2WVDA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
133
Chain Sequence
KDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLSTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 32
structure length 133
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvdA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvdA02
1QTGA 2KELA 1P94A 3H87C 2BNZA 1B28A 3FMTA 2BA3A 2HZVA 3VW4A 2Y3YA 4HV0A 3VEAA 3VEBA 2FGCA 2JXIA 2BJ3A 2JXGA 2RBFA 2K1OA 3QOQA 1PARA 3PHTA 2BJ1A 2CAJA 2K29A 1BDTA 3GXQA 3FT7A 1MYLA 1ARQA 1ARRA 2WVCA 2WVEA 1BAZA 2HZAA 4FXEA 2NZCA 3BKFA 1Q5YA 1MNTA 2K9IA 1EA4A 2K6LA 2WVFA 1B01A 2CADA 1MYKA 2WVBA 4ME7E 2F1FA 2CPGA 2JXHA 2K5JA 2WVDA 1NLAA 1BDVA 2BSQE 1IRQA 1Q5VA 2BJ9A 4D8JA 2BJ8A 2BNWA 3QSIA 2AY0A 2PC6A 3BKTA 1U9PA 2BJ7A 3LGHA 1X93A 2H1OE 3BKUA 2CAXA 2GPEA 2CA9A 3OD2A
chains in the Genus database with same CATH superfamily
3RTVA 3M1VA 3FSYA 2AJQA 4KPYA 1OIAA 1X4DA 1Z2LA 3M8YA 4OLPA 2BRLA 4FP9A 2OH2A 2MZQA 3I0RB 3B78A 1QVGR 1PC5A 4LJMA 2G0JA 4CIOA 2KZMA 2I5JB 1RWVB 3KK1A 3WC2A 2AN7A 4O3QA 1LV5A 2R7SA 3HO1A 3EICA 1KFSA 2GX8A 1RAGB 3W2WA 2K6LA 1VIOA 3IBCB 3MFHA 1C1CB 1NK4A 4Q45A 1IKVB 1Y10A 2VPYB 4B3MJ 2J7UA 2OPSA 4YY3J 3L09A 5IV3A 2PO4A 2ZDPA 1HI1A 4PWWA 5DG9A 5L1LA 3AD8C 1JLQA 2QT7A 5HQ8A 1X60A 1UMJA 3QZ7A 3GIMA 1GMUA 5CHCB 2DO0A 1HQEA 1B70B 4JI7F 4WFAQ 2NXEA 4P7VA 4Y65A 2JEIA 4H4MB 3CJ8A 2OAUA 2EKNA 4ZP8A 3DOKB 2XY5A 2W7OA 2MKJA 2GVZB 4ZHRB 3CULA 4GKKJ 4AQYJ 4DJBA 2FHOB 1C0UA 3I0SB 3M8QA 5DZ7A 3JAMY 5F8IA 2MHEA 4LR7A 2XCAA 1CJUB 2BJ3A 2HAIA 3KK3B 3IRXB 1XMOF 5ADZA 1TL1A 1Q0NA 1SJFA 2CPJA 1WC5A 2DR6A 1CBKA 1JLCB 4OX6A 3DOMB 4EFAC 2W24A 4OL8A 2YWGA 3FC9A 3MCNA 4BC7A 1SJ1A 2OMOA 1RWNB 3ILOA 2DO4A 5LM7E 3D6MB 3TEGA 3H2UB 1IJEB 1Q16B 2PA3A 4O3RA 2DNYA 3H42A 5HROB 2XTJP 4RWXA 3W62A 2W7AA 3SSSA 3DM2A 1SBRA 1CJVA 1PC4A 3IXQA 1L3TA 4B08A 4RBUA 1ELOA 1TL5A 2GO8A 5CH7B 3TVKA 4CLKA 1NK5A 1Q95G 1VK3A 2L9WA 2QN6B 4PYDA 5CXTA 4JI3F 4W98A 1CQMA 3KOAA 1NHKL 2GO9A 4D3HA 1GAOA 3R5JB 3KHGA 1HR0F 4RW7B 4ENOA 4DZDA 3KLEA 3H2VE 3VGUA 1L3KA 3C6UB 3HKWA 3GP9A 2N7YA 3GCWP 3OFEA 4GVBB 1N52B 2FJEB 2GAGC 1LWEA 2J8AA 3G6ES 4LFCJ 2WONB 4WU2A 1OPZA 3HJFA 4PAAA 3MZIA 1S5ZA 2OEMA 5HVHA 2OIHA 1UW9A 4Z37A 1YGYA 2K5JA 2HVDA 1I5OB 1S0NA 2BE2B 1WKLA 2V6AA 3RRKA 4YP3A 4A8QA 3K5OA 3DLBA 1E6YA 4L74A 1Q7YT 2X7IA 1MN7A 1T11A 2M2BA 4A47A 1SL0A 1P6TA 2YWFA 2V34A 5AXNA 2EVZA 1GXLA 2KRBA 1WC4A 3M6VA 1B28A 1FRIA 2HRTA 3GJRB 4PKDB 2O1PA 3EDRB 4IR1A 3MR2A 2ZBRA 1TKTB 1HHTP 5ETPA 1QVFR 3KLEB 4RW7A 1FFGB 4FKYA 1YJWS 4C8MA 1TKXA 4OYBA 3VZHA 3GPAA 2FJXA 1AYEA 1VGYA 1U1QA 2KU7A 1HD1A 1X5OA 3ET6A 5CA5A 2XLKA 1IM4A 1URRA 4HHUA 4WYWA 4FYDA 1NUEA 3TJ9A 2IC3A 5KT6A 3OW2R 2FVPA 3AB4B 4Y2KA 1T9UA 4HHJA 3IS9B 2CNNB 2MKCA 2PFFB 2WK4A 3QBCA 5KG3A 3A13A 5HROA 4LF6J 4X4NA 3KDNA 2EBGA 1X93A 1DTQA 1ZYQA 1PCAA 1QUVA 4GKKF 3SEOA 1O5JA 3BF4A 4KHPJ 4F3OA 1EB0A 5EUHA 1Y5IB 1J5EJ 5ETKA 4L6V3 3IRXA 2W2PP 4UTGA 3Q24A 1CJUA 1F3FA 4HT7A 4XTTA 1ZZFA 5DGBA 1F2HA 4LSZB 1OPIA 5RUBA 4ED3A 4EMDA 1MWYA 4DWIA 4AL6A 4EO8A 3SIPB 2MKKA 2ASJA 1U48A 1I94J 3MR3A 1FKPA 4H4MA 2NZ4A 2FB0A 3DDKA 5DS7A 2P9GA 3R97A 1VQPS 4ELVA 1HQEB 4NMLA 4OV1A 3KUEA 3ZZ0A 2E7VA 5DLFA 1JXEA 2F4VJ 2DGOA 2GVDA 1DURA 2MQQA 4KGVB 1RYRA 3IG1A 3DLJA 2PI5A 3OXFA 4OZ5A 2JDJA 3TJAA 1LNQA 1VC5A 1TV6A 1U6ZA 2OPSB 3ZTOA 4JI1J 3LALA 1IKVA 1N6QB 2HK3A 4NPOA 1RHQB 3MUVP 1WC1A 2Z57B 3PR4A 3HLUA 2QA2A 3MR7A 1Q81T 1VQ5S 1M5KC 4Y3CA 2CAXA 2VV5A 1B99A 3Q8PB 3OV7A 1YZ7A 2W8KA 2ZH3A 1AUSL 2MKYA 4F0MA 2UVUA 4N41A 1U0SA 4IFVB 4IKAA 1VBXA 4JI2J 2H65B 1MROA 1VYAA 5JXSA 4DBQA 3HSDA 1GTHA 3BGOP 3EZ5A 4Z7CA 3B6BA 1FD2A 4YB1P 2MQNA 4WPAA 3HZGA 3B4DA 5BJRA 1KLMB 2AX1A 4U6PA 2NPIA 2HZAA 1T05A 4NXNF 3OL9A 1RTHA 2H3EB 3BGUA 2PMZD 2JL9A 1VQOS 3QFWA 3W60A 1WKKA 2B8PA 1F0XA 2R3VA 1SKUB 4IG0A 1IWGA 2CPGA 3CDEA 4OI2A 2F4FA 1NLAA 2LDYA 3KJNB 3P3DA 2MLXA 3ULHA 5KT4A 3CCRS 4DQIA 1SC1B 2RE1A 1NPRA 2IMOA 3GCXP 1XEZA 3R3TA 2HHSA 3HP6A 1S1VB 3HHEA 4EZ9A 3CJ3A 4RU2A 2EXUA 3NLCA 5KFPA 4DUYF 1LW2A 4F4ZA 2OO4A 3ONQA 1D3WA 1RGVA 2J5AA 3IWXA 1TKDA 2BJ1A 2DY1A 4NA2A 5F3ZA 1K44A 2IJFA 1H7XA 1NK7A 2VC0A 3MURP 2QMUB 4EGLA 2ADBA 4TVAB 3AJ1A 3NMAA 4Q0BA 1WSVA 3IAM9 1KN6A 1VRQC 3CSKA 3T1YJ 3FZBA 4QIWD 4NLXA 4DR6F 1E6VB 2M0GB 4X4PA 4X2BA 5LXRA 3GV5B 1SC4B 4RNNA 5E3CA 3M8WA 1EKRA 2AEFA 3RB6A 5J1NA 2AF6A 4DG1B 1A0OB 1EZZB 4U95A 2O3DA 3NS5A 4ZVOB 4OJ1A 1YRXA 4OZJA 4C3LA 3G6XA 3QJJA 1RACB 1YLXA 2OPRA 1XBWA 4CM2A 2IIHA 1T9YA 4NI2A 2FC8A 5IFMA 1IKWA 2FJAB 2HSEB 2PA8D 3A3NB 4KHPF 3PFEA 1Z1ZA 2KG0A 1N5TA 2A18A 4O0NA 2VKZG 3JQKA 4EO6A 4HI1A 3BR8A 4B9NA 2DKOB 3KFWX 3QAUA 1ZAWA 3NGDA 3QGHA 2OI2A 4DCPB 4Q7AA 3KYLA 4I68A 2HPUA 4QPTA 2HNYA 2PEBA 3AAWB 2ACYA 4PXBA 3GR0A 5CD4H 2LYVA 2VA3A 3RBDA 4IRDA 5F8LA 5DDPC 5HLFA 5EN1A 2KJVA 3CPWR 3QGGA 3DNCA 2KELA 4IFYB 3GFZA 1NO8A 3H98A 4DX8H 2QA4S 1D9DA 3TUIC 3DRSA 5A76A 3MPUB 3QPIA 1EIYB 1HNIB 4L73A 2BE9B 3Q8SB 1YRUA 2VA2A 2FYXA 3FMWA 3RW7A 1D1UA 3IBWA 4B3RF 5IOLA 3LP0A 4ID8A 3TAMA 4C98A 3V6JA 3BSCA 1N5SA 5DM7Q 3K8WA 4F2RA 2GIRA 3HFVA 1AW0A 1WELA 1HWJA 3H4DA 1HWLA 5ETQA 3R7NB 1FDDA 2E5LJ 4ZPWR 3ISNC 1GMWD 3IM8A 4RKUC 2R2RA 4CLWA 4J9NA 1CEZA 1FERA 1QE1B 1FJCA 1Y00A 4M5LA 2CFXA 3W9JA 3OL7A 3OTOJ 1N0UA 4X66J 2DBBA 3QT7A 5CABA 5KAKA 2OPRB 4KPCA 1OWXA 4ZVQB 4MK8A 4UUXA 4X4QA 3LGMA 1K73T 4ES3A 3F0NA 2RH3A 5KTQA 4A48A 2DTJA 2QA1A 4DG1A 2HZVA 1S4EA 2GA7A 3AT1B 2P5VA 3KLFB 3BGFA 4WBFA 5A8WA 4B02A 1C2PA 2HHUA 1NM2A 1B7FA 1RAFB 2I6WA 2W2QP 3L7UA 3G87A 2PGCA 2HG4A 5L1KA 1D9AA 1R6VA 5KG6A 3JAMU 1N54B 4X4UA 1NDCA 1SC3B 5KFYA 1FDAA 2A1BA 3Q86A 3EMTA 1FE0A 2K2PA 2RDIA 2ZOGA 3DXBA 1FK9B 1RZMA 4R8UB 4YR2A 1IBKJ 3HHLC 2RNEA 5GAGI 1D0EA 1NKBA 4DU7A 3CDUA 4OHXA 2CNKB 4NLWA 2XO7A 3DRXA 2XSJA 4W92B 5EX0A 3PIOQ 3EZUA 2KRRA 3ILJA 1LW2B 3JSRA 4ZCKA 2V8DA 3WQPA 1AT1B 3FMTA 1X9WA 2B7CB 3HHKA 5ETSA 4UZCA 1T02A 3MPWA 3AODA 2X1BA 3DGPB 4PWUA 2E29A 3J7A1 1Q8IA 2BACA 2ZHOA 3W7BA 2FHJD 3LOUA 4JOUA 4TKTA 5HVGA 3IM9A 1AUDA 4GKJJ 4QIEA 1S0MA 4F4KA 1F2GA 4IG0B 4ATNA 5T7LB 3RJMB 1YTYA 4OZ2A 2ZH4A 4JI4F 1RTHB 3RW6A 2NZCA 4P2MA 3NRBA 4RW8B 1TL4A 4PR6A 5KG0A 3VV2B 4CYUA 4Z2XA 1RCXB 2XGQA 2QA4G 1X9MA 2E5LF 1H3DA 3LAMA 4JI4J 3N28A 4U96A 3MM5A 1RT4B 2WW8A 2CYYA 2DEJA 2Z2LA 2A0FB 4IFVA 2R7RA 1VRTB 4NOHA 1U25A 1SIWB 3UR3C 1YBTA 2AT1B 2B4UA 2FUG9 2ZBQA 1B0TA 1N5QA 2NXNA 2ZJPQ 2YKQA 1N6QA 4WZQA 1J2VA 2HRUA 3M2UB 1D09B 4NLSA 2ZFHA 5DDQC 1L3VA 1IBLJ 3S8SA 4F3QA 4Z7YA 5GADI 2VONA 3I5BA 4LBPA 3HPOA 2GVDB 3G9CA 4OYZA 4IQXA 2CVEA 4I4BA 3CDWA 4DPOA 3Q22A 3PYDA 3QAEA 1HWUA 3W2VA 3RAXA 2MHNA 4DR1F 1FKPB 1KOOA 3FBEA 3K89A 3M2VB 2ROEA 3A1YG 1U09A 4J9VA 3GIKA 1XMQJ 2Y9HA 3TI0A 2VQFF 1FXLA 1UAWA 1SV5B 1GMVA 1WWHA 2LU1A 1XTZA 3H5SA 1KQFB 3WIUA 4LBIA 4ZCIA 3L4BC 5A0YA 1H2VZ 4G1QA 4C97A 2K3IA 2VDIA 5DQIA 3HSZA 5DQHA 4DL5A 1ZH5A 3DRPA 4PQUA 1DTQB 3THVA 4KKOA 1S72S 2FJWA 1MSWD 2AGQA 2RUGA 3FFIB 3IC1A 3TAPA 1O51A 1VQKS 3CO0P 3R7SB 1DJ0A 2RQMA 4O44B 4FPRA 3SBMA 5KOXA 2L41A 2DNZA 3IS9A 3T3FA 1B4SA 1PJ7A 2LDIA 3FSIA 1T9WA 5DZ6A 2VU5A 3LWMA 1SCJB 1LXNA 4MIAA 2LVWA 1S9FA 2V4RA 3CC4S 2AYGA 3TRGA 2CKWA 3LWLA 3ET6B 1TU0B 4FXWA 1VLOA 3ITHA 4ER8A 4RNOA 3VAGA 5DJBA 4YN3B 5GMEA 3J7Z5 4ZVUB 4ZPCA 1S49A 2Q79A 5L9NA 2B3TB 1HNZJ 3QJLA 3PYEA 3TR5A 4E98A 3QJPA 1TKTA 4P71A 2R8IA 3PW5A 4FXDA 1IWAA 2FLPA 2GNKA 4WJBA 4QJVA 1WOSA 4DFKA 4O4GA 5BR8J 2CQHA 1V6HA 1RWKB 1YJRA 2JC0A 2K3KA 3LAKA 4PG6A 1RKJA 1U47A 1H74A 1FRLA 2FJVA 1E6YB 3OXGA 4PG7A 4NRTA 4MFBB 2I0XA 4DR5J 2DY9A 4NLRA 1X4FA 2GJIA 3GG0A 2L3MA 1LWFB 4LR9A 2PI4A 3JB9k 2LXIA 2XS5A 4LFAJ 2VB6A 1KQSR 3A8KA 3VQSA 1LWEB 5KG1A 3TZWA 4ECZA 5B0CA 3CC7S 3QGIA 2OPPA 1X7VA 4OI4A 4QYRA 4USJC 4YHHJ 4IOCQ 2K7JA 3VAMA 2GZOA 3C6UA 2JJ4D 4F4WA 1X0PA 2ASDA 4CWBA 2LMIA 5DM6Q 4AQYF 2ZH7A 3BZQA 3FEXB 5KOWA 1B64A 2FJDB 2O5DA 8AT1B 1Z4UA 3AXMA 3M9MB 3SV3A 1XC9A 3FCHA 4FF4A 2CQPA 3HMJG 3PW4A 2Z0GA 3PYGA 2O67A 2GJ2A 2M52A 4LF8J 3OQ2A 1CJTA 3ZFVA 3CEDA 3HDSA 4WZMA 1S1TA 1U0HA 5IQ6A 3N5BA 3RRHA 4KHMA 4MJKA 1WF0A 5HK4A 3DM2B 2KI2A 2E5IA 3MECA 4DPWA 1JJ2R 5E0OA 1GH8A 4M63A 2QIFA 3MTJA 4ZIWA 5I42B 3I87A 2YPYA 4GKJF 4L3NA 4JI3J 2QLBB 3R5CA 4F0HA 2VQFJ 1VQ7S 5D8HB 5KFAA 1ZZNA 3X3UA 1WTBA 2E9ZA 3G8QA 1YJUA 1RKIA 3L3CA 3JS9A 3M8PB 4LIWA 4LF2A 4ECTA 3MR5A 3KK3A 3RAQA 2DNHA 2V9WA 3M8QB 4A8SA 3T6JA 4LF1A 4AD6A 4ED6A 1YHQS 3DKDA 2DNGA 3HSGA 4DLGA 2HMIB 5F0UA 3CCJS 2D9PA 1GEHA 2VFVA 2PDAA 3MEDA 4ZK7M 3SQOP 4YUDA 3MM6A 1ZTTA 4N77A 4HHHA 4M5DB 2VFTA 4X62F 1NSKL 4I1TA 3QT8A 1JLQB 4DDFA 3WX4A 2DPIA 1B0PA 1RT1A 4H4OB 3UWTA 5MAOA 2XLJA 4FYXB 2QL9B 2Z4PA 3HHLB 3HKZD 5B0GA 1NB2A 4KY3A 3UCUP 3UDVA 2DR7A 4RNMA 4QU7A 2R2SA 3W2WB 3EDQB 5DO2A 4ECRA 3Q83A 1H2UX 3D0HE 4EYIB 2ABYA 2H48B 2R8KA 2QX0A 1Q78A 1R6YA 4NL5A 2FVCA 3NAIA 3KK1B 3Q23A 5D78A 2COLA 1UWBA 4WYLA 3UD3P 4USMA 1PAEX 3QT5A 4GO7X 4YR3A 2XMAA 4B3MF 2H1OE 3HX9A 5H1SV 1PGZA 3AOAA 5IT9Y 1YJTA 2E7XA 3HT0A 2B6AA 2CA9A 1AB8A 2NYHA 1SJQA 2RSQA 1UVKA 3HI9A 3MOJB 4DCJB 3MEEA 3ZTPA 4U9RA 2RIJA 1WEYA 1XMBA 5D4PA 3OJUA 4K8RA 2DGTA 1N8RT 3PW0A 2AGOA 3BV8A 1JNZB 2G9OA 3CJRA 3MMBB 4RBTA 2CAJA 1KFDA 3MM7A 3OFFA 5J2MB 3KUHA 4ZJOA 3EYZA 5M2UA 3CCMS 3V6DB 2C22A 5EWEA 3TJ8A 2F8EX 3BBFA 1D9FA 1Q1KA 2V68A 4XDCA 4IUFA 4HACB 3T1HJ 2ZH6A 1U6BA 1WG1A 1R0CB 3DLGA 5GVQA 4FVMA 5L38A 4URQU 2BJ8A 1X4BA 3UNYA 2JSXA 5FDLA 1V3SA 2JH3A 5E41A 4LF8F 3QO9B 1L5UA 4BCAA 4AUKA 3NY0A 5B09A 1RXOB 4LREA 4NZ6A 1P94A 2BNZA 1MMDA 5CYQA 1IQTA 1JWWA 1MU2B 2HBZB 2ATCB 1HI0P 4I56A 2XC9A 3TUPA 4J90A 2B5JB 5IS2A 1Y7PA 2GS8A 4PPDA 1BXNA 3GV8B 1LWXA 3W5XA 3K58A 2UVVA 1TFWA 3H59A 2I1RA 1KR4A 4RZRA 2L48A 4BHQA 4TU8A 3SFUA 2UV8G 4DSKA 1TK0A 1U1PA 1Q82T 5KFLA 2C3PA 2AIRB 1YJ7A 1RU1A 2HQIA 2RDDA 2RDJA 1R8BA 1F9EB 2CXEA 3P45B 5J2QA 1N0VC 3E01B 1JIHA 5U47A 3J80Y 5GAEI 2VC1A 2V2ZA 3FKBA 2Q6BA 4HACA 2M7SA 4NEZA 2XYHB 1SQEA 1ZS6A 2AJ0A 2CQ0A 3OSPA 4LF5J 3KJVB 1FJ7A 5B7WA 4PABA 3GWCA 4O23A 2C3YA 3CDAA 3O2IA 1A7GE 1TL7B 5ITHA 3CF5Q 1SL2A 2A6MA 4FXVA 4YB7A 2HHHJ 4LT6A 4QR0A 3MTKA 1JK9B 4MK9A 1VLYA 2BUNA 2K1OA 2H5JB 4N7TA 3D66A 2YPZA 2CG4A 2YKNB 3PJXA 4KB7A 4UQGA 2QFJA 3VGSA 5CAAA 5BYSA 2B6AB 1N56A 4JI8J 4CO0A 1DQ8A 1WG4A 1NAQA 3OFGA 3D9BA 2BBEA 3DI6B 5M2RA 4KFBB 4W4MA 5A2QU 3I55S 2KXFA 3TEHB 3D5MA 1N48A 3K57A 2FDNA 3FZ2A 4NWBA 2BYCA 2NSCA 5LMUJ 2J7WA 4DR7J 1R43A 1K0VA 1PG5B 2AYBA 1VI7A 1VISA 3FJ2A 4RW6A 3OTDA 2YNFA 4YEAA 5F9NA 4KJIA 1C1BB 3JTNA 5B0AA 3ILLA 5HBMB 2DB1A 2DGQA 2FD2A 2RU9A 4EUVA 2KG1A 1F6TA 3QZ8A 3DRRA 3FBFA 1RT1B 4DV3F 3V81B 4I6AA 2C2KB 1XMQF 1S0OA 3MI7X 4WK3A 1Y5LB 4C8YA 2ZWPA 3MUTP 3NOCA 3HHLD 3C6TB 3A4TA 3JQJA 1DLOA 3MM6B 2FZKB 3BO4A 3RB3A 2C28A 2EFOA 1G3OA 1YITS 1FRJA 1RTDB 2HRYA 2X51A 2HMIA 2KHDA 2PN6A 2ZUAA 4UOHA 3D6FB 1XK8A 2RS2A 4JUZA 1SH0A 4RX6A 4M5NA 4IOAQ 3GONA 3M8PA 4G1IA 3F73A 3R1HA 2UXDF 3E8OA 2ZEJA 4MK7A 4DX6A 3G71S 2ILYA 2OJ3A 1RT7A 5G0RA 2BR0A 4C8ZA 5I42A 1RAHB 3PRDA 1HWKA 2MPUA 3D0GE 4NA3A 1SJRA 5HI7A 4CLUA 1HWIA 5L39A 2F4VF 2FGCA 2EC0A 1KTVA 3RRGA 1F5AA 2ROPA 1CQNA 1IM6A 3MAHA 1S7HA 1S1TB 3DLKA 1WHYA 1HD0A 2XM3A 3K0JA 2J0WA 5MLCV 2MGZA 1S6UA 4NCGA 3JSMB 1S9GB 3NS7B 3EVOA 4IYQA 3VTIA 1DFDA 4RUHA 2VBXA 4KSEB 4DLEA 1LW0A 2DNPA 4NRUA 2H4WB 4FZVA 1TKZA 4CRJA 2LU2A 4DL4A 1VQ4S 2UVRA 1IKYB 1X4AA 4P2XA 5LSRA 4JV0A 4NXNJ 3W8PA 3C2PA 3V2UC 5KFSA 2KFZA 4RWWA 4N47A 4I6WA 3OHBA 4LF6F 3MAAA 2BKPA 4FPIA 2OUGA 2RMLA 5D3GA 2AU0A 1RAEB 2K7KA 1TUWA 1MN9A 3CB4A 1YZ6A 3H40A 2DPJA 4USTA 3DHXA 1OSCA 1WKJA 1Y3KA 1LWFA 5KFFA 3EPGA 4ZVTB 1VJWA 3HF5A 2K1RA 5CYMA 4WTOB 4J9UE 4RO0A 2WHOA 4JI6J 1Q4RA 4L72B 1TFYA 1UEKA 4MFBA 1U8SA 3NCQA 4PXEA 4AE5A 5I3UA 3VAIA 4GC7A 1Y11A 2DT9A 4M8LA 1WHVA 1YBAA 2G1DA 4LRAA 4OIXA 4IRCA 2M8DB 3HJVA 1TAQA 2J6TA 3F56A 1HW8A 3TA1A 3Q2TC 1CS4A 2YX1A 1NSQA 2V2VA 3D0IE 4C11A 4J9QA 5HP1A 1WF2A 3W9IA 2CNOB 2CZ9A 3IWLA 2LQ5A 4DL7A 1K47A 2KTQA 3D68A 3T1AA 2HQDA 3ITHB 1MWZA 2C2EA 1JLAA 1YQHA 3PDNA 2QYGA 4ZS6A 2DVIA 3PY8A 4Y6IA 1SQGA 2DHAA 5E5NA 2IDEA 4CO3A 1G1XA 2MZRA 1HQ2A 1N33J 4QYZK 2CZ4A 3HD2A 4DL6A 3ZNUA 1U1KA 3BREA 1NB7A 5CYJA 4DI6A 4WIIA 1S76D 3E51A 4A8OA 4QWEA 4N76A 1QM9A 4WFZA 4NLTA 4X65F 2U1AA 3KLHA 3TA0A 4M5MA 4YQWA 1ZA2B 4X65J 5KFOA 1UVJA 3MR6A 1K0TA 4B3RJ 4G1QB 3LUYA 1JLGA 1OY9A 1KP6A 2BJEA 2LA4A 2QL7B 2GHVC 3LTOA 4C0HA 4CT9A 1V3RA 1FF2A 5I4MA 1BHNA 2D7SA 2LEPA 2QTWA 2JXHA 1NJIT 2EC2A 3FEZA 3R9LA 1CULA 3DN9A 3QSIA 1UL3A 1VRUA 2Z30B 3CCTA 3R5GA 4ZA1A 3UO0A 2M70A 3VHQA 2KH9A 4RBVA 3OL8A 3NNHA 1C0TB 3LGNA 1UJ6A 3N6MA 3PO4A 1PYTA 3K17A 2SXLA 3EUNA 3UD4P 4B9UA 1FRHA 3NWGA 4WKRA 3NCPA 7AT1B 4CTAA 5FLXY 1XWLA 3UCGA 4DHVA 1YX2A 4LIRA 3VCDA 4WXOA 1R8PA 1RWUA 3D1HA 1VHFA 5F0WA 4E8UA 4A8YA 1WUUA 1XJWB 3M4XA 2HS0A 2WSEC 2CQCA 4RL1A 3DLHA 1D8ZA 2JHEA 4CP5A 1KEKA 3CWJA 1DHMA 1VBZA 3KKFA 3PTWA 1NJXA 1N36F 3KG4A 1VOMA 1XN9A 2YNIA 2M8HA 4OI3A 1R89A 4OMFG 2MQPA 1EQMA 2RRAA 2Y1JA 2WCXA 1RT4A 1KHVA 1OS5A 4NE9C 3H5XA 1UJ5A 2HHPA 2ZH9A 3BPSP 2ZHBA 2CPZA 2MY8A 3U02A 4HVZA 4CI0B 5EX3A 4YFUA 3A3PB 3OUYA 1Y4ZB 1SUQB 3CIMA 4J9LA 1RTIB 3BN7A 2FIUA 1HW9A 4RW8A 5K20B 1RT2A 1Q86T 3DDNA 4WFNQ 2BE7D 2AWZA 1FKOA 3CJ0A 3G96A 1FWPA 2CJKA 4ZIVA 1H38A 3DYAA 2KL8A 1WSRA 2Y0SD 3KLGB 4WFBQ 5KFUA 2HWIA 1BD6A 3SQGA 3M30B 4ED5A 2U2FA 4ED4A 1XR5A 2EI5A 1UCNA 2VPWB 2E7WA 4GRSA 4QIVA 1UPMB 2BM1A 1TTHB 2DD8S 2OELA 2XLIA 4LF7F 3I4HX 3ZTQA 2VOOA 2PT0A 2DNLA 1X5SA 5B0FA 2YNGB 4K4UA 4DR4J 2F8MA 4DUYJ 2J9EA 2Q1LA 2B43A 3I31A 2YNHA 3QT6A 3GV7B 1F5CA 3BJYA 2ZNYA 5D4LA 1HNVA 4I2PA 4DV4F 4NYZA 1BUXA 4IO9Q 1HNXF 2RRBA 2CQ1A 4QBUA 4NCBA 4DPXA 1GX5A 2N4DA 4C4WA 3H0PA 2KOEA 3V5RA 3VGTA 3MMAA 5CZVA 2KT5A 4ALZA 4ZPAA 5KFWA 3WIVA 2YQ0A 4Q44A 3JYTA 4DR2F 2Y3YA 1LQ9A 4KV8B 3OR1B 2C2RA 4KBIA 4ZJLA 1RWMB 2JC1A 1SKWA 4DN0A 5ETRA 2VL1A 3KLFA 2MYFA 1Y3JA 3NBPA 2ZM6F 4P52A 5A8RA 3T9NA 3UVJB 2RQCA 4XPEA 1AFIA 5B08A 2DGUA 2WVFA 4PRFA 3M8ZA 1RUSA 2RHQB 2FY8A 3CJTA 1QE1A 4OYOA 4UOCA 4DFPA 2DNQA 2F8HA 2RKIA 1ZA1B 2IFXA 3GB0A 1TVRB 3D3BJ 3TNVA 4AT1B 5EWGA 2IVYA 2UU9J 1HI8A 1RP5A 5AJ3F 1NK9A 3MMAB 2FHJA 4Y2CA 1UZHA 4DV0F 1SL1A 4NXMJ 1WDTA 1HNWF 2HHTA 4HTIA 1MMNA 2BMBA 2P6TA 1GTEA 3LH2S 5CQGA 1KLNA 1QTMA 1QDUB 3PNIA 2JLEA 3HCXA 4LRCA 5KFDA 4DV1J 5H9FK 3PXGa 3ZTSA 2UP1A 2YNHB 2FVRA 1FWLA 1LKZA 1NH7A 2EKYA 3CE8A 2XI3A 2D1CA 4IFYA 3TWZA 3C66A 2R42A 3MD1A 5KG7A 2YKOA 2VIHA 2N4CA 1S1UB 3FQLA 1I51B 1IKXA 1VFJA 3I82A 2UUAF 1SI9A 2W4PA 4N5SA 3T5LA 3I4PA 1PKUA 4FBUA 1QSSA 4CLTA 1UJ4A 3GJQB 4ILRA 4ERDA 4DL3A 2HNYB 5HAOA 4ZVHA 4ZLPA 2W4CA 3VQTA 2HIYA 3DYAB 3W1YC 4M94A 1HFEL 3TUZC 1FKOB 2HVZA 4DV7J 2UXBJ 3OD2A 1OYDA 1RT6A 3CCES 3T19A 2WTFA 4K4XA 2C2DA 2HQ3A 1VBYA 3L9ZA 4KH0B 1SUQA 2FTRA 2CPHA 3L7PA 4TY9A 4O3NA 3OUYB 1BQMA 2VASA 5IQQA 3GIIA 3EM1A 1V5VA 3KG0A 4NEYA 2MLYA 4NI2B 2ZJQQ 4G3IA 3OVBA 3N79A 3R27A 4UF4A 4JP8A 2ZNZA 6AT1B 3JTOA 4Y0FA 2W4DA 5D77A 4DL0C 1E6VA 5ETMA 5D0RA 2HVEA 4OZ3A 4P9SA 4CO2A 1FNMA 2G2YA 3FRYA 3IGNA 5J1EA 5LMNF 3US5A 1L3UA 1SIZA 1V3ZA 1FEEA 5GADU 3QWPA 3C8YA 2DXDA 4EEYA 1NCLA 4QW9A 3QRPA 1NXIA 2YQ3A 3PACA 1YG0A 2CIMA 3M9OB 4RUAA 4KQZA 3I5AA 4MAKA 3HHNB 3THPA 2HWHA 3FCVA 2BOAA 2W01A 3S01A 4ZP6A 1NRKA 1T03A 4LF4F 4LFCF 4AL7A 1SXLA 4TLRA 4KRWA 3WZ0A 1S10A 3LP1B 4WXWA 4K5SA 1SQFA 2H3AA 3D7SB 4IDKA 2K9IA 3DLEA 4J9OA 2HVIA 2MTLA 4H4KA 3CJKB 1RHRB 4ZN1A 2V4JB 4P10A 5KFKA 2J6UA 4QPXA 4F4YA 4I69A 1S7IA 5HATA 1KNZA 2DGSA 1J5OB 2XWYA 3K2YA 1FJGJ 1NEEA 2ZOFA 3AJ2A 3O8WA 3U1LA 1FFSB 1WDDA 4DX5A 1X9SA 1T05B 3POTB 1ZM3A 1FX4A 2DIVA 1KLMA 2AKWB 2DXFA 1K8AT 1R27B 2BEFA 2RB7A 4M5HA 4DQQA 3RBEA 2YY3A 3J7ZT 1OQ3A 5K14B 1HQUA 2V5HG 4O3PA 1N88A 4QWBA 2WOMB 2Y1RI 3QQCD 1RTZA 2GMJA 4PG5A 4IH7A 4NCAA 1N32J 2G1HA 4BDPA 2PEHA 3H2LA 2Z58B 3KTQA 3C14B 1S48A 9ATCB 2JVOA 4YB5A 4ETZA 1W2BR 3KWMA 2HFOA 3IO1A 1UA0A 1NDPA 1CSJA 1TV6B 3O3LA 2HK2A 1R0AB 1KRPA 4K0KJ 2MEWA 1IRQA 2CDQA 4ZN3A 2OGUA 2B4VA 2ILZA 3Q8VA 3PZPA 2XY7A 3TQ1A 1W7WA 4UOGA 1IJFB 1WEXA 3GFYA 4FDFA 4ZLJA 1DAXA 2Q6CA 2GPEA 1UWAA 4O3SA 5IT9U 4ECVA 3RBZA 1W25A 4Q8FA 2HHWA 4C3MA 4TLQA 2UUWA 4P2FA 1F60B 3GMGA 1XQIA 1LWCA 5C2GA 3TX8A 1NMEB 3PV8A 4UQTA 1WD6A 2R8JA 1IKYA 2B4PA 3EVMA 3WBZA 3M6WA 2QLJB 1XR6A 4EBDA 1LW0B 2W2OP 3CD0A 4F4XA 2UXCJ 2HS3A 1HMVA 4WK1A 5KFQA 4K7QA 2R8HA 1U1LA 5DDOC 1S9GA 3MD3A 1QAIA 3MOZA 3NAHA 2YH0A 4UUWA 2MGZB 1GFWB 3MF5A 2VG6B 2BANB 5HO4A 2MSTA 3DLKB 4NYPA 2C1EB 2XBPA 1YK9A 1Q5VA 5KFVA 2O01C 2ATLA 3N6NA 2AY0A 2IM1A 4C8KA 2NXJA 2R2UA 2ZJRQ 3RB0A 2X1GA 4QWCA 4ED1A 2UUCF 1M0SA 2QGFB 2X3DA 1YJNS 4QCLA 1Y5NB 3CJ4A 3DOLB 3VVUA 2XHCA 1RT7B 2ZBIA 3H20A 4HEA9 1M1HA 5G0RB 4ZLNA 3T5JA 3UN2A 4NLQA 4IRKA 5HMYA 4CM0A 4JI0J 1G6BA 3SCIE 1XIQA 3ICLA 4RUCA 2XS7A 1NZ8A 4OJ3A 3JTPA 4CLZA 4K4VA 2RBFA 3BSOA 4OZLA 4ZKAA 1RAAB 2J9DE 1IBMJ 4LFAF 4JV5J 4Y2IA 4ZPVR 2OEJA 1FVSA 4B3SJ 2ZH1A 3DC2A 2ZVIA 3V4IB 1JX4A 1Z2ZA 3G8TA 1UVIA 3C6TA 1S6QB 2E5GA 3TUJC 1U1NA 4C7QA 1T8EA 4USVA 1H7WA 3M9NB 2WVDA 3BQ1A 5LJ5Y 1SKRA 2NQPA 1WC3A 3V81A 4UT4A 1YVFA 1R3NA 5LOQA 4I64A 2GMLA 1RSCA 1JJHA 1P9QC 1JLEB 2YNFB 5M2PA 4RW6B 5B0BA 3BB5A 2A10A 2GIQA 3FRZA 4NLVA 3Q0AA 2UZAA 4GVBA 4DV2J 4HT5A 2Y1IA 4OX9J 4EU0A 3Q8QB 1U2CA 2VH7A 4DV6J 2BKNA 3I96A 2WW4A 4Y2MA 3QIPB 4P74A 4ED7A 1K9MT 4JI5J 2ZKUA 3PJWA 1NNDA 1F5BA 2AZ1A 2VKRA 4DV6F 1N34F 3PG9A 1M90T 3SCKE 2BW7A 1KDNA 1TUGB 3M32B 3K5MA 2XMWA 3OTEA 2FLNA 4OHWA 2CQIA 1N33F 2WVCA 1AA1B 2FPHX 3OPKA 1Q5YA 3P5BP 3ZZUA 1HBUA 4ZMMA 3HD1A 3OR2A 2HYIB 2RF2A 8RUCA 3I56S 2YKNA 2AJ1A 2HFVA 4DQRA 2XNQA 1JKHA 1BE4A 4RPFA 2WAQD 4WE1B 2HQGA 3DHWC 2BNWA 2AYMA 2GQCA 3PJ9A 3V6HA 1FE4A 1Q16A 3EJMA 1WI8A 3NGTA 4QR1A 3JQMA 2DXEA 2J9CA 3SZ2A 4JYAJ 2LP4A 3VAHA 1H72C 3CXCR 2JFDA 2KYZA 1RI7A 3DOMA 3KJVA 1JLCA 4OI6A 3TARA 2HBRB 2XHWA 4EK2A 3R5BA 4TYAA 4BLGA 2EEYA 3AQPA 1GQEA 3KLIB 4F26A 1NHVA 1C0UB 1S57A 3E01A 2QRRA 3TP2A 4M5JA 3NP5A 4ANEA 4DX7A 2RU3A 4LBHA 4ZHRA 2QSWA 1FNXH 2QYCA 5SZTA 1FHTA 2AV5A 2LQBA 4DF4A 1U49A 2OKQA 4LRVA 3RB4A 2NCKL 3FUYA 2B5JA 4M5IA 4B17A 5JJBA 3NXZA 3CMAS 4BWMA 3VAFA 3W66A 4OYPA 1S1WA 5F41A 1RABB 3HXMA 1JJ4A 5CYQB 2LXFA 5KT7A 1R8HA 2W2MP 1QUPA 2AMCB 4ZVRB 3H90A 2ZH2A 1N5YB 2UXCF 2ZUGA 2A2BA 3ZNJ1 4RU9A 3CCVS 2ADLA 3UN3A 4ILLA 1WTFA 2K8GA 1JB0C 2IBOA 2ZHAA 4CNZA 4FBTA 5FDLB 3AJDA 5HQLA 3MFIA 1JLFB 4ECWA 1W26A 3CT9A 2UUAJ 1NBEB 5EDWA 3CUNA 3I0RA 3NNAA 2GCFA 3KMSA 1O6XA 4DS5A 1WI6A 3H5UA 3M1VB 1M5HA 4DQPA 2MSSA 5HSPA 5J2NA 3WX8A 2DGWA 4C0BA 2FHKA 3PO5A 2RAQA 3V6DA 4LVNP 1IQZA 3H7HB 3AHPA 4ZCMA 2ASYA 5FLXU 2P9EA 3AA8A 3BGRB 3BGRA 2HGNA 4UW2A 5EHHA 3J81j 4ECXA 2C3UA 2V8VA 1U1OA 4PG8A 1VC6A 3BKTA 4DR3J 4S0MA 1KWMA 5KT2A 3MHYA 3VF0B 2A2CA 2I38A 3BS9A 4WIQA 5D0HA 1X5TA 5J2NB 3UW1A 1DQ9A 2MZTA 4C6AA 4EBEA 4LF9J 2LQJA 4PQAA 1UEUA 4P6QA 5D0GA 2A3JA 2QV6A 2R2TA 1FKAF 4F67A 1Y0HA 2JXIA 1RE1B 4B9LA 4H54A 2DEIA 2V50A 1IR1A 3FSXA 4TYBA 1UP1A 1VR6A 4YOEA 2XY6A 3GXQA 1NPPA 3IGVA 3VWSA 1AFJA 2E9RX 5L8RC 2QJ3A 4P2SA 2EG2A 3OTCA 3ETMA 4FYVB 1HBOB 2Q2KA 1S1WB 2AHOB 2AZ3A 2MJUA 2F1FA 3HHLA 3MPVA 2VBWA 3VZIA 5KFBA 1YBUA 2BV3A 3CCSS 2NUHA 4YB6A 4F0KA 2F63A 5HMZA 2AD9A 1KQKA 4PQUB 2B0GA 1T0TV 2D3O1 4A8MP 3MGJA 3IRWP 3UQSA 1UKUA 1RBOB 4JV2A 4KIAA 3TA2A 4JYAF 4LSNB 1BQXA 3AD7C 4CO5A 2P2CB 3KLIA 4OYMA 2QSFA 5DQGA 4EYHB 4IO1A 1H98A 1H2TZ 1J27A 5T41A 4F3MA 1MLAA 2CJAA 5KFMA 4O4RA 1OQ6A 4ZDNA 5BR8F 2X3GA 3CJQA 1U1RA 1URNA 2KFNA 2YBVA 1VK8A 1BGXT 2B9EA 2MDAA 5AE2A 1JKHB 2MMYA 1RTJB 3W5ZA 5C42B 2RF2B 2XMMA 2W9CB 2CUYA 4XDDA 3R5DA 1RHKB 4LSLB 4DUTA 2CQDA 2O66A 4TN2A 3TVYA 8ATCB 2IRYA 2C3OA 2GIFA 4PG4A 4ICLA 5ETNA 2XMVA 3M32A 3K5PA 2CWKA 2XO6A 3D6TB 1YIJS 3VEAA 1CJKB 1TL3B 2DYAA 3KLVA 3QIPA 4ECYA 4OHZA 4ZOSA 4KTQA 3C46A 2V2KA 1JXVA 2LFVA 4NX9A 4RJVA 4CCHA 1CLFA 4P7TA 3DGVA 1BDTA 2VD3A 4WP8A 3LPYA 2UXBF 4I7FA 3KDOA 3UR0A 2JEFA 3CCUS 3VR1A 5C25A 2MLZA 3D28A 2R8GA 4FNHA 2IPOB 5KFIA 3GSDA 4I2QB 2KJWA 3I32A 4ETXA 3M2RA 3LO3A 1B0VA 1UW4A 3NNCA 3IP0A 3EGWB 5F8HA 4XO0A 2HNDA 3VVTA 1U45A 1BC6A 1R0BG 3P96A 2OMLA 1KQGB 3B82A 5E33A 4DSIA 2W1BA 3R2DJ 1U6FA 4JI6F 4O4GB 1JMTA 1T9TA 5A8KB 3L95X 4USUA 4ANCA 4QIFA 3K5LA 1PYSB 3CVKA 4Y2AA 1VHIA 4ZITA 4AL5A 3LA0A 2MKIA 3A8EA 3QRQA 2VFRA 3NGUA 4NZ7A 4OX7A 1PJ6A 1S4FA 2CJYB 2N7CA 3MUMP 1FO1A 2H5EA 2LXUA 2IVFB 4AAIA 1EJ7L 1FXDA 1OHNA 4TY8B 2N82B 2APOA 3NCRA 2JOQA 4K5RA 1MG7A 2IJNA 2RQ4A 3SDEA 2W9BA 4FKXA 1SPBP 2J0SD 3P8BB 4JB8B 4U7CA 1WG5A 2VG6A 1XR7A 3I9ZA 4P75A 1NZAA 4LQ9A 1FTCA 4KKOB 4EBCA 2MY7A 1KONA 1ULRA 2EWHA 3DRPB 1HMVB 3KK2B 2OHDA 2ZM6J 1FESA 4YMEA 2CQ3A 5J2PA 3N5FA 3PFOA 1GNKA 3M8SA 4A4JA 2X1AA 4Q8EA 3Q8UA 3EWGA 4KGMA 5IT4A 4DR2J 1RT3A 1LWCB 3F41A 1XNRF 1SV5A 3G6YA 3NKYA 2XQCA 5C2CA 1Q7LB 2YKAA 3DXSX 1AZSA 3PR5B 3RYLA 3M2VA 4C8OA 5HL7Q 3KHLA 2VBYA 3W2VB 1KVKA 2OD6A 3IN5A 4PUOB 1FRXA 4DSJA 1S1XA 4ANDA 2DHGA 3HVAA 1RAIB 1P1LA 1OY6A 3EZOA 4NLGA 2XWXA 4KE5A 2LQ8A 3M2UA 2ADCA 1FNOA 1G4CA 2VF3A 1PILA 3BBBA 3KHHA 4ED0A 1I6JA 4LF7J 5E3AA 3SXLA 4CLSA 3CCLS 3PHEA 4KYZA 1VIXA 2CJ9A 2QC3A 5IV4A 2V67A 5KFCA 2FC9A 2KKEA 3IR5B 3AQOA 4RLEA 2Y8WA 3R8YA 5GAHU 4NMXA 4DQSA 2WOMA 4HDGA 2JZ5A 1HQUB 4QIGA 5K14A 3VAJA 3BM7A 4F25A 2H1YA 4HH1A 2CZVC 1EKSA 5H9FJ 1RA6A 4CNYA 2D3OR 2LA6A 4OHVA 5T7LA 2EFVA 2WVBA 4L3KA 1AROP 2DR9A 2FGOA 2OTLS 1VBKA 3J7YI 1RT3B 3MAQA 2VQEJ 3CJKA 2EK1A 1UFKA 2PC6A 2YKMB 2ALYB 3HVRA 2DNMA 4NA1A 5J2PB 2G0IA 2HKEA 2ZDOA 3UDLA 4ES2A 2VODA 3GFXA 4A8KA 3G8SA 4OZNA 2P9CA 2ZD1B 1HKAA 1H6KX 2H51B 2JRSA 3HFKA 3ISND 1T03B 2DCUB 2HNZA 2KHCA 3AFGA 3AY0A 4DU8A 2W2NP 2HHVA 1RHMB 1HL6A 5AXMA 4KGXB 2XSJB 2DR8A 3OJSA 2W9BB 3SDEB 2JBVA 4WU3A 3PHTA 2HWTA 1MNEA 2V2QA 3R5AA 1FRKA 2RQKA 1FK9A 4R8UA 2HBQB 4B9VA 4TY8A 3CO9A 1NK8A 3J81U 1NPKA 4ZPBA 2D69A 1FWKA 3MM9B 3FQKA 4LRBA 2HFZA 2WSCC 5DLGA 4HYKA 4I67A 1TAUA 3T9ZA 3C19A 2ZZNA 4PEOA 2WB4A 3TYTA 1QAXA 1NSAA 3UFCX 3GJSB 3ILIA 5F3TA 2RS8A 5LJ3Y 1KC8T 1HNZF 4DR7F 2N3OA 5D0EA 1SJ3P 2JWNA 4G1PA 3NGKA 1SJ4P 2KXNB 2LQ9A 3I5CA 2G13A 2E1CA 5KFXA 4UY8T 3J7AN 2J6SA 5HJXA 4C48A 2KVQE 2J0QD 1EARA 3O44A 3M2RB 3GILA 3IR7A 1NU4A 2DH7A 3U1MA 2EG1A 3ADAC 3CIZA 3QIDA 2IM0A 2WBRA 1FA0A 2EPIA 2D74B 3C16B 4J7CA 2JFKA 1RT6B 2AYEA 2DK2A 4C0OC 2RRNA 2NSBA 4FN5A 4I7FB 4IH6A 2BDPA 2IYIA 1HR0J 1LXJA 4U67Q 1KD1T 1MWQA 4OYIA 4R5PB 4H4KC 1RAOA 1D8YA 4C3KA 2YWHA 5LMNJ 2UUBJ 4MYTA 4TNOA 1RK8A 2I2YA 2ZKTA 1TL3A 3JSYA 3TAQA 1CJKA 1EHWA 1HPZA 1SC6A 2RILA 2XCPA 4ICLB 1HLWA 3IA0A 2QEXS 1BWEA 3MPDA 4MMOA 1ZTWA 3CD5A 3NMRA 4JI0F 3L7OA 4DV0J 4NXMF 2C2OB 3RU0A 5HLFB 2H9ZA 3HVTB 1TR0A 1F3VA 5C24A 2XG8A 4OX9F 2W9CA 4LRFA 4DPUA 2W25A 2M9KA 1NJZA 2BA9A 5AE1A 5EWFA 1QLNA 3GIJA 2CWXA 4ZJQA 2GAHC 3OVAA 2DHSA 3KUGA 5F8MA 4X64J 3FEYB 3IR6B 2B8QA 1TMJA 3W63A 2AJ2A 5A6PA 3OVSA 4WP3A 3TOQA 3D2WA 1PO6A 1RYSA 1M1KT 2B51A 3ENQA 3P6YC 2VOPA 3NGSA 1FXRA 4OZ1A 4Y34A 1TVRA 3M7VA 5GMDA 3W5YA 4A8XA 1S79A 4BWJA 3HM9A 1IKWB 2KB2A 3LW5C 4LSNA 4HH0A 2HLUA 2ASLA 3D6HB 2H5IB 4PPZA 2IBKA 4ZPTR 1ZM2A 1IBMF 2VICA 2IJRA 3UVJA 4U8VA 2NREA 2BQ3A 4LUBA 3NBPB 2VDHA 4YY3F 3BQ2A 2OSRA 2QLFB 3MM8B 2LEBA 1ZBTA 2R4FA 2IRXA 4J37A 4R25A 3QNWB 1QTNB 3Q2SC 3W65A 3N0VA 3GQCA 3SV4A 4ELUA 3OR1A 4FVCA 4LFBF 4F36A 2UUCJ 5HVFA 1HBOA 1IUJA 2LCWA 6FDRA 3AOCA 2E9TA 1A9NB 2CJXB 2WVEA 4UOFA 1C4AA 3LPEA 4Q0BB 4DL2A 1HNWJ 1HBNA 1REGX 2UXDJ 2LECA 1VQYA 1HNVB 1EX8A 3WDOA 5GAGU 1XNQF 3CMQA 3OFHA 2CJBA 2EK6A 4MH8A 2VPXB 3NEKA 5ETOA 3U1NA 9RUBA 4DUZJ 2YNGA 3D67A 2BJ7A 1YWXA 2UV8A 1HYSA 7FDRA 1GT8A 4LRDA 5T14A 4MIBA 2GC8A 1QD1A 1S1VA 4ID5B 2MQMA 2OP5A 1FX2A 4B9MA 1CPZA 3M05A 1RISA 1YSJA 4M1KA 1FFWB 3RAMA 3TW0A 3M30A 5KFHA 3SQGB 1FEHA 2VHGA 1VQLS 2MB0B 2AEMA 2OPQA 2CDRB 1FJGF 2IAJA 1PSDA 4DUZF 1REVA 2QG9B 2BX6A 2VG7B 4USKA 4ZVSB 5IZHA 1UVMA 1RT2B 2MXYA 4OFZA 2ZH8A 2R7WA 1PBAA 3M6UA 4DR3F 1APSA 1RTIA 2ZZMA 1KHWA 2DIUA 5L1JA 3E2EA 5K8OA 5ETVA 1UPPA 5KT5A 1U26A 3QSYB 4C9DA 3MEGB 1MROB 3S7RA 5LL6d 5D4NA 2KM8B 1UA1A 1JLFA 4JV1A 4M95A 2M3DA 3H25A 3RR8A 1Q8LA 4JI8F 3RG6A 2CQGA 3BH7B 1RHJB 2GJFA 2KKHA 2QLWA 3AH6A 3PM9A 4MKBA 3AD9C 2UUBF 4LFBJ 2CQBA 3U27A 5BYRA 5K8NA 1M5OC 4X4SA 4WF9Q 2QMWA 1N5YA 4U7UK 1PAUB 2BQRA 2BA3A 2CPEA 3VW4A 2POKA 3BEGB 3FMBA 3NWRA 2ERRA 3TQEA 4CTAB 5SUHA 2V8HA 3SCJE 2I9SA 2RD5C 3IG1B 3FK4A 4QQBA 4DCOB 2AGPA 4L76A 1C0TA 1SH2A 3EGVA 2DGVA 1XERA 2BZ2A 5IWAF 4XPCA 2M88A 4HDHA 4X84A 1CULB 1HA1A 4JI5F 2DCLA 1IVZA 4LR8A 2GFFA 1I1GA 2HFNA 3BH6B 3W8GA 2D41A 5K9FA 3H5YA 1OO0B 2D3ZA 1JLGB 4LF4J 3DCAA 3GYNA 2Z2YB 1UTAA 3X1LB 2PD1A 1IR0A 1T7PA 1QSLA 3KLHB 4YHHF 2FLOA 1VQSA 1ZOTA 3GIRA 1U4BA 4TU7A 1X8DA 2GMHA 3EPIA 3G82A 4YS2A 2KN4A 4WE1A 1KOHA 2VJVA 2R7OA 4F8RA 6FD1A 2GV1A 1SVDA 2HFSA 3CD7A 1TP7A 4J5OA 3OR2B 5DETA 5F8NA 2YQ1A 2IC3B 1QAJA 3BDPA 3ZZOA 1HBUB 1S0VA 3NL0A 1JLBB 2VJUA 2OEKA 2C42A 4USWA 4UY85 1B01A 1EA4A 3S6EA 5ETLA 4EI2A 2Z2ZA 1DZ5A 1TKXB 1FI4A 1PIEA 2XZWA 3MPYA 2BXJA 2W7PA 4RNFA 4DR1J 2BQUA 3P4UB 2BJ9A 5HP1B 4DR6J 1ACMB 1ZPVA 2XMKA 1BWVA 5I3QA 3QWUA 2PE8A 3OL6A 1CS4B 1RCOB 2PSZA 3T1YF 5K5MA 4MKYA 4AXJA 3D1QA 2ACMA 3UN5A 3CJSA 5I3UB 1JLEA 5IM0B 1M5PC 4WFXA 3SCLE 2BE2A 4ZP7A 4NZ0A 2JXGA 5CYMB 2DR5A 5JMNA 4DV7F 3N6LA 4J91A 5IT0A 3MCOA 5IWAJ 5AJ3J 3J81Y 3BDEA 4F50A 1S6QA 4X4TA 3T41A 1U2RA 3V4IA 2WONA 3UNGC 4QU6A 2R7TA 1V9OA 3LJPA 3EXYA 1BMQB 2WRMA 1RAJA 4DOZA 1LK5A 2DJWA 1TK5A 2OFGX 4URSA 3N01A 3SMZA 1RQ0A 2MJNA 5D6GA 1R31A 3H8YA 4FYYB 1U9PA 3CMES 3LGHA 4NLOA 4KR0B 2ZH5A 3MDFA 4ECUA 4B3SF 4IQMA 3U7JA 3DOLA 4NCGB 1YJ9S 1WEZA 4A46A 3H87C 2C3MA 4QR2A 1N5VA 1T3OA 5FIIA 5CCMA 2R7XA 2DHXA 2V8GA 1RDRA 2B4OA 1CJVB 1Q8KA 4NLDA 4X62J 1PARA 4FNIA 1IBCB 1YJVA 1UVNA 1OJ4A 3PRBA 5DG7A 3CCZA 2BANA 3DU6A 1KTQA 1WHWA 4KGKA 4Q2MA 4XAKA 1K1QA 2UU9F 2HHQA 4ZP9A 2MQ8A 3GR1A 1IBLF 3T5KA 3BYPA 4XIUA 3RGIA 1G7CB 2QLXA 5K8MA 1TL1B 1CG2A 1H73A 1S99A 3DFEA 2DITA 4ED8A 1DRZA 1NK6A 1P9YA 3M6XA 3HVWA 1RWXB 1O0PA 4Q2LA 2W9AA 4ED2A 3FBCA 4G6VB 3I0SA 2R7VA 3O6QA 3BSAA 3M8RA 1QJHA 5F8JA 2CPXA 1RTDA 1UFLA 2GVZA 4HI2A 4OLOA 3DOKA 4NLUA 3TANA 1DLOB 4A8FA 2QFIA 1BY9A 2YWKA 3A8IA 2KVIA 2RT3A 4KGZB 4K2XA 2UUTA 2RUSA 1ZAXA 4WP9A 3UDEA 2MZSA 3DRRB 3TZXA 5EGYA 4PCQA 1R0AA 3QRRA 5HMXA 3E3XA 2CQ4A 5IM0A 2K29A 1X4CA 3I9V9 3NGRA 2BW2A 1C1CA 2PMHA 5BYQA 4X66F 2FVQA 1HNXJ 4CDIA 2B9YA 1OYEA 2Z8QA 3C14A 4NLPA 5GMKa 3ZZTA 4URGA 3TO8A 1FT8A 3Q8RB 4DSFA 3V6KA 4NASA 4OJGA 1CC8A 2MQLA 3ZTRA 4DR4F 2QMXA 1HARA 5KT3A 4K0KF 2I5JA 4V19X 2IRUA 2DRAA 4MYUA 1GK8A 2HQFA 3BYRA 2WZ1A 4DEZA 2BVZA 3OXLA 1GX6A 4PXDA 4XK8C 3CC2S 1FTRA 3DU5A 4ITSA 4RUBA 1JLBA 3BO2A 2K06A 3POTA 2IA6A 1N32F 1HHQA 1U8WA 2AEJA 5I3PA 3TZYA 2Y1LB 1IBKF 1J5OA 1C4CA 1OY8A 3G82B 4OYWA 5D4OA 5IC4B 3KHRA 2V4JA 3K5NA 3IBFB 2LKZA 1RU2A 2AQ4A 2ZITA 3R2CJ 4IOBA 1X4EA 1FJEB 2IM3A 2VFSA 4HR2A 3ZXWA 5IXUA 1DQAA 3DLEB 2BJDA 4IDKB 3B54A 5B0EA 3LP1A 3PX4A 1NK0A 1KVIA 3ENAA 4K59A 3QMQA 1MMLA 1LOUA 1WORA 5C7PA 1RJJA 5AE3A 5KFNA 5FJ4A 3SSQA 4U7UD 2NS1B 2HQCA 1DARA 2ZZTA 3OSNA 5J2QB 1UZDA 3GYXB 3QLHA 5DG8A 4QWAA 1M1GA 1VQMS 4OZ0A 1WNEA 2VG5B 4QWDA 4PWDA 5DDRC 3CGIA 4ES1A 4NYOA 2V0NA 2DRDA 1TZ0A 1HBMB 3NS6A 4O3OA 4CLYA 2DNRA 5J1EB 4NLYA 3WC0A 4K4SA 1MU2A 2YWEA 2QE5A 3IAS9 1TUVA 2MZ1A 4LMZA 3GZ7A 4CLLA 2V94A 2NYIA 3GG1A 3MWBA 3O1LA 5AXKA 1JJCB 2IM2A 3TZZA 1BAZA 4Y00A 3UPFA 4CLFA 3F44A 4KT0C 3QO9A 1S9EA 2BOPA 3JSBA 4CH1A 3G5OA 1BLUA 1RBLA 1WACA 2FZCB 2HGLA 3MEGA 3PIPQ 3BO3A 1U1MA 4MT1A 1Q79A 4DFMA 2OTJS 4IG3A 5GAEU 1BQMB 3UD5A 5A2QY 2HVHA 5A6WA 2HW3A 2CPFA 3CW2C 2H54B 4X4VA 1T9XA 5IC6B 4DV5F 1TK8A 5J1PA 1RWWB 2YTCA 1OG7A 2BKOA 2VG7A 3C15B 1REVB 2XZDB 2EBEA 4OI1A 4V1Ak 4F04B 5DGAA 1FD8A 2HFUA 1NHUA 1RT5B 1RLCL 2IAJB 2OPQB 2Z56B 3ENVA 3LANA 4CZCA 3OLBA 4J9SA 5E3QA 3ZC4A 5G4DA 1F1BB 2VZ9A 2Q66A 2P6SA 1NJWA 1B3TA 4E2FB 4K2JA 5LSOA 4FF3A 3CNQP 2ALZA 3HK2A 2BRKA 3QFHA 2L9NA 4ID5A 4W90B 4GVLA 1IKXB 4DXLA 1S1UA 4USHA 1HYSB 2M5YA 3G4SS 3WHIA 1WC0A 3EX7B 3DMJB 1EQ0A 4LF9F 4C2MA 3P49B 3NNEA 1UWBB 4JV5F 1P1TA 2IA0A 5DRKA 4WCEQ 4CH0S 1U02A 3AA9A 1TMMA 4E0DA 3MCSA 3RR7A 1CVJA 1WJ9A 1HBNB 2XYGB 4DR5F 2AW0A 2BABA 2CVIA 1GMWA 2AJ4A 1R7IA 4RW9B 1S59A 3CCQS 2ZC3A 3VAKA 1X31C 1FDNA 2G2ZA 4ZCLA 5H9EJ 5JVHQ 2HLTA 3GE9A 5LSLA 2R7QA 1LK7A 2QO3A 4WWSA 4J9RA 1P27B 4H4OA 2E66A 2FHMA 2HS4A 1OMSA 3NO7A 2RKIB 1IN0A 3EGNA 4FF1A 3PKMA 3KJQB 3OHAA 3MM8A 4ECSA 4CH7A 2V4QA 4M5DA 5HQMA 2V63A 2MKHA 1DY3A 4FF2A 4HLBA 1ARQA 3MEDB 2Z2MA 2KT2A 2JVRA 3KJFB 5A8RB 2DNKA 1BQNB 2E1RA 2CADA 4AXIA 5BXIA 4KO0A 4B3OB 2DHHA 3CJ5A 4A8WA 4DSLA 3GJTB 2J0XA 2GQ2A 2V9KA 4N8NA 3AOBA 4UZBA 4KV8A 3CTRA 2GGPA 4OQJA 1EETA 5KFGA 3JYTB 4YDDB 1UETA 5HMWA 1UVLA 1YRTA 5KG4A 2FQQB 3O5TB 5E2QA 2XI2A 2MQOA 2EFNA 2CQ2A 2MZJA 2ZBCA 1T9VA 4Q5VA 3MECB 4I2PB 2KM8C 3ZZYA 4DPYA 2D3UA 1S6PA 1TELA 2EFGA 4JBCA 2JLGA 1U0HB 4ZVFA 1NKEA 2FY1A 3HVTA 5C24B 1CJTB 1FRMA 3AB2B 3BN4A 1QAYA 4ZVPB 2D9OA 4M5GA 1KBRA 3BR9A 4HTJA 3GLJA 4FXEA 4TU9A 1FDBA 2XEXA 2GHPA 1VQ8S 3CJ2A 3HFZB 4JI2F 5GAHI 1PBUA 1VMBA 1HPZB 2ZBPA 3OBIA 2V69A 4DV4J 1X0FA 2HAFA 2C2ZB 1XNRJ 1RLDA 1VDHA 2IVMA 2W8LA 5CCLA 3UE2A 2DRBA 1JNRB 4R5PA 5L46A 2OPPB 4ZVEA 3KLGA 4DV5J 1Q8BA 4K50A 1R8CA 1VQ9S 3BSNA 3BKUA 1DTTB 4WFYA 2IY5B 3ZZPA 4HKQA 2XS2A 1I3OB 1YKWA 4I6YA 2C2MB 4DV3J 3C16A 3K8VA 4PXCA 3B8HA 3OLAA 2XMUA 3PRVA 3IR7B 4MTPA 1IXKA 3D1OA 2OD4A 4Q43A 3PKYA 1L3SA 1M5VC 1NDKA 3NG8A 1K1SA 1VS3A 3OT9A 4LF5F 4CT8A 1EP4B 4OV6A 2GHWA 5LMUF 4LQ3A 5JUMA 4ZVGA 2XYPB 2YNIB 2ROGA 2ZC4A 5CZXA 3HT3A 4MIWA 2J8SA 5HANA 2J7KA 2NUUG 3LP2A 4RW4B 1IR2A 5AXLA 1VC0A 2LLZA 4EZ6A 5F8GA 1J5EF 2LEAA 2YX4A 2OFHX 4OJHA 4TQRA 1F9HA 3TVZA 1ZM9A 4D3GA 2HGMA 3I6PA 1LFPA 3D54A 3MM9A 4N8OA 1SKSA 1LFWA 2XSFA 2ZE2A 3R6GB 1X4HA 3R1LA 1N36J 3LQVA 1SH3A 3QYYA 2PFDA 2NLWA 2E1AA 4DFJA 3MMJA 3PVXA 5B0DA 2M4MA 2E44A 3K7RA 3KG1A 2XGPA 2YXLA 3GU0A 1VRUB 4M5KA 3HHDA 4O44A 2NXUA 2F7VA 2E1MC 4B9TA 2HHXA 3FFIA 2FJBB 2HNZB 3J7YU 3MMCA 3ZZRA 2J9DA 2VBZA 3FVYA 4MKVA 2B56A 4P72A 2ZD1A 3ZZZA 4DN9A 4J9MA 4J9KA 2FLLA 2EW9A 2YKPA 1UFWA 2F9JA 2RVJA 2WB1D 3HZEA 2VFUA 2HZCA 3GSIA 4EWTA 4F7VA 3TX0A 1RBAA 5A0YB 2YKMA 4GO5X 2FVSA 2B9XA 1VCTA 3PX0A 1ZM4A 1EAYC 1ROFA 3MMCB 4IH5A 3PX6A 2R7UA 5E3RA 4RNHA 3MXHP 2QZ8A 2GW8A 3KNAA 2CRLA 4FYWB 1U2FA 1RA7A 2KYXA 3D4JA 4QOTA 1N34J 4F2SA 4ILMA 3B4MA 2EFPA 4PYAA 4K4YA 2ZWOA 5L9XA 2CG8A 1XMOJ 3W3SA 1JLAB 2NR0A 2ZE2B 4DV2F 5H9EK 4MJWA 4QYZJ 3V4MA 2G4BA 5KFZA 3W61A 3SSRA 1S6OA 2XMJA 5K8PA 2DNOA 2PIIA 3Q8YA 1VQNS 4C11B 5JVGQ 1P8GA 2JLFA 3LP2B 4RW4A 2A6OA 1N4LA 3IWNC 1NKCA 1SIWA 1ARRA 4PZVA 3UI3A 1VQ6S 2MKSA 1T3NA 3ISZA 1VRTA 3FCWA 3FNNA 1MYKA 5LT5A 4J9PA 1YDLA 1Y9OA 2DH8A 1EP4A 1BDVA 3MM5B 2I8EA 3VALA 1KKHA 2BSQE 1RWOB 1QY7A 2F9DA 2K1RB 3QATA 2CNLB 4R0JA 3RUBL 1MW7A 1S1XB 3FBBA 4X4RA 3T5HA 4CYUB 5F9LA 4PUOA 3PW2A 1UEVA 3R6LB 2CPDA 2P8IA 1HIYA 3AXKA 5AT1B 2JEJA 1AZSB 1DTTA 4K4ZA 2NXCA 5D3GB 3MAAB 1ZPWX 2DH9A 4K4WA 5KFEA 1KSPA 2RHSB 3BBCA 4HV0A 1H0HB 2XZTB 1JXLA 2XMTA 4K4TA 2H4YB 3G86A 3G2XA 4YDXA 3DGPA 1TKZB 4L75A 3EXCX 3EE3A 3SFGA 3FT7A 2Q3PA 2Q43A 3R7BB 3T6BA 1OSDA 5LXYA 3KK2A 4QW8A 3JSMA 4JI1F 2XNRA 3A3OB 1S12A 2HIQA 2IDLA 2Y0BB 2YVSA 3D3CJ 4KH1B 3FDSA 5D15A 5HN0A 4YR0A 2XB2D 1X5PA 2HBYB 2G0CA 4GC6A 1W2IA 1S6PB 3UDCA 4OX8A 4WKYA 2E1PA 2L9DA 7FD1A 2IMWP 4KAIA 4JI7J 2UVWA 3VGVA 3OTBA 2AX0A 4KHRA 4DZ6A 2F5GA 4GMKA 5L1IA 1I94F 1NSPA 5E7OB 3BGLA 3W64A 4DPTA 2KXHA 1QTGA 3S1TA 1XNQJ 2DGXA 2KZZA 4ZPDA 1EETB 3J80U 3EGZA 2GGPB 3LF0A 3DLLQ 3THTA 2EFQA 3KMQA 1PJ5A 1O8BA 5A8WB 2L08A 3PYFA 3QOQA 2YWWA 4G65A 1S97A 2ZOMA 2A2DA 4BC9A 4B3OA 4KO0B 1RHUB 3A12A 1ITPA 4LVOP 3W9HA 5A8KA 2HURA 1BQNA 3KXDA 2GQQA 3FGVA 3NOGA 1MNTA 4F4AA 2HNDB 3ELHA 5KFTA 4ME7E 5HJYA 2RJZA 1ICEB 2VUGA 3G6VA 2HHHF 4D8JA 4U8YA 4CQ1A 1NH8A 4I2QA 2CPYA 4OYAA 3A8JA 2F65A 2OSQA 3DRYA 1C1BA 2KO1A 2E5HA 5HBMA 4CO4A 5C25B 3N4WA 3LP0B 2AP6A 4R0EA 4RW9A 3TAMB 3PEJA 4N56A 1NJYA 5CD4A 2N3LA 1RWPB 1FCAA 3VEBA 1GXTA 1Q53A 4OI0A 2DISA 5C5JA 4KFBA 1HNIA 3DI6A 2B9WA 4Y28C 2NPFA 4X64F 1RB0A 3DRSB 2J76E 4OHYA 1ZAVA 3DMJA 2HEKA 3ENWA 3QGPA 4V19J 1WC6A 2OLWA 1F9FA 4LSLA 1HHSA 4RR5A 4C8NA 3N9UC 3CDBA 3IFEA 4DS4A 1JQGA 2AJFE 2F3JA 4DF8A 1AXQA 1M5SA 2VPZB 3ZO7A 1RTJA 5C42A 1SB6A 5ETTA 3OTOF 4ECQA 2X1FA 1DBDA 1U7LA 1VJQA 1RT5A 4P73A 1TL7A 2IHR1 5THWA 3C15A 5KFRA 4B3TF 2YH1A 4CLPA 4USIA 2CPIA 3UCZP 1R8AA 3DDIA 4WTYA 1NDLA 2JX2A 4ZLLA 4TXSA 1WOPA 5E3PA 4IG3B 1LEOA 2BM0A 3T1HF 3SI8A 1YI2S 1U24A 2V8PA 2CJQA 4HL9A 1S9EB 1NLKL 1MYLA 5KG5A 3PW7A 4TQSA 2QL5B 3BKFA 4DV1F 4FS2A 3GFHA 2E5JA 4I0WA 4AYBD 1V5IB 3PCOB 2YX7A 1X4GA 2B7BB 2ZVSA 3JXOA 1ZETA 2JNJA 4OYXA 3BQ0A 4B3TJ 3CD6S 2Y8YA 1HBMA 1FVQA 1T95A 4ELTA 5FD1A 3KNGA 4B9SA 4BS2A 2G2OA 3MEKA 2WSFC 3RZAA 1KS2A 2XULA 1QSYA 2KDOA 2KFYA 2WBMA 4BBYA 3H4BA 1KVJA 2VG5A 1WF1A 4IR9A 3PEHA 4PWDB 2IYGA 4X4OA 3QLHB 4O0IA 1B7YB 1TQLA 3GTYX 3RBXA 3DLGB 3IMQJ 4AFFA 4KC5A 3K59A 1WOOA 4DMZA 1T94A 2FZGB 3HULA 3SYZA 3EVWA 3MCMA 4CO1A 2C2NA 4MKAA 2F40A 1PYOB 3GYGA 1S77D 3CCWA 3HSJA 1A6LA 2KT3A 4FS1A 3MM7B 3C3LA 5J2MA 1G2EA 4QZVB 1CC7A 1GXUA 2PMWA 3ETOA 3MMBA 5KG2A 4DSEA 2R9LA 2JEGA 3BPDA 3P5TL 5KFJA 4C8LA 4F02A 2VQEF 2DNNA 1WHXA 3MEEB 3Q89A 1RADB
chains in the Genus database with same CATH topology
1QTGA 2KELA 1P94A 3H87C 2BNZA 1B28A 3FMTA 2BA3A 2HZVA 3VW4A 2Y3YA 4HV0A 3VEAA 3VEBA 2FGCA 2JXIA 2BJ3A 2JXGA 2RBFA 2K1OA 3QOQA 1PARA 3PHTA 2BJ1A 2CAJA 2K29A 1BDTA 3GXQA 3FT7A 1MYLA 1ARQA 1ARRA 2WVCA 2WVEA 1BAZA 2HZAA 4FXEA 2NZCA 3BKFA 1Q5YA 1MNTA 2K9IA 1EA4A 2K6LA 2WVFA 1B01A 2CADA 1MYKA 2WVBA 4ME7E 2F1FA 2CPGA 2JXHA 2K5JA 2WVDA 1NLAA 1BDVA 2BSQE 1IRQA 1Q5VA 2BJ9A 4D8JA 2BJ8A 2BNWA 3QSIA 2AY0A 2PC6A 3BKTA 1U9PA 2BJ7A 3LGHA 1X93A 2H1OE 3BKUA 2CAXA 2GPEA 2CA9A 3OD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QTG A;  2KEL A;  1P94 A;  3H87 C;  2BNZ A;  1B28 A;  3FMT A;  2BA3 A;  2HZV A;  3VW4 A;  2Y3Y A;  4HV0 A;  3VEA A;  3VEB A;  2FGC A;  2JXI A;  2BJ3 A;  2JXG A;  2RBF A;  2K1O A;  3QOQ A;  1PAR A;  3PHT A;  2BJ1 A;  2CAJ A;  2K29 A;  1BDT A;  3GXQ A;  3FT7 A;  1MYL A;  1ARQ A;  1ARR A;  2WVC A;  2WVE A;  1BAZ A;  2HZA A;  4FXE A;  2NZC A;  3BKF A;  1Q5Y A;  1MNT A;  2K9I A;  1EA4 A;  2K6L A;  2WVF A;  1B01 A;  2CAD A;  1MYK A;  2WVB A;  4ME7 E;  2F1F A;  2CPG A;  2JXH A;  2K5J A;  2WVD A;  1NLA A;  1BDV A;  2BSQ E;  1IRQ A;  1Q5V A;  2BJ9 A;  4D8J A;  2BJ8 A;  2BNW A;  3QSI A;  2AY0 A;  2PC6 A;  3BKT A;  1U9P A;  2BJ7 A;  3LGH A;  1X93 A;  2H1O E;  3BKU A;  2CAX A;  2GPE A;  2CA9 A;  3OD2 A; 
#chains in the Genus database with same CATH topology
 3RTV A;  3M1V A;  3FSY A;  2AJQ A;  4KPY A;  1OIA A;  1X4D A;  1Z2L A;  3M8Y A;  4OLP A;  2BRL A;  4FP9 A;  2OH2 A;  2MZQ A;  3I0R B;  3B78 A;  1QVG R;  1PC5 A;  4LJM A;  2G0J A;  4CIO A;  2KZM A;  2I5J B;  1RWV B;  3KK1 A;  3WC2 A;  2AN7 A;  4O3Q A;  1LV5 A;  2R7S A;  3HO1 A;  3EIC A;  1KFS A;  2GX8 A;  1RAG B;  3W2W A;  2K6L A;  1VIO A;  3IBC B;  3MFH A;  1C1C B;  1NK4 A;  4Q45 A;  1IKV B;  1Y10 A;  2VPY B;  4B3M J;  2J7U A;  2OPS A;  4YY3 J;  3L09 A;  5IV3 A;  2PO4 A;  2ZDP A;  1HI1 A;  4PWW A;  5DG9 A;  5L1L A;  3AD8 C;  1JLQ A;  2QT7 A;  5HQ8 A;  1X60 A;  1UMJ A;  3QZ7 A;  3GIM A;  1GMU A;  5CHC B;  2DO0 A;  1HQE A;  1B70 B;  4JI7 F;  4WFA Q;  2NXE A;  4P7V A;  4Y65 A;  2JEI A;  4H4M B;  3CJ8 A;  2OAU A;  2EKN A;  4ZP8 A;  3DOK B;  2XY5 A;  2W7O A;  2MKJ A;  2GVZ B;  4ZHR B;  3CUL A;  4GKK J;  4AQY J;  4DJB A;  2FHO B;  1C0U A;  3I0S B;  3M8Q A;  5DZ7 A;  3JAM Y;  5F8I A;  2MHE A;  4LR7 A;  2XCA A;  1CJU B;  2BJ3 A;  2HAI A;  3KK3 B;  3IRX B;  1XMO F;  5ADZ A;  1TL1 A;  1Q0N A;  1SJF A;  2CPJ A;  1WC5 A;  2DR6 A;  1CBK A;  1JLC B;  4OX6 A;  3DOM B;  4EFA C;  2W24 A;  4OL8 A;  2YWG A;  3FC9 A;  3MCN A;  4BC7 A;  1SJ1 A;  2OMO A;  1RWN B;  3ILO A;  2DO4 A;  5LM7 E;  3D6M B;  3TEG A;  3H2U B;  1IJE B;  1Q16 B;  2PA3 A;  4O3R A;  2DNY A;  3H42 A;  5HRO B;  2XTJ P;  4RWX A;  3W62 A;  2W7A A;  3SSS A;  3DM2 A;  1SBR A;  1CJV A;  1PC4 A;  3IXQ A;  1L3T A;  4B08 A;  4RBU A;  1ELO A;  1TL5 A;  2GO8 A;  5CH7 B;  3TVK A;  4CLK A;  1NK5 A;  1Q95 G;  1VK3 A;  2L9W A;  2QN6 B;  4PYD A;  5CXT A;  4JI3 F;  4W98 A;  1CQM A;  3KOA A;  1NHK L;  2GO9 A;  4D3H A;  1GAO A;  3R5J B;  3KHG A;  1HR0 F;  4RW7 B;  4ENO A;  4DZD A;  3KLE A;  3H2V E;  3VGU A;  1L3K A;  3C6U B;  3HKW A;  3GP9 A;  2N7Y A;  3GCW P;  3OFE A;  4GVB B;  1N52 B;  2FJE B;  2GAG C;  1LWE A;  2J8A A;  3G6E S;  4LFC J;  2WON B;  4WU2 A;  1OPZ A;  3HJF A;  4PAA A;  3MZI A;  1S5Z A;  2OEM A;  5HVH A;  2OIH A;  1UW9 A;  4Z37 A;  1YGY A;  2K5J A;  2HVD A;  1I5O B;  1S0N A;  2BE2 B;  1WKL A;  2V6A A;  3RRK A;  4YP3 A;  4A8Q A;  3K5O A;  3DLB A;  1E6Y A;  4L74 A;  1Q7Y T;  2X7I A;  1MN7 A;  1T11 A;  2M2B A;  4A47 A;  1SL0 A;  1P6T A;  2YWF A;  2V34 A;  5AXN A;  2EVZ A;  1GXL A;  2KRB A;  1WC4 A;  3M6V A;  1B28 A;  1FRI A;  2HRT A;  3GJR B;  4PKD B;  2O1P A;  3EDR B;  4IR1 A;  3MR2 A;  2ZBR A;  1TKT B;  1HHT P;  5ETP A;  1QVF R;  3KLE B;  4RW7 A;  1FFG B;  4FKY A;  1YJW S;  4C8M A;  1TKX A;  4OYB A;  3VZH A;  3GPA A;  2FJX A;  1AYE A;  1VGY A;  1U1Q A;  2KU7 A;  1HD1 A;  1X5O A;  3ET6 A;  5CA5 A;  2XLK A;  1IM4 A;  1URR A;  4HHU A;  4WYW A;  4FYD A;  1NUE A;  3TJ9 A;  2IC3 A;  5KT6 A;  3OW2 R;  2FVP A;  3AB4 B;  4Y2K A;  1T9U A;  4HHJ A;  3IS9 B;  2CNN B;  2MKC A;  2PFF B;  2WK4 A;  3QBC A;  5KG3 A;  3A13 A;  5HRO A;  4LF6 J;  4X4N A;  3KDN A;  2EBG A;  1X93 A;  1DTQ A;  1ZYQ A;  1PCA A;  1QUV A;  4GKK F;  3SEO A;  1O5J A;  3BF4 A;  4KHP J;  4F3O A;  1EB0 A;  5EUH A;  1Y5I B;  1J5E J;  5ETK A;  4L6V 3;  3IRX A;  2W2P P;  4UTG A;  3Q24 A;  1CJU A;  1F3F A;  4HT7 A;  4XTT A;  1ZZF A;  5DGB A;  1F2H A;  4LSZ B;  1OPI A;  5RUB A;  4ED3 A;  4EMD A;  1MWY A;  4DWI A;  4AL6 A;  4EO8 A;  3SIP B;  2MKK A;  2ASJ A;  1U48 A;  1I94 J;  3MR3 A;  1FKP A;  4H4M A;  2NZ4 A;  2FB0 A;  3DDK A;  5DS7 A;  2P9G A;  3R97 A;  1VQP S;  4ELV A;  1HQE B;  4NML A;  4OV1 A;  3KUE A;  3ZZ0 A;  2E7V A;  5DLF A;  1JXE A;  2F4V J;  2DGO A;  2GVD A;  1DUR A;  2MQQ A;  4KGV B;  1RYR A;  3IG1 A;  3DLJ A;  2PI5 A;  3OXF A;  4OZ5 A;  2JDJ A;  3TJA A;  1LNQ A;  1VC5 A;  1TV6 A;  1U6Z A;  2OPS B;  3ZTO A;  4JI1 J;  3LAL A;  1IKV A;  1N6Q B;  2HK3 A;  4NPO A;  1RHQ B;  3MUV P;  1WC1 A;  2Z57 B;  3PR4 A;  3HLU A;  2QA2 A;  3MR7 A;  1Q81 T;  1VQ5 S;  1M5K C;  4Y3C A;  2CAX A;  2VV5 A;  1B99 A;  3Q8P B;  3OV7 A;  1YZ7 A;  2W8K A;  2ZH3 A;  1AUS L;  2MKY A;  4F0M A;  2UVU A;  4N41 A;  1U0S A;  4IFV B;  4IKA A;  1VBX A;  4JI2 J;  2H65 B;  1MRO A;  1VYA A;  5JXS A;  4DBQ A;  3HSD A;  1GTH A;  3BGO P;  3EZ5 A;  4Z7C A;  3B6B A;  1FD2 A;  4YB1 P;  2MQN A;  4WPA A;  3HZG A;  3B4D A;  5BJR A;  1KLM B;  2AX1 A;  4U6P A;  2NPI A;  2HZA A;  1T05 A;  4NXN F;  3OL9 A;  1RTH A;  2H3E B;  3BGU A;  2PMZ D;  2JL9 A;  1VQO S;  3QFW A;  3W60 A;  1WKK A;  2B8P A;  1F0X A;  2R3V A;  1SKU B;  4IG0 A;  1IWG A;  2CPG A;  3CDE A;  4OI2 A;  2F4F A;  1NLA A;  2LDY A;  3KJN B;  3P3D A;  2MLX A;  3ULH A;  5KT4 A;  3CCR S;  4DQI A;  1SC1 B;  2RE1 A;  1NPR A;  2IMO A;  3GCX P;  1XEZ A;  3R3T A;  2HHS A;  3HP6 A;  1S1V B;  3HHE A;  4EZ9 A;  3CJ3 A;  4RU2 A;  2EXU A;  3NLC A;  5KFP A;  4DUY F;  1LW2 A;  4F4Z A;  2OO4 A;  3ONQ A;  1D3W A;  1RGV A;  2J5A A;  3IWX A;  1TKD A;  2BJ1 A;  2DY1 A;  4NA2 A;  5F3Z A;  1K44 A;  2IJF A;  1H7X A;  1NK7 A;  2VC0 A;  3MUR P;  2QMU B;  4EGL A;  2ADB A;  4TVA B;  3AJ1 A;  3NMA A;  4Q0B A;  1WSV A;  3IAM 9;  1KN6 A;  1VRQ C;  3CSK A;  3T1Y J;  3FZB A;  4QIW D;  4NLX A;  4DR6 F;  1E6V B;  2M0G B;  4X4P A;  4X2B A;  5LXR A;  3GV5 B;  1SC4 B;  4RNN A;  5E3C A;  3M8W A;  1EKR A;  2AEF A;  3RB6 A;  5J1N A;  2AF6 A;  4DG1 B;  1A0O B;  1EZZ B;  4U95 A;  2O3D A;  3NS5 A;  4ZVO B;  4OJ1 A;  1YRX A;  4OZJ A;  4C3L A;  3G6X A;  3QJJ A;  1RAC B;  1YLX A;  2OPR A;  1XBW A;  4CM2 A;  2IIH A;  1T9Y A;  4NI2 A;  2FC8 A;  5IFM A;  1IKW A;  2FJA B;  2HSE B;  2PA8 D;  3A3N B;  4KHP F;  3PFE A;  1Z1Z A;  2KG0 A;  1N5T A;  2A18 A;  4O0N A;  2VKZ G;  3JQK A;  4EO6 A;  4HI1 A;  3BR8 A;  4B9N A;  2DKO B;  3KFW X;  3QAU A;  1ZAW A;  3NGD A;  3QGH A;  2OI2 A;  4DCP B;  4Q7A A;  3KYL A;  4I68 A;  2HPU A;  4QPT A;  2HNY A;  2PEB A;  3AAW B;  2ACY A;  4PXB A;  3GR0 A;  5CD4 H;  2LYV A;  2VA3 A;  3RBD A;  4IRD A;  5F8L A;  5DDP C;  5HLF A;  5EN1 A;  2KJV A;  3CPW R;  3QGG A;  3DNC A;  2KEL A;  4IFY B;  3GFZ A;  1NO8 A;  3H98 A;  4DX8 H;  2QA4 S;  1D9D A;  3TUI C;  3DRS A;  5A76 A;  3MPU B;  3QPI A;  1EIY B;  1HNI B;  4L73 A;  2BE9 B;  3Q8S B;  1YRU A;  2VA2 A;  2FYX A;  3FMW A;  3RW7 A;  1D1U A;  3IBW A;  4B3R F;  5IOL A;  3LP0 A;  4ID8 A;  3TAM A;  4C98 A;  3V6J A;  3BSC A;  1N5S A;  5DM7 Q;  3K8W A;  4F2R A;  2GIR A;  3HFV A;  1AW0 A;  1WEL A;  1HWJ A;  3H4D A;  1HWL A;  5ETQ A;  3R7N B;  1FDD A;  2E5L J;  4ZPW R;  3ISN C;  1GMW D;  3IM8 A;  4RKU C;  2R2R A;  4CLW A;  4J9N A;  1CEZ A;  1FER A;  1QE1 B;  1FJC A;  1Y00 A;  4M5L A;  2CFX A;  3W9J A;  3OL7 A;  3OTO J;  1N0U A;  4X66 J;  2DBB A;  3QT7 A;  5CAB A;  5KAK A;  2OPR B;  4KPC A;  1OWX A;  4ZVQ B;  4MK8 A;  4UUX A;  4X4Q A;  3LGM A;  1K73 T;  4ES3 A;  3F0N A;  2RH3 A;  5KTQ A;  4A48 A;  2DTJ A;  2QA1 A;  4DG1 A;  2HZV A;  1S4E A;  2GA7 A;  3AT1 B;  2P5V A;  3KLF B;  3BGF A;  4WBF A;  5A8W A;  4B02 A;  1C2P A;  2HHU A;  1NM2 A;  1B7F A;  1RAF B;  2I6W A;  2W2Q P;  3L7U A;  3G87 A;  2PGC A;  2HG4 A;  5L1K A;  1D9A A;  1R6V A;  5KG6 A;  3JAM U;  1N54 B;  4X4U A;  1NDC A;  1SC3 B;  5KFY A;  1FDA A;  2A1B A;  3Q86 A;  3EMT A;  1FE0 A;  2K2P A;  2RDI A;  2ZOG A;  3DXB A;  1FK9 B;  1RZM A;  4R8U B;  4YR2 A;  1IBK J;  3HHL C;  2RNE A;  5GAG I;  1D0E A;  1NKB A;  4DU7 A;  3CDU A;  4OHX A;  2CNK B;  4NLW A;  2XO7 A;  3DRX A;  2XSJ A;  4W92 B;  5EX0 A;  3PIO Q;  3EZU A;  2KRR A;  3ILJ A;  1LW2 B;  3JSR A;  4ZCK A;  2V8D A;  3WQP A;  1AT1 B;  3FMT A;  1X9W A;  2B7C B;  3HHK A;  5ETS A;  4UZC A;  1T02 A;  3MPW A;  3AOD A;  2X1B A;  3DGP B;  4PWU A;  2E29 A;  3J7A 1;  1Q8I A;  2BAC A;  2ZHO A;  3W7B A;  2FHJ D;  3LOU A;  4JOU A;  4TKT A;  5HVG A;  3IM9 A;  1AUD A;  4GKJ J;  4QIE A;  1S0M A;  4F4K A;  1F2G A;  4IG0 B;  4ATN A;  5T7L B;  3RJM B;  1YTY A;  4OZ2 A;  2ZH4 A;  4JI4 F;  1RTH B;  3RW6 A;  2NZC A;  4P2M A;  3NRB A;  4RW8 B;  1TL4 A;  4PR6 A;  5KG0 A;  3VV2 B;  4CYU A;  4Z2X A;  1RCX B;  2XGQ A;  2QA4 G;  1X9M A;  2E5L F;  1H3D A;  3LAM A;  4JI4 J;  3N28 A;  4U96 A;  3MM5 A;  1RT4 B;  2WW8 A;  2CYY A;  2DEJ A;  2Z2L A;  2A0F B;  4IFV A;  2R7R A;  1VRT B;  4NOH A;  1U25 A;  1SIW B;  3UR3 C;  1YBT A;  2AT1 B;  2B4U A;  2FUG 9;  2ZBQ A;  1B0T A;  1N5Q A;  2NXN A;  2ZJP Q;  2YKQ A;  1N6Q A;  4WZQ A;  1J2V A;  2HRU A;  3M2U B;  1D09 B;  4NLS A;  2ZFH A;  5DDQ C;  1L3V A;  1IBL J;  3S8S A;  4F3Q A;  4Z7Y A;  5GAD I;  2VON A;  3I5B A;  4LBP A;  3HPO A;  2GVD B;  3G9C A;  4OYZ A;  4IQX A;  2CVE A;  4I4B A;  3CDW A;  4DPO A;  3Q22 A;  3PYD A;  3QAE A;  1HWU A;  3W2V A;  3RAX A;  2MHN A;  4DR1 F;  1FKP B;  1KOO A;  3FBE A;  3K89 A;  3M2V B;  2ROE A;  3A1Y G;  1U09 A;  4J9V A;  3GIK A;  1XMQ J;  2Y9H A;  3TI0 A;  2VQF F;  1FXL A;  1UAW A;  1SV5 B;  1GMV A;  1WWH A;  2LU1 A;  1XTZ A;  3H5S A;  1KQF B;  3WIU A;  4LBI A;  4ZCI A;  3L4B C;  5A0Y A;  1H2V Z;  4G1Q A;  4C97 A;  2K3I A;  2VDI A;  5DQI A;  3HSZ A;  5DQH A;  4DL5 A;  1ZH5 A;  3DRP A;  4PQU A;  1DTQ B;  3THV A;  4KKO A;  1S72 S;  2FJW A;  1MSW D;  2AGQ A;  2RUG A;  3FFI B;  3IC1 A;  3TAP A;  1O51 A;  1VQK S;  3CO0 P;  3R7S B;  1DJ0 A;  2RQM A;  4O44 B;  4FPR A;  3SBM A;  5KOX A;  2L41 A;  2DNZ A;  3IS9 A;  3T3F A;  1B4S A;  1PJ7 A;  2LDI A;  3FSI A;  1T9W A;  5DZ6 A;  2VU5 A;  3LWM A;  1SCJ B;  1LXN A;  4MIA A;  2LVW A;  1S9F A;  2V4R A;  3CC4 S;  2AYG A;  3TRG A;  2CKW A;  3LWL A;  3ET6 B;  1TU0 B;  4FXW A;  1VLO A;  3ITH A;  4ER8 A;  4RNO A;  3VAG A;  5DJB A;  4YN3 B;  5GME A;  3J7Z 5;  4ZVU B;  4ZPC A;  1S49 A;  2Q79 A;  5L9N A;  2B3T B;  1HNZ J;  3QJL A;  3PYE A;  3TR5 A;  4E98 A;  3QJP A;  1TKT A;  4P71 A;  2R8I A;  3PW5 A;  4FXD A;  1IWA A;  2FLP A;  2GNK A;  4WJB A;  4QJV A;  1WOS A;  4DFK A;  4O4G A;  5BR8 J;  2CQH A;  1V6H A;  1RWK B;  1YJR A;  2JC0 A;  2K3K A;  3LAK A;  4PG6 A;  1RKJ A;  1U47 A;  1H74 A;  1FRL A;  2FJV A;  1E6Y B;  3OXG A;  4PG7 A;  4NRT A;  4MFB B;  2I0X A;  4DR5 J;  2DY9 A;  4NLR A;  1X4F A;  2GJI A;  3GG0 A;  2L3M A;  1LWF B;  4LR9 A;  2PI4 A;  3JB9 k;  2LXI A;  2XS5 A;  4LFA J;  2VB6 A;  1KQS R;  3A8K A;  3VQS A;  1LWE B;  5KG1 A;  3TZW A;  4ECZ A;  5B0C A;  3CC7 S;  3QGI A;  2OPP A;  1X7V A;  4OI4 A;  4QYR A;  4USJ C;  4YHH J;  4IOC Q;  2K7J A;  3VAM A;  2GZO A;  3C6U A;  2JJ4 D;  4F4W A;  1X0P A;  2ASD A;  4CWB A;  2LMI A;  5DM6 Q;  4AQY F;  2ZH7 A;  3BZQ A;  3FEX B;  5KOW A;  1B64 A;  2FJD B;  2O5D A;  8AT1 B;  1Z4U A;  3AXM A;  3M9M B;  3SV3 A;  1XC9 A;  3FCH A;  4FF4 A;  2CQP A;  3HMJ G;  3PW4 A;  2Z0G A;  3PYG A;  2O67 A;  2GJ2 A;  2M52 A;  4LF8 J;  3OQ2 A;  1CJT A;  3ZFV A;  3CED A;  3HDS A;  4WZM A;  1S1T A;  1U0H A;  5IQ6 A;  3N5B A;  3RRH A;  4KHM A;  4MJK A;  1WF0 A;  5HK4 A;  3DM2 B;  2KI2 A;  2E5I A;  3MEC A;  4DPW A;  1JJ2 R;  5E0O A;  1GH8 A;  4M63 A;  2QIF A;  3MTJ A;  4ZIW A;  5I42 B;  3I87 A;  2YPY A;  4GKJ F;  4L3N A;  4JI3 J;  2QLB B;  3R5C A;  4F0H A;  2VQF J;  1VQ7 S;  5D8H B;  5KFA A;  1ZZN A;  3X3U A;  1WTB A;  2E9Z A;  3G8Q A;  1YJU A;  1RKI A;  3L3C A;  3JS9 A;  3M8P B;  4LIW A;  4LF2 A;  4ECT A;  3MR5 A;  3KK3 A;  3RAQ A;  2DNH A;  2V9W A;  3M8Q B;  4A8S A;  3T6J A;  4LF1 A;  4AD6 A;  4ED6 A;  1YHQ S;  3DKD A;  2DNG A;  3HSG A;  4DLG A;  2HMI B;  5F0U A;  3CCJ S;  2D9P A;  1GEH A;  2VFV A;  2PDA A;  3MED A;  4ZK7 M;  3SQO P;  4YUD A;  3MM6 A;  1ZTT A;  4N77 A;  4HHH A;  4M5D B;  2VFT A;  4X62 F;  1NSK L;  4I1T A;  3QT8 A;  1JLQ B;  4DDF A;  3WX4 A;  2DPI A;  1B0P A;  1RT1 A;  4H4O B;  3UWT A;  5MAO A;  2XLJ A;  4FYX B;  2QL9 B;  2Z4P A;  3HHL B;  3HKZ D;  5B0G A;  1NB2 A;  4KY3 A;  3UCU P;  3UDV A;  2DR7 A;  4RNM A;  4QU7 A;  2R2S A;  3W2W B;  3EDQ B;  5DO2 A;  4ECR A;  3Q83 A;  1H2U X;  3D0H E;  4EYI B;  2ABY A;  2H48 B;  2R8K A;  2QX0 A;  1Q78 A;  1R6Y A;  4NL5 A;  2FVC A;  3NAI A;  3KK1 B;  3Q23 A;  5D78 A;  2COL A;  1UWB A;  4WYL A;  3UD3 P;  4USM A;  1PAE X;  3QT5 A;  4GO7 X;  4YR3 A;  2XMA A;  4B3M F;  2H1O E;  3HX9 A;  5H1S V;  1PGZ A;  3AOA A;  5IT9 Y;  1YJT A;  2E7X A;  3HT0 A;  2B6A A;  2CA9 A;  1AB8 A;  2NYH A;  1SJQ A;  2RSQ A;  1UVK A;  3HI9 A;  3MOJ B;  4DCJ B;  3MEE A;  3ZTP A;  4U9R A;  2RIJ A;  1WEY A;  1XMB A;  5D4P A;  3OJU A;  4K8R A;  2DGT A;  1N8R T;  3PW0 A;  2AGO A;  3BV8 A;  1JNZ B;  2G9O A;  3CJR A;  3MMB B;  4RBT A;  2CAJ A;  1KFD A;  3MM7 A;  3OFF A;  5J2M B;  3KUH A;  4ZJO A;  3EYZ A;  5M2U A;  3CCM S;  3V6D B;  2C22 A;  5EWE A;  3TJ8 A;  2F8E X;  3BBF A;  1D9F A;  1Q1K A;  2V68 A;  4XDC A;  4IUF A;  4HAC B;  3T1H J;  2ZH6 A;  1U6B A;  1WG1 A;  1R0C B;  3DLG A;  5GVQ A;  4FVM A;  5L38 A;  4URQ U;  2BJ8 A;  1X4B A;  3UNY A;  2JSX A;  5FDL A;  1V3S A;  2JH3 A;  5E41 A;  4LF8 F;  3QO9 B;  1L5U A;  4BCA A;  4AUK A;  3NY0 A;  5B09 A;  1RXO B;  4LRE A;  4NZ6 A;  1P94 A;  2BNZ A;  1MMD A;  5CYQ A;  1IQT A;  1JWW A;  1MU2 B;  2HBZ B;  2ATC B;  1HI0 P;  4I56 A;  2XC9 A;  3TUP A;  4J90 A;  2B5J B;  5IS2 A;  1Y7P A;  2GS8 A;  4PPD A;  1BXN A;  3GV8 B;  1LWX A;  3W5X A;  3K58 A;  2UVV A;  1TFW A;  3H59 A;  2I1R A;  1KR4 A;  4RZR A;  2L48 A;  4BHQ A;  4TU8 A;  3SFU A;  2UV8 G;  4DSK A;  1TK0 A;  1U1P A;  1Q82 T;  5KFL A;  2C3P A;  2AIR B;  1YJ7 A;  1RU1 A;  2HQI A;  2RDD A;  2RDJ A;  1R8B A;  1F9E B;  2CXE A;  3P45 B;  5J2Q A;  1N0V C;  3E01 B;  1JIH A;  5U47 A;  3J80 Y;  5GAE I;  2VC1 A;  2V2Z A;  3FKB A;  2Q6B A;  4HAC A;  2M7S A;  4NEZ A;  2XYH B;  1SQE A;  1ZS6 A;  2AJ0 A;  2CQ0 A;  3OSP A;  4LF5 J;  3KJV B;  1FJ7 A;  5B7W A;  4PAB A;  3GWC A;  4O23 A;  2C3Y A;  3CDA A;  3O2I A;  1A7G E;  1TL7 B;  5ITH A;  3CF5 Q;  1SL2 A;  2A6M A;  4FXV A;  4YB7 A;  2HHH J;  4LT6 A;  4QR0 A;  3MTK A;  1JK9 B;  4MK9 A;  1VLY A;  2BUN A;  2K1O A;  2H5J B;  4N7T A;  3D66 A;  2YPZ A;  2CG4 A;  2YKN B;  3PJX A;  4KB7 A;  4UQG A;  2QFJ A;  3VGS A;  5CAA A;  5BYS A;  2B6A B;  1N56 A;  4JI8 J;  4CO0 A;  1DQ8 A;  1WG4 A;  1NAQ A;  3OFG A;  3D9B A;  2BBE A;  3DI6 B;  5M2R A;  4KFB B;  4W4M A;  5A2Q U;  3I55 S;  2KXF A;  3TEH B;  3D5M A;  1N48 A;  3K57 A;  2FDN A;  3FZ2 A;  4NWB A;  2BYC A;  2NSC A;  5LMU J;  2J7W A;  4DR7 J;  1R43 A;  1K0V A;  1PG5 B;  2AYB A;  1VI7 A;  1VIS A;  3FJ2 A;  4RW6 A;  3OTD A;  2YNF A;  4YEA A;  5F9N A;  4KJI A;  1C1B B;  3JTN A;  5B0A A;  3ILL A;  5HBM B;  2DB1 A;  2DGQ A;  2FD2 A;  2RU9 A;  4EUV A;  2KG1 A;  1F6T A;  3QZ8 A;  3DRR A;  3FBF A;  1RT1 B;  4DV3 F;  3V81 B;  4I6A A;  2C2K B;  1XMQ F;  1S0O A;  3MI7 X;  4WK3 A;  1Y5L B;  4C8Y A;  2ZWP A;  3MUT P;  3NOC A;  3HHL D;  3C6T B;  3A4T A;  3JQJ A;  1DLO A;  3MM6 B;  2FZK B;  3BO4 A;  3RB3 A;  2C28 A;  2EFO A;  1G3O A;  1YIT S;  1FRJ A;  1RTD B;  2HRY A;  2X51 A;  2HMI A;  2KHD A;  2PN6 A;  2ZUA A;  4UOH A;  3D6F B;  1XK8 A;  2RS2 A;  4JUZ A;  1SH0 A;  4RX6 A;  4M5N A;  4IOA Q;  3GON A;  3M8P A;  4G1I A;  3F73 A;  3R1H A;  2UXD F;  3E8O A;  2ZEJ A;  4MK7 A;  4DX6 A;  3G71 S;  2ILY A;  2OJ3 A;  1RT7 A;  5G0R A;  2BR0 A;  4C8Z A;  5I42 A;  1RAH B;  3PRD A;  1HWK A;  2MPU A;  3D0G E;  4NA3 A;  1SJR A;  5HI7 A;  4CLU A;  1HWI A;  5L39 A;  2F4V F;  2FGC A;  2EC0 A;  1KTV A;  3RRG A;  1F5A A;  2ROP A;  1CQN A;  1IM6 A;  3MAH A;  1S7H A;  1S1T B;  3DLK A;  1WHY A;  1HD0 A;  2XM3 A;  3K0J A;  2J0W A;  5MLC V;  2MGZ A;  1S6U A;  4NCG A;  3JSM B;  1S9G B;  3NS7 B;  3EVO A;  4IYQ A;  3VTI A;  1DFD A;  4RUH A;  2VBX A;  4KSE B;  4DLE A;  1LW0 A;  2DNP A;  4NRU A;  2H4W B;  4FZV A;  1TKZ A;  4CRJ A;  2LU2 A;  4DL4 A;  1VQ4 S;  2UVR A;  1IKY B;  1X4A A;  4P2X A;  5LSR A;  4JV0 A;  4NXN J;  3W8P A;  3C2P A;  3V2U C;  5KFS A;  2KFZ A;  4RWW A;  4N47 A;  4I6W A;  3OHB A;  4LF6 F;  3MAA A;  2BKP A;  4FPI A;  2OUG A;  2RML A;  5D3G A;  2AU0 A;  1RAE B;  2K7K A;  1TUW A;  1MN9 A;  3CB4 A;  1YZ6 A;  3H40 A;  2DPJ A;  4UST A;  3DHX A;  1OSC A;  1WKJ A;  1Y3K A;  1LWF A;  5KFF A;  3EPG A;  4ZVT B;  1VJW A;  3HF5 A;  2K1R A;  5CYM A;  4WTO B;  4J9U E;  4RO0 A;  2WHO A;  4JI6 J;  1Q4R A;  4L72 B;  1TFY A;  1UEK A;  4MFB A;  1U8S A;  3NCQ A;  4PXE A;  4AE5 A;  5I3U A;  3VAI A;  4GC7 A;  1Y11 A;  2DT9 A;  4M8L A;  1WHV A;  1YBA A;  2G1D A;  4LRA A;  4OIX A;  4IRC A;  2M8D B;  3HJV A;  1TAQ A;  2J6T A;  3F56 A;  1HW8 A;  3TA1 A;  3Q2T C;  1CS4 A;  2YX1 A;  1NSQ A;  2V2V A;  3D0I E;  4C11 A;  4J9Q A;  5HP1 A;  1WF2 A;  3W9I A;  2CNO B;  2CZ9 A;  3IWL A;  2LQ5 A;  4DL7 A;  1K47 A;  2KTQ A;  3D68 A;  3T1A A;  2HQD A;  3ITH B;  1MWZ A;  2C2E A;  1JLA A;  1YQH A;  3PDN A;  2QYG A;  4ZS6 A;  2DVI A;  3PY8 A;  4Y6I A;  1SQG A;  2DHA A;  5E5N A;  2IDE A;  4CO3 A;  1G1X A;  2MZR A;  1HQ2 A;  1N33 J;  4QYZ K;  2CZ4 A;  3HD2 A;  4DL6 A;  3ZNU A;  1U1K A;  3BRE A;  1NB7 A;  5CYJ A;  4DI6 A;  4WII A;  1S76 D;  3E51 A;  4A8O A;  4QWE A;  4N76 A;  1QM9 A;  4WFZ A;  4NLT A;  4X65 F;  2U1A A;  3KLH A;  3TA0 A;  4M5M A;  4YQW A;  1ZA2 B;  4X65 J;  5KFO A;  1UVJ A;  3MR6 A;  1K0T A;  4B3R J;  4G1Q B;  3LUY A;  1JLG A;  1OY9 A;  1KP6 A;  2BJE A;  2LA4 A;  2QL7 B;  2GHV C;  3LTO A;  4C0H A;  4CT9 A;  1V3R A;  1FF2 A;  5I4M A;  1BHN A;  2D7S A;  2LEP A;  2QTW A;  2JXH A;  1NJI T;  2EC2 A;  3FEZ A;  3R9L A;  1CUL A;  3DN9 A;  3QSI A;  1UL3 A;  1VRU A;  2Z30 B;  3CCT A;  3R5G A;  4ZA1 A;  3UO0 A;  2M70 A;  3VHQ A;  2KH9 A;  4RBV A;  3OL8 A;  3NNH A;  1C0T B;  3LGN A;  1UJ6 A;  3N6M A;  3PO4 A;  1PYT A;  3K17 A;  2SXL A;  3EUN A;  3UD4 P;  4B9U A;  1FRH A;  3NWG A;  4WKR A;  3NCP A;  7AT1 B;  4CTA A;  5FLX Y;  1XWL A;  3UCG A;  4DHV A;  1YX2 A;  4LIR A;  3VCD A;  4WXO A;  1R8P A;  1RWU A;  3D1H A;  1VHF A;  5F0W A;  4E8U A;  4A8Y A;  1WUU A;  1XJW B;  3M4X A;  2HS0 A;  2WSE C;  2CQC A;  4RL1 A;  3DLH A;  1D8Z A;  2JHE A;  4CP5 A;  1KEK A;  3CWJ A;  1DHM A;  1VBZ A;  3KKF A;  3PTW A;  1NJX A;  1N36 F;  3KG4 A;  1VOM A;  1XN9 A;  2YNI A;  2M8H A;  4OI3 A;  1R89 A;  4OMF G;  2MQP A;  1EQM A;  2RRA A;  2Y1J A;  2WCX A;  1RT4 A;  1KHV A;  1OS5 A;  4NE9 C;  3H5X A;  1UJ5 A;  2HHP A;  2ZH9 A;  3BPS P;  2ZHB A;  2CPZ A;  2MY8 A;  3U02 A;  4HVZ A;  4CI0 B;  5EX3 A;  4YFU A;  3A3P B;  3OUY A;  1Y4Z B;  1SUQ B;  3CIM A;  4J9L A;  1RTI B;  3BN7 A;  2FIU A;  1HW9 A;  4RW8 A;  5K20 B;  1RT2 A;  1Q86 T;  3DDN A;  4WFN Q;  2BE7 D;  2AWZ A;  1FKO A;  3CJ0 A;  3G96 A;  1FWP A;  2CJK A;  4ZIV A;  1H38 A;  3DYA A;  2KL8 A;  1WSR A;  2Y0S D;  3KLG B;  4WFB Q;  5KFU A;  2HWI A;  1BD6 A;  3SQG A;  3M30 B;  4ED5 A;  2U2F A;  4ED4 A;  1XR5 A;  2EI5 A;  1UCN A;  2VPW B;  2E7W A;  4GRS A;  4QIV A;  1UPM B;  2BM1 A;  1TTH B;  2DD8 S;  2OEL A;  2XLI A;  4LF7 F;  3I4H X;  3ZTQ A;  2VOO A;  2PT0 A;  2DNL A;  1X5S A;  5B0F A;  2YNG B;  4K4U A;  4DR4 J;  2F8M A;  4DUY J;  2J9E A;  2Q1L A;  2B43 A;  3I31 A;  2YNH A;  3QT6 A;  3GV7 B;  1F5C A;  3BJY A;  2ZNY A;  5D4L A;  1HNV A;  4I2P A;  4DV4 F;  4NYZ A;  1BUX A;  4IO9 Q;  1HNX F;  2RRB A;  2CQ1 A;  4QBU A;  4NCB A;  4DPX A;  1GX5 A;  2N4D A;  4C4W A;  3H0P A;  2KOE A;  3V5R A;  3VGT A;  3MMA A;  5CZV A;  2KT5 A;  4ALZ A;  4ZPA A;  5KFW A;  3WIV A;  2YQ0 A;  4Q44 A;  3JYT A;  4DR2 F;  2Y3Y A;  1LQ9 A;  4KV8 B;  3OR1 B;  2C2R A;  4KBI A;  4ZJL A;  1RWM B;  2JC1 A;  1SKW A;  4DN0 A;  5ETR A;  2VL1 A;  3KLF A;  2MYF A;  1Y3J A;  3NBP A;  2ZM6 F;  4P52 A;  5A8R A;  3T9N A;  3UVJ B;  2RQC A;  4XPE A;  1AFI A;  5B08 A;  2DGU A;  2WVF A;  4PRF A;  3M8Z A;  1RUS A;  2RHQ B;  2FY8 A;  3CJT A;  1QE1 A;  4OYO A;  4UOC A;  4DFP A;  2DNQ A;  2F8H A;  2RKI A;  1ZA1 B;  2IFX A;  3GB0 A;  1TVR B;  3D3B J;  3TNV A;  4AT1 B;  5EWG A;  2IVY A;  2UU9 J;  1HI8 A;  1RP5 A;  5AJ3 F;  1NK9 A;  3MMA B;  2FHJ A;  4Y2C A;  1UZH A;  4DV0 F;  1SL1 A;  4NXM J;  1WDT A;  1HNW F;  2HHT A;  4HTI A;  1MMN A;  2BMB A;  2P6T A;  1GTE A;  3LH2 S;  5CQG A;  1KLN A;  1QTM A;  1QDU B;  3PNI A;  2JLE A;  3HCX A;  4LRC A;  5KFD A;  4DV1 J;  5H9F K;  3PXG a;  3ZTS A;  2UP1 A;  2YNH B;  2FVR A;  1FWL A;  1LKZ A;  1NH7 A;  2EKY A;  3CE8 A;  2XI3 A;  2D1C A;  4IFY A;  3TWZ A;  3C66 A;  2R42 A;  3MD1 A;  5KG7 A;  2YKO A;  2VIH A;  2N4C A;  1S1U B;  3FQL A;  1I51 B;  1IKX A;  1VFJ A;  3I82 A;  2UUA F;  1SI9 A;  2W4P A;  4N5S A;  3T5L A;  3I4P A;  1PKU A;  4FBU A;  1QSS A;  4CLT A;  1UJ4 A;  3GJQ B;  4ILR A;  4ERD A;  4DL3 A;  2HNY B;  5HAO A;  4ZVH A;  4ZLP A;  2W4C A;  3VQT A;  2HIY A;  3DYA B;  3W1Y C;  4M94 A;  1HFE L;  3TUZ C;  1FKO B;  2HVZ A;  4DV7 J;  2UXB J;  3OD2 A;  1OYD A;  1RT6 A;  3CCE S;  3T19 A;  2WTF A;  4K4X A;  2C2D A;  2HQ3 A;  1VBY A;  3L9Z A;  4KH0 B;  1SUQ A;  2FTR A;  2CPH A;  3L7P A;  4TY9 A;  4O3N A;  3OUY B;  1BQM A;  2VAS A;  5IQQ A;  3GII A;  3EM1 A;  1V5V A;  3KG0 A;  4NEY A;  2MLY A;  4NI2 B;  2ZJQ Q;  4G3I A;  3OVB A;  3N79 A;  3R27 A;  4UF4 A;  4JP8 A;  2ZNZ A;  6AT1 B;  3JTO A;  4Y0F A;  2W4D A;  5D77 A;  4DL0 C;  1E6V A;  5ETM A;  5D0R A;  2HVE A;  4OZ3 A;  4P9S A;  4CO2 A;  1FNM A;  2G2Y A;  3FRY A;  3IGN A;  5J1E A;  5LMN F;  3US5 A;  1L3U A;  1SIZ A;  1V3Z A;  1FEE A;  5GAD U;  3QWP A;  3C8Y A;  2DXD A;  4EEY A;  1NCL A;  4QW9 A;  3QRP A;  1NXI A;  2YQ3 A;  3PAC A;  1YG0 A;  2CIM A;  3M9O B;  4RUA A;  4KQZ A;  3I5A A;  4MAK A;  3HHN B;  3THP A;  2HWH A;  3FCV A;  2BOA A;  2W01 A;  3S01 A;  4ZP6 A;  1NRK A;  1T03 A;  4LF4 F;  4LFC F;  4AL7 A;  1SXL A;  4TLR A;  4KRW A;  3WZ0 A;  1S10 A;  3LP1 B;  4WXW A;  4K5S A;  1SQF A;  2H3A A;  3D7S B;  4IDK A;  2K9I A;  3DLE A;  4J9O A;  2HVI A;  2MTL A;  4H4K A;  3CJK B;  1RHR B;  4ZN1 A;  2V4J B;  4P10 A;  5KFK A;  2J6U A;  4QPX A;  4F4Y A;  4I69 A;  1S7I A;  5HAT A;  1KNZ A;  2DGS A;  1J5O B;  2XWY A;  3K2Y A;  1FJG J;  1NEE A;  2ZOF A;  3AJ2 A;  3O8W A;  3U1L A;  1FFS B;  1WDD A;  4DX5 A;  1X9S A;  1T05 B;  3POT B;  1ZM3 A;  1FX4 A;  2DIV A;  1KLM A;  2AKW B;  2DXF A;  1K8A T;  1R27 B;  2BEF A;  2RB7 A;  4M5H A;  4DQQ A;  3RBE A;  2YY3 A;  3J7Z T;  1OQ3 A;  5K14 B;  1HQU A;  2V5H G;  4O3P A;  1N88 A;  4QWB A;  2WOM B;  2Y1R I;  3QQC D;  1RTZ A;  2GMJ A;  4PG5 A;  4IH7 A;  4NCA A;  1N32 J;  2G1H A;  4BDP A;  2PEH A;  3H2L A;  2Z58 B;  3KTQ A;  3C14 B;  1S48 A;  9ATC B;  2JVO A;  4YB5 A;  4ETZ A;  1W2B R;  3KWM A;  2HFO A;  3IO1 A;  1UA0 A;  1NDP A;  1CSJ A;  1TV6 B;  3O3L A;  2HK2 A;  1R0A B;  1KRP A;  4K0K J;  2MEW A;  1IRQ A;  2CDQ A;  4ZN3 A;  2OGU A;  2B4V A;  2ILZ A;  3Q8V A;  3PZP A;  2XY7 A;  3TQ1 A;  1W7W A;  4UOG A;  1IJF B;  1WEX A;  3GFY A;  4FDF A;  4ZLJ A;  1DAX A;  2Q6C A;  2GPE A;  1UWA A;  4O3S A;  5IT9 U;  4ECV A;  3RBZ A;  1W25 A;  4Q8F A;  2HHW A;  4C3M A;  4TLQ A;  2UUW A;  4P2F A;  1F60 B;  3GMG A;  1XQI A;  1LWC A;  5C2G A;  3TX8 A;  1NME B;  3PV8 A;  4UQT A;  1WD6 A;  2R8J A;  1IKY A;  2B4P A;  3EVM A;  3WBZ A;  3M6W A;  2QLJ B;  1XR6 A;  4EBD A;  1LW0 B;  2W2O P;  3CD0 A;  4F4X A;  2UXC J;  2HS3 A;  1HMV A;  4WK1 A;  5KFQ A;  4K7Q A;  2R8H A;  1U1L A;  5DDO C;  1S9G A;  3MD3 A;  1QAI A;  3MOZ A;  3NAH A;  2YH0 A;  4UUW A;  2MGZ B;  1GFW B;  3MF5 A;  2VG6 B;  2BAN B;  5HO4 A;  2MST A;  3DLK B;  4NYP A;  2C1E B;  2XBP A;  1YK9 A;  1Q5V A;  5KFV A;  2O01 C;  2ATL A;  3N6N A;  2AY0 A;  2IM1 A;  4C8K A;  2NXJ A;  2R2U A;  2ZJR Q;  3RB0 A;  2X1G A;  4QWC A;  4ED1 A;  2UUC F;  1M0S A;  2QGF B;  2X3D A;  1YJN S;  4QCL A;  1Y5N B;  3CJ4 A;  3DOL B;  3VVU A;  2XHC A;  1RT7 B;  2ZBI A;  3H20 A;  4HEA 9;  1M1H A;  5G0R B;  4ZLN A;  3T5J A;  3UN2 A;  4NLQ A;  4IRK A;  5HMY A;  4CM0 A;  4JI0 J;  1G6B A;  3SCI E;  1XIQ A;  3ICL A;  4RUC A;  2XS7 A;  1NZ8 A;  4OJ3 A;  3JTP A;  4CLZ A;  4K4V A;  2RBF A;  3BSO A;  4OZL A;  4ZKA A;  1RAA B;  2J9D E;  1IBM J;  4LFA F;  4JV5 J;  4Y2I A;  4ZPV R;  2OEJ A;  1FVS A;  4B3S J;  2ZH1 A;  3DC2 A;  2ZVI A;  3V4I B;  1JX4 A;  1Z2Z A;  3G8T A;  1UVI A;  3C6T A;  1S6Q B;  2E5G A;  3TUJ C;  1U1N A;  4C7Q A;  1T8E A;  4USV A;  1H7W A;  3M9N B;  2WVD A;  3BQ1 A;  5LJ5 Y;  1SKR A;  2NQP A;  1WC3 A;  3V81 A;  4UT4 A;  1YVF A;  1R3N A;  5LOQ A;  4I64 A;  2GML A;  1RSC A;  1JJH A;  1P9Q C;  1JLE B;  2YNF B;  5M2P A;  4RW6 B;  5B0B A;  3BB5 A;  2A10 A;  2GIQ A;  3FRZ A;  4NLV A;  3Q0A A;  2UZA A;  4GVB A;  4DV2 J;  4HT5 A;  2Y1I A;  4OX9 J;  4EU0 A;  3Q8Q B;  1U2C A;  2VH7 A;  4DV6 J;  2BKN A;  3I96 A;  2WW4 A;  4Y2M A;  3QIP B;  4P74 A;  4ED7 A;  1K9M T;  4JI5 J;  2ZKU A;  3PJW A;  1NND A;  1F5B A;  2AZ1 A;  2VKR A;  4DV6 F;  1N34 F;  3PG9 A;  1M90 T;  3SCK E;  2BW7 A;  1KDN A;  1TUG B;  3M32 B;  3K5M A;  2XMW A;  3OTE A;  2FLN A;  4OHW A;  2CQI A;  1N33 F;  2WVC A;  1AA1 B;  2FPH X;  3OPK A;  1Q5Y A;  3P5B P;  3ZZU A;  1HBU A;  4ZMM A;  3HD1 A;  3OR2 A;  2HYI B;  2RF2 A;  8RUC A;  3I56 S;  2YKN A;  2AJ1 A;  2HFV A;  4DQR A;  2XNQ A;  1JKH A;  1BE4 A;  4RPF A;  2WAQ D;  4WE1 B;  2HQG A;  3DHW C;  2BNW A;  2AYM A;  2GQC A;  3PJ9 A;  3V6H A;  1FE4 A;  1Q16 A;  3EJM A;  1WI8 A;  3NGT A;  4QR1 A;  3JQM A;  2DXE A;  2J9C A;  3SZ2 A;  4JYA J;  2LP4 A;  3VAH A;  1H72 C;  3CXC R;  2JFD A;  2KYZ A;  1RI7 A;  3DOM A;  3KJV A;  1JLC A;  4OI6 A;  3TAR A;  2HBR B;  2XHW A;  4EK2 A;  3R5B A;  4TYA A;  4BLG A;  2EEY A;  3AQP A;  1GQE A;  3KLI B;  4F26 A;  1NHV A;  1C0U B;  1S57 A;  3E01 A;  2QRR A;  3TP2 A;  4M5J A;  3NP5 A;  4ANE A;  4DX7 A;  2RU3 A;  4LBH A;  4ZHR A;  2QSW A;  1FNX H;  2QYC A;  5SZT A;  1FHT A;  2AV5 A;  2LQB A;  4DF4 A;  1U49 A;  2OKQ A;  4LRV A;  3RB4 A;  2NCK L;  3FUY A;  2B5J A;  4M5I A;  4B17 A;  5JJB A;  3NXZ A;  3CMA S;  4BWM A;  3VAF A;  3W66 A;  4OYP A;  1S1W A;  5F41 A;  1RAB B;  3HXM A;  1JJ4 A;  5CYQ B;  2LXF A;  5KT7 A;  1R8H A;  2W2M P;  1QUP A;  2AMC B;  4ZVR B;  3H90 A;  2ZH2 A;  1N5Y B;  2UXC F;  2ZUG A;  2A2B A;  3ZNJ 1;  4RU9 A;  3CCV S;  2ADL A;  3UN3 A;  4ILL A;  1WTF A;  2K8G A;  1JB0 C;  2IBO A;  2ZHA A;  4CNZ A;  4FBT A;  5FDL B;  3AJD A;  5HQL A;  3MFI A;  1JLF B;  4ECW A;  1W26 A;  3CT9 A;  2UUA J;  1NBE B;  5EDW A;  3CUN A;  3I0R A;  3NNA A;  2GCF A;  3KMS A;  1O6X A;  4DS5 A;  1WI6 A;  3H5U A;  3M1V B;  1M5H A;  4DQP A;  2MSS A;  5HSP A;  5J2N A;  3WX8 A;  2DGW A;  4C0B A;  2FHK A;  3PO5 A;  2RAQ A;  3V6D A;  4LVN P;  1IQZ A;  3H7H B;  3AHP A;  4ZCM A;  2ASY A;  5FLX U;  2P9E A;  3AA8 A;  3BGR B;  3BGR A;  2HGN A;  4UW2 A;  5EHH A;  3J81 j;  4ECX A;  2C3U A;  2V8V A;  1U1O A;  4PG8 A;  1VC6 A;  3BKT A;  4DR3 J;  4S0M A;  1KWM A;  5KT2 A;  3MHY A;  3VF0 B;  2A2C A;  2I38 A;  3BS9 A;  4WIQ A;  5D0H A;  1X5T A;  5J2N B;  3UW1 A;  1DQ9 A;  2MZT A;  4C6A A;  4EBE A;  4LF9 J;  2LQJ A;  4PQA A;  1UEU A;  4P6Q A;  5D0G A;  2A3J A;  2QV6 A;  2R2T A;  1FKA F;  4F67 A;  1Y0H A;  2JXI A;  1RE1 B;  4B9L A;  4H54 A;  2DEI A;  2V50 A;  1IR1 A;  3FSX A;  4TYB A;  1UP1 A;  1VR6 A;  4YOE A;  2XY6 A;  3GXQ A;  1NPP A;  3IGV A;  3VWS A;  1AFJ A;  2E9R X;  5L8R C;  2QJ3 A;  4P2S A;  2EG2 A;  3OTC A;  3ETM A;  4FYV B;  1HBO B;  2Q2K A;  1S1W B;  2AHO B;  2AZ3 A;  2MJU A;  2F1F A;  3HHL A;  3MPV A;  2VBW A;  3VZI A;  5KFB A;  1YBU A;  2BV3 A;  3CCS S;  2NUH A;  4YB6 A;  4F0K A;  2F63 A;  5HMZ A;  2AD9 A;  1KQK A;  4PQU B;  2B0G A;  1T0T V;  2D3O 1;  4A8M P;  3MGJ A;  3IRW P;  3UQS A;  1UKU A;  1RBO B;  4JV2 A;  4KIA A;  3TA2 A;  4JYA F;  4LSN B;  1BQX A;  3AD7 C;  4CO5 A;  2P2C B;  3KLI A;  4OYM A;  2QSF A;  5DQG A;  4EYH B;  4IO1 A;  1H98 A;  1H2T Z;  1J27 A;  5T41 A;  4F3M A;  1MLA A;  2CJA A;  5KFM A;  4O4R A;  1OQ6 A;  4ZDN A;  5BR8 F;  2X3G A;  3CJQ A;  1U1R A;  1URN A;  2KFN A;  2YBV A;  1VK8 A;  1BGX T;  2B9E A;  2MDA A;  5AE2 A;  1JKH B;  2MMY A;  1RTJ B;  3W5Z A;  5C42 B;  2RF2 B;  2XMM A;  2W9C B;  2CUY A;  4XDD A;  3R5D A;  1RHK B;  4LSL B;  4DUT A;  2CQD A;  2O66 A;  4TN2 A;  3TVY A;  8ATC B;  2IRY A;  2C3O A;  2GIF A;  4PG4 A;  4ICL A;  5ETN A;  2XMV A;  3M32 A;  3K5P A;  2CWK A;  2XO6 A;  3D6T B;  1YIJ S;  3VEA A;  1CJK B;  1TL3 B;  2DYA A;  3KLV A;  3QIP A;  4ECY A;  4OHZ A;  4ZOS A;  4KTQ A;  3C46 A;  2V2K A;  1JXV A;  2LFV A;  4NX9 A;  4RJV A;  4CCH A;  1CLF A;  4P7T A;  3DGV A;  1BDT A;  2VD3 A;  4WP8 A;  3LPY A;  2UXB F;  4I7F A;  3KDO A;  3UR0 A;  2JEF A;  3CCU S;  3VR1 A;  5C25 A;  2MLZ A;  3D28 A;  2R8G A;  4FNH A;  2IPO B;  5KFI A;  3GSD A;  4I2Q B;  2KJW A;  3I32 A;  4ETX A;  3M2R A;  3LO3 A;  1B0V A;  1UW4 A;  3NNC A;  3IP0 A;  3EGW B;  5F8H A;  4XO0 A;  2HND A;  3VVT A;  1U45 A;  1BC6 A;  1R0B G;  3P96 A;  2OML A;  1KQG B;  3B82 A;  5E33 A;  4DSI A;  2W1B A;  3R2D J;  1U6F A;  4JI6 F;  4O4G B;  1JMT A;  1T9T A;  5A8K B;  3L95 X;  4USU A;  4ANC A;  4QIF A;  3K5L A;  1PYS B;  3CVK A;  4Y2A A;  1VHI A;  4ZIT A;  4AL5 A;  3LA0 A;  2MKI A;  3A8E A;  3QRQ A;  2VFR A;  3NGU A;  4NZ7 A;  4OX7 A;  1PJ6 A;  1S4F A;  2CJY B;  2N7C A;  3MUM P;  1FO1 A;  2H5E A;  2LXU A;  2IVF B;  4AAI A;  1EJ7 L;  1FXD A;  1OHN A;  4TY8 B;  2N82 B;  2APO A;  3NCR A;  2JOQ A;  4K5R A;  1MG7 A;  2IJN A;  2RQ4 A;  3SDE A;  2W9B A;  4FKX A;  1SPB P;  2J0S D;  3P8B B;  4JB8 B;  4U7C A;  1WG5 A;  2VG6 A;  1XR7 A;  3I9Z A;  4P75 A;  1NZA A;  4LQ9 A;  1FTC A;  4KKO B;  4EBC A;  2MY7 A;  1KON A;  1ULR A;  2EWH A;  3DRP B;  1HMV B;  3KK2 B;  2OHD A;  2ZM6 J;  1FES A;  4YME A;  2CQ3 A;  5J2P A;  3N5F A;  3PFO A;  1GNK A;  3M8S A;  4A4J A;  2X1A A;  4Q8E A;  3Q8U A;  3EWG A;  4KGM A;  5IT4 A;  4DR2 J;  1RT3 A;  1LWC B;  3F41 A;  1XNR F;  1SV5 A;  3G6Y A;  3NKY A;  2XQC A;  5C2C A;  1Q7L B;  2YKA A;  3DXS X;  1AZS A;  3PR5 B;  3RYL A;  3M2V A;  4C8O A;  5HL7 Q;  3KHL A;  2VBY A;  3W2V B;  1KVK A;  2OD6 A;  3IN5 A;  4PUO B;  1FRX A;  4DSJ A;  1S1X A;  4AND A;  2DHG A;  3HVA A;  1RAI B;  1P1L A;  1OY6 A;  3EZO A;  4NLG A;  2XWX A;  4KE5 A;  2LQ8 A;  3M2U A;  2ADC A;  1FNO A;  1G4C A;  2VF3 A;  1PIL A;  3BBB A;  3KHH A;  4ED0 A;  1I6J A;  4LF7 J;  5E3A A;  3SXL A;  4CLS A;  3CCL S;  3PHE A;  4KYZ A;  1VIX A;  2CJ9 A;  2QC3 A;  5IV4 A;  2V67 A;  5KFC A;  2FC9 A;  2KKE A;  3IR5 B;  3AQO A;  4RLE A;  2Y8W A;  3R8Y A;  5GAH U;  4NMX A;  4DQS A;  2WOM A;  4HDG A;  2JZ5 A;  1HQU B;  4QIG A;  5K14 A;  3VAJ A;  3BM7 A;  4F25 A;  2H1Y A;  4HH1 A;  2CZV C;  1EKS A;  5H9F J;  1RA6 A;  4CNY A;  2D3O R;  2LA6 A;  4OHV A;  5T7L A;  2EFV A;  2WVB A;  4L3K A;  1ARO P;  2DR9 A;  2FGO A;  2OTL S;  1VBK A;  3J7Y I;  1RT3 B;  3MAQ A;  2VQE J;  3CJK A;  2EK1 A;  1UFK A;  2PC6 A;  2YKM B;  2ALY B;  3HVR A;  2DNM A;  4NA1 A;  5J2P B;  2G0I A;  2HKE A;  2ZDO A;  3UDL A;  4ES2 A;  2VOD A;  3GFX A;  4A8K A;  3G8S A;  4OZN A;  2P9C A;  2ZD1 B;  1HKA A;  1H6K X;  2H51 B;  2JRS A;  3HFK A;  3ISN D;  1T03 B;  2DCU B;  2HNZ A;  2KHC A;  3AFG A;  3AY0 A;  4DU8 A;  2W2N P;  2HHV A;  1RHM B;  1HL6 A;  5AXM A;  4KGX B;  2XSJ B;  2DR8 A;  3OJS A;  2W9B B;  3SDE B;  2JBV A;  4WU3 A;  3PHT A;  2HWT A;  1MNE A;  2V2Q A;  3R5A A;  1FRK A;  2RQK A;  1FK9 A;  4R8U A;  2HBQ B;  4B9V A;  4TY8 A;  3CO9 A;  1NK8 A;  3J81 U;  1NPK A;  4ZPB A;  2D69 A;  1FWK A;  3MM9 B;  3FQK A;  4LRB A;  2HFZ A;  2WSC C;  5DLG A;  4HYK A;  4I67 A;  1TAU A;  3T9Z A;  3C19 A;  2ZZN A;  4PEO A;  2WB4 A;  3TYT A;  1QAX A;  1NSA A;  3UFC X;  3GJS B;  3ILI A;  5F3T A;  2RS8 A;  5LJ3 Y;  1KC8 T;  1HNZ F;  4DR7 F;  2N3O A;  5D0E A;  1SJ3 P;  2JWN A;  4G1P A;  3NGK A;  1SJ4 P;  2KXN B;  2LQ9 A;  3I5C A;  2G13 A;  2E1C A;  5KFX A;  4UY8 T;  3J7A N;  2J6S A;  5HJX A;  4C48 A;  2KVQ E;  2J0Q D;  1EAR A;  3O44 A;  3M2R B;  3GIL A;  3IR7 A;  1NU4 A;  2DH7 A;  3U1M A;  2EG1 A;  3ADA C;  3CIZ A;  3QID A;  2IM0 A;  2WBR A;  1FA0 A;  2EPI A;  2D74 B;  3C16 B;  4J7C A;  2JFK A;  1RT6 B;  2AYE A;  2DK2 A;  4C0O C;  2RRN A;  2NSB A;  4FN5 A;  4I7F B;  4IH6 A;  2BDP A;  2IYI A;  1HR0 J;  1LXJ A;  4U67 Q;  1KD1 T;  1MWQ A;  4OYI A;  4R5P B;  4H4K C;  1RAO A;  1D8Y A;  4C3K A;  2YWH A;  5LMN J;  2UUB J;  4MYT A;  4TNO A;  1RK8 A;  2I2Y A;  2ZKT A;  1TL3 A;  3JSY A;  3TAQ A;  1CJK A;  1EHW A;  1HPZ A;  1SC6 A;  2RIL A;  2XCP A;  4ICL B;  1HLW A;  3IA0 A;  2QEX S;  1BWE A;  3MPD A;  4MMO A;  1ZTW A;  3CD5 A;  3NMR A;  4JI0 F;  3L7O A;  4DV0 J;  4NXM F;  2C2O B;  3RU0 A;  5HLF B;  2H9Z A;  3HVT B;  1TR0 A;  1F3V A;  5C24 A;  2XG8 A;  4OX9 F;  2W9C A;  4LRF A;  4DPU A;  2W25 A;  2M9K A;  1NJZ A;  2BA9 A;  5AE1 A;  5EWF A;  1QLN A;  3GIJ A;  2CWX A;  4ZJQ A;  2GAH C;  3OVA A;  2DHS A;  3KUG A;  5F8M A;  4X64 J;  3FEY B;  3IR6 B;  2B8Q A;  1TMJ A;  3W63 A;  2AJ2 A;  5A6P A;  3OVS A;  4WP3 A;  3TOQ A;  3D2W A;  1PO6 A;  1RYS A;  1M1K T;  2B51 A;  3ENQ A;  3P6Y C;  2VOP A;  3NGS A;  1FXR A;  4OZ1 A;  4Y34 A;  1TVR A;  3M7V A;  5GMD A;  3W5Y A;  4A8X A;  1S79 A;  4BWJ A;  3HM9 A;  1IKW B;  2KB2 A;  3LW5 C;  4LSN A;  4HH0 A;  2HLU A;  2ASL A;  3D6H B;  2H5I B;  4PPZ A;  2IBK A;  4ZPT R;  1ZM2 A;  1IBM F;  2VIC A;  2IJR A;  3UVJ A;  4U8V A;  2NRE A;  2BQ3 A;  4LUB A;  3NBP B;  2VDH A;  4YY3 F;  3BQ2 A;  2OSR A;  2QLF B;  3MM8 B;  2LEB A;  1ZBT A;  2R4F A;  2IRX A;  4J37 A;  4R25 A;  3QNW B;  1QTN B;  3Q2S C;  3W65 A;  3N0V A;  3GQC A;  3SV4 A;  4ELU A;  3OR1 A;  4FVC A;  4LFB F;  4F36 A;  2UUC J;  5HVF A;  1HBO A;  1IUJ A;  2LCW A;  6FDR A;  3AOC A;  2E9T A;  1A9N B;  2CJX B;  2WVE A;  4UOF A;  1C4A A;  3LPE A;  4Q0B B;  4DL2 A;  1HNW J;  1HBN A;  1REG X;  2UXD J;  2LEC A;  1VQY A;  1HNV B;  1EX8 A;  3WDO A;  5GAG U;  1XNQ F;  3CMQ A;  3OFH A;  2CJB A;  2EK6 A;  4MH8 A;  2VPX B;  3NEK A;  5ETO A;  3U1N A;  9RUB A;  4DUZ J;  2YNG A;  3D67 A;  2BJ7 A;  1YWX A;  2UV8 A;  1HYS A;  7FDR A;  1GT8 A;  4LRD A;  5T14 A;  4MIB A;  2GC8 A;  1QD1 A;  1S1V A;  4ID5 B;  2MQM A;  2OP5 A;  1FX2 A;  4B9M A;  1CPZ A;  3M05 A;  1RIS A;  1YSJ A;  4M1K A;  1FFW B;  3RAM A;  3TW0 A;  3M30 A;  5KFH A;  3SQG B;  1FEH A;  2VHG A;  1VQL S;  2MB0 B;  2AEM A;  2OPQ A;  2CDR B;  1FJG F;  2IAJ A;  1PSD A;  4DUZ F;  1REV A;  2QG9 B;  2BX6 A;  2VG7 B;  4USK A;  4ZVS B;  5IZH A;  1UVM A;  1RT2 B;  2MXY A;  4OFZ A;  2ZH8 A;  2R7W A;  1PBA A;  3M6U A;  4DR3 F;  1APS A;  1RTI A;  2ZZM A;  1KHW A;  2DIU A;  5L1J A;  3E2E A;  5K8O A;  5ETV A;  1UPP A;  5KT5 A;  1U26 A;  3QSY B;  4C9D A;  3MEG B;  1MRO B;  3S7R A;  5LL6 d;  5D4N A;  2KM8 B;  1UA1 A;  1JLF A;  4JV1 A;  4M95 A;  2M3D A;  3H25 A;  3RR8 A;  1Q8L A;  4JI8 F;  3RG6 A;  2CQG A;  3BH7 B;  1RHJ B;  2GJF A;  2KKH A;  2QLW A;  3AH6 A;  3PM9 A;  4MKB A;  3AD9 C;  2UUB F;  4LFB J;  2CQB A;  3U27 A;  5BYR A;  5K8N A;  1M5O C;  4X4S A;  4WF9 Q;  2QMW A;  1N5Y A;  4U7U K;  1PAU B;  2BQR A;  2BA3 A;  2CPE A;  3VW4 A;  2POK A;  3BEG B;  3FMB A;  3NWR A;  2ERR A;  3TQE A;  4CTA B;  5SUH A;  2V8H A;  3SCJ E;  2I9S A;  2RD5 C;  3IG1 B;  3FK4 A;  4QQB A;  4DCO B;  2AGP A;  4L76 A;  1C0T A;  1SH2 A;  3EGV A;  2DGV A;  1XER A;  2BZ2 A;  5IWA F;  4XPC A;  2M88 A;  4HDH A;  4X84 A;  1CUL B;  1HA1 A;  4JI5 F;  2DCL A;  1IVZ A;  4LR8 A;  2GFF A;  1I1G A;  2HFN A;  3BH6 B;  3W8G A;  2D41 A;  5K9F A;  3H5Y A;  1OO0 B;  2D3Z A;  1JLG B;  4LF4 J;  3DCA A;  3GYN A;  2Z2Y B;  1UTA A;  3X1L B;  2PD1 A;  1IR0 A;  1T7P A;  1QSL A;  3KLH B;  4YHH F;  2FLO A;  1VQS A;  1ZOT A;  3GIR A;  1U4B A;  4TU7 A;  1X8D A;  2GMH A;  3EPI A;  3G82 A;  4YS2 A;  2KN4 A;  4WE1 A;  1KOH A;  2VJV A;  2R7O A;  4F8R A;  6FD1 A;  2GV1 A;  1SVD A;  2HFS A;  3CD7 A;  1TP7 A;  4J5O A;  3OR2 B;  5DET A;  5F8N A;  2YQ1 A;  2IC3 B;  1QAJ A;  3BDP A;  3ZZO A;  1HBU B;  1S0V A;  3NL0 A;  1JLB B;  2VJU A;  2OEK A;  2C42 A;  4USW A;  4UY8 5;  1B01 A;  1EA4 A;  3S6E A;  5ETL A;  4EI2 A;  2Z2Z A;  1DZ5 A;  1TKX B;  1FI4 A;  1PIE A;  2XZW A;  3MPY A;  2BXJ A;  2W7P A;  4RNF A;  4DR1 J;  2BQU A;  3P4U B;  2BJ9 A;  5HP1 B;  4DR6 J;  1ACM B;  1ZPV A;  2XMK A;  1BWV A;  5I3Q A;  3QWU A;  2PE8 A;  3OL6 A;  1CS4 B;  1RCO B;  2PSZ A;  3T1Y F;  5K5M A;  4MKY A;  4AXJ A;  3D1Q A;  2ACM A;  3UN5 A;  3CJS A;  5I3U B;  1JLE A;  5IM0 B;  1M5P C;  4WFX A;  3SCL E;  2BE2 A;  4ZP7 A;  4NZ0 A;  2JXG A;  5CYM B;  2DR5 A;  5JMN A;  4DV7 F;  3N6L A;  4J91 A;  5IT0 A;  3MCO A;  5IWA J;  5AJ3 J;  3J81 Y;  3BDE A;  4F50 A;  1S6Q A;  4X4T A;  3T41 A;  1U2R A;  3V4I A;  2WON A;  3UNG C;  4QU6 A;  2R7T A;  1V9O A;  3LJP A;  3EXY A;  1BMQ B;  2WRM A;  1RAJ A;  4DOZ A;  1LK5 A;  2DJW A;  1TK5 A;  2OFG X;  4URS A;  3N01 A;  3SMZ A;  1RQ0 A;  2MJN A;  5D6G A;  1R31 A;  3H8Y A;  4FYY B;  1U9P A;  3CME S;  3LGH A;  4NLO A;  4KR0 B;  2ZH5 A;  3MDF A;  4ECU A;  4B3S F;  4IQM A;  3U7J A;  3DOL A;  4NCG B;  1YJ9 S;  1WEZ A;  4A46 A;  3H87 C;  2C3M A;  4QR2 A;  1N5V A;  1T3O A;  5FII A;  5CCM A;  2R7X A;  2DHX A;  2V8G A;  1RDR A;  2B4O A;  1CJV B;  1Q8K A;  4NLD A;  4X62 J;  1PAR A;  4FNI A;  1IBC B;  1YJV A;  1UVN A;  1OJ4 A;  3PRB A;  5DG7 A;  3CCZ A;  2BAN A;  3DU6 A;  1KTQ A;  1WHW A;  4KGK A;  4Q2M A;  4XAK A;  1K1Q A;  2UU9 F;  2HHQ A;  4ZP9 A;  2MQ8 A;  3GR1 A;  1IBL F;  3T5K A;  3BYP A;  4XIU A;  3RGI A;  1G7C B;  2QLX A;  5K8M A;  1TL1 B;  1CG2 A;  1H73 A;  1S99 A;  3DFE A;  2DIT A;  4ED8 A;  1DRZ A;  1NK6 A;  1P9Y A;  3M6X A;  3HVW A;  1RWX B;  1O0P A;  4Q2L A;  2W9A A;  4ED2 A;  3FBC A;  4G6V B;  3I0S A;  2R7V A;  3O6Q A;  3BSA A;  3M8R A;  1QJH A;  5F8J A;  2CPX A;  1RTD A;  1UFL A;  2GVZ A;  4HI2 A;  4OLO A;  3DOK A;  4NLU A;  3TAN A;  1DLO B;  4A8F A;  2QFI A;  1BY9 A;  2YWK A;  3A8I A;  2KVI A;  2RT3 A;  4KGZ B;  4K2X A;  2UUT A;  2RUS A;  1ZAX A;  4WP9 A;  3UDE A;  2MZS A;  3DRR B;  3TZX A;  5EGY A;  4PCQ A;  1R0A A;  3QRR A;  5HMX A;  3E3X A;  2CQ4 A;  5IM0 A;  2K29 A;  1X4C A;  3I9V 9;  3NGR A;  2BW2 A;  1C1C A;  2PMH A;  5BYQ A;  4X66 F;  2FVQ A;  1HNX J;  4CDI A;  2B9Y A;  1OYE A;  2Z8Q A;  3C14 A;  4NLP A;  5GMK a;  3ZZT A;  4URG A;  3TO8 A;  1FT8 A;  3Q8R B;  4DSF A;  3V6K A;  4NAS A;  4OJG A;  1CC8 A;  2MQL A;  3ZTR A;  4DR4 F;  2QMX A;  1HAR A;  5KT3 A;  4K0K F;  2I5J A;  4V19 X;  2IRU A;  2DRA A;  4MYU A;  1GK8 A;  2HQF A;  3BYR A;  2WZ1 A;  4DEZ A;  2BVZ A;  3OXL A;  1GX6 A;  4PXD A;  4XK8 C;  3CC2 S;  1FTR A;  3DU5 A;  4ITS A;  4RUB A;  1JLB A;  3BO2 A;  2K06 A;  3POT A;  2IA6 A;  1N32 F;  1HHQ A;  1U8W A;  2AEJ A;  5I3P A;  3TZY A;  2Y1L B;  1IBK F;  1J5O A;  1C4C A;  1OY8 A;  3G82 B;  4OYW A;  5D4O A;  5IC4 B;  3KHR A;  2V4J A;  3K5N A;  3IBF B;  2LKZ A;  1RU2 A;  2AQ4 A;  2ZIT A;  3R2C J;  4IOB A;  1X4E A;  1FJE B;  2IM3 A;  2VFS A;  4HR2 A;  3ZXW A;  5IXU A;  1DQA A;  3DLE B;  2BJD A;  4IDK B;  3B54 A;  5B0E A;  3LP1 A;  3PX4 A;  1NK0 A;  1KVI A;  3ENA A;  4K59 A;  3QMQ A;  1MML A;  1LOU A;  1WOR A;  5C7P A;  1RJJ A;  5AE3 A;  5KFN A;  5FJ4 A;  3SSQ A;  4U7U D;  2NS1 B;  2HQC A;  1DAR A;  2ZZT A;  3OSN A;  5J2Q B;  1UZD A;  3GYX B;  3QLH A;  5DG8 A;  4QWA A;  1M1G A;  1VQM S;  4OZ0 A;  1WNE A;  2VG5 B;  4QWD A;  4PWD A;  5DDR C;  3CGI A;  4ES1 A;  4NYO A;  2V0N A;  2DRD A;  1TZ0 A;  1HBM B;  3NS6 A;  4O3O A;  4CLY A;  2DNR A;  5J1E B;  4NLY A;  3WC0 A;  4K4S A;  1MU2 A;  2YWE A;  2QE5 A;  3IAS 9;  1TUV A;  2MZ1 A;  4LMZ A;  3GZ7 A;  4CLL A;  2V94 A;  2NYI A;  3GG1 A;  3MWB A;  3O1L A;  5AXK A;  1JJC B;  2IM2 A;  3TZZ A;  1BAZ A;  4Y00 A;  3UPF A;  4CLF A;  3F44 A;  4KT0 C;  3QO9 A;  1S9E A;  2BOP A;  3JSB A;  4CH1 A;  3G5O A;  1BLU A;  1RBL A;  1WAC A;  2FZC B;  2HGL A;  3MEG A;  3PIP Q;  3BO3 A;  1U1M A;  4MT1 A;  1Q79 A;  4DFM A;  2OTJ S;  4IG3 A;  5GAE U;  1BQM B;  3UD5 A;  5A2Q Y;  2HVH A;  5A6W A;  2HW3 A;  2CPF A;  3CW2 C;  2H54 B;  4X4V A;  1T9X A;  5IC6 B;  4DV5 F;  1TK8 A;  5J1P A;  1RWW B;  2YTC A;  1OG7 A;  2BKO A;  2VG7 A;  3C15 B;  1REV B;  2XZD B;  2EBE A;  4OI1 A;  4V1A k;  4F04 B;  5DGA A;  1FD8 A;  2HFU A;  1NHU A;  1RT5 B;  1RLC L;  2IAJ B;  2OPQ B;  2Z56 B;  3ENV A;  3LAN A;  4CZC A;  3OLB A;  4J9S A;  5E3Q A;  3ZC4 A;  5G4D A;  1F1B B;  2VZ9 A;  2Q66 A;  2P6S A;  1NJW A;  1B3T A;  4E2F B;  4K2J A;  5LSO A;  4FF3 A;  3CNQ P;  2ALZ A;  3HK2 A;  2BRK A;  3QFH A;  2L9N A;  4ID5 A;  4W90 B;  4GVL A;  1IKX B;  4DXL A;  1S1U A;  4USH A;  1HYS B;  2M5Y A;  3G4S S;  3WHI A;  1WC0 A;  3EX7 B;  3DMJ B;  1EQ0 A;  4LF9 F;  4C2M A;  3P49 B;  3NNE A;  1UWB B;  4JV5 F;  1P1T A;  2IA0 A;  5DRK A;  4WCE Q;  4CH0 S;  1U02 A;  3AA9 A;  1TMM A;  4E0D A;  3MCS A;  3RR7 A;  1CVJ A;  1WJ9 A;  1HBN B;  2XYG B;  4DR5 F;  2AW0 A;  2BAB A;  2CVI A;  1GMW A;  2AJ4 A;  1R7I A;  4RW9 B;  1S59 A;  3CCQ S;  2ZC3 A;  3VAK A;  1X31 C;  1FDN A;  2G2Z A;  4ZCL A;  5H9E J;  5JVH Q;  2HLT A;  3GE9 A;  5LSL A;  2R7Q A;  1LK7 A;  2QO3 A;  4WWS A;  4J9R A;  1P27 B;  4H4O A;  2E66 A;  2FHM A;  2HS4 A;  1OMS A;  3NO7 A;  2RKI B;  1IN0 A;  3EGN A;  4FF1 A;  3PKM A;  3KJQ B;  3OHA A;  3MM8 A;  4ECS A;  4CH7 A;  2V4Q A;  4M5D A;  5HQM A;  2V63 A;  2MKH A;  1DY3 A;  4FF2 A;  4HLB A;  1ARQ A;  3MED B;  2Z2M A;  2KT2 A;  2JVR A;  3KJF B;  5A8R B;  2DNK A;  1BQN B;  2E1R A;  2CAD A;  4AXI A;  5BXI A;  4KO0 A;  4B3O B;  2DHH A;  3CJ5 A;  4A8W A;  4DSL A;  3GJT B;  2J0X A;  2GQ2 A;  2V9K A;  4N8N A;  3AOB A;  4UZB A;  4KV8 A;  3CTR A;  2GGP A;  4OQJ A;  1EET A;  5KFG A;  3JYT B;  4YDD B;  1UET A;  5HMW A;  1UVL A;  1YRT A;  5KG4 A;  2FQQ B;  3O5T B;  5E2Q A;  2XI2 A;  2MQO A;  2EFN A;  2CQ2 A;  2MZJ A;  2ZBC A;  1T9V A;  4Q5V A;  3MEC B;  4I2P B;  2KM8 C;  3ZZY A;  4DPY A;  2D3U A;  1S6P A;  1TEL A;  2EFG A;  4JBC A;  2JLG A;  1U0H B;  4ZVF A;  1NKE A;  2FY1 A;  3HVT A;  5C24 B;  1CJT B;  1FRM A;  3AB2 B;  3BN4 A;  1QAY A;  4ZVP B;  2D9O A;  4M5G A;  1KBR A;  3BR9 A;  4HTJ A;  3GLJ A;  4FXE A;  4TU9 A;  1FDB A;  2XEX A;  2GHP A;  1VQ8 S;  3CJ2 A;  3HFZ B;  4JI2 F;  5GAH I;  1PBU A;  1VMB A;  1HPZ B;  2ZBP A;  3OBI A;  2V69 A;  4DV4 J;  1X0F A;  2HAF A;  2C2Z B;  1XNR J;  1RLD A;  1VDH A;  2IVM A;  2W8L A;  5CCL A;  3UE2 A;  2DRB A;  1JNR B;  4R5P A;  5L46 A;  2OPP B;  4ZVE A;  3KLG A;  4DV5 J;  1Q8B A;  4K50 A;  1R8C A;  1VQ9 S;  3BSN A;  3BKU A;  1DTT B;  4WFY A;  2IY5 B;  3ZZP A;  4HKQ A;  2XS2 A;  1I3O B;  1YKW A;  4I6Y A;  2C2M B;  4DV3 J;  3C16 A;  3K8V A;  4PXC A;  3B8H A;  3OLA A;  2XMU A;  3PRV A;  3IR7 B;  4MTP A;  1IXK A;  3D1O A;  2OD4 A;  4Q43 A;  3PKY A;  1L3S A;  1M5V C;  1NDK A;  3NG8 A;  1K1S A;  1VS3 A;  3OT9 A;  4LF5 F;  4CT8 A;  1EP4 B;  4OV6 A;  2GHW A;  5LMU F;  4LQ3 A;  5JUM A;  4ZVG A;  2XYP B;  2YNI B;  2ROG A;  2ZC4 A;  5CZX A;  3HT3 A;  4MIW A;  2J8S A;  5HAN A;  2J7K A;  2NUU G;  3LP2 A;  4RW4 B;  1IR2 A;  5AXL A;  1VC0 A;  2LLZ A;  4EZ6 A;  5F8G A;  1J5E F;  2LEA A;  2YX4 A;  2OFH X;  4OJH A;  4TQR A;  1F9H A;  3TVZ A;  1ZM9 A;  4D3G A;  2HGM A;  3I6P A;  1LFP A;  3D54 A;  3MM9 A;  4N8O A;  1SKS A;  1LFW A;  2XSF A;  2ZE2 A;  3R6G B;  1X4H A;  3R1L A;  1N36 J;  3LQV A;  1SH3 A;  3QYY A;  2PFD A;  2NLW A;  2E1A A;  4DFJ A;  3MMJ A;  3PVX A;  5B0D A;  2M4M A;  2E44 A;  3K7R A;  3KG1 A;  2XGP A;  2YXL A;  3GU0 A;  1VRU B;  4M5K A;  3HHD A;  4O44 A;  2NXU A;  2F7V A;  2E1M C;  4B9T A;  2HHX A;  3FFI A;  2FJB B;  2HNZ B;  3J7Y U;  3MMC A;  3ZZR A;  2J9D A;  2VBZ A;  3FVY A;  4MKV A;  2B56 A;  4P72 A;  2ZD1 A;  3ZZZ A;  4DN9 A;  4J9M A;  4J9K A;  2FLL A;  2EW9 A;  2YKP A;  1UFW A;  2F9J A;  2RVJ A;  2WB1 D;  3HZE A;  2VFU A;  2HZC A;  3GSI A;  4EWT A;  4F7V A;  3TX0 A;  1RBA A;  5A0Y B;  2YKM A;  4GO5 X;  2FVS A;  2B9X A;  1VCT A;  3PX0 A;  1ZM4 A;  1EAY C;  1ROF A;  3MMC B;  4IH5 A;  3PX6 A;  2R7U A;  5E3R A;  4RNH A;  3MXH P;  2QZ8 A;  2GW8 A;  3KNA A;  2CRL A;  4FYW B;  1U2F A;  1RA7 A;  2KYX A;  3D4J A;  4QOT A;  1N34 J;  4F2S A;  4ILM A;  3B4M A;  2EFP A;  4PYA A;  4K4Y A;  2ZWO A;  5L9X A;  2CG8 A;  1XMO J;  3W3S A;  1JLA B;  2NR0 A;  2ZE2 B;  4DV2 F;  5H9E K;  4MJW A;  4QYZ J;  3V4M A;  2G4B A;  5KFZ A;  3W61 A;  3SSR A;  1S6O A;  2XMJ A;  5K8P A;  2DNO A;  2PII A;  3Q8Y A;  1VQN S;  4C11 B;  5JVG Q;  1P8G A;  2JLF A;  3LP2 B;  4RW4 A;  2A6O A;  1N4L A;  3IWN C;  1NKC A;  1SIW A;  1ARR A;  4PZV A;  3UI3 A;  1VQ6 S;  2MKS A;  1T3N A;  3ISZ A;  1VRT A;  3FCW A;  3FNN A;  1MYK A;  5LT5 A;  4J9P A;  1YDL A;  1Y9O A;  2DH8 A;  1EP4 A;  1BDV A;  3MM5 B;  2I8E A;  3VAL A;  1KKH A;  2BSQ E;  1RWO B;  1QY7 A;  2F9D A;  2K1R B;  3QAT A;  2CNL B;  4R0J A;  3RUB L;  1MW7 A;  1S1X B;  3FBB A;  4X4R A;  3T5H A;  4CYU B;  5F9L A;  4PUO A;  3PW2 A;  1UEV A;  3R6L B;  2CPD A;  2P8I A;  1HIY A;  3AXK A;  5AT1 B;  2JEJ A;  1AZS B;  1DTT A;  4K4Z A;  2NXC A;  5D3G B;  3MAA B;  1ZPW X;  2DH9 A;  4K4W A;  5KFE A;  1KSP A;  2RHS B;  3BBC A;  4HV0 A;  1H0H B;  2XZT B;  1JXL A;  2XMT A;  4K4T A;  2H4Y B;  3G86 A;  3G2X A;  4YDX A;  3DGP A;  1TKZ B;  4L75 A;  3EXC X;  3EE3 A;  3SFG A;  3FT7 A;  2Q3P A;  2Q43 A;  3R7B B;  3T6B A;  1OSD A;  5LXY A;  3KK2 A;  4QW8 A;  3JSM A;  4JI1 F;  2XNR A;  3A3O B;  1S12 A;  2HIQ A;  2IDL A;  2Y0B B;  2YVS A;  3D3C J;  4KH1 B;  3FDS A;  5D15 A;  5HN0 A;  4YR0 A;  2XB2 D;  1X5P A;  2HBY B;  2G0C A;  4GC6 A;  1W2I A;  1S6P B;  3UDC A;  4OX8 A;  4WKY A;  2E1P A;  2L9D A;  7FD1 A;  2IMW P;  4KAI A;  4JI7 J;  2UVW A;  3VGV A;  3OTB A;  2AX0 A;  4KHR A;  4DZ6 A;  2F5G A;  4GMK A;  5L1I A;  1I94 F;  1NSP A;  5E7O B;  3BGL A;  3W64 A;  4DPT A;  2KXH A;  1QTG A;  3S1T A;  1XNQ J;  2DGX A;  2KZZ A;  4ZPD A;  1EET B;  3J80 U;  3EGZ A;  2GGP B;  3LF0 A;  3DLL Q;  3THT A;  2EFQ A;  3KMQ A;  1PJ5 A;  1O8B A;  5A8W B;  2L08 A;  3PYF A;  3QOQ A;  2YWW A;  4G65 A;  1S97 A;  2ZOM A;  2A2D A;  4BC9 A;  4B3O A;  4KO0 B;  1RHU B;  3A12 A;  1ITP A;  4LVO P;  3W9H A;  5A8K A;  2HUR A;  1BQN A;  3KXD A;  2GQQ A;  3FGV A;  3NOG A;  1MNT A;  4F4A A;  2HND B;  3ELH A;  5KFT A;  4ME7 E;  5HJY A;  2RJZ A;  1ICE B;  2VUG A;  3G6V A;  2HHH F;  4D8J A;  4U8Y A;  4CQ1 A;  1NH8 A;  4I2Q A;  2CPY A;  4OYA A;  3A8J A;  2F65 A;  2OSQ A;  3DRY A;  1C1B A;  2KO1 A;  2E5H A;  5HBM A;  4CO4 A;  5C25 B;  3N4W A;  3LP0 B;  2AP6 A;  4R0E A;  4RW9 A;  3TAM B;  3PEJ A;  4N56 A;  1NJY A;  5CD4 A;  2N3L A;  1RWP B;  1FCA A;  3VEB A;  1GXT A;  1Q53 A;  4OI0 A;  2DIS A;  5C5J A;  4KFB A;  1HNI A;  3DI6 A;  2B9W A;  4Y28 C;  2NPF A;  4X64 F;  1RB0 A;  3DRS B;  2J76 E;  4OHY A;  1ZAV A;  3DMJ A;  2HEK A;  3ENW A;  3QGP A;  4V19 J;  1WC6 A;  2OLW A;  1F9F A;  4LSL A;  1HHS A;  4RR5 A;  4C8N A;  3N9U C;  3CDB A;  3IFE A;  4DS4 A;  1JQG A;  2AJF E;  2F3J A;  4DF8 A;  1AXQ A;  1M5S A;  2VPZ B;  3ZO7 A;  1RTJ A;  5C42 A;  1SB6 A;  5ETT A;  3OTO F;  4ECQ A;  2X1F A;  1DBD A;  1U7L A;  1VJQ A;  1RT5 A;  4P73 A;  1TL7 A;  2IHR 1;  5THW A;  3C15 A;  5KFR A;  4B3T F;  2YH1 A;  4CLP A;  4USI A;  2CPI A;  3UCZ P;  1R8A A;  3DDI A;  4WTY A;  1NDL A;  2JX2 A;  4ZLL A;  4TXS A;  1WOP A;  5E3P A;  4IG3 B;  1LEO A;  2BM0 A;  3T1H F;  3SI8 A;  1YI2 S;  1U24 A;  2V8P A;  2CJQ A;  4HL9 A;  1S9E B;  1NLK L;  1MYL A;  5KG5 A;  3PW7 A;  4TQS A;  2QL5 B;  3BKF A;  4DV1 F;  4FS2 A;  3GFH A;  2E5J A;  4I0W A;  4AYB D;  1V5I B;  3PCO B;  2YX7 A;  1X4G A;  2B7B B;  2ZVS A;  3JXO A;  1ZET A;  2JNJ A;  4OYX A;  3BQ0 A;  4B3T J;  3CD6 S;  2Y8Y A;  1HBM A;  1FVQ A;  1T95 A;  4ELT A;  5FD1 A;  3KNG A;  4B9S A;  4BS2 A;  2G2O A;  3MEK A;  2WSF C;  3RZA A;  1KS2 A;  2XUL A;  1QSY A;  2KDO A;  2KFY A;  2WBM A;  4BBY A;  3H4B A;  1KVJ A;  2VG5 A;  1WF1 A;  4IR9 A;  3PEH A;  4PWD B;  2IYG A;  4X4O A;  3QLH B;  4O0I A;  1B7Y B;  1TQL A;  3GTY X;  3RBX A;  3DLG B;  3IMQ J;  4AFF A;  4KC5 A;  3K59 A;  1WOO A;  4DMZ A;  1T94 A;  2FZG B;  3HUL A;  3SYZ A;  3EVW A;  3MCM A;  4CO1 A;  2C2N A;  4MKA A;  2F40 A;  1PYO B;  3GYG A;  1S77 D;  3CCW A;  3HSJ A;  1A6L A;  2KT3 A;  4FS1 A;  3MM7 B;  3C3L A;  5J2M A;  1G2E A;  4QZV B;  1CC7 A;  1GXU A;  2PMW A;  3ETO A;  3MMB A;  5KG2 A;  4DSE A;  2R9L A;  2JEG A;  3BPD A;  3P5T L;  5KFJ A;  4C8L A;  4F02 A;  2VQE F;  2DNN A;  1WHX A;  3MEE B;  3Q89 A;  1RAD B; 
#chains in the Genus database with same CATH homology
 1QTG A;  2KEL A;  1P94 A;  3H87 C;  2BNZ A;  1B28 A;  3FMT A;  2BA3 A;  2HZV A;  3VW4 A;  2Y3Y A;  4HV0 A;  3VEA A;  3VEB A;  2FGC A;  2JXI A;  2BJ3 A;  2JXG A;  2RBF A;  2K1O A;  3QOQ A;  1PAR A;  3PHT A;  2BJ1 A;  2CAJ A;  2K29 A;  1BDT A;  3GXQ A;  3FT7 A;  1MYL A;  1ARQ A;  1ARR A;  2WVC A;  2WVE A;  1BAZ A;  2HZA A;  4FXE A;  2NZC A;  3BKF A;  1Q5Y A;  1MNT A;  2K9I A;  1EA4 A;  2K6L A;  2WVF A;  1B01 A;  2CAD A;  1MYK A;  2WVB A;  4ME7 E;  2F1F A;  2CPG A;  2JXH A;  2K5J A;  2WVD A;  1NLA A;  1BDV A;  2BSQ E;  1IRQ A;  1Q5V A;  2BJ9 A;  4D8J A;  2BJ8 A;  2BNW A;  3QSI A;  2AY0 A;  2PC6 A;  3BKT A;  1U9P A;  2BJ7 A;  3LGH A;  1X93 A;  2H1O E;  3BKU A;  2CAX A;  2GPE A;  2CA9 A;  3OD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...