2WV8A

Complex of human dihydroorotate dehydrogenase with the inhibitor 221290
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE, MITOCHONDRIAL
publication title Inhibition of Human Dhodh by 4-Hydroxycoumarins, Fenamic Acids, and N-(Alkylcarbonyl)Anthranilic Acids Identified by Structure-Guided Fragment Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 138
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2wv8A00
3R5EA 2QCNA 1FCUA 3BLFA 4N9CA 3LCWA 1SSGA 2Y6ZA 1OFAA 3EX4A 3W85A 3L2IA 3KVKA 3W86A 3PSVA 4DBDA 5HWNA 2NWSA 3OA3A 1RVGA 4O52A 2H90A 2B4GA 2NUWA 3W1XA 4FB7A 1XDMA 4Z1BA 1SZFA 4JR5A 3NQMA 4O13A 3TQ0A 5KSWA 1VCGA 2CZDA 4FNRA 1DORA 3W2MA 3STCA 4O1CA 2A6LA 1LZOA 2P1FA 3SJ3A 4R7JA 4Z0JA 4RZ5A 1YTDA 1N55A 3DHDA 5U4NA 5HMSA 1QOQA 4DO4A 2B0MA 4P2VA 2QCLA 2YFOA 4CCDA 4LC6A 5AHNA 3LRMA 1H1YA 1YYAA 1BEUA 4Q32A 3LGEA 1TTJA 1DBTA 4CCEA 3C52A 4OE7A 1AW2A 3T4CA 1VS1A 2VELA 3HB9A 3C2RA 1N7KA 2QAFA 4NX5A 1HTIA 2J88A 3HG3A 3WK0A 1RZMA 5FF7A 3HF3A 3ATZA 4LV9A 5EBUA 3S6DA 4IMCA 3JRKA 3QMTA 4NZFA 3M5ZA 2I9EA 5AHFA 4NNCA 4M6PA 5D03A 3UPWA 3NZ1A 1KM5A 3L65A 1MEIA 1OX6A 4ML9A 2NX1A 3Q37A 3CPRA 3NL3A 3WK2A 4JXCA 4KFOA 1D9EA 3MUXA 3MHFA 2O7QA 3UWWA 5LHEA 3DFNA 3VE9A 2A5HA 2YDAA 3P7YA 3W2JA 5CZSA 2RKXA 5CZJA 5C2XA 2FDSA 7TIMA 1BWKA 1LRNA 5FEXA 4DO5A 1AK5A 1UJPA 2Q3OA 2R8WA 4K7VA 5LGZA 3PSWA 2VEMA 3NL6A 3NQVA 1XUZA 2C3ZA 3TFCA 1GPWA 4YWIA 3BVJA 1GVOA 1ZALA 2PURA 2ZRXA 1IIGA 3M43A 2X1UA 1W56A 4MFDA 5KZDA 5KZMA 1OF8A 3BARA 3LXCA 1WV2A 3MBDA 1T0OA 1JULA 2QCGA 2ZQ0A 2GQ8A 3TQVA 3P67A 1J5TA 1DV7A 4M7SA 3HG2A 4K38A 2ZA3A 4DF1A 4O57A 4U4MA 1H7NA 1K8ZA 2CZFA 5K9CA 5D04C 4MY1A 3NO5A 1XCFA 2ZZ4A 1IXQA 5DXXA 1HO1A 1Q3NA 2XN1A 2YCEA 2C1HA 5IBXA 1GG0A 4UTWA 2ZDRA 4AAJA 2DZSA 2QEZA 4Y8FA 1LCOA 1C8VA 4CNOA 1SO4A 3S1XA 3QRHA 3P81A 3TSMA 3IEBA 3BW4A 3SW6A 1A5CA 1IF2A 5A5WA 2A2IA 3CEPA 2R94A 2Y7EA 2CLEA 4WY0F 2QCMA 1OG0A 5BMXA 4ZQCA 2P0OA 3B04A 2NXIA 3BO9A 3BW2A 2A7RA 4DO6A 3BGGA 1P4CA 4GUHA 4O4WA 4LVAA 1Q45A 3DBPA 4GUFA 3KRUA 5MHBA 3GNNA 3NGJA 2F7FA 4RLIA 4O10A 3TC7A 5J5DA 1CW2A 3NEVA 4JY8A 1RQEA 3S5NA 3N3MA 3WJYA 3HBLA 3NL2A 1X6UA 3W76A 1DJQA 4UTJA 3B03A 1KTCA 3CWNA 4JYEA 1Z42A 1H61A 4MZ1A 1FXQA 2VKZG 4AH7A 1FWTA 4UTMA 1Y0EA 3DHFA 2YZRA 2WOQA 1SW0A 1CX9A 2OJPA 5AB3A 5KZEA 1H7OA 4UFMA 3NQEA 1F2JA 4C1KA 4DBEA 4X22A 3MP3A 4WOQA 3PB0A 4H4IA 1FUYA 3GVGA 3DI1A 3FEMA 1KTNA 4IMFA 1KM0A 5AN7A 4N4QA 4GXMA 1TRDA 1C29A 2FLIA 1JUKA 4KFNA 4WXZA 3RK8A 4AVFA 4ADUA 2WO5A 3LCFA 3LRLA 4AB4A 3FFSA 1ICPA 1WXJA 1YDOA 1OFEA 3TJXA 3TR2A 4O1AA 3SZ8A 1ONRA 2Q8LA 4UNLA 1P0NA 3LOTA 4JDYA 4CNPA 4U28A 4JDBA 4OWGA 4WD0A 1W5NA 3MJYA 5DXYA 4JTJA 2QUVA 1C9DA 1GYLA 4FEZA 4N9DA 1ZFJA 1FWSA 5G4EA 2DZUA 4EIVA 1JCJA 3C2EA 1F5ZA 3MI6A 2YYTA 4A2RA 4WZHA 1HO4A 3O05A 1M5WA 3C8FA 3UWQA 2VEKA 1W3TA 1VRDA 3G8RA 4K8HA 4R33A 3LRKA 3A23A 1H7RA 4AHPA 4WOZA 3KAOA 1SZEA 4XWUA 3G0XA 1LBLA 3LLDA 1EEPA 4JTUA 2CU0A 2Y62A 5LZLA 4OQVA 4O17A 3TFXA 4AWUA 2EPHA 1JCXA 4NJJA 4E2BA 1W54A 2YXGA 1ZY9A 4Z1CA 2ZZ1A 3T40A 1D3HA 3V1PA 3EWBX 2OCZA 1LRQA 1XC4A 4S2CA 1G4EA 2J9XA 4AHQA 2FTPA 3LCGA 4IPJA 5EPDA 4E2DA 1OFPA 3BG3A 1H50A 3DGRA 1HL2A 4A21A 3FLUA 3UD6A 4LNYA 5HNRA 1FDYA 3W7JA 4YCOA 2TSYA 4IXXA 3L0GA 4ICNA 3S8HA 1TPWA 3LBCA 4FO4A 4A22A 5CSRA 1R46A 2GVLA 2E6YA 2WPBA 3W88A 1I2QA 1H7PA 2CLFA 4IPIA 3N19B 1QCWA 4RKAA 1TPC1 3N2XA 1KM2A 5F1UA 1ZENA 3G18A 3W7CA 1GTEA 3O15A 5EMUA 3G1AA 1OX4B 4JX6A 2W0UA 1SO5A 1WYIA 3GYEA 5AC6A 5FI8A 5TBOA 3HQ1A 3GDLA 3HG5A 4FNTA 1MEWA 3FS2A 4AXKA 1F76A 3EXTA 3DKJA 1IXPA 3DKLA 3TW7A 1NF0A 5C54A 1W31A 1TMHA 4ZMGA 3HGOA 5EA9A 3W72A 3LERA 3KXQA 2ZZ7A 1F6PA 3TROA 3M5YA 5LKYA 4IJBA 1TIMA 3P8JA 1FCVA 3DENA 4JY9A 4HPXA 4QITA 5DY2A 3W1LA 3W6YA 3UWVA 3PBUA 2GVJA 3O6CA 3W84A 1OF6A 3ABOA 5D30A 5C55A 1H5YA 2PCQA 2NLIA 1EB3A 5AHEA 4MIMA 3LV6A 3GAYA 1W1ZA 2JKAA 2YFNA 1KLYA 1KLZA 3ABQA 1JR1A 4RR4A 1SSDA 1H60A 3ZR4A 3MYPA 3UNDA 1RQHA 3ANYA 5L9FA 4XZ9A 4MFEA 3W71A 1KM3A 3KVLA 2GPTA 4IWWA 2DJLA 3QF0A 2DZWA 2JBMA 3ABRA 2CLMA 1LBMA 3TXVA 2Y70A 1G6CA 4N02A 3P61A 2CLKA 3Q2DA 4KWVA 2Y63A 6TIMA 3BPWA 4IX0A 1KV8A 3GNDA 3RU6A 4A3UA 3GXPA 1Q6RA 1F05A 1TSIA 3L9CA 4LUIA 4WY0B 2X1TA 3HGRA 2H3DA 2ZRYA 3KFTA 4JX5A 1R2SA 4H6KA 2YW3A 1HUVA 1YTEA 2BXVA 1KA9F 3BW3A 3LI0A 1OX5A 5AFDA 2QJHA 5AHIA 4XQ6A 3F4NA 3A9IA 3FKRA 2C13A 3L5AA 2E5DA 2FFCA 4FXSA 2GOUA 4Z1AA 1FDZA 2FPTA 3E02A 3WK1A 3CTLA 3O8AA 3TMQA 1LYXA 5I3FA 2HSAA 4I7VA 2E77A 3JR2A 1TPEA 4PL1A 4K39A 2KZHA 1JCNA 3PF3A 2QCEA 3KRZA 1OFQA 4KWWA 1TREA 1VCFA 1AMKA 1XKYA 3DFQA 5C5YA 3LB0A 1F74A 4O15A 3VE7A 3LHTA 2A1YA 3A22A 4UFLA 1W5QA 3BK0A 3P60A 1X8FA 5FEZA 1MXSA 1TTQA 3KX6A 1WDWA 1B4KA 2QCHA 4N9EA 1TV5A 2E1DA 3LM7A 1JCLA 3PWAA 3ZS4A 1WBHA 2C18A 2PC4A 2FPYA 1WQ5A 3L5MA 4UTTC 4ONVA 5I3IA 1HFBA 3NQCA 4FIRA 3HG4A 2YW4A 4JTGA 2GQ9A 2E6FA 4QIUA 3FJ6A 3CT7A 3ABSA 5F1VA 5BMWA 1MEHA 5FEPA 4Z1DA 2C19A 1KTBA 3GR7A 3L5LA 4O11A 3IVUA 3B06A 3PR2A 3W7MA 3EKZA 2H8XA 2QAPA 5F2GA 3CLMA 3Q94A 1ICSA 4BWLA 2ZRZA 4IUOA 5FF0A 1K02A 2ABAA 2RHGA 4AF0B 3EKLA 1XDLA 2A7NA 3TDFA 1YTKA 2QJIA 3OHIA 5KTLA 5DELA 1H7XA 3E96A 4WQ6A 3W87A 3M5VA 2JGQA 3EXRA 4LT9A 1ME7A 1TRIA 2X30A 3NQ2A 1TPB1 1X1ZA 1I8JA 3NQAA 3RLUA 3W2NA 3M7WA 3D0CA 5C6MA 5LNSA 1G67A 4MLRA 3C2VA 4O50A 4EWND 3C2FA 3LBMA 4UC5A 5CPOA 4Q4KA 5DCDA 4NJIA 4LOCA 4HSOA 1ZNNA 4TMCA 4JTHA 1XXXA 4FX8A 3AJXA 3TX9A 4UFHA 3AO0A 3N34A 3NM1A 2B7PA 1LROA 3UWZA 1RQBA 1W37A 3W7GA 2UV8G 3DH7A 1GYNA 3FYPA 3W7DA 4MYXA 3TV8A 1KBIA 2FJKA 4JTIA 4MPQA 3YPIA 2XN0A 1KFJA 4GUJA 2CLIA 5G2WA 3B05A 2V9DA 5K2ZA 2X1RA 3F1QA 3UZ5A 4FNQA 3SIZA 4R53A 1NAL1 1PVNA 1TPVA 4GBUA 3QQ0A 4GUGA 3RMJA 4HKPA 1XBXA 1L9WA 3C6CA 3CC1A 5BRBA 3EWUA 1DQXA 2ZTKA 4DPQA 4JN6A 3BG9A 1LLZA 2VENA 4MY8A 1QPOA 4QQ3A 1J2WA 3CEUA 1ICQA 3VI2A 1SW3A 4ZQRA 3ZWTA 2P10A 3TAKA 3QJAA 4NJKA 1JQXA 4FX7A 3W1RA 3LX9A 3QPYA 4N2YA 3TK7A 5D02A 1EP3A 1SQ7A 4MVAA 1X7FA 1F7BA 1FWNA 4FNPA 5CPMA 3WJWA 4MLJA 4WUIA 5KINA 2BTMA 5HULA 1ZAIA 3BLEA 4XKYA 2RDWA 4GRSA 4W9TA 3M9YA 3EXSA 1QO5A 1EIXA 3PBVA 2QCFA 4FF7A 3W75A 4NXSA 3E9AA 4LS0A 4AWSA 1L6SA 4PH6A 3EX2A 1TPDA 1LOSA 2TMDA 4H3DA 3CB8A 4PFMA 4B5NA 5F4XA 3GIYA 4N9BA 3VFLA 5CZ0A 1L6WA 2NXHA 4EVZA 2DZPA 1EX5A 1LORA 2H8ZA 3IVSA 5AYZA 5I3JA 1TPFA 1R30A 3NQ7A 3R13A 1QPRA 4CQ8A 1KFLA 1VPXA 2ISSA 1RPXA 2H3BA 4NJGA 5D05A 1LLWA 3VNDA 1JQVA 1JUEA 1DVJA 3GKAA 1QAPA 3LTPA 1I2OA 4TIMA 1OYAA 3SECA 4AWTA 3N2MA 2NV1A 4N4PA 5E1QA 4MJMA 3GR8A 4YCPA 3W7NA 3PC0A 4OV9A 4LWWA 5AHLA 1P1XA 1TV8A 4IQLA 3LDVA 3OVQA 1GG1A 3W7HA 4M6VA 4KKXA 1OHLA 1S5WA 5HWMA 3NPXA 4RZ6A 1YDVA 3TSBA 3I68A 3RFAA 4LVFA 3W1TA 3F03K 4HIBA 5D32A 2NUYA 5AC7A 2BZNA 4GFSA 2W6RA 3QSTA 3KHJA 1YPIA 5DCEA 3GZ3A 3PG8A 4ZL1A 4TO8A 1TO3A 1B57A 3GKFA 2NX9A 4RCXA 4K36A 1YXCA 2VFHA 2ALDA 1KFBA 2VC6A 1TPH1 2WV8A 4PC8A 3UY7A 1LOLA 2J9ZA 4LY8A 5HINA 3UPBA 5K3VA 3G1SA 1EPXA 3LXAA 5K9XA 1QR7A 3GK0A 4FX6M 5AYYA 1H7WA 2Z0IA 3HJZA 2QKFA 1GJPA 4JICA 2PE4A 3O63A 1AL8A 1I2NA 4ZQNA 4BR1A 4UIOA 3IV3A 3GDTA 3GDRA 1WBJA 4NNAA 1ML1A 2FB2A 5HR7A 1FCBA 4GNJA 5L6UA 5DBUA 1IGSA 2Y61A 5K7JA 2J6XA 1R2TA 3HPSA 5J5RA 3W9ZA 1XBYA 2C14A 5HUPA 2Z2UA 4BK9A 3NXFA 3CU2A 3NQFA 3QEZA 4JGDA 5I3KA 1W8SA 1SO6A 3FJLA 3SGZA 3KVMA 1G7VA 1WX0A 3S5YA 5SWUA 5DY3A 2GJLA 3M6YA 2BLEA 2EHHA 2EAWA 3NAVA 3CHVA 1DJNA 3NVTA 3C0JA 4RX0A 2RH9A 5CZTA 4PCFA 3C2OA 4YMZA 4HPJA 2ZA1A 4PEKA 3L68A 1JRCA 1OFOA 2NXGA 1TTPA 3TA6A 2Z6JA 3G1DA 3QSRA 3G1FA 1DOSA 2CZEA 5F2LA 5EL1A 4LTSA 3EX3A 4RK8A 1RV8A 4O28A 1QO2A 4DF0A 1PHWA 5KMYA 5D2VA 1KM6A 4BF9A 4OV4A 2QDGA 3INPA 4JTFA 1FBAA 2G97A 3LTSA 4M6QA 2VFEA 4DEFA 4LUJA 2WSYA 3TSDA 5EKYA 1W3IA 4UTKA 1UASA 2NWRA 1L2UA 4IMGA 4YXGA 4K8EA 3C4UA 4QM1A 4YLWA 1ZAJA 3EX6A 3NDOA 1AG1O 1SFJA 3U6WA 3W3OA 2BWGA 4MUZA 3TC6A 3QMSA 3OEXA 1GT8A 3BV4A 3PUDA 3PBYA 4LU0A 3HMJG 4JTSA 1YLVA 2ATMA 1PS9A 1OYBA 4X9SA 5LNRA 3STFA 3MHUA 4LVDA 3V75A 3W74A 3S1WA 3O6YX 2DU2A 2A85A 3GAKA 1EUAA 3UXDA 3MO7A 3TAOA 4LW7A 4DPPA 4POCA 2C15A 4GJ1A 1SZGA 3P62A 2CW6A 3H55A 1W3NA 4O4VA 1B4EA 3N9RA 1F73A 3STEA 4A29A 5CSSA 4MZ8A 2BSLA 1OFBA 3NQ6A 2QCDA 1O4UA 3IIVA 3W7IA 4BI7A 3I7SA 3NPUA 4XTDA 5F2MA 5H2ZA 3ZFHA 3PVFA 3G8EA 5LNVA 1PCKA 2A7PA 3LI1A 3SY5A 2JK2A 4MYAA 3LHUA 2ZZ6A 1A5BA 2YR1A 1A50A 4KFPA 4K7YA 5HQEA 2ZCGA 1FDJA 2G95A 3EB2A 1K7FA 2ZTJA 4IX2A 3LLFA 3T44A 4OBTA 5I3GA 1D3GA 3BGJA 2HMCA 1XUUA 3W7KA 1UCWA 3NG3A 1BKSA 3UZJA 3M0ZA 1LTDA 4Q33A 1ZAHA 3QM3A 3TCEA 5D2XA 3M16A 4QNWA 4X3ZA 2Y89A 1V7YA 3H53A 1GZGA 4LVBA 3MBFA 5D2TA 2Y7GA 1UB3A 2ZRUA 8TIMA 1T99A 2ZZ5A 4O54A 4ORMA 2FPVA 3WJXA 4GE8A 3WK3A 1FWWA 3IGSA 3K30A 3OVPA 1QOPA 2Y85A 4UTWC 5IBXC 2J27A 3DXIA 1TQXA 1GVRA 3TKFA 3W1MA 3C56A 3EWWA 1XL9A 2EGZA 1TQJA 1ZHAA 3KVJA 1GVQA 1OK4A 3DAQA 3R89A 3IRDA 3U8GA 1Z44A 2I1OA 3HPXA 5CGQA 2ISWA 3P82A 3QYQA 2DZXA 2ZRVA 3M47A 5TQLA 4JIPA 3RNDA 2WKJA 1FQ0A 3QH2A 4UTIA 2V30A 3FIGA 4CQAA 3LV5A 2RDUA 4YL2A 5AC8A 2YX0A 1VC4A 1I4NA 2X16A 4TU1A 1SPQA 1W5PA 2OX1A 4O19A 1S5TA 3W7QA 1VQTA 3PAJA 3GX9A 3UWYA 1FX6A 1WAUA 4RZ4A 5EY5A 3B0UX 4O53A 1GEQA 4PL2A 1OFDA 2Z6IA 3BLIA 4JTLA 1TJRA 4LRTA 5D37A 4UCGA 2PRLA 1VCVA 1MSSA 4Z08A 2E5BA 4OT7A 1H62A 3IVTA 1Z48A 4BI5A 1L6YA 4IXHA 4L4MA 1QWGA 1WOAA 1QPQA 2YPIA 3HGSA 2H6RA 3PULA 4NU7A 4Y90A 1B9BA 3G0UA 4ZQOA 4O12A 4UR8A 3EWZA 3PS7A 3A21A 2QUTA 2B7QA 4HSNA 3QMRA 4O8RA 2OMAA 5E93A 4MKNA 5HR6A 5BW6A 1VLWA 5HJLA 3ELFA 3PUOA 4LC8A 2DJXA 3TH6A 4DXVA 2QF7A 3H54A 3P80A 1I2RA 1S3HA 3S42A 3QFEA 1BWLA 2I14A 2V0TA 3F4WA 1UUOA 1PHQA 1KFEA 3ZWSA 2VEIA 5LNUA 1EWDA 4RXGA 4PODA 3M1ZA 4IMEA 3NR0A 3MI2A 3SI9A 3A5FA 1TTIA 1LP6A 3KRSA 4I7WA 3NNTA 3I6RA 2BX7A 1W5OA 3LHWA 1I45A 1GTHA 4TR9A 4EF8A 2E09A 2CWNA 5LNWA 2HS6A 3W73A 2PRMA 2PRHA 3ATYA 3G24A 4O0KA 2FB3A 2OT0A 2QUUA 1V5XA 3LTYA 2A4AA 5E0KA 1UBSA 4UTHA 4GWEA 3GXNA 3KOFA 3W7OA 1PL9A 3W7PA 3B0VC 1WOBA 5LSMA 3NM3A 4MZYA 3N14A 1M7PA 1NSJA 4HT3A 3QC3A 5H91A 2WSQA 3RF9A 4FIQA 2HS8A 4O16A 4MY9A 4JTTA 2ZZ3A 3G3MA 1JCYA 5DCBA 4HNUA 2E6DA 1DQWA 4XUGA 4IGHA 1YDNA 3LHVA 5D33A 1XI3A 2E68A 5ABTA 3W83A 2V2DA 2R91A 2ZFAA 1G69A 4BI6A 3GB6A 3LCIA 4M19A 3M41A 4LS2A 1ME8A 2RDTA 1SFLA 2V5BA 4JTKA 1ZJIA 3B0PA 4FHAA 3FOKA 3W7LA 4HNNA 2J9YA 1QFEA 3OIXA 1TJPA 1K7XA 4MJZA 4X2RA 3W2KA 4L4LA 1IIHA 3W07A 4K37A 3P8IA 1XM3A 2LLEA 2AQWA 1VHNA 3HO8A 4BFAA 2FQIA 4RXFA 4RV8A 5FF2A 1H63A 1P0KA 1KV5A 4C1LA 2NX3A 4D2JA 1G4PA 1DHPA 4ZVJA 4M7TA 4QSHA 1YPFA 5DLCA 4O0ZA 3UY8A 1IXNA 1AW5A 2ZYFA 3MW7A 3SGUA 4LRSA 2ATSA 1JCMP 1T96A 3HOJA 4UTLA 5DN1A 3IIPA 2G96A 2ZZ2A 2B7NA 1EUNA 4JYFA 3C3NA 5IM51 3M5XA 4JD4A 3DI0A 3FYOA 1KM1A 1Q6LA 4UFKA 1TB3A 3P5YA 1VYSX 4UMBA 1TCDA 4CQ9A 1LRTA 1KW1A 1VZWA 1HG3A 2J24A 2FIQA 2F84A 2TRSA 3TXZA 1LDCA 1B3OA 1YXDA 3TW6A 4CCCA 6ALDA 3CQ0A 1TPUA 1GVFA 3S5OA 4ZQPA 3P5ZA 3PG9A 3T7VA 2TYSA 1EP2A 2VEPA 4HHPA 5BNKA 2JKEA 4S1FA 5FF4A 4XTIA 4CNNA 3DFSA 1K03A 3O07A 4CLMA 1M7OA 1NEYA 1O5KA 3HGJA 4LV4A 4NNBA 5I3HA 3EWXA 4UNKA 4PTNA 3QQ1A 1Q6OA 5BOOA 1VH7A 3A5VA 1LM1A 1OFRA 2WNNA 4IOTA 1H51A 5EYWA 3TIMA 4PA8A 3PBWA 3U2OA 4XKYB 2C0AA 5AOUA 1QMLA 4UTTA 1W5MA 3O16A 1MZHA 2X2GA 3R8RA 3E12A 4S2BA 2YGYA 4R34A 3I7RA 2V2HA 3IGXA 3T78A 4AHOA 4DELA 3TJLA 1ME9A 4NXKA 3S1VA 1S5VA 1K8XA 2WSRA 1XBZA 3FKKA 3G1HA 3TUUA 3T55A 3NQDA 3MP5A 3QZEA 5F4SA 3TQKA 3MWAA 3WJZA 3MYOA 4FNUA 4JTEA 3MI3A 1ZCOA 5CKSA 2C6QA 1VLIA 2WNZA 1DL3A 4O1BA 3G3DA 4MOZA 1ADOA 2AAMA 2HTMA 2OZ0A 3O1NA 4G1KA 4OHQA 3QPZA 3B8DA 1GVSA 2AGKA 4A2SA 2EF9A 2ISVA 1IXOA 1JVNA 2TPSA 4JYDA 3R2GA 2QCCA 4I7UA 3NZRA 4JNMA 3M44A 4Z0SA 5G4WA 3IGUA 3SSJA 1EP1A 3TU9A 3QW4B 3L0KA 1LOQA 4JX4A 3PY2A 5FESA 3I7QA 3RLVA 3USBA 3CIWA 3MHGA 1FWRA 2VFDA 3W1AA 1EA0A 5HWJA 2Z1BA 2W79A 5CG7A 1YXYA 2A21A 3L67A 3DU0A 3BG5A 2GUUA 2ZA2A 5K4ZA 1CI1A 1ALDA 1E51A 3NQ8A 2YSWA 3DFTA 3EX1A 1PV8A 1TYGA 1PCWA 3UWUA 1JJKA 2YYUA 2G5WA 5G1YA 4JS3A 1MO0A 1SZNA 1KBJA 4TMBA 4FNSA 2ZRWA 3W2UA 1UUMA 4DQWA 1G4TA 3E0IA 1W0MA 2X1SA 3L0NA 4AMAA 1JUBA 3CM4A 3OG3A 1OX4A 5HUOA 1Q6QA 1RD5A 1PIIA 4O14A 1G7UA 1PE1A 5AHMA 2CLHA 2QJGA 2E6AA 5F2IA 1A5AA 1I2PA 2GQAA 4UUIA 4BWLC 4IMDA 1O95A 2JGYA 1A53A 2NZLA 1QDSA 3IIZA 1VHCA 4UTUA 1FXPA 1OABA 3P84A 4HNVA 3WJSA 5K4XA 2VFFA 2OT1A 2WNQA 4NQ1A 4E38A 3NPVA 4UFJA 3S1UA 2JKPA 4O18A 1BTMA 3LCLA 3W70A 2Y7FA 4NZJA 2A0NA 5G2HA 3S5ZA 2CLLA 5AYXA 4TX9A 2XN2A 5FF3A 4FXRA 1K8YA 4DF2A 3PB2A 2CFFA 1XFBA 3G0SA 3IIXA 3Q58A 2VFIA 1YADA 4JEQA 2WQPA 4K6AA 3GXTA 3W22A 1A5SA 2ZBTA 1OK6A 1QNVA 4LS1A 5CPLA 1FY6A 1FCQA 4ZZ9A 3HIJA 3HPZA 4UMAA 1NFBA 1TV7A 2QDHA 5LHFA 1KM4A 1R47A 1SO3A 2GVGA 2D73A 3G1VA 1RR2A 2V5LA 3SFKA 3EWYA 4WY0A 2VFGA 1SU5A 4UR7A 1N8FA 4N6EA 1SUXA 3NA8A 1SW7A 4OGZA 4RJEA 2Q3RA 5DBTA 5G5IA 3S0CA 3LCXA 4M5PA 3MMTA 3G22A 2DP3A 1R2RA 1U83A 5D09A 3NL5A 3E49A 4UFIA 3TE9A 2XFWA 4QAIA 1VGAA 2GJNA 1GWJA 1OYCA 1H1ZA 2ABBA 4WXYA 4JIQA 1OJXA 3UXAA 2V81A 4Y96A 2IQTA 4XBKA 3B4UA 1EWEA 1KFCA 2NUXA 4NJHA 1T8XA 1THFD 2WJZA 3W7EA 3DFPA 1WA3A 2Y88A 3W1NA 1K3UA 3W1UA 3NOEA 5KITA 3THAA 3P74A 3UQNA 3GDMA 4Y6GA 4XBSA 3LXBA 3I65A 3W2LA 1VJIA 4EOUA 5TIMA 5FEWA 3GDKA 4J9JA 4LVGA 1O94A 1VYRA 2NV2A 3N73A 4P61A 1U5JA 4HNTA 4O1DA 2V82A 5D2YA 3DFOA 2DZTA 4GC4A 4NX0A 4WX2A 5F4WA 4ADSA 4ALDA 2Q8ZA 2QR6A 3STGA 1NVMA 5D2WA 3LHZA 1M6JA 5K9DA 1XBVA 3G1YA 2E5CA 3G1XA 4Y9AA 1O60A 3EEGA 1X1OA 3OBKA 4OU1A 4QNEA 5U7SA 1LBFA 3JS3A 1DKWA 2RFGA 5GVJA 3SR7A 4UMCA 3L21A 4AF0A 3LCHA 5A8GA 2B7OA 3CIXA 3TMLA 2CLOA 4WJEA 5G2IA 4UXDA 4AEOA 1KFKA 3A24A 2V8ZA 2R14A 3W1PA 3TNOA 4ORIA 1P5BA 1VR6A 2QCDB 4ADTA 1AW1A 4ZQMA 5T26A 2A6NA 3R12A 2CZ5A 3NQGA 3THQA 3O06A 3VCRA 1G4SA 3MP4A 1Z41A 1O5XA 3GLCA 1J4EA 3LHYA 1GOXA 4NT0A 4EF9A 2V2CA 2VOMA 3FA5A 1GQNA 3PUEA 4E0CA 1NF7A 2DORA 5D38A 5CPNA 1VYPX 2EKCA 3PM6A 4NUWA 3C61A 3VKJA 3S9YA 3NYZA 2VXNA 3NPWA 2DZVA 3W7RA 3W1QA 3N9SA 4GUIA 1JRBA 1QPNA 3WFAA 1AL7A 3DZ1A 4N6FA 2Y7DA 4HN4A 4QJ1A 4I9AA 3OVRA 1OVDA 3L66A 3W23A 1SR9A 4QISA 3IIOA 2C16A 3CWOX 2O7SA 3QW3A 1K7EA 3O6DA 1F6KA 3UYCA 5G1TA 5LGXA 4NVTA
chains in the Genus database with same CATH superfamily
2QCNA 3BLFA 2PZ0A 3KDOA 2Z29A 3BMXA 3LCWA 2PMQA 2Y6ZA 1XCWA 3EX4A 3KVKA 3VOHA 3M7SA 3MQTA 4CNUA 1TMQA 4L6OA 1CGVA 3QV8A 2WLYA 2HRWA 1GK8A 4HA3A 3W2MA 1CEOA 3STCA 4OOZA 1E1CB 2J7BA 4RZ5A 3VU2A 4JFUA 2G3JA 5U4NA 1QOQA 4CCDA 4S3DA 2V3FA 4H9YA 3EPOA 5AVNA 4JIRA 1BEUA 4Q32A 3U2EA 2WJFA 3VKBA 1V0MA 4OE7A 3VXGA 2BY2A 2VELA 2DH3A 3I10A 3BV7A 1N7KA 2QAFA 4JTQA 2J88A 1CXFA 5HMEA 1OB0A 2BVWA 4ECLA 3ATZA 1V3JA 4RZBA 4F0HA 3JRKA 3QMTA 4NZFA 3M5ZA 1BF2A 5AHFA 4ZFMA 2PDMA 5T8GA 4NNCA 4DWSD 4HYVA 3ARYA 1MEIA 2JEPA 5DANA 1HKMA 3CPRA 3NL3A 4G8TA 4JXCA 3W82A 4Q3MA 3MUXA 3MHFA 2IPWA 3DFNA 2YDAA 2BVTA 4HNLA 2RKXA 5CZJA 5JBEA 3GG1A 1CIUA 2DT3A 4HU8A 4GH3A 1GPWA 1GVOA 3A13A 2ZRXA 1MWOA 3Q65A 4LB3A 3A4XA 2GVYA 3XINA 1B54A 4WJ8A 3CASA 5CPTA 4PCPA 5A2BA 1WV2A 2HV5A 1EC8A 1SFSA 2QCGA 2J4GA 2ZQ0A 2GQ8A 1FWAC 1J5TA 2XM1A 4S3AA 1CTNA 2ZA3A 1RCOB 1CXIA 4MG4A 3HV8A 3UXKA 3E74A 5K9CA 4QDPA 1V79A 2EJAA 2VRJA 3RRXA 4V1YA 1QI4A 4DJDD 1V08A 1Q3NA 3L4TA 2YCEA 3S47A 5IBXA 2ZDRA 5M17A 4AAJA 1REQA 2QEZA 3FXGA 1SO4A 1NQ6A 1ZP4A 4UQ9A 3TSMA 2VX5A 3IEBA 3TA9A 4RPQA 4KF1A 3SW6A 3MUZ1 2XYLA 4RE0A 3V5OA 4WY0F 3SM0A 4NILA 2QCMA 1OG0A 4NAEB 1FH7A 3FHQA 4BQ5A 3BO9A 2A7RA 3OZPA 2WYSA 2E28A 3CL6A 3GY1A 2OKOA 3UZXA 3K1DA 1N8IA 3DBPA 2Q01A 3NGJA 2OZ8A 2O0TA 4RLIA 4O10A 4RE2A 4E5TA 1RQEA 1W2VA 3WJYA 3HBLA 1UD6A 4UTJA 4LYKA 3B0XA 2DZBA 3P93A 1W91A 3VK5A 1Y0EA 3DHFA 2WOQA 1Z3NA 4HA4A 5FAJA 1WZAA 3CHCA 1JZ4A 5CLTA 3MP3A 1KFWA 3PB0A 5AZ0A 4E4FA 3KBJA 3W6LA 3OOQA 4RNHA 1VBGA 1KTNA 3H12A 5AN7A 4FOJA 4N4QA 4GXMA 4AZGA 4D6FA 1HJVA 5JH2A 3WY1A 2PDIA 1K6AA 4KFNA 4WXZA 3ENLA 4AVFA 5BZAA 4XVEA 1V6XA 3TN5A 2PP1A 4HPGA 3HU7A 2VVSA 1TV3A 1ICPA 3A9BA 1PDYA 1WXJA 1RLDA 5CGMA 2NVCA 4KIRA 3TR2A 3L2MA 4O1AA 1P48A 1Z8AA 2Q8LA 2D23A 4X2PA 4JDYA 1PAMA 3N4EA 4FR1A 5LXXA 4OKDA 3WDJA 3KE0A 3BICA 4JTJA 1EBGA 4AIOA 1M53A 1R7OA 1H0IA 1WO2A 2DZUA 3QR3A 2C79A 2ZUWA 3DYOA 3L7RA 1S39A 1SMDA 2XH0A 1K6WA 4A8IA 3VOIA 5A94A 5LIWX 3O05A 3WNKA 1PWMA 3V4BA 1Q6CA 3UP8A 1E6ZA 1BYBA 3K8KA 4PUDA 1VRDA 1ZUAX 2EBNA 2IKJA 4RDYA 2CKRA 5IOBA 5CPQA 4Y2WA 1EEPA 3EPNA 4JTUA 3KWSA 4OQVA 2WC4A 2PTYA 2WC3A 3XISA 3R7MA 2PGRA 1JCXA 4Q7BA 1W54A 4ZXOA 4HNOA 1FA2A 2J7DA 3R0DA 5BU9A 1TX2A 1YW1A 4XZBA 1V6YA 2OCZA 1XFCA 3KRBA 1XC4A 3O3RA 4KMQA 4UQBA 4W89A 4BJHA 4H9TA 1OFPA 4DUOA 1H50A 4B9YA 2J7HA 3ZT6A 4GD0A 5CBJA 4YTUA 2DSUA 1FDYA 4YCOA 4IXXA 4JIHA 2UBPC 1TPWA 1S1PA 4PCSA 3W88A 3DG3A 1R87A 3ITGA 1KKRA 1EO5A 1O1ZA 4E2VA 3KS6A 3AWOA 4TVDA 4XVDA 2VP8A 1ZS2A 1IWBA 3H4XA 3E5PA 1QNOA 3W7CA 3O15A 3ABXA 3WH9A 3WUFA 3G1AA 1F3EA 1KCLA 2ON3A 4DJEA 3TR9A 4PB3A 1C91A 3W24A 3EB3A 1UHVA 2DY3A 4YYFA 4UCFA 4V28A 3FS2A 5E70A 4ZFCA 3EXTA 3LNPA 1EYWA 3O0FA 1CECA 3UF9A 4DX3A 1US0A 2XU2A 2JEQA 3UWEA 1KCZA 1W31A 3AI0A 5EA9A 1KXVA 4XV0A 1F6PA 2ZZ7A 4M56A 4ZGYA 5HBFA 4HPXA 3WLSA 2GGJA 3ALFA 4QITA 3PBUA 2PB1A 4QJ3B 4A35A 3PZGA 2QZRA 4WSJA 4JQ1A 2PCQA 1EB3A 5AHEA 2OX4A 3DYMA 4MIMA 4UQAA 3GAYA 2JKAA 1KLYA 1Q6FA 1JG9A 1SSDA 1H60A 3OQ8A 1RQHA 5L9FA 4XZ9A 3JZUA 1KM3A 2WCAA 3UXIA 1ADDA 4J5NA 3ABRA 2EG7A 4P5UA 4KWVA 5J04A 3GBEA 4I8DA 6TIMA 1QI0A 4JX5A 2Y2WA 1R2SA 3IANA 1HUVA 3BW3A 3GS6A 3RLGA 5AFDA 5AHIA 1JGIA 4XQ6A 3VNYA 3FKRA 4C6OA 3E02A 3AHYA 1WAWA 4LGXA 5ABHA 4I7VA 2E77A 1TPEA 1KQZA 4KWWA 4JQ2A 1PZ3A 4AG0A 5C5YA 4IH3A 2A1YA 2XHYA 4GZIA 3A22A 4UFLA 4W5UA 3BK0A 3S4TA 4QS5A 3WDHA 1OEPA 4IF2A 4C6FA 2C91A 4YWSA 1SM9A 2GK1B 2JALA 2ZUTA 3DDMA 1TV5A 2E1DA 5BU6A 3PWAA 3SJNA 2D0HA 2PC4A 1WKYA 3L5MA 2QS8A 3NZQA 1AJ0A 4LCRA 4D8AA 4FIRA 1NDWA 2X0HA 2YW4A 4QEEA 1UA3A 1WZKA 3B8IA 3S2CA 1GOWA 4R9OA 4XD3A 4CNSA 3BOFA 3KS5A 5FEPA 3AUOA 2ZADA 3CUXA 2C19A 3W26A 1KTBA 3AU2A 1EZWA 3IVUA 1H49A 3W7MA 5F2GA 2H8XA 1TUFA 3Q94A 5C9XA 1ICSA 2ZRZA 2OYLA 2VCAA 1YTKA 4G7EA 4W4QA 5KTLA 2XSXA 1XYAA 3F4CA 4UTFA 2RJHA 2RDXA 3T09A 4AUBA 1X1ZA 3NQAA 3RLUA 1BLIA 2ZKMX 3M7WA 3A4AA 1XSJA 2CCRA 1TE1A 1MZRA 2OZTA 3KW3A 4AZ5A 3LBMA 4BY3A 6CGTA 3N2OA 5DCDA 4LOCA 3W38A 1BVNP 3AJXA 3EA1A 3CUZA 4CU7A 3AO0A 1DXEA 3URQA 1RQBA 1W37A 3W7GA 3DH7A 4MAZA 1GOIA 1KBIA 3VIOA 2X42A 3U57A 3O9NA 3MTWA 3MZNA 4R3UA 4JTIA 3ANVA 3N18A 4GUJA 5E9XA 3SN1A 5DEZA 1XS2A 3BZJA 3QVQA 1NAL1 1W32A 4DIAA 3QQ0A 3POHA 3RMJA 2BP1A 5I06A 2JIWA 3IJIA 1VFOA 1DWJM 2AMGA 3CC1A 4L9ZA 5T9CE 3AZRA 8XIMA 2VENA 4MY8A 1RD6A 3CEUA 4P8WA 1ICQA 3VI2A 4ZQRA 4AD0A 4PSRA 3TAKA 1QK2A 3QJAA 1XGDA 4AC7C 4ZOCA 3QPYA 4N2YA 4YVVA 3TK7A 3ARZA 4H1ZA 2JF6A 5CPMA 3CH0A 4MLJA 5HULA 3BLEA 2C7FA 2RDWA 1FWEC 3HA1A 4AIEA 3EXSA 4HOXA 1W3KA 3H23A 4LS0A 1Q6GA 2PWEA 2V63A 4AWSA 3H22A 1LOSA 2E0PA 1R0MA 1R3SA 4BQ3A 3TW9A 1FKWA 1L6WA 1IWAA 5EMKA 3MZ2A 3H21A 3ZJ7A 4GKTA 3WQFA 5AYZA 3NOYA 4UZSA 3E6EA 4CQ8A 1VPXA 2VQTA 1MQQA 5D05A 2V67A 4ILSA 1JUEA 3FHAA 1I2OA 4AWTA 2NV1A 1WPCA 5E1QA 4MJMA 1A5OC 4YCPA 2XDFA 4R88A 4OV9A 4LWWA 5AHLA 3H2NA 1PKNA 1XSIA 4WDXA 2VTFA 4M6VA 4HU4A 3ITVA 5HWMA 1X97A 4W93A 1YDVA 3TSBA 4LVFA 3WYZA 4HIBA 3WENA 2NUYA 3T2OA 2PTDA 3S9ZA 4P8UA 5AC7A 4G9PA 4GFSA 3ANUA 3BCDA 7ENLA 3GZ3A 4TO8A 3TYAA 2W27A 2CERA 3DHPA 3A3HA 4M1BA 1YXCA 2VC6A 1TPH1 3RM4A 4W88A 1ENUA 1LOLA 2WJDA 4JFSA 1CXEA 3QHNA 1PYFA 3HJZA 1BRLB 4NASA 4GY7A 2J13A 3RCMA 3WLRA 3FK4A 2YCJA 4UIOA 1XYBA 1ML1A 2Y61A 4QGCA 2J6XA 1BQCA 3URAA 3HPSA 1UROA 3W9ZA 1XBYA 1CLXA 1V8EA 5HUPA 3IJ9A 4BK9A 1HIZA 1SO6A 4S3KA 1N8WA 3FJLA 3SGZA 4EE9A 1WX0A 5EGRA 1Y65A 4MWAD 4XZWA 1L6GA 1R6WA 2BLEA 2EAWA 4XD6A 2P3ZA 2XISA 4RX0A 2RH9A 4GH1A 2FYMA 4HPJA 4PEKA 1IT7A 4M29A 5FL1A 1OFOA 2PCEA 4J3VA 1RY0A 1RAKA 1AH0A 3ITTA 6XIMA 4UOQA 3BLPX 2XVGA 4XG1A 4LTSA 1KO0A 2KAUC 3LN3A 1UKPA 5D8WA 3BZGA 1B31A 4MB4A 3MV11 5FD0A 4J1OA 1RLCL 1XIFA 3RAOA 4D6DA 1V3MA 3LTSA 1IHIA 2WSYA 3PZTA 1EGZA 5I3DA 1W3IA 4AZ7A 1OT1A 4TTUA 1CCWB 3GUGA 3SRHA 4YXGA 3GXFA 4F8XA 4QM1A 3EX6A 3U6WA 3SY8A 4GO9A 2QIWA 3NWRA 1ONEA 1BPLB 1GT8A 2CBIA 3PBYA 4GGHA 1E0VA 3VD4A 1LUCA 2PTXA 3VX0A 4JTSA 4EPBC 1SJCA 4ZSUA 3T05A 1SMAA 3V75A 4OECA 4XSLA 1EUAA 3UXDA 3TAOA 4DPPA 4POCA 1JPIA 3RR4A 2C15A 4LAZA 4HPHA 1SZGA 4JEJA 2VNCA 4O4VA 1E3ZA 3NVDA 1F73A 4ERGA 3STPA 4MZ8A 3LUTA 4IIEA 1M7XA 3NQ6A 3WD1A 2PD9A 4ZSTA 2QGYA 1P1MA 4I9MA 4XTDA 3KM8A 3CH9A 4JNYA 1BGAA 4ZBCA 5LNVA 2A7PA 3LI1A 3SY5A 1R3VA 2QF8A 4JAWA 3LHUA 2ZZ6A 2NQZA 4LQ1A 3NURA 4KFPA 5HQEA 2ZTJA 3WQGA 4IX2A 3LLFA 3T44A 3WNLA 1ZQ5A 4HU0A 3BGJA 2HMCA 1XLGA 1UCWA 2QXWA 1BKSA 1OIFA 4CD6A 4HHLA 2VEFA 3M16A 2GK1A 4K2SA 4QNWA 3AXIA 1S2TA 3RITA 2Y89A 3RRAA 5I23A 1PUDA 1F9CA 2PZNA 4ZE5A 1V02E 4HMEA 4HNCA 4BHYA 5CZKA 1LG2A 1GCYA 5DMMA 1FWWA 4DN1A 5IBXC 1QOPA 3FJ4A 2J27A 1GVRA 3C56A 4FAMA 3BOXA 3KVJA 3DAQA 3U8GA 3IRDA 4KERA 4PRRA 2WB5A 2ISWA 1W9DM 5C2GA 2ZRVA 3GHTA 4JIPA 4S3BA 1XD0A 1U33A 4LCSA 3CQIA 2WKJA 1PTGA 2XVKA 2RDUA 4KRTA 3HN3A 3S46A 1YQ2A 1RCXB 4NZ4A 2WMKA 2ZIDA 4HTYA 2I5QA 3UJSA 4L1XA 3B0UX 4O53A 1GEQA 4PL2A 1OFDA 4B2DA 4CD8A 3CHFA 4LRTA 7REQB 4NL1A 2R1KA 5D37A 1Q63A 2PRLA 4UCGA 4A8RA 3LPPA 4Z08A 1GOMA 2Z1SA 4MWAE 4GK8A 3WQVA 1M04A 3MU7A 4HBKA 2H6RA 4IQJA 3E2VA 4NU7A 4ZQOA 2BHZA 1NWSA 3ME3A 2NT1A 4LY4A 1BSIA 5G4HC 2VURA 2B7QA 1V6VA 3WQCA 2QJMA 5HR6A 5BW6A 1EJRC 1VLWA 1JXJA 4GX8A 4B5WA 1T5AA 1SZRA 2XINA 5XIMA 3GG8A 1W17A 1U1UA 3H26A 1BSLA 1JNEA 1EDGA 2VEIA 3EB4A 3H8AA 2WZMA 3NR0A 4OOUA 2WNWA 3MI2A 4L56A 1TTIA 1LP6A 1MXGA 1VIWA 2OO6A 4HU3A 3NNTA 5BYWA 4B5VA 4F9JA 1GTHA 1GOQA 2NQ5A 3ZVHB 2FHCA 2E09A 2PGWA 2HS6A 5I03A 1PZ2A 4NI3A 5E0CA 3ATYA 3G24A 1ZP3A 4Q7NA 1V5XA 2A4AA 4GWEA 3GXNA 2V3GA 3B0VC 3FYYA 1HVXA 1V3KA 2XTKA 2DVXA 5I6SA 1M7PA 1NSJA 3E2RA 1QXLA 4DJFA 5A95A 4RL3A 3L4UA 1F3XA 4C6JA 2XFYA 4QR6A 4GI9A 5I2UA 4JFWA 4HNUA 1UH2A 3EMZA 1K4GA 4IGHA 1YDNA 3W6MA 1W9XA 4D6GA 5D33A 3EMQA 1YRRA 2V2DA 3L4XA 4PMRA 2PDBA 5EBAA 2WVSA 1G69A 1V6TA 4M19A 1Z7AA 4GCXA 1SFLA 1J0HA 3B0PA 4FHAA 3FOKA 4QRNA 1LG1A 5DMLA 3EOSA 4X2RA 3CS2A 1IIHA 3W07A 2ZE3A 3KLKA 3C8NA 3IUHA 4C6EA 2REQB 3ZYZA 2ZVIA 1KV5A 4C1LA 2NX3A 1GZJA 5ABFA 1BD0A 5IHRA 3VKDA 3GTXA 1V6UA 4CUCA 3E5BA 3CMGA 1YPFA 3IJQA 1VFFA 3UY8A 1LF1A 4E8DA 1A5MC 3MW7A 1SR0A 4LRSA 8RUCA 1JCMP 1T96A 3PP7A 3HOJA 1OCJA 1EJ7L 3C3NA 1NDZA 2Z7KA 3UZZA 3DI0A 1M01A 4DJEC 3VABA 1X38A 3MDWA 2Y5SA 4IICA 5FJRA 1C7TA 2E3ZA 3VILA 3T2QA 1VYSX 4KRZA 2OZ3A 3RDKA 4UMBA 2AQVA 2BB0A 2VC5A 1QBBA 1B0IA 1LRTA 1OC5A 1VZWA 5AKQA 2J24A 3WKZA 3PZVA 3TP4A 1UQYA 1LDCA 1B3OA 1YXDA 1GVFA 3KL0A 3L23A 1DIKA 3BLOA 3S5OA 5DMYA 1FP8A 3ZXWA 1XG4A 4LBUA 4CGTA 4S1FA 3GIPA 2FVKA 2BBFA 3D5HA 1NEYA 3HGJA 2O4MA 4NNBA 4XX6A 4UNKA 4PTNA 4EKJA 4IOTA 4AD5A 3URBA 1GPFA 3OLEA 3U2OA 2C0AA 3GHSA 4MADA 4HHHA 3O16A 2BHUA 2NSXA 1GVIA 2XIIA 3I7RA 3EOEA 4WGHA 1TVPA 2EEXA 3QKEA 3T78A 4JHOA 3T81A 4J3UA 1ODUA 2CHOA 3WF0A 1XBZA 4ZCWA 3NQDA 3MP5A 3T55A 3QZEA 5F4SA 3TQKA 3WJZA 4GA8A 1QI2A 4FNUA 4JTEA 3NDYA 4ES4A 3VNKA 4DBWA 1DJGA 1ZCOA 2OKTA 2WQDA 2PD5A 4MOZA 1XLHA 2AAMA 2OZ0A 3WQPA 4GOAA 4ZE4A 2AGKA 4Q8NA 2ISVA 1IXOA 1JVNA 1VBHA 2AAAA 2NSOA 3QXBA 2PAJA 2QCCA 3GH5A 2ANUA 3LY0A 3PY2A 3I7QA 2OQYA 2NQHA 4E4UA 3HPFA 4KCTA 1FWRA 3W1AA 2W79A 3ITXA 5CG7A 3L67A 3UCDA 1KBLA 2PTWA 5HA7A 3RMEA 3MY9A 1ALDA 3TN3A 5PTDA 4QCEA 3UWUA 2G5WA 5G1YA 5D4YA 1GVYA 1WDSA 4FNSA 3S2NA 1G4TA 3E0IA 4AMAA 1JUBA 3CM4A 1VJZA 5FJTA 4UQEA 1Q6QA 3WH5A 1RD5A 1PIIA 2PI6A 2VYOA 1DIOA 3FSTA 4P8XA 4IMDA 4YHGA 1O95A 2DUZA 2JGYA 2Z4GA 1CLVA 1NFPA 1Y5VA 4QEHA 2QV4A 2OT1A 4AD1A 4JNZA 3S1UA 3N2TA 2AKMA 2JKPA 3ID7A 3OW1A 3ITOA 4ZODA 2A0NA 4TX8A 3AQUA 4IT1A 1X1NA 1FVPA 1IR2A 1TG7A 3N2BA 4GG9A 3PB2A 4HTBA 3LK6A 2CFFA 1XFBA 3G0SA 4A3RA 1KRAC 1MQRA 3SB0A 7TAAA 3GXTA 3M07A 4PR4A 4Q8VA 1VIZA 2ZBTA 1PX3A 2CZVA 3MC5A 1M3UA 5CPLA 1HGYA 2QDHA 3MMWA 4KEZA 2V5LA 2ESCA 5C2CA 3EWYA 3L2LA 2VFGA 3EOLA 4LF1A 4UR7A 2V68A 1XG3A 3VKAA 2XZ9A 4H6QA 2NQ9A 1AQ0A 1WCGA 2PWUA 1T8QA 1UZ4A 1KXQA 4F66A 3SQLA 1U2YA 1WDPA 3NL5A 3AS1A 3PJWA 1GWJA 4WXYA 1EF3A 3UXAA 1OJXA 4AZHA 2V81A 4K8GA 4Y96A 2IQTA 3TTYA 1GQKA 5FJOA 1C90A 2XIOA 3DFYA 2D2JA 2WJZA 2DIEA 3W1NA 1K3UA 3W1UA 5KITA 3CBWA 1E9LA 4Y6GA 1VJIA 5TIMA 4IG2B 2DZAA 1XIBA 2DQWA 3QV9A 5LIUX 3N73A 1U5JA 4HNTA 2EG6A 2V82A 3EEZA 1LWHA 4DB7A 4JIEA 3N4AA 4C6CA 3HPAA 4H6EA 3G1YA 1K9EA 4XZNX 4QJ5B 3FXYA 3OBKA 3U9IA 3R43A 3VGGA 4KH2A 1FHUA 2IPFA 3UT0A 1UH3A 5U7SA 3PZNA 4US5D 4B3ZA 3PPGA 5GVJA 2V5JA 4GACA 4ENLA 3CIXA 4IFOA 3AU6A 3GXDA 1J0YA 5G2IA 1YBQA 2DSKA 2V8ZA 1UC5A 4TUFA 1P5BA 2PLJA 1CGWA 1AW1A 3EDDA 1P7TB 4FOUA 4MGGA 2CZ5A 4HA1A 3ZVHA 1E0WA 3NQGA 3THQA 3VCRA 1CB7B 4LPCA 3VGEA 1W1PA 3LA4A 6TAAA 4NT0A 1GOXA 1E40A 2V2CA 3LGDA 4Q4OA 3WDQA 4Z2GA 4F0KA 5CPNA 2EKCA 1XPYA 2XWDA 1QW7A 1XYZA 4LBRA 3VKJA 2VXNA 1XH1A 3QLDA 4AZIA 2G8ZA 1FWCC 4YU1A 1JXKA 4AIBA 3Q45A 3IAQA 3W7RA 3DERA 3NYDA 3N9SA 4GUIA 3WFAA 1QPNA 3DZ1A 2DH2A 4LF2A 3G1RA 1K77A 4Y9PA 4D8ZA 3QZ6A 1XIIA 3OLIA 4QISA 4GYPA 4ICCX 2Y8UA 2BDQA 3O6DA 4MDOA 4AY1A 4H04A 3L4WA 3R1ZA 4N9CA 3B8UA 5A8OA 3MMUA 5XINA 3W85A 3CHDA 1BVZA 3PSVA 4DBDA 1L0PA 2OYKA 3OA3A 4XKMA 2B4GA 2WCGA 2NUWA 1WZMA 3MKKA 4AD4A 3H6OA 3W1XA 4FB7A 1XDMA 2PP0A 1TWSA 4JR5A 3C5QA 3IK2A 4O13A 1ZGDA 3TQ0A 5KSWA 1GW1A 2PTZA 3CAKA 5CJNA 3SUWA 1NWTA 1XLIA 4Q6JA 3WH7A 2P1FA 3VVGA 3DOPA 4S3EA 1YTDA 1GKPA 5HMSA 2QGHA 4PCTA 1RVKA 1ECQA 4LC6A 1B3YA 4INFA 1VKFA 3LGEA 4F0LA 1UQZA 4A8LA 1AODA 1TTJA 1DBTA 2IS7A 1TJ0A 1AW2A 1H3GA 2W62A 3TN4A 3QV6A 3HB9A 4BF7A 2OOFA 2F6XA 4HZ6A 5A6MA 3N12A 4WGXA 3VDAA 1RZMA 5FF7A 1EF2A 3KOZA 4B5TA 4AWEA 5FKYA 3QPEA 3UPWA 1KM5A 1HJSA 4ML9A 3P14A 3WMLA 3WK2A 3FGCA 2BXYA 5XIAA 2PWVA 4IUGA 3VE9A 3W2JA 1MUWA 2HQAA 2FDSA 7TIMA 3TZNA 1BWKA 5FEXA 4DO5A 2Q3OA 1UJPA 2R8WA 3PSWA 2VEMA 3NL6A 2GJXA 1PJ9A 2PURA 2X1UA 1W56A 1LQ0A 5KZMA 1XRFA 2BODX 4E3VA 3WQ6A 3MBDA 5C7HA 3O7UA 1UWTA 1DV7A 3HG2A 2VZSA 1JZ8A 1A0EA 1A3WA 3R6IA 4O57A 2VCCA 1K8ZA 2CZFA 3SN4A 1OSEA 3OTRA 5D04C 2F6KA 1XCFA 4R5EA 5DXXA 1HO1A 2C1HA 4UTWA 2G4FA 2DZSA 1LCOA 1H41A 3P81A 2G3NA 3BW4A 1S46A 3EZ4A 5JIPA 1TA3B 4J4KA 2A2IA 2Y7EA 1IZKA 2XSAA 2XJ7A 1OIMA 5BMXA 3MMDA 4ZQCA 5A69A 3B04A 1J9YA 2YIHA 1P4CA 1UKTA 2BOEX 4LVAA 4MNKA 4EP8C 2PUZA 1OCNA 3ZJ6A 3QTGA 4GUFA 3MPGA 3C86A 3GNNA 2OFJA 1XX1A 1XPGA 2WHKA 1CW2A 3NEVA 4EX4A 4L9XA 3BCJA 3BSGA 3ZSSA 4G7FA 3CWHA 1DJQA 3B03A 2DGAA 4Q4MA 2VL4A 3GG0A 3RIKA 1P0EA 2VKZG 4IIFA 3DBNA 2BMBA 3OBEA 1KWGA 3AISA 1Q13A 1SW0A 4F2UA 3BAKA 5KZEA 4PB4A 3VDHA 1H5VA 4UFMA 1F2JA 1VFLA 5EB8A 1LWJA 1F07A 1PXGA 1BF6A 3UG8A 4DBEA 2VC7A 1VD6A 3ECQA 4WOQA 5DF0A 4H4IA 1FUYA 4OIFA 3B97A 4Q8TA 2OLAA 3WF3A 3A3XA 2OOGA 1TRDA 3F7JA 5H6HA 4W8AA 2Z1VA 2FLIA 3G6LA 1L6FA 2JE8A 5D9OA 3TTSA 3B0YA 2A3LA 1JUKA 2WMIA 4IIBA 3RK8A 7XIMA 4ADUA 2WO5A 3LCFA 3LRLA 1ZSXA 3DG7A 3FFSA 1CXKA 4FF5A 1MRQA 4KCUA 1VFMA 4GISA 1OFEA 3ZIZA 3BWWA 2EPLX 2Z26A 4E3TA 1B2YA 5JBDA 1ONRA 3RU8X 4UNLA 5FSDC 3FVMA 3LOTA 4U28A 3AICA 2QUNA 2ZXQA 3UJFA 4HK7A 3GM8A 1W8GA 2Z1KA 3CXOA 5G4EA 5ECUA 2BY1A 3F2BA 4EIVA 1JIBA 1JCJA 3SUVA 4IM4A 1R3RA 4IZGA 4GC3A 2TAAA 4H8HA 1JI1A 2XIQA 4A2RA 5HATA 3GFZA 1M5WA 2P88A 3NFUA 4PTXA 5I02A 3G8RA 4L4OA 2DEPA 4Q4SA 1BAGA 3E0LA 4Q8PA 4Y9OA 4UNIA 1A5NC 3SCRA 3PK7A 3ARPA 4PE8A 3G0XA 1LBLA 1BVWA 2CU0A 2GWGA 2XPKA 1MI3A 4Y9MA 1A0DA 2Q8XA 1Z69A 4DWSB 2EPHA 1X7IA 4NJJA 2H9AB 2YXGA 1ZY9A 4OBRA 4Z1CA 5DT5A 3GVWA 2ZZ1A 1D3HA 3V1PA 4EACA 1ZL1A 3WLMA 1LRQA 2WJEA 2WSPA 3ZLHA 1RSCA 4S2CA 2J9XA 4QX4A 1PX8A 5EPDA 3VIMA 3SCTA 4XISA 1J2BA 3WUGA 1PPIA 1E72M 4AIUA 4A21A 4DJFC 5A6LA 4F4RA 1CB2A 5HNRA 2A3BA 2TSYA 4FO4A 4A22A 2CESA 2FMNA 4H9ZA 2E6YA 1I2QA 1U5HA 4KEVA 2VDHA 2X8RA 3N19B 1T41A 3VM7A 1UBPC 3R58A 2J7FA 1ZENA 4PTVA 1GTEA 1R8LA 4GLEA 2W0UA 4PFHA 3GYEA 3LMYA 2PWFA 3CK5A 5FI8A 3OHMB 3HQ1A 4M82A 5EMMA 2RJGA 4DZHA 1MW0A 2I17A 2Z24A 3OYZA 1IXPA 4E2OA 5C54A 3PBGA 3LERA 1TWDA 3KXQA 2WXDM 1KRBC 4IJBA 1TIMA 1DJZA 3N17A 4BS0A 3O6CA 2CPUA 1OF6A 3T4WA 4AY7A 3UR7A 5MF5A 4FPSA 5A6TC 2NLIA 2EPOA 3SGGA 2XGIA 4HZ8A 1KLZA 3QLLA 1AJ2A 3MYPA 1PZ0A 4PYSA 3UGRA 4MFEA 3RM9A 3PZIA 3W71A 3QF0A 2DZWA 2JBMA 2KX9A 2ONEA 1ISWA 5IHSA 1OBAA 4RPPA 3Q2DA 4PTDA 3RR1A 1KV8A 1VEPA 4I90A 3GXPA 4PMOA 1F05A 4WY0B 5JQ9A 4H6KA 2YW3A 1KA9F 1FHVA 1NU5A 4LUTA 3L5AA 2C13A 4XO6A 2PA6A 3TLLA 2GOUA 1FDZA 1OD8A 3GVRA 3IRSA 1E70M 4B92A 2BY3A 3CTLA 2YA1A 3O8AA 3CZ8A 1WXYA 5I3FA 4NZ1A 4LNCA 1J10A 1JCNA 3CYJA 2PLMA 2DVUA 2G3MA 3KRZA 3AMLA 1XYFA 1XKYA 3LB0A 4AZBA 3VE7A 4KEMA 3WBWA 2Z2BA 2PDKA 4DZ5A 1X8FA 1N2VA 1SGJA 1WDWA 2BVDA 1B4KA 3TTEA 2J79A 1IEXA 4J3TA 4P7OA 3VMOA 2BFGA 2C18A 4CN1A 1WQ5A 2TODA 1TFVA 4ONVA 4CN4A 1WDRA 2VUYA 2O56A 1HFBA 3QOKA 2CHRA 3HG4A 3VO0A 4QIUA 2J8TA 4LAKA 2RGMA 3CAQA 3FDKA 2DT0A 4Z1DA 3UETA 3CMFA 1R9YA 3GR7A 3GXMA 4O11A 3B06A 4AXNA 2WANA 2VVNA 3EA2A 3CLMA 3WF1A 5FF0A 1K02A 2ABAA 4AF0B 4H2CA 4HYRA 3PN8A 1BTCA 2QJIA 3LQLA 3FW6A 1H7XA 3CZJA 3M0IA 4WR3A 3BDKA 3EXRA 3IV8A 1ME7A 1IT0A 4CD7A 2PDJA 1S5MA 1I8JA 2SFPA 1VBUA 3C3UA 1ZPTA 2ZX7A 3OODA 3OIHA 2G0WA 5LNSA 4RV3A 1J12A 4MLRA 4EWND 7ODCA 5MKGB 2HROA 4UBPC 3S2MA 4A6GA 1LL4A 2B81A 3PZUA 3CL8A 2WCSA 2UV8G 1TKKA 2YDSA 2O4QA 1GYNA 3FYPA 3W7DA 4MYXA 4GI4A 3TV8A 2FJKA 2YA0A 4L4PA 4MPQA 2J74A 2W61A 5G2WA 4URIA 2V9DA 5H1WA 2E40A 3UVAA 1TA3A 3GH4A 4R53A 1JDDA 2CBVA 1QOXA 1JD7A 4CCZA 2D2OA 1TPVA 4GBUA 3PPHA 4U3CA 1XBXA 3UGVA 1L9WA 3BL3A 4PUMA 1FWFC 3EWUA 4JN6A 1W1B1 1LLZA 1UG6A 4QQ3A 2HBXA 1NOUA 1SW3A 1VP5A 5H8UA 3SIMA 4AQLA 4MVAA 4GI6A 1X7FA 1F7BA 3VX1A 1X39A 4BEUA 1FWNA 3WJWA 4WUIA 5GJPA 4ACZA 4XKYA 4GRSA 2CWXA 4W9TA 2QULA 3OLDA 1QO5A 5ECVA 2A3HA 2CC0A 1RCQA 2V3DA 3N11A 4PH6A 4H3DA 3ABZA 4PFMA 1Q7MA 5F4XA 3GIYA 1MUCA 2GSHA 2NXHA 3WLPA 4EVZA 1GQJA 2H8ZA 2D22A 3VIHA 5I3JA 3C2YA 1R30A 3QV7A 3R13A 1QPRA 3FCPA 2V6AA 3EWCA 2WW5A 1LLWA 1E5JA 2DUAA 1JQVA 1EZ2A 4DXKA 2CBUA 4IPLA 4J2MA 4TIMA 1OYAA 3SECA 3UA4A 2QW5A 3KBWA 2UWFA 4JN8A 1Y8BA 1OHLA 1S5WA 2GQ3A 3RFAA 4GYJA 4J35A 1ESWA 1X6NA 3KHJA 1PDZA 3V16A 3ZR5A 1YPIA 3PG8A 3U4AA 1QNPA 4XZHA 1UD8A 1B57A 3HQOA 3GKFA 1TZ7A 2RGLA 1GNXA 1VBRA 2PS2A 4RCXA 4K36A 1JGMA 2PDWA 4RDWA 3VINA 3DHUA 2D3LA 3UY7A 4XAFA 3HV9A 3VIPA 2PU1A 2VEGA 4I8YA 3UPBA 3G1SA 3UA3A 4QE5A 4L61A 1EO7A 5K9XA 3GK0A 2XZ7A 3N25A 1HGWA 4QDWA 1LL7A 1GOOA 3AUJA 3KL3A 1REQB 3WNOA 4R85A 1AL8A 3WH6A 4M3PA 3R8GA 4LUYA 3IV3A 1ONWA 3GDRA 4Y8EA 3KHDA 1FCBA 5L6UA 4DWSA 2ZVRA 5K7JA 4ZOAA 2H9AA 1R2TA 4Q8MA 4HYWA 4DZIA 1F8MA 2Z2UA 5H8PA 3NXFA 5A3HA 3SCOA 5I3KA 2ISDA 4DWDA 3GC5A 1G7VA 2BHYA 1OQFA 5D9MA 2FJUB 4ATLA 5DY3A 2GJLA 3M6YA 3NAVA 3R11A 3C0JA 3T6CA 5CZTA 4LSBA 2ZA1A 3L68A 4YN5A 3JVAA 3VD5A 4X9YA 1CLKA 1J0IA 1S2WA 1TTPA 3PANA 2Z6JA 4GYPC 4M8UA 3QSRA 4QDMA 3G1FA 1W9UA 4RK8A 4M24A 2I7GA 1QO2A 4DF0A 3THUA 5D2VA 3B40A 1EJUC 3HFYA 4DJDA 2GGHA 2G97A 4M6QA 4ERIA 3T1GA 4ZEPA 4DEFA 4LUJA 2VX7A 3ARVA 3TSDA 4Q4RA 1RJPA 1M03A 4QAWA 1FOBA 2C0HA 1UASA 1WDDA 3PZMA 5GNZA 1I1WA 3C4UA 3S1GA 4YLWA 5AYIA 1ZAJA 2FTYA 4MM1A 4DNHA 3TC6A 3QMSA 1RUSA 3BV4A 2PU0A 1UR8A 4LU0A 1IWPA 1PS9A 5HPCA 1Y5WA 2Y0FA 1E56A 4RUBA 3W4RA 1IGWA 4GYFA 1VPYA 2I16A 4IHCA 1JZ6A 3S9IA 1FH8A 3E3HA 3PPFA 5GNYA 3P62A 1H0GA 3BJSA 4PUJA 4H9VA 3N9RA 3M0VA 3UW6A 4PMVA 1F3WA 1E9YB 1KR0A 2QCDA 3EDKA 4REQA 1J11A 3I7SA 4OTKA 3WUBA 2WSKA 1J96A 3G8EA 5CJ5A 1FWJC 1X8CA 1HW6A 1ITCA 3MDUA 3REQB 2JK2A 4XZMX 1CWYA 1A5BA 1A50A 1WXZA 3SURA 2ZCGA 1LWIA 5A2CA 4OZOA 2A3AA 3BCFA 5I3GA 5IXEA 1XUUA 2AOSA 4J3ZA 3UZJA 4Q33A 1ZAHA 1ZRQA 3QM3A 1XRVA 3AYSA 1GHSA 1XR2A 5ENLA 2NQLA 1KXTA 1R85A 1XWYA 1Z89A 2G50A 3FNDA 4GCAA 3PWGA 1JZ5A 4HGXA 1NTHA 4LVBA 4DUVA 2Y7GA 1UB3A 3DECA 1CZ1A 3WQDA 2X2YA 4U2ZA 2XFFA 3WJXA 2JF7A 1A4LA 3ZMRA 3OVPA 4UTWC 3DXIA 1C9WA 1TQJA 4XD5A 3IPWA 4YPJA 2ZUMA 2I1OA 3CUJA 5CGQA 4LAUA 3P82A 2BASA 3UEQA 3M47A 1UD4A 1POKA 4D6HA 4WSKA 3P3BA 3QH2A 2V30A 1VFSA 3FIGA 4CQAA 2GL5A 1R9ZA 4QCFA 3DN5A 4TU1A 1SPQA 1V0KA 5BRQA 1OADA 2Q6ZA 1S5TA 4DBUA 3USZA 3GX9A 3UWYA 1FX6A 1NH6A 3OB8A 2VD8A 3FDGA 2HE8A 3BLIA 2ZXBA 2G3IA 1RBLA 5CCZA 4YTSA 1K9TA 5AC5A 1VCVA 1AD1A 3BLLA 4S3CA 4GHRA 1US2A 1D8WA 2J7EA 1DJWA 1L6YA 2G4JA 1QWGA 5I5RA 4H00A 2YPIA 3RGTA 3WDIA 1O5RA 3W02A 4QS6A 3QY7A 4Y90A 3TWBA 2YL6A 1QATA 3PS7A 4JIIX 2QUTA 2D1ZA 3BAYA 4EXQA 5E93A 2WZIA 4K3ZA 3RX4A 2DT2A 4MWAB 2FZBA 2QF7A 3P80A 3UESA 3NXLA 1E5NA 1S3HA 3S42A 2IPGA 3QFEA 1BFNA 4C91A 5E6YA 1HL8A 2V0TA 4PMDA 3F4WA 2FKPA 2INEA 3N6JA 1KFEA 2Z27A 3ZWSA 1EWDA 4RXGA 1J18A 4IMEA 2OODA 3A5FA 1M41A 3CV1A 3KRSA 1YNYA 1GOKA 1P0BA 5LNWA 4Y9NA 2PRHA 4JN7A 2FB3A 2OT0A 3W01A 4H9UA 2QUUA 4O8AA 3CQJA 5E0KA 3ITCA 4AU0A 3DC8A 1OINA 1Q6EA 3KOFA 4B5UA 3VNZA 1PL9A 5JU6A 3W7PA 3LENA 3N14A 3V35A 3WIJA 4KCVA 1VFUA 1EOKA 4HT3A 1OGGA 5REQB 1NIUA 4BQ2A 1JF5A 3W29A 3E0FA 2HS8A 4MY9A 4NHVA 3CO8A 1KB3A 3SAZA 4JTTA 2ZZ3A 1XINA 3G3MA 1JCYA 3WN6A 2BGQA 2R1PA 4LYRA 3R10A 3W83A 5A6BD 4YIWA 3V0SA 3F2CA 3MWCA 2ZFAA 2R1LA 1E71M 2XGZA 2OSXA 4F3HA 2E7FA 4LS2A 1DWFM 4JTKA 3QN3A 1TV2A 3W7LA 1KWKA 2FHBA 1GW9A 4HNNA 1ISVA 5AC4A 1K7XA 4MJZA 3B9EA 4Q7IA 4PEEA 3WG6A 2QUMA 3RX2A 1JDAA 4WVXA 4K37A 4GMEA 4G7EB 1XM3A 4G1NA 3TYZA 1VHNA 3HO8A 3SADA 1W1IE 2PWDA 2VHLA 1G01A 1H63A 5FF2A 4KT2A 1DHPA 1H1NA 4M7TA 5LXEA 3P0WA 4AYSA 1IXNA 3SGUA 1UJQA 3WFLA 2OQLA 5EFFA 3VDGA 2ATSA 2CIPA 4PGLA 4QLLA 1DHKA 2ZZ2A 3V5CA 3VGHA 4JYFA 5IM51 1V0LA 2ZE0A 2HE5A 2QT3A 4FS9A 4JD4A 1KM1A 4UFKA 1LQAA 3NCOA 3P5YA 2YL8A 1XLDA 3BAXA 3V3WA 2VRKA 3OGRA 9CGTA 1S2AA 2HDJA 3KL5A 1HG3A 2QDEA 4IJRA 3G6MA 2GUBA 2P8BA 2TRSA 1A5LC 1VBJA 3OGSA 2WZHA 6ALDA 4KIEA 2Z1XA 5EMJA 4W7UA 2YCKX 2OSYA 1PBGA 4PUWA 3P5ZA 3PG9A 3E2QA 3VD7A 2TYSA 4HHPA 2JKEA 2Z7GA 5FF4A 2W91A 4XTIA 4CNNA 3DFSA 1K03A 3O07A 4CLMA 2G3FA 2VWSA 9RUBA 3S6OA 5BXTA 2X0YA 3EWXA 1VH7A 3QHMA 1LM1A 3T8LA 1OFRA 4F79A 1QW9A 1H51A 4CKQA 5EYWA 3VMPA 3AFBA 4PA8A 3PBWA 4PCNA 3AXXA 2XVNA 5AOUA 4QTGA 2FFIA 4UQCA 4UTTA 3KTXA 1FFQA 2XH2A 3E12A 4S2BA 3ZOAA 2V2HA 1W3JA 3TJLA 1KNWA 4NXKA 3WQOA 1CT5A 3FKKA 3WEOA 2VC9A 1CXHA 4GVIA 4R27A 3MYOA 1A3HA 2IMRA 2HVMA 3SRFA 1FRBA 3ZLGA 5CKSA 2C6QA 4NSBA 1K8CA 1L8PA 5A8QA 2PFHA 3AHVA 2OU4A 3ONBA 2V5KA 3B8DA 1GVSA 4JYDA 1PO9A 4Z0SA 3M44A 4DZAA 3P6LA 2HJPA 3V18A 1E6XM 3L0KA 4M81A 3H70A 3USBA 5M2FX 5JBFA 1J93A 5I00A 3MUCA 4OUEA 4D1JA 1QNRA 2A21A 3DU0A 3GFYA 1CI1A 4AYGA 2YSWA 2ZUVA 1ONXA 1PCWA 3VNJA 4WK9A 2XVLA 1JYNA 2YJQA 1KBJA 4TMBA 5FJIA 2ZRWA 3R94A 1UWIA 1XRTA 1W0MA 4GO8A 2I5GA 1OX4A 3AS3A 3T0TA 1T7LA 1PE1A 4C7GA 1B9ZA 5AHMA 5JXQA 3WNPA 4AZCA 2E6AA 1HF6A 3HURA 4OVXA 3REQA 4UUIA 3LPGA 4XUYA 1YNQA 2IQ0A 1FXPA 2OWCA 1OABA 3P84A 4WKFA 4L80A 1XHGA 3IJ8A 4FZIA 5KZ6A 4TQTA 1E0TA 4O18A 1BTMA 5B7YA 2WMJA 5G2HA 3S5ZA 4CQBA 3SCVA 2CLLA 3FA3A 3ZJKA 5FF3A 1AQHA 5BWFA 4DF2A 2JFEX 1HJWA 1YADA 1K70A 3E1F1 2WQPA 3WD2A 2VRQA 4MSSA 1W1TA 1TJ1A 1OK6A 3ZVIA 4GVFA 2CBJA 3VOCA 3KDNA 3WLQA 3HIJA 4UMAA 3LSCA 5LHFA 1SO3A 3I4EA 2D2GA 3KTCA 3G1VA 2HZGA 1MFUA 1MW2A 2VWTA 1VJSA 1XYCA 1RK6A 1SU5A 3IK4A 4NAFA 3LMZA 4N6EA 3NA8A 4OGZA 2Q3RA 2AGTA 1MNZA 5G5IA 2GSJA 2J8GA 1K4HA 3LCXA 1GJWA 1NOFA 1V02A 3MMTA 4B3KA 2FHFA 3G22A 1TUXA 3MJMA 1R2RA 1E4NA 4GZJA 1RA5A 4UFIA 4D1IA 3QGVA 4KGLA 4LFYA 4AZ6A 1OYCA 4IMAA 3QGAC 3G2GA 1SJBA 3W27A 4JIQA 2J62A 4CVUA 1VFTA 1UWSA 4C6KA 1DXIA 5EFDA 4NJHA 3W7EA 2WVTA 4HP5A 1C8QA 3APYA 3THAA 3P74A 3UQNA 3GDMA 4XBSA 3I65A 1DJIA 4EOUA 1V93A 3I3BA 5I09A 3GDKA 3HQPA 4LVGA 3D3FA 1VYRA 1A3XA 3VZZA 4W5ZA 5AYBA 3EGJA 2HVNA 5D2YA 5JVLA 4GC4A 3UNTA 5F4WA 4ALDA 2QR6A 1TCMA 4XIAA 1NVMA 5D2WA 1LUCB 5LYRA 3I3DA 1HT6A 3RLHA 2E5CA 3G1XA 4Y9AA 1VEOA 3KWXA 1X1OA 4YNGA 2DFAA 4MWAA 4QNEA 1E6SM 3JU2A 2MUCA 3ZJ8A 2FTWA 1DKWA 2WZEA 1DIEA 1FKXA 2XFRA 3SR7A 1OWQA 3B8VA 5A8GA 2B7OA 3D3AA 3VZYA 5ABGA 4PN2A 1J6PA 4AEOA 3H7VA 3AZTA 2R14A 4ORIA 1VR6A 1EL3A 4V33A 3NUKA 2IXVA 2W63A 3R12A 4L64A 1Q8JA 4GXWA 4RE4A 2Y8VA 2HNEA 2AKZA 1W2PA 1R9XA 5GJMA 3MP4A 1O5XA 3ARUA 3GLCA 3LHYA 5FJPA 4EF9A 2VOMA 3H24A 1IEQA 3ZLFA 1KRCC 4BZYA 1FWGC 3TTOA 2BVYA 4W7WA 2D3NA 4H7VA 3PPCA 3W1QA 1CGTA 4C6PA 5HQMA 5FJJA 5REQA 1JRBA 2GZXA 4N6FA 3AZSA 2Y7DA 4HN4A 4I5RA 1EQPA 2R82A 4XIMA 1E55A 1MQPA 3AIWA 4G6CA 3IUIA 1I0DA 2D69A 1SR9A 2W92A 2F9RA 3ERPA 4JCMA 3IIOA 2C16A 2O7SA 4H01A 3UYCA 3GR4A 2C71A 1UP0A 1UR3M 3WEZA 3WD0A 1FCUA 4LAMA 3O2LA 4AY8A 1OFAA 4B4HA 3W86A 2OR2A 5HWNA 4DWSC 1F4AA 1XQKA 3FN9A 2H90A 3DG6A 2WBGA 1SZFA 1DTUA 3NQMA 1EJWC 4U10A 3UZYA 1VCGA 2CZDA 1DORA 3LU2A 2A6LA 1LZOA 3AXMA 3SJ3A 3EPMA 4R7JA 3FAXA 1N55A 2FVLA 3DHDA 2B0MA 2QCLA 4WCJA 4XAZA 3KOXA 3RJXA 4FA3A 5AHNA 3LRMA 1H1YA 4BQ4A 1RALA 1A49A 5CC3A 2XH4A 4CCEA 1HJUA 3C52A 5CGTA 3TJ4A 4YVXA 1J0KA 3NSNA 4HSHA 4D71A 4NX5A 2HISA 4DRSA 1XJBA 3WK0A 5I0DA 3LEPA 3S6DA 2GUYA 3PFRA 1D2KA 2I9EA 5T91A 2GDUA 4M6PA 5D03A 4K68A 3NZ1A 1R86A 3TONA 2BXZA 3CO4A 2HXTA 1JI2A 2NX1A 3Q37A 4DJDC 4KFOA 3A64A 1D9EA 5HAOA 1NARA 3UWWA 2A5HA 1ZJHA 3P7YA 3GWQA 3HQNA 1LRNA 1XIDA 2C3ZA 3TFCA 3GHRA 3CUFA 3E0VA 5AY7A 2VGBA 2AMXA 3M43A 4IFKA 3VGBA 5KZDA 3BARA 5GNXA 3LXCA 1PKMA 1RJRA 4KWSA 2L5HA 4G2DA 1JULA 3TQVA 3AIEA 4IP4A 3ARRA 5H8MA 4K38A 2OQHA 2QYGA 3MKCA 3DYPA 1H7NA 1L2QA 1EQCA 4MY1A 3NO5A 1K9DA 3VNIA 1YX1A 4MUPA 4QSFA 2FVMA 3VGDA 2XN1A 4IQDA 1TE6A 3U3HA 1GG0A 2Y24A 3SQSA 4CNOA 1FHDA 4ASTA 3QRHA 1E43A 2DDXA 1Z9AA 1WDQA 1IF2A 2FMOA 5A5WA 2ICSA 2R94A 3CEPA 4GGBA 2CLEA 1O66A 1IEVA 1UZDA 2P0OA 1G5AA 2PF0A 3BW2A 2HBVA 3UJEA 5M1TA 3WCZA 3LSBA 1FWHC 2F7FA 5J5DA 3EOUA 1D3CA 4HK6A 3S5NA 1X6UA 3W76A 1C3FA 4GNVA 4M6UA 3CWNA 1POJA 4CD5A 3ICJA 4D6EA 2F2KA 4AH7A 4UTMA 4S23A 4EANA 2YZRA 3WD4A 5ABFB 5AB3A 3EA3A 1H7OA 3NQEA 1U5VA 3OA5A 4C1KA 3VNMA 2GVEA 1XLEA 2ZXAA 4UWMA 1F4HA 3TYUA 4CU8A 3T42A 2Z1WA 3DI1A 3XIMA 3ZM8A 3FEMA 1KM0A 3MVTA 2A79A 4ROQA 3AWNA 4MNJA 4QLJA 4RNIA 4GQRA 5TAOA 5LA0A 5CJMA 2ZICA 4AB4A 1PIFA 4V2XA 4H9XA 3TJXA 1X96A 3GD6A 3DEQA 4XAPA 2W9MA 3NIYA 4X0VA 3SZ8A 4ZENA 2P0IA 3BGAA 2WVVA 4QP0A 2ASHA 1P0NA 1RBOB 4CNPA 1E9IA 1IEWA 1JYVA 1UWUA 4JDBA 4OWGA 2EKGA 4KESA 3CB3A 1W5NA 1JFXA 3GTHA 4O1FA 5DXYA 4JTRA 1Q4NX 2VGIA 3WF4A 4U5KA 6ENLA 1C9DA 1UOZA 5KETA 5CBBA 3A12A 4CQCA 3C0SA 1XGEA 2C1IA 2HXUA 1XICA 5CC7A 1GVEA 2AL2A 3POCA 1F5ZA 2PDFA 1XP3A 4LBSA 3M0YA 4WZHA 1HO4A 2NW0A 1XYLA 3E0WA 1QUMA 3UCQA 3BXWA 3DIPA 4HN8A 3E2SA 4AHPA 4MNLA 2CEQA 4LCQA 4XWUA 5TF0A 4DYJA 4O17A 1A47A 4PBEA 3T40A 1XLBA 3PTQA 4PTWA 3EWBX 3R8HA 1MDLA 2O92A 4AHQA 2FTPA 3LCGA 4IPJA 2PBOA 5HMFA 3LZ5A 4AD3A 3DGRA 2E8ZA 4Q8QA 1HL2A 3UD6A 4LNYA 3NEHA 3L0GA 4ICNA 3S8HA 3M0JA 4RNJA 3LBCA 3GO2A 5CSRA 3AYRA 1R46A 2GVLA 1RH9A 4P7NA 2WPBA 1Q5MA 1H7PA 4IPIA 1QCWA 1EA9C 1TPC1 3JZEA 4I9TA 4GY0A 3OG2A 3AROA 4HQVA 1S5NA 5F1UA 3G18A 1W1YA 5EMUA 5IFTA 4C1NA 4JX6A 3A4WA 4ZOEA 1UD3A 3QTPA 3GDLA 2XUCA 3KZPA 1TVNA 1MEWA 4AXKA 2R24A 3EBVA 3B8WA 2R9RA 3DKJA 4LYQA 5C7VA 1EDQA 4JHZA 1NF0A 1TMHA 3EAUA 3HGOA 4ZMGA 3F2DA 5A1AA 5CC5A 1YE6A 3P8JA 1Q2RA 3W1LA 2X7VA 3UWVA 3W84A 4PUKA 2XH7A 3U7VA 4EPDC 5C55A 4RR4A 3WQWA 1HP5A 1XLLA 5E5CA 3ZR4A 3ANYA 3F4VA 4GI8A 3KVLA 2DJLA 1UKSA 2PDCA 4AX6A 2CLMA 3TXVA 1CYGA 2Y70A 1G6CA 3HZ3A 3P61A 1AFSA 4ML4A 2QLYA 1FWIC 1JYXA 1QHZA 3BPWA 4IX0A 2XWEA 1WZLA 3GNDA 1Q6RA 2WM1A 1TSIA 3L9CA 4LUIA 1UH4A 3HGRA 3KFTA 3ZT5A 3LI0A 3OLGA 2QJHA 3F4NA 1WKEA 1OGSA 3A9IA 4FXSA 2X41A 4DBSA 2E5DA 2FFCA 4QQUA 3IARA 2BOFX 3CZGA 3T0BA 3TMQA 9XIAA 4HZ7A 3M6DA 4PL1A 2ADAA 2KZHA 1O12A 2OYMA 2QCEA 3JW7A 3UFYA 1TREA 2FZMA 1IQ8A 1VCFA 4Q8WA 2ACQA 4O15A 3DCPA 1FP9A 5BOEA 1XLFA 3P60A 3LNMA 5FEZA 1MXSA 1TTQA 4NP7A 4MPKA 3KX6A 1EHNA 2J47A 2QCHA 4HOZA 2E9BA 3LM7A 1JCLA 2PDPA 1NY1A 5DRCA 2YL5A 3ZS4A 5E09A 4HK5A 2FPYA 4AW7A 2GFTA 4UTTC 2YL9A 5I3IA 4MMWA 4M0XA 1RJQA 4JTGA 3PNUA 2E6FA 4QG6A 3W81A 1QRQA 2Z2AA 5F1VA 5BMWA 2HWGA 1W1VA 1U22A 3CAVA 5HQLA 4GZEA 4UR9A 2G37A 3PR2A 3EKZA 2QAPA 1XC6A 4LX4A 4IUOA 4WIWA 7A3HA 1XDLA 3CZKA 5DELA 4OUIA 1EJVC 3VD3A 3QZAA 1YBQB 4WQ6A 1H09A 1R3TA 2YXXA 3SFWA 3AIBA 4YTQA 3GTNA 2X30A 1OZQA 3PFMA 1TZZA 5C6MA 3KBVA 3WZ0E 1MDRA 2BG5A 1GHRA 2X05A 3C2VA 3AXHA 4O50A 3C2FA 4UC5A 4Q4KA 4NJIA 4HSOA 3CPGA 4JTHA 1ZBVA 4NYYA 4JKMA 4D72A 4UFHA 4NI8A 4GFIA 2HCVA 2B7PA 2J75A 1OC6A 1MNSA 1VAHA 4PMUA 2J25A 3RCNA 4AX7A 3SRKA 4NIRA 3B9DA 2VZUA 4C6NA 1SVDA 5K2ZA 4L1GA 3F1QA 3AHTA 4FNQA 4GPNA 3SIZA 3ZO9A 1PVNA 4GUGA 4HKPA 1NWUA 1E6RA 4FSAA 4AISA 1RK5A 1DQXA 3SCPA 3BG9A 4US5A 3OGVA 4Q4PA 1FWBC 1XF0A 2P10A 4FX7A 3W1RA 1EP3A 1SQ7A 3CLWA 4CU6A 4IIHA 3OBAA 5KINA 1BQGA 4EAYA 1ZCCA 5B7ZA 2OXNA 3PBVA 1OCQA 2QCFA 4FF7A 3W75A 4NXSA 3CNYA 1E3XA 1L6SA 3EX2A 1DE6A 1TPDA 2BV9A 2TMDA 3NZGA 1HKWA 3UJRA 3UBPC 4DXXA 3TTQA 1XLJA 4N9BA 3W0KA 5CZ0A 3KEHA 2DZPA 3GU2A 1V6WA 2ZWYA 1TPFA 3EDJA 4F0MA 1KFLA 1AZ2A 3FA4A 1YHTA 2ISSA 4ZO6A 1RPXA 3N04A 3QKZA 3QBUA 4JHMA 3GKAA 5CH9A 1IT8A 5CEWA 3LTPA 4N4PA 3FGCB 1G0CA 4WF7A 1BHGA 4FXFA 3GR8A 3W7NA 3PC0A 2ZXDA 3BMVA 1TV8A 3K5XA 3CAWA 1UKOA 3OVQA 1UIPA 4RZ6A 2GJXB 3I68A 3W1TA 3BLKA 3F03K 4XBJA 1M68A 3RM8A 1KR1A 3SO7A 2E4TA 2BZNA 5I07A 3QSTA 1PKLA 4XSMA 5DCEA 4ZL1A 3H2FA 5I77A 2E25A 5IDIA 4MWAC 2I57A 4DLFA 4LJ3A 1QHOA 3BH4A 3GUWA 3SUUA 2VFHA 1JCTA 4JL2A 1OG6A 2F2HA 2VQUA 4LY8A 5HINA 1UZ1A 5K3VA 4Q6XA 1A4MA 7PTDA 3LXAA 1KGXA 1QR7A 4EXBA 1EJTC 1GGOA 1X98A 2Z0IA