2UWFA 2VURA 3GU1A 4LUIA 5D37A 5T9CE 5LXEA 4XKYB 4OBSA 3QR3A 3HJZA 1VBUA 2CBVA 1KM0A 1WKDA 5EB8A 1EZWA 2PDXA 3L0GA 3QXBA 4DHGA 2D0GA 3TZNA 2RUSA 1MUWA 2PDPA 3VNDA 1QT1A 4PFMA 1YHTA 1DORA 3W1MA 1J12A 3KVMA 2Y7FA 1GYNA 1QR7A 3WL1A 3VDGA 3MV01 1XWYA 5A8MA 1DJZA 4ES4A 3NQVA 3VIGA 3QGVA 2WKGA 3EOOA 4HZMA 3JR2A 5D03A 4LCSA 3GDKA 2GQ3A 5A6MA 3M9YA 4R88A 1GOQA 2JF6A 1KFLA 5CSYA 2AAAA 2W4XA 3QW3A 2D22A 4LY8A 3CHDA 3WQVA 4YHEA 2X1SA 3FEMA 4BQ4A 1VCVA 4LVDA 2RHGA 4DF1A 4HSHA 3GK0A 4AZCA 5AC6A 5D2TA 2O9RA 3HV8A 3TV8A 5AC8A 5CC3A 4GQ0A 1BF2A 3OIHA 4PMZA 1J18A 3O05A 1WZLA 1F3EA 5I6SA 3ITTA 3MPGA 5T8GA 4UFHA 1XISA 4UQDA 4AY8A 1PAMA 3M43A 1QI4A 3QM3A 1JPIA 2FVMA 3UG4A 1U83A 3ZR6A 4WOQA 1J0JA 4UTLA 3GZAA 3CEPA 4PEEA 4FLOA 3OVRA 3UETA 2VRQA 4AIOA 4AZBA 1MW1A 3GVWA 3R0KA 2Q8XA 1E3ZA 5PTDA 3M64A 2XIIA 1MQRA 3VFCA 3I3EA 3AXHA 3AOFA 1J5TA 3LCHA 1JQXA 3MVIA 1EOKA 3DFNA 3ARRA 3K8LA 3FJLA 4GMEA 5HNRA 3BLLA 2BY3A 5KZ6A 4PUMA 7ODCA 5BROA 4AF0B 4PTVA 4XTDA 3PZIA 1X1ZA 4RCXA 2OEJA 4PN2A 3C3NA 5C6MA 1F8IA 3SJ3A 3FOKA 3LEPA 1PE1A 4W85A 2AL2A 2ZVRA 3KWSA 1V6YA 1TREA 2HS6A 3BAKA 4F0HA 3H2EA 2ALRA 3VUSA 2J8GA 2HWGA 4K8EA 4CD8A 5IRPA 5DCEA 3RDKA 1K8YA 5D9OA 1U5JA 4CNPA 3KRBA 4NAFA 5A69A 3ZLFA 4B5SA 4PUWA 3S5OA 3C0SA 4TXEA 3ZLHA 2QYGA 2RDXA 4HU4A 1WCGA 1WE5A 4E8CA 1KA9F 3LPFA 4BQ5A 4TU1A 1X8CA 2WZHA 1XLDA 4FIQA 1W3NA 3EDFA 2X8RA 1EA0A 3PJWA 1KW1A 2FZMA 4JN8A 1RA0A 4M80A 1FH9A 3MMTA 2V68A 3WF0A 3SQMA 4AWUA 4WEVX 4A3YA 5LNVA 3VKJA 3N9RA 4XG1A 5DMLA 1Z89A 3KVJA 1DXEA 1AVAA 3A23A 5ABGA 1DIEA 3BANA 3USBA 3CASA 4IL2A 1F6PA 3Q4DA 2O56A 2PAJA 3WK0A 3MUIA 4XISA 3QHNA 1HJQA 1F4HA 1EH9A 2CWXA 1A47A 1H63A 3BMXA 3M5ZA 3VAVA 2AGKA 4CN4A 5CG0A 4UTUA 4DLFA 4NKCA 5AVHA 7PTDA 5D9MA 4OUIA 3W7IA 1V6XA 5FESA 1EO5A 4YWIA 3T44A 5BWFA 3GAYA 3LHTA 3W3OA 4JIHA 1JPDX 1MXSA 1KRBC 3UJRA 5H8MA 4MKVA 1H3GA 3EEZA 3UA3A 1R46A 1LROA 3W87A 3LUTA 4PUEA 2WV8A 2BV9A 2RDWA 4AVOA 1JZ3A 3CZKA 5GNYA 2VHLA 2PMQA 4NQ1A 5G2IA 4NX5A 5EYWA 4B3ZA 2Q71A 3TN6A 5LZLA 1UP2A 3DEQA 3L4UA 4NVTA 3W25A 3IJ9A 1JDFA 1ZS2A 3HFYA 2PCQA 1R2TA 3N34A 3VGHA 1E3XA 1TE6A 1PWMA 1TG7A 3E2VA 1TIMA 1TR9A 1DE5A 3WQ8A 1KR0A 3CMFA 1CGVA 3W7RA 3LBMA 1ML1A 4WDUA 1FY6A 4I7WA 1PCKA 4J2PA 1NSJA 3N4FA 5DLCA 1ZQ5A 4JNZA 3KM8A 2V2HA 1X6LA 1V7YA 2WVSA 3AJXA 2WVUA 3QBUA 2QMJA 1W1A1 1BWLA 2GGHA 3BAWA 4M24A 4MPQA 1HKVA 1R9XA 3PAOA 4LAKA 4D6HA 5GPRA 3R0UA 3RLGA 1YNYA 1TJ1A 3ABZA 5K9CA 5M1TA 2ACSA 3OLIA 3KVKA 3I10A 3NIYA 2QCEA 2PTYA 1FTXA 2VR4A 3WNNA 2CLMA 4GRSA 4QE5A 5BRPA 4DWSB 4GXPA 4H9TA 4WCJA 1L2UA 3O6CA 2DP3A 2V5CA 4CEUC 4EXQA 2E09A 1DWJM 1HO1A 4XZBA 2WBGA 2Y8UA 4GPNA 4YTSA 3HFTA 4OU1A 3RX4A 1O66A 2DVUA 3P0XA 4HZ6A 3A3HA 3O0KA 4AWTA 2EHHA 4IPIA 4EF9A 4H8VA 2CHOA 4K68A 2ZXDA 3GRIA 2QPSA 4QS6A 1WB0A 1KM4A 2DZXA 4WY0B 2CLLA 3USZA 3WK1A 1QAPA 3RGTA 2E6DA 4LYKA 4YJ5A 4LYQA 1QW9A 1VBRA 4W87A 5B7YA 5FF4A 5FACA 3CZGA 1LBFA 2BP1A 2D73A 2Z0IA 5CJNA 2WZTA 3OGVA 1E51A 1MQPA 4H9MA 3CPGA 4RX0A 1BF6A 3WLQA 1WPCA 2PP1A 1VJIA 1OYBA 2RGMA 4F9JA 1QPNA 2PGWA 4AMCA 1XKYA 1JUBA 2QR6A 4FK9A 3TYBA 5KZEA 3W70A 4UQAA 2ZZ2A 2BXZA 3TNOA 2QCGA 1AUSL 5HBFA 2YCLA 1TPWA 1HP5A 5C7VA 3KWXA 4I8DA 5AZ0A 1UR9A 4O1EA 4J9JA 4UC5A 1LUCA 4FR6A 3ES7A 1KRAC 4HPJA 3LQLA 3AYRA 3MMWA 4KEVA 1V3JA 3ORWA 5J04A 4DJDA 3O1NA 4XBJA 3L0KA 2FZBA 1TWZA 3VOGA 1EJ7L 4P8UA 3MO7A 5FF7A 1Z6KA 2G0WA 3TJXA 2XG9A 4GYPA 1FOBA 3DGRA 1KR1A 4HYWA 2IXUA 4QQ3A 2QUMA 5CSUA 1Q3NA 1HKMA 1V5XA 1OGGA 3ERPA 3UZYA 4ATDA 4QJ3B 3MY9A 3R89A 4RZ4A 1TCMA 5ABHA 1QMLA 3W7GA 2EPMX 2C7FA 4UFMA 4B5VA 4QITA 5BCAA 1TPH1 4IFOA 4PSRA 5G1MA 3N18A 3NQMA 4PE8A 4DBEA 4O4VA 4D1IA 3O6YX 4PTXA 3CC1A 4KEZA 1UD5A 1X98A 5C70A 4AYSA 3NQ7A 4TVCA 2ACUA 2NLYA 3AO0A 1Z42A 3OHIA 5IFTA 2NVCA 3DESA 3O8AA 3QSRA 1KB3A 3AROA 1A5NC 4PMVA 3LHZA 2YB1A 3KOZA 2I5GA 4NZ3A 3BG3A 3NPUA 1XHGA 2UV8G 3SI9A 5IBXA 4GUHA 4KCTA 4H7VA 3DFQA 1MO0A 2FIQA 4REQA 3ZSTA 3A4AA 3VMPA 1H50A 4YTRA 1EJTC 3VKAA 1V0MA 1GNXA 2CNCA 1A5OC 3V4BA 5J5RA 2XFFA 4W86A 3KBVA 7ENLA 2GDQA 1XLKA 5DCDA 3GG7A 1UASA 1REQA 1XI3A 5HNTA 4UTTC 4RL3A 3I6TA 5A6BA 4R34A 2AMGA 4GE8A 2YCEA 3LZ3A 5MHBA 3W74A 2OWCA 1OZMA 3NL5A 1DJYA 2Y70A 4G2DA 1VEMA 3N6HA 1DVJA 1P1MA 4ZE5A 3IEBA 4EE9A 3QHMA 2VX7A 4US5D 1KV5A 1FHUA 4UZSA 1US3A 2GVYA 5LNSA 4WIWA 3LB0A 3GTFA 5F4WA 4DNHA 3BJSA 1YNQA 3UCQA 4W88A 3N04A 1FXPA 3PJUA 5IHRA 3WQ5A 3KL0A 3GQYA 2BTMA 2VWSA 4Q8OA 4MLJA 4E4PA 1IR1A 2VEKA 3CLMA 4UNKA 4AD3A 2J7DA 5TNVA 2WSPA 4Q4QA 5HJXA 1UD8A 3XIMA 2J6VA 5BMWA 4DO5A 4U28A 5D2YA 3GDLA 2WVVB 4P8WA 3EA3A 5FJOA 1EC7A 1DIOA 1JF5A 3T0TA 4F48A 1KCKA 1H11A 2WWCA 4L1XA 1BRLA 3OYZA 3GDMA 3A21A 3GS6A 5HK4A 4ADUA 2NWSA 4BJHA 3PN8A 2RAGA 4AY7A 1G5AA 4H6RA 4ZB5A 3GR8A 3CS2A 2GGJA 4JS3A 4RZ6A 3PANA 1E6QM 3QVQA 3TYZA 1DIKA 1HL8A 4EAMA 3NG3A 4BKNA 1XIBA 2DH2A 4F4RA 4GI8A 1FH8A 2ODOA 1ITUA 4RDYA 1GGOA 4IFKA 1KLYA 1OT1A 2C6QA 3S3GA 4H00A 5LGXA 3OVQA 2WCAA 1YX1A 1EC8A 1UKTA 3BQ6A 3CUIA 2GSEA 4P8XA 4RNFA 2UY5A 3N9KA 4LV9A 4U5KA 1FWJC 4Y9NA 4J3TA 4J3XA 3EGJA 4WXYA 4DXXA 3QY8A 3D0CA 4FOJA 5H6HA 3QV8A 1GKPA 4J2MA 3BAIA 1ELSA 1Y7VA 2HK0A 4K8GA 4LY4A 3GIQA 2AOSA 4MOZA 3DYOA 4FMVA 1Z8AA 1P1XA 2I7GA 4C1NA 3WUBA 3RMEA 2P0OA 5DXXA 1MXGA 1E4LA 1HGWA 1YPIA 2BG5A 3I3BA 1TQJA 1S5TA 1NDVA 4CN1A 1S39A 2E67A 3DZ1A 4W89A 4K37A 2ZZ6A 2JGYA 3WDIA 4N9DA 2X16A 3B4UA 2P8CA 1GVRA 4WUIA 1O1HA 1NDWA 4JIRA 2NXIA 2HEJA 4PBGA 3C3UA 4LANA 4QRNA 3CBWA 3QPZA 2NUYA 2PC8A 3CLWA 3B03A 3MSGA 1LLWA 3W26A 3EPMA 3DC0A 3GD6A 3HGRA 5DT5A 3LCWA 3UR8A 3I68A 3NSMA 3U7VA 3QHOA 3W1QA 2CHRA 4DXKA 1IGSA 2R14A 3PSWA 4NNBA 3EX6A 4UQEA 3SN1A 2FHCA 4W5UA 4ERIA 4H41A 1UP0A 1H4PA 1OG6A 3DYPA 3SRHA 3M5XA 1EA9C 1EHAA 4P7LA 5IM51 2ZX9A 2ZADA 4X22A 4NAEA 3KE0A 4K8HA 5DMNA 3TQPA 4ZFMA 3QLLA 4UQCA 1QOQA 5BOFA 1JZ5A 4IJRA 1ODZA 3WCZA 1A3XA 2XYLA 1JCNA 4HU3A 1AW1A 3B4YA 2FMOA 2F6UA 2GUBA 3SCNA 3TJLA 1XRSA 2X2YA 4HK6A 5AVNA 1LJYA 2ZUUA 3IIZA 3SFWA 3GAKA 4HBKA 3PUGA 1IIGA 1QVBA 4UUIA 1R9YA 5IOBA 4Q3MA 4WSKA 2G50A 4MB5A 3GVQA 2B81A 5D4YA 4U2YA 2VEIA 1G67A 1ME9A 3ZWTA 1FCUA 5DMYA 4MNJA 3TN4A 3BUVA 5AYZA 4GQGA 2IQDA 1TVNA 3GR7A 3SUWA 2JEQA 3MWCA 1W3HA 1AA1B 4C6LA 3P80A 1TPEA 2MUCA 3QF0A 4JTSA 3WJXA 1LQ2A 3B0XA 4YIWA 3P8IA 2Y8KA 1PUDA 2ZC1A 4U4MA 3L21A 3SZ8A 2ZKMX 4AC7C 3B8VA 5HWMA 1CECA 4JKKA 4L61A 1PVNA 3TK7A 4CQBA 2TYSA 3FA5A 3SCPA 1H7NA 3TN3A 4RW5A 3NZRA 3APYA 1CGXA 2DZUA 3UCCA 2XWEA 4YTQA 3FHQA 3CUHA 3ECQA 1Z41A 1HKJA 4V28A 5LHFA 3B3DA 3CV6A 2WJZA 4Y7EA 5A6AA 1W9VA 3ZFHA 2VX4A 4S3BA 4Q4PA 5A2CA 3UJFA 1WYIA 3UD6A 1ME8A 4TX6A 1NDYA 4QXIA 1FP9A 1J0IA 1EJRC 1G4EA 2W91A 3NO5A 2ALDA 2IKIA 4C1LA 3QLDA 2GWNA 5H2ZA 1RP8A 4NF7A 5K3VA 1UJPA 1M7XA 7TIMA 1E5JA 1TVLA 4IQLA 2CKRA 2C16A 2FPTA 1W3JA 4JICA 5K4ZA 1KM1A 1OFBA 3W1LA 2YBUA 3ATYA 4F0RA 3TSMA 3CV2A 3RHGA 4HCDA 4NZJA 3DCPA 2FPYA 4EX4A 3HG4A 1ICQA 2HMCA 3AFBA 2FVKA 2ZA2A 2VENA 1I2PA 3VMNA 3R7MA 3GNXA 1O5QA 1OFOA 3MI3A 9XIMA 2OSYA 1E0XA 1Y0EA 5A8QA 4CQAA 3HBLA 2C79A 1UROA 1LRNA 7REQA 1NARA 1J0ZA 1E9ZB 5CZJA 1ZZMA 2VGFA 2ATSA 3TCSA 4B92A 1LLOA 5F2LA 2A85A 4NX0A 2J77A 4X0NA 2WZMA 1VBGA 1P0DA 5G4WA 5I23A 3B9AA 2TODA 3TR2A 2VGIA 4NRSA 1ISWA 3WEZA 4PL2A 4MFEA 3S8HA 1PKYA 1BD0A 4A8LA 2Z7KA 2PGFA 4Z2HA 2O9TA 4JY9A 3T4WA 2A21A 1C8XA 3U2OA 1G1YA 5EL1A 1A53A 2JFEX 3ITVA 2NV9A 3RIKA 3T7VA 5LGZA 4JXCA 3WL0A 5ABFA 3G1FA 3CIXA 2GOKA 3QMRA 3W7KA 2MANA 3SM0A 2WZEA 5E1QA 1HG3A 1QHZA 4CGTA 4LS2A 1HTIA 1DV7A 5AHEA 2QJGA 2XSBA 3TWBA 1I0DA 2GQAA 3OLEA 5D9PA 3DC8A 1TMQA 1XRVA 4KF1A 1F4AA 3B0VC 3M44A 3STPA 2PDFA 4AZ7A 1JFXA 3T0DA 3WSUA 3L12A 3WLJA 1FKWA 1CCWB 3POCA 5AC5A 3S83A 3PNUA 2Z1VA 1QXLA 3QTGA 2D2HA 2DW7A 1WAUA 3K2GA 3TOPA 2WWDA 4F0KA 4QDWA 2CBIA 4UMBA 2LLEA 3ENLA 5EFDA 2Z1XA 1KQZA 3NR0A 3VU2A 3KP1A 2AKMA 1JYVA 5XIAA 1AL7A 1Q66A 3GBDA 3QY6A 5LNRA 2QNEA 3H4XA 1Q13A 1BLIA 1VS1A 4RXGA 3OVGA 3W01A 1A0EA 5AHMA 2AMXA 3BGGA 3VCRA 3PFRA 3W2JA 4O0QA 4UTHA 4W9TA 1UH4A 1JQVA 2FTPA 4U3AA 3VCNA 1LDCA 1JPKA 2CPUA 1X6UA 2YCKX 4I5XA 1MYRA 3N3MA 1NF7A 2VZVA 4GQQA 3WH6A 2YGYA 1XCWA 3H55A 2W66A 4A3QA 2A5HA 4PMJA 3C2EA 1J6OA 5I0DA 2B7PA 3THUA 3LHWA 3NL3A 4QE1A 2ZUVA 3BZJA 1QNRA 1H60A 1SZGA 2WM1A 3WX7A 3ZJ8A 4NZ4A 4Z0SA 2W92A 2PGEA 4IP4A 4AY1A 1E9YB 1RD6A 1Z9AA 1XD1A 4XWUA 2G3NA 4AZCB 1O95A 4L64A 3KTXA 2YDSA 3TP4A 2PBGA 3NGJA 3V1PA 1AQHA 1KNWA 4HSNA 3R2GA 3GM8A 2Y24A 4HMDA 1VPYA 1R6WA 1PYFA 2FLIA 2HROA 3N4EA 1CPUA 5AYIA 3T08A 1PTGA 1SJBA 1PXGA 3BVJA 3WD0A 2NSXA 5ENLA 1EJSC 1LBMA 4FNTA 3HQOA 3C61A 2NVDA 4FX7A 5D2VA 3BAYA 4C6OA 4YVPA 1MEWA 1ME7A 2J7EA 3URAA 4DBSA 4A4AA 2BY1A 1DIDA 3EAUA 2CZDA 2HNHA 1N82A 4GXMA 5DEZA 3G1SA 2BASA 2QMKA 2OU4A 4ZBCA 1EDTA 1DJGA 3WLRA 2YFNA 3P67A 9RUBA 2NX9A 1BFNA 3VDHA 4EP8C 1OX4A 1NM9A 2CETA 2IUZA 4NJGA 3RJYA 1XP3A 5DBUA 3GXFA 2HISA 4DJFD 4A3RA 4C6BA 4QM1A 2E25A 2VELA 1WUFA 4HTBA 1KV8A 5A94A 1V08A 3RLVA 3WLKX 3LGGA 1ZPTA 3PTKA 8XIMA 5ECUA 5DRCA 4QQUA 1KRMA 4AQLA 1W3KA 4QJ1A 3K5XA 4W4QA 3WMBA 4HU8A 1SJAA 4KGJA 4NAFB 3B97A 4ZQRA 3EKLA 2C1IA 2WM0A 4UR8A 3BSMA 2GOUA 1C93A 1EQCA 4S1FA 3DFYA 1VC4A 3FIGA 5HXMA 1QI0A 2VDHA 3VNIA 4S3DA 2E77A 4O53A 5A6JA 4Z1CA 1L9WA 3EDKA 3L5MA 4XD3A 1GPWA 3IGHX 4MFDA 4UMCA 5D32A 1AD1A 1Q4WA 1PIFA 4V2XA 2P1FA 1F61A 3D47A 2HZGA 2P3ZA 2E40A 2YZRA 1IT7A 4DJFC 2NSOA 2BWGA 1KWKA 4WOZA 4JQAA 3O6AA 3CH9A 4MSSA 4AVFA 4DO4A 1J2WA 1JRCA 1OCBA 5LSMA 1FWNA 2GSJA 4FZIA 3LRMA 1YLVA 2DDXA 3NVTA 5I06A 3M5YA 3WLLA 1WUEA 2WZIA 3AHZA 1YQ2A 4L4PA 1JCJA 3E74A 1VP5A 4MY8A 2V63A 1OD8A 1V3LA 3H21A 5H8UA 1FDYA 2Q02A 4H4IA 3QPYA 2Y5EA 5A2AA 1ZCCA 5JBEA 1QNOA 3N25A 1W5QA 3VKBA 5EKYA 4L6OA 4C6FA 5IDIA 1DQXA 1WDPA 1H1ZA 3ZWSA 2E8YA 3TMLA 1XIDA 4JYFA 1HF6A 3EKZA 2Z00A 3W6MA 2CW6A 5BZAA 3OZMA 4IM4A 3R13A 2R1PA 2AAMA 3LPPA 2FGZA 3W72A 3N13A 3S5NA 2A7NA 3BLOA 3UZZA 3S42A 3F5LA 3Q37A 4I9AA 5A3HA 5EBAA 1GVEA 3QQWA 4KETA 3AXKA 3KHJA 3T09A 3WK3A 1EYEA 1U1JA 3N9SA 2FB3A 6CGTA 1ISVA 2XINA 1XV8A 2XH2A 3WDRA 5HPCA 4Y90A 2VDIA 3IVTA 4WZHA 3BARA 4JBRA 4ZQNA 2DFAA 2KZHA 3BGAA 2XIOA 3PJTA 2OB3A 3S1UA 4HNNA 4QX4A 2OLSA 4E38A 3T42A 5CLTA 2A4AA 4RE3A 1YXDA 3L4YA 4LTSA 1UR1A 3BAXA 2PU0A 2YA1A 5HUPA 3NZPA 1XINA 4CD5A 3W27A 8XIAA 1XBVA 2PTXA 3WD1A 2EJ1A 3IUIA 3BK0A 1ZJIA 1JF6A 3VKCA 3EDDA 4OQVA 1O94A 1JDEA 4QNWA 3SDOA 1V0KA 1JPHA 4HPXA 4BQ2A 5FF0A 3KX6A 4Y8FA 1XLHA 3WLSA 3CH0A 3FY1A 3KL3A 5C7HA 4Y2WA 3D5HA 4B2DD 4B16A 3U0HA 4CCDA 1I9CB 1O4UA 2O9PA 3R43A 4HMCA 2E6FA 4QDMA 2E9BA 1JCXA 3ICJA 1O68A 4OT7A 1ALDA 1UIPA 1TV2A 2PTZA 4AUBA 3UR2A 1CGYA 2JIWA 1HFBA 3IV8A 1NVMA 4HGXA 2WCGA 3PTDA 4PCFA 2OPJA 1QPOA 3N3TA 2ZZ4A 1HJSA 3RX2A 4H2CA 1E6RA 2ZUMA 3UWZA 1Q2SA 1MEHA 3NQ2A 3B9EA 2DT2A 3MDWA 4C6JA 5CQ1A 2YJQA 4XTIA 2J9ZA 4WLCA 3OA3A 4ZGYA 3ARSA 1QOXA 2HS8A 3KBJA 4O52A 2W61A 2YCLB 3DHDA 3EEGA 4LRSA 1V79A 3LV6A 4WXZA 3LX9A 3H7VA 4U33A 1WDWA 3D6NA 4DXVA 1JI1A 2P88A 1F3WA 4AIBA 3ITGA 2Z4GA 3CL8A 1KGXA 2CIPA 3IJ7A 1LUCB 1AZ1A 1MZRA 3RMJA 2RDUA 1EKOA 1THFD 4AHOA 3WELA 3KW3A 4CNNA 1RCQA 2QAPA 2EG6A 2R1LA 3AAMA 1OEPA 1RALA 2OQYA 4IFRA 4TO8A 4ORIA 1LWJA 4WJ8A 1CB7B 2P53A 4CNOA 2AQVA 4AEOA 4NSBA 3BCJA 4R33A 5LKYA 4AZHA 5CGTA 3HA1A 2NX3A 3V5OA 4WD0A 2MNRA 4S3EA 3SRFA 2QUVA 5D2WA 1XBZA 1F05A 4X2RA 3EWYA 1EO7A 1NP0A 4H6KA 4AZGA 3SUTA 3BH4A 6XIMA 4XAFA 4OVXA 2ZZ3A 4KWSA 1AD4A 2QKFA 4PTWA 3G1YA 1CGUA 4DWSD 3ARZA 3BGJA 5GNXA 1FKXA 2QULA 3THDA 3W88A 5M17A 3W6LA 4Z17A 3CM4A 2ACRA 3EXTA 4O50A 4DB7A 5DBTA 4ICNA 1I1WA 3I7SA 4P7OA 4OZOA 1B4EA 2OT0A 1CB2A 4A2RA 2X41A 4W7VA 1HW6A 3TFXA 4NASA 1K9EA 2WMIA 3KOWA 4FF5A 4K7VA 3RXZA 3U2ZA 1GQJA 1TELA 2ZBTA 3WLNA 3TTQA 1LF1A 3VGBA 3C2RA 2A0NA 1S3TC 1IGWA 4YXGA 1M65A 3PF3A 1XSKA 1XGEA 2OLHA 4FLQA 1CGWA 1N7KA 5BOEA 3HN3A 3YPIA 1FCBA 4PGLA 3GH7A 2DT1A 2QXWA 4FXRA 3NZ1A 3LLDA 1GOKA 3WUEA 4REQB 4DWSC 4IL0A 2ZE0A 4QDPA 3GB6A 2VQTA 3WFZA 2DIKA 2W9MA 4UQ9A 1VLIA 5FA5A 3H4GA 2OWWA 3TAOA 3GE7A 2ZA1A 3AXIA 4XX6A 3BW4A 4XK2A 1RBAA 3RF9A 1REQB 3CMJA 1I8JA 4Q6XA 3VD4A 3ZR5A 2WMHA 3Q58A 3VD9A 4PTNA 3R10A 1ISXA 2CFFA 3NVDA 2QIIA 1PTDA 1BHGA 3LY0A 1XDJA 3B0YA 3FKRA 5CCZA 4E6MA 1KGWA 1T0OA 3OGSA 1W2PA 2JIEA 2Z1SA 3JU2A 5FSDC 5JQ9A 3UXAA 1VFMA 1MW3A 2QCDA 1WQ5A 3E02A 1CWYA 4DNMA 3AIVA 3PZVA 1NWSA 4PB4A 1VFHA 3H22A 4FOKA 2Q3RA 1GOXA 4EPEC 5CPMA 2BHYA 2XZ9A 1OG0A 4FNUA 5H91A 3L5AA 4AVNA 4GZEA 3N12A 1TJRA 5CG7A 3SO7A 5A8PA 3VGFA 1EXBA 1FBAA 1RP9A 1BG4A 4RDVA 1KM2A 1RSCA 5K9DA 4HNOA 4XAZA 4XV0A 3AMGA 1EP2A 2VNCA 5FAGA 3IWPA 3ZQ9A 5CSRA 1BRLB 3AZSA 3Q94A 4KRUA 4ZXLA