2WVDA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
133
Chain Sequence
b'KDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLSTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
molecule tags Transcription
source organism Helicobacter pylori
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
total genus 32
structure length 133
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvdA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvdA02
2AY0A 2CADA 1BDTA 3QSIA 3FT7A 1PARA 2H1OE 2JXIA 3H87C 1BDVA 1ARQA 2JXHA 2FGCA 1ARRA 2GPEA 1B01A 2BSQE 1Q5YA 1QTGA 2HZVA 2CAJA 3VW4A 2WVBA 2BJ3A 4ME7E 3FMTA 3VEAA 1X93A 1P94A 2NZCA 2PC6A 1U9PA 3BKFA 2K9IA 3BKTA 2WVCA 2CA9A 3GXQA 1B28A 4FXEA 2K6LA 1IRQA 2BJ1A 2JXGA 2WVEA 2BJ8A 4HV0A 2RBFA 2K5JA 1EA4A 2BNWA 2KELA 1MYLA 2WVFA 4D8JA 2BNZA 1Q5VA 2F1FA 2Y3YA 2WVDA 1NLAA 2HZAA 3OD2A 1MYKA 3LGHA 3VEBA 2BA3A 1BAZA 2BJ7A 3QOQA 2CPGA 2CAXA 3BKUA 2BJ9A 2K1OA 3PHTA 1MNTA 2K29A
chains in the Genus database with same CATH superfamily
2DY1A 2PMZD 4YOEA 1U6BA 2W9CA 3RB3A 2CZ4A 3R3TA 1S57A 1CC8A 4CRJA 1SH3A 5LJ5Y 2XBPA 1WSVA 1SQGA 4OYWA 1RWUA 2AW0A 3MEDA 4NZ6A 1BQXA 2W4PA 1E6YA 3ZNJ1 3ZZRA 2LQBA 3CGIA 3K59A 1Q78A 3QPIA 1DQ8A 2CQHA 2JFDA 3C15A 3SYZA 1RT7B 2KFZA 4A48A 1ULRA 4HH0A 1GXTA 2HZCA 4P2FA 4LFCF 1LNQA 2RVJA 4L6V3 5LMNJ 1D8YA 4N8NA 4LIWA 1QVGR 4CH0S 3O8WA 4UUWA 1DTQA 4NLWA 3UCGA 3ZZZA 5D77A 2XMJA 3KLHA 1HPZA 5KTQA 3VWSA 4PQAA 2X51A 3HJVA 1ZTWA 1NAQA 2Y8WA 2GIFA 3BEGB 3H0PA 3RBEA 2G1DA 2BZ2A 1TL4A 4OIXA 2C2NA 3ZTSA 5KT4A 4KT0C 4EWTA 4DSKA 2WBRA 1VGYA 1W26A 4J7CA 4OYMA 2GVZB 2KKHA 4NE9C 2BQUA 3HXMA 3E2EA 1RYSA 2B7BB 5AXMA 2DPJA 1X4AA 3EGWB 4B9SA 3R1LA 5ETVA 5A0YB 4J9MA 1BLUA 3QRPA 3BF4A 3KMSA 3V4IB 4JYAJ 3W60A 2ASJA 4B3OA 1IWGA 3RBZA 4ZPVR 4D3HA 4LF9F 2IY5B 2ZH5A 1U1RA 1YWXA 1NDLA 2OKQA 3I56S 4WXOA 4ZPAA 1TTHB 1JLGA 2FLOA 3NGSA 2DRBA 3EPGA 2J7UA 2U1AA 4LR7A 4QWEA 3NO7A 1CJKB 2C42A 5E33A 4CH7A 1R6VA 5AT1B 4LVOP 2ZJRQ 5EWFA 2XLIA 1L5UA 1FK9B 4LR8A 4MYUA 1FRLA 5LXYA 3Q23A 1BDTA 2B9XA 5I42A 2CQIA 4KPCA 2Y0SD 1APSA 1TL1A 1S4EA 2ZKTA 3BH6B 4Q44A 3B78A 2AJ1A 3AAWB 5C5JA 1MU2B 1X8DA 5EHHA 1S1TA 4LSNB 2FZGB 4QWCA 4DJBA 2QV6A 4KKOA 1CJVB 1Q8BA 1R6YA 4BS2A 3CD6S 4FDFA 1ZTTA 3NCPA 1S1UA 2KHCA 2Y9HA 1RT6A 2FIUA 3DLEA 3JTOA 4QR0A 4MIWA 1UMJA 2BVZA 1N5YB 4G1QA 1U1NA 2HFNA 4V19X 1WC5A 2HIYA 1UCNA 3HVWA 1FX2A 5I4MA 3ET6A 1FNMA 2HK2A 1S6OA 2LCWA 2ROEA 2PI4A 1YRTA 3QLHB 5HP1B 1OG7A 4B9UA 4IQMA 1CBKA 2B56A 2RF2A 4M5LA 1QAIA 4K4YA 2EI5A 2ZNYA 2ZZTA 4GO7X 4IFVB 4B08A 2E9TA 2FJDB 2XMAA 3F73A 4BWJA 5ADZA 3D1QA 1NK6A 2RQCA 3WX8A 2RF2B 2IVMA 1JLAB 3IGVA 2OGUA 5ETQA 2MQQA 2UP1A 5DG9A 1NJZA 2XO6A 5KAKA 3OL7A 3FK4A 1EZZB 3LJPA 1U9PA 1G3OA 2HWIA 1LWXA 4I7FA 2DVIA 3D2WA 1UVJA 2UV8G 4RJVA 1M5VC 2V63A 3DM2A 2EW9A 1CS4A 2YKPA 1BMQB 2BNZA 1Y3KA 2BKOA 5GMKa 1U1QA 1NNDA 3IAM9 4RLEA 4MJWA 3QOQA 1P6TA 2EWHA 2V4JB 2MMYA 3PYEA 1T11A 2ZH4A 4NLVA 1QAJA 1RCOB 3TVZA 1RT3B 2FHMA 2VBWA 3MZIA 3R6GB 5F8MA 3M9OB 3MECB 4PXDA 4U67Q 2ZJPQ 2NS1B 3R2DJ 2QLFB 3CSKA 1JMTA 1VQSA 2R4FA 3GFZA 4Y0FA 2MKKA 4QIEA 3NNEA 2YNFB 3B4DA 4AL6A 3AJDA 1HR0F 4QU6A 4DR4J 1CJUB 5T41A 1JJ4A 4QR1A 4LFCJ 3BGFA 3EYZA 3LANA 3VALA 1G6BA 4OV6A 3E01B 2F4VF 1HPZB 4MK7A 4KE5A 4LJMA 1VIOA 3U1LA 2H1YA 2AT1B 3C14B 3C8YA 4LRVA 3KLGB 3DFEA 1SJ1A 4M5IA 5F8NA 3HT0A 3FRYA 3NNAA 2UVUA 1SV5A 3J81U 4TU8A 4WFAQ 2RH3A 1RT6B 1Z2LA 4P75A 2EG2A 2MGZA 3QO9A 2IAJA 1M5PC 3BSAA 5A0YA 3T6BA 3KWMA 2HFOA 5K5MA 5EX3A 5EX0A 1OYEA 2AF6A 2DTJA 2I38A 3CJ4A 1Y5NB 4USUA 4CT8A 4ZHRA 2JBVA 2ASYA 2B4OA 2HK3A 3CMQA 4B9VA 1BC6A 5BXIA 1S49A 2YPYA 2BANB 3KHHA 3GV7B 3CJ2A 3KG4A 4U96A 2D41A 1I94J 2JOQA 5HBMB 4LMZA 2J7KA 2YH0A 4QR2A 4MAKA 1FRIA 2M8HA 3G6YA 1XNRJ 1VBZA 4B02A 3SDEA 2Y1JA 1RABB 2YKMB 1GMUA 1JLFB 3NGUA 2HBYB 5CAAA 4OHYA 2ZFHA 3W2VA 3PX0A 4KH0B 4YHHJ 4Q45A 3RAQA 1JLGB 4O44A 1H3DA 3M9NB 3RB0A 1LKZA 2XGPA 2ZD1B 1LWEB 2KXHA 3M6VA 3LWMA 3QJLA 2XS2A 1SI9A 1LXNA 3NOCA 4IRDA 2WONA 4U7UK 2GHWA 3GMGA 4TYAA 4C6AA 1BQMA 3FEXB 3KFWX 4FKYA 4LF5J 2G4BA 4QW8A 4ZCIA 3X1LB 2VQFJ 1XNQJ 3ELHA 3DU5A 1K73T 1NDKA 2F65A 3CJQA 2E5LF 3HO1A 3ILOA 3NMAA 4FPIA 3AXMA 4CLSA 2XY6A 4LF8F 4PQUB 1YRUA 3U27A 1A9NB 2QLJB 1FXRA 5JUMA 3ENWA 1WG1A 2A1BA 1C4CA 2LU2A 3R7SB 4ECZA 1X4EA 2VFRA 3H7HB 4UY8T 3IBCB 1RHMB 2EG1A 5LMNF 3KUGA 3DXBA 4OQJA 4OJHA 2FJEB 3DLJA 2X1AA 1WTBA 1U25A 4LSLA 2HHQA 4MJKA 1U1PA 2XWXA 3EJMA 3THVA 2XYHB 1HA1A 4WP3A 2YNGB 1VRTB 3P3DA 2UXDF 4NXMJ 4MFBA 4FP9A 1XWLA 4Y2MA 3S01A 1F5CA 4U95A 5C25B 3P6YC 2C3YA 4S0MA 1MMDA 2LLZA 4LF7F 5HVFA 4M5NA 3IGNA 2YQ1A 1HLWA 3DC2A 4DF8A 5KT5A 1Y3JA 1IBLJ 4A8FA 4F4ZA 1IKYB 2RMLA 4CM0A 4GVLA 1HNWJ 3MTJA 4NYPA 3G82B 4J9UE 3PW4A 3T3FA 3QT7A 3HSZA 5KFEA 3OPKA 3P5BP 5AE3A 3T5JA 2AZ1A 5A6PA 4DR7F 4PWDA 1RU1A 4OZJA 3J81Y 4JI1F 5CZVA 4V19J 1M90T 1VISA 1C0UB 1GTEA 3EWGA 3QO9B 1KVIA 4ES2A 4K4SA 2ZKUA 5B0BA 3M8WA 2BE2A 3OFHA 4OZNA 1PG5B 3UD5A 2UVWA 3C6UB 3M7VA 3KHLA 4YR3A 4ID5B 4CI0B 4ALZA 3MM7B 3CJSA 2MSSA 2CG8A 4IYQA 3NWRA 2IVFB 3TX8A 4J9NA 4DV1F 1J5OB 4NMXA 5C24A 3HM9A 2Z56B 3GE9A 1CSJA 2GMJA 4IDKA 2DGUA 4NLPA 1UFKA 4AQYJ 4IH5A 2E5HA 2OPPA 5E3RA 1FRHA 5B0AA 4QBUA 2E66A 3TUZC 2VBXA 4HL9A 1LWCA 1WHYA 2IVYA 3MUVP 2YQ3A 5M2UA 2CJYB 1LWFA 4A4JA 3H59A 2HRYA 2G0IA 3GSDA 1HNIA 3BBFA 1S72S 3WX4A 2FGCA 3DNCA 1OO0B 2NXJA 3VCDA 1NXIA 2OMLA 5DJBA 1NEEA 4MKBA 4TLQA 4Y00A 1T9YA 5HMZA 4O3RA 2OIHA 2RJZA 2HFSA 1CC7A 3CDEA 5KFOA 4HHHA 2CQ4A 1HW8A 2YXLA 2J9CA 4CO3A 3M2VA 4LQ3A 1SKWA 4DQIA 1PYTA 5FIIA 4CLFA 3NCRA 3PVXA 4USHA 1UW4A 4BLGA 2DPIA 3RRKA 3LGMA 3RAMA 2RS8A 5C24B 1JNZB 2GQ2A 3OSPA 2BQ3A 2H54B 4AFFA 2LQJA 1RK8A 1OYDA 2XWYA 2VC1A 2PFDA 4P2MA 3CC7S 2MZTA 2QSWA 5D3GB 1XNRF 2R7WA 2F4FA 4X62J 4RUCA 4NCAA 1IVZA 3QATA 1RTJB 2BNWA 5GAHU 4HYKA 4D8JA 1VRUB 2LQ5A 3W64A 2P5VA 4IRKA 5HI7A 1FO1A 2KN4A 3D1OA 4GKKJ 1RISA 3M8YA 3TAMA 1ZOTA 2JRSA 1HBNB 3N79A 1KDNA 2G2YA 5LMUJ 3WIUA 2I5JB 5ETOA 2B43A 1ZBTA 1R0AA 4KGMA 2ZDOA 2R2SA 5D0RA 1SQFA 2OMOA 3MM5A 2WAQD 3DRXA 1KOHA 2CQPA 1GMVA 5DZ7A 2ATLA 2JNJA 5GMEA 2CPYA 4I7FB 2R7OA 3CDUA 1T03A 1Q79A 2J0WA 4WE1B 3UR3C 1U1KA 2WOMB 5J2NA 2GZOA 2C3OA 6FD1A 4TU7A 4DR5F 4I68A 4WFZA 1K1QA 4R8UA 4WZQA 1B0PA 1KQSR 4TU9A 2XMVA 4AD6A 1Q82T 3BKFA 3D1HA 3H2UB 2MEWA 3R9LA 4OYAA 1SB6A 1S1XB 2QYCA 3BR8A 3IR6B 4J9LA 2OO4A 4ECRA 1F5BA 2HURA 3H2LA 2L08A 1N6QB 2RSQA 5CYMB 4JI4J 3EDRB 3ZZ0A 4I2QA 3FSIA 4OX7A 5LSLA 3PX4A 2IJFA 1SJ3P 2UXBF 1RAGB 4TY9A 1H7WA 3K2YA 1KWMA 3I32A 3O2IA 4CIOA 2FLPA 1IKVB 4WWSA 2V4JA 3SSSA 4M5HA 4PYDA 2GS8A 2BJEA 4QOTA 5IOLA 1W7WA 1QSSA 1IKVA 3K5PA 5J2QA 4TYBA 1HYSB 2WHOA 2R7XA 1VI7A 4Y2KA 1T05B 1MU2A 1ZS6A 2WVCA 2HNDB 3CT9A 1OY8A 3D6FB 4C11B 1UW9A 1TZ0A 1U1LA 5LOQA 3FNNA 1YBTA 3QIPA 4P71A 4RPFA 1LW2B 1K9MT 3M8PA 3BKUA 4RO0A 2BYCA 2W2MP 1JLBB 1D9AA 1X4GA 3GZ7A 1D1UA 2V6AA 5E3CA 1FHTA 2BDPA 2ZZNA 1FE0A 2E1AA 1KHVA 2KYXA 1U2CA 3KG1A 2CQ3A 1NCLA 2MZQA 4KGZB 3CXCR 1SC6A 1FJGJ 1UJ5A 1RT4B 2N3OA 2X3DA 3UDLA 2JVOA 1FI4A 1O8BA 2VPXB 4L75A 3FVYA 1EX8A 1QJHA 3N01A 1WORA 2QLXA 3I87A 4IH6A 3TZZA 3HPOA 2AGQA 2ZUAA 2C2OB 2KM8C 3OT9A 2ZH9A 2Y8YA 3MEDB 2VG7B 3BS9A 3MMBA 4N7TA 3ILJA 5B7WA 3CD0A 1AFJA 4OYIA 2E7VA 4N8OA 1B28A 1D09B 4C8OA 3W5XA 2DNKA 4QQBA 2HHUA 3FCVA 1GAOA 2QA2A 3DRSA 1X0PA 4CO2A 1V6HA 3RBDA 2V9WA 2ZUGA 4IG3A 4KQZA 2J5AA 2W8LA 1FERA 1X4CA 2QJ3A 5DG7A 2XGQA 1F2GA 2IA6A 3WZ0A 3IXQA 1T9WA 2OPQB 3PTWA 2XQCA 1QTMA 5CCLA 4K59A 4DV4F 2EPIA 3CJ5A 2LMIA 4MIBA 5D4OA 4UZBA 1RGVA 3KG0A 5E3QA 4DR2F 3CJ8A 2OEJA 3KUHA 4H4MB 3IR7B 3GYXB 5HVGA 2LXUA 4Q5VA 5HP1A 3JQMA 2KT2A 4NLOA 2PMWA 5KFNA 3UQSA 3DKDA 1C1CA 2DO4A 1RTHB 3EXYA 4NI2B 4NCBA 1KVJA 2K2PA 3KMQA 2HGLA 2XEXA 3GILA 3MR3A 2MKHA 5F8GA 3VAKA 2HPUA 2JX2A 3G2XA 4LF9J 2C2MB 3PG9A 4OYBA 1CJVA 4LF1A 1TFYA 1FJCA 2PMHA 1UWAA 2CJ9A 1DY3A 4YB6A 2W9CB 2HBRB 2ZHOA 3TO8A 1VC6A 2R7TA 2AJ2A 3KXDA 4OYPA 4F0MA 3TA0A 3O1LA 2CUYA 2BJ7A 5KT3A 3QT5A 2UXBJ 2UVRA 3R5CA 2ZDPA 4ILLA 1TUWA 1RA7A 3BB5A 3Q8UA 2WTFA 2RRBA 4YP3A 1F3VA 3M8PB 2R8IA 4DCOB 1PILA 3MPWA 4I4BA 4CLPA 5HJYA 5HL7Q 2IHR1 4KHMA 3H4BA 5C2GA 5CD4A 1VS3A 2VU5A 2C2KB 2PI5A 3HULA 1V5IB 4KO0A 1PCAA 4B3TJ 3IWNC 5KFWA 1MN9A 1FXLA 3KK2B 3VGTA 4CNZA 3DGPA 2DEJA 1BUXA 2V4RA 4DFMA 4NLSA 5DM6Q 3NP5A 2BJ8A 2G1HA 2Q6BA 1M5HA 3PHEA 5KG3A 4LF2A 5E3PA 4C3MA 1RADB 4CTAA 2BQRA 4RWXA 3Q2TC 3TOQA 4RUBA 5KOWA 3M6XA 1S1VA 3SCJE 4M8LA 4YHHF 2MKSA 3FQLA 2J0SD 4Q7AA 4DR5J 5DO2A 4ZIWA 3OTOF 5B0CA 5KFMA 5HO4A 2VQEJ 3GJTB 5GMDA 2VICA 3KDNA 2ZWPA 1N6QA 4WPAA 3HZEA 3MEEA 2WRMA 3L95X 2ASLA 1IJFB 4ILRA 4KV8B 2RAQA 5E3AA 5AE2A 2VC0A 4GC7A 2HHWA 2ROPA 3RB6A 2DNYA 4ME7E 3O6QA 2K1RA 5IQQA 4ETXA 1X5TA 3GR1A 3Q8PB 2CDRB 3IRXA 2MY7A 3LUYA 3NLCA 4NEYA 3J81j 1XJWB 1YJ7A 3G4SS 1QSYA 1NMEB 2COLA 3D6TB 4GKJF 4U9RA 2DHXA 2W7AA 1XMQF 2H3AA 2K1RB 4QYRA 3J7YU 5KT7A 3IWLA 1RT2B 2MY8A 4CO5A 3CTRA 1HWLA 3GPAA 1BAZA 1S10A 2DGOA 4F36A 4RW9A 1B99A 5E5NA 5GADI 2XHWA 2DEIA 1UFWA 4ZVHA 1HHSA 2HBQB 2IFXA 5KFUA 2KG0A 2L41A 5A2QY 2YVSA 3CCVS 2AD9A 2B5JA 2GGPA 3RW6A 2BM0A 1D0EA 2NYHA 4ZS6A 2ADBA 3F44A 3I0RB 2C3PA 3PJ9A 4I0WA 1G1XA 2WONB 3PX6A 2GJIA 4JI8F 2OFHX 3UVJB 3EPIA 1FTCA 1DLOB 1V3SA 2PC6A 4LIRA 5BJRA 5L46A 3R5DA 4NMLA 4H4KA 4EZ9A 4EZ6A 1AROP 4WFYA 1T7PA 4LBPA 1HMVB 4KR0B 5DQGA 4JI3F 4ANEA 4DR6F 2FHKA 2E7XA 2VH7A 2UUTA 1ROFA 4KGKA 2N82B 5AJ3J 3D4JA 1FTRA 2HMIA 2CXEA 2C2ZB 3PDNA 5KFBA 4ECTA 4NEZA 1T02A 2MQ8A 2XY5A 3GFHA 4B3TF 2CADA 1TKTA 1RWVB 2B9YA 3GIJA 2KYZA 1SUQB 1YI2S 1F1BB 1P9YA 2VKZG 4N56A 1NK8A 4OJGA 4C2MA 2F8EX 2HFUA 1P27B 1JXVA 3Q86A 3MDFA 2J0QD 2VOPA 4USMA 3BN7A 3QAUA 2BSQE 4MK8A 4KHPJ 1WEZA 2MJUA 6AT1B 2D3ZA 1FFGB 3WDOA 1RKJA 2HBZB 1KOOA 3PYDA 3TR5A 2DB1A 3OFFA 5BYSA 1CJTA 2OELA 2MKJA 5LXRA 3ISND 2RDDA 3L3CA 1FJ7A 1GH8A 4HI2A 4B3RF 4DEZA 4ZDNA 1FD8A 3HFKA 1KP6A 1UWBB 3DDNA 1HFEL 1NJYA 5C25A 1J5EF 2QG9B 2IM2A 1O5JA 3C14A 3J7ZT 3MFIA 3SDEB 1WEXA 4MKAA 3EX7B 3AB2B 1S6QA 1Q86T 3FT7A 1P1TA 2VA3A 3PO5A 2MB0B 3C6UA 3HD2A 3R5BA 3R1HA 3DMJB 3BJYA 3RW7A 4FS1A 3UR0A 5L39A 3QQCD 3UNYA 3AOCA 3R6LB 5CA5A 2AGPA 4P7VA 4NLXA 3I4HX 5KFAA 4FXDA 3NAIA 1S9EA 5A8RB 2WCXA 4F0KA 4B9MA 2P8IA 3HHKA 3OHBA 3CULA 1KQGB 4FF3A 2NZ4A 2CQ1A 4OLPA 4WFNQ 2PE8A 1PYOB 3MUMP 2DR7A 3TEHB 1MMNA 1RYRA 3T19A 4JB8B 4LF8J 8AT1B 4OZ0A 1S1VB 2R7QA 4PZVA 3NNHA 1M5SA 4IO9Q 1MW7A 2HAIA 4KFBB 2WBMA 2MGZB 2HHTA 3ICLA 2QLWA 4DXLA 3OSNA 3HHEA 1RHJB 1TKTB 1VC0A 1S1WB 2FJWA 2XYPB 3M8QB 4KH1B 1JLEA 2H48B 1MYKA 3NRBA 3K0JA 1VQ8S 2HHPA 4K4TA 2CNKB 2LQ8A 2K1OA 3KLEB 1WJ9A 4H4OA 1ZAVA 4IKAA 2QFIA 3Q8QB 1M5OC 4ICLA 2H1OE 3G8TA 2ZE2B 5EN1A 1N48A 4C3KA 3E01A 1RHRB 1RWKB 8RUCA 5KFCA 2KG1A 2XO7A 2J8SA 4EO6A 4A8YA 3IRWP 3GJSB 1QTGA 2CAJA 4IFVA 5HROB 3V6DB 1RWMB 2CPDA 3FBEA 3LP1B 5J2MB 3BREA 4DV6F 4YY3F 5IS2A 3GIRA 4E98A 1CQMA 1FDNA 2J9DA 2BANA 4WTYA 4ED0A 2ZOGA 3D7SB 2B4UA 2M7SA 1ZPWX 4O3QA 1XMOF 1N34J 4DWIA 2W9AA 4UOFA 1TVRB 1VJWA 2GQCA 2LA6A 2Q3PA 2Z2ZA 3TUIC 1NKEA 1IBMJ 3BN4A 3OJUA 1FWKA 3FGVA 1CS4B 2GJFA 4FNHA 1V5VA 3BGRB 3ZTQA 2ILYA 2GQQA 3UNGC 4TQSA 2XZWA 3GYGA 4NASA 3SCLE 5D8HB 1PC5A 5DDPC 2QC3A 2XSFA 1C1CB 1XR6A 4C8KA 2XCPA 1V3ZA 3MMAB 3UDVA 4I2QB 2KFYA 4YB7A 2ZH6A 3RRHA 1H0HB 2HAFA 4OZ5A 2NQPA 2Z58B 3L7PA 1RDRA 3BO4A 2A6OA 5GAHI 1EP4B 4H4MA 2APOA 3N4WA 1HQEA 2ZBPA 3MCSA 4I2PA 2CQDA 2LYVA 2EFQA 2LEPA 4XPEA 3CCRS 3GSIA 1NJXA 4DV6J 4X64F 3FSXA 4C9DA 3H5XA 3SV4A 2RHQB 4KV8A 1UVLA 2HVDA 4UTGA 1Q81T 3IS9A 1ITPA 1NK5A 5FJ4A 3FDSA 1S7IA 2JXGA 2ZC4A 1F2HA 5L1KA 2C2RA 1EA4A 2V2QA 3BBCA 1BD6A 1Q8KA 1VIXA 3M9MB 4Q43A 2HNZA 4IOAQ 2QSFA 1RT3A 2X3GA 2POKA 3AOBA 4ECXA 3Q8VA 2AWZA 4ZHRB 2YH1A 5T7LB 1EJ7L 4O4RA 3CJTA 3OUYA 2IBKA 2F8HA 2F4VJ 4KJIA 3BGOP 4DPUA 3Q22A 1SKRA 2V67A 1G7CB 3NAHA 2AJFE 2FLNA 2CQCA 3MGJA 4TQRA 3JSMB 4DR3F 5DLFA 2F40A 2F7VA 4WBFA 3MPVA 1U49A 3R5GA 2DRDA 3BQ2A 1LFPA 3DGPB 4DZDA 3NGTA 2HW3A 3A8JA 1UTAA 3AB4B 3CCMS 5D6GA 3CWJA 1R3NA 2KT3A 2WSFC 2XI3A 4UOCA 4ECSA 2XMTA 3U1NA 1SJ4P 4LF6J 5HLFA 7FD1A 1VRQC 3GXQA 2HS3A 2IM3A 5HATA 2LDYA 4AL5A 1XR5A 1H2UX 4JI2J 4DQRA 1L3SA 3VZHA 4I1TA 4J9PA 2XS5A 4O4GB 3DYAB 3GG1A 4B3RJ 4ICLB 2XMMA 2HZAA 1GMWD 2L48A 2DGQA 4J37A 3DRPB 1R31A 1RWPB 4ZVOB 4C8NA 2VIHA 2OSRA 2L9NA 3GTYX 4I6AA 3T1AA 5IXUA 1SH0A 1EKRA 1KD1T 3QAEA 4ECUA 1HNZF 4N5SA 4I67A 2B6AB 4YDXA 1MWQA 3BPSP 3MOJB 3CF5Q 2IYIA 5E2QA 1S9GB 3DLGB 3US5A 2V2VA 3TNVA 5D0EA 3HVTA 2HLUA 4PEOA 4DN0A 2H5EA 2HWHA 4RW4A 3TUJC 4LFBJ 1UAWA 1FRMA 2W2OP 3W9HA 1QE1B 3H20A 4F2RA 4G3IA 3AFGA 1MN7A 2VDHA 3D68A 2BW2A 4ZVTB 3HSGA 2QL7B 3PM9A 2P9GA 5A8RA 4A46A 3LP1A 5J2MA 1FNXH 3L7UA 3ZZTA 4ZJQA 1UA1A 3OL9A 3V6KA 4HDGA 5AXKA 5I42B 1KQFB 3Q8SB 4QPXA 5F3TA 4DL6A 3RAXA 2UUCF 3PRDA 3IP0A 4RUHA 2DR9A 3FRZA 2M52A 2W2PP 2DNGA 4JV5J 3JTNA 1RLDA 1LOUA 3E51A 4WE1A 2VKRA 2EFOA 2K7KA 3ET6B 2YKOA 5ITHA 1UZDA 2YNHB 2DCLA 4ZVUB 1RT7A 4DLGA 4MIAA 2JEFA 3UN3A 2GHPA 4JI3J 3AD7C 2JL9A 1VBXA 3IN5A 2GO8A 3GU0A 3HDSA 1WG5A 1D3WA 2L9DA 3MM5B 4ZLJA 1JWWA 4NYZA 4KFBA 1H73A 2AKWB 3R7BB 3W8GA 1TV6A 3M8SA 1U48A 5FDLA 1KFDA 2K9IA 3BKTA 3DRYA 4ZVFA 3J80U 5F9LA 3N28A 2CPJA 4FYWB 3HVAA 3P5TL 4ZA1A 4IOBA 4M5GA 1RBLA 3DOLA 2CZVC 3SQGA 2DNHA 3WC0A 4URGA 2JC0A 4K0KJ 3GIMA 1PBUA 1TUVA 2GMHA 2YWHA 3D0GE 1HNIB 1SL0A 1QVFR 3QT8A 3SMZA 5G0RB 1XMQJ 1IWAA 4PKDB 2OD6A 2OPSB 3CCUS 5I3UB 1U1MA 3AXKA 4D3GA 1WKKA 1EP4A 3J7AN 3DDKA 3KK1B 2VJVA 2YNGA 3NWGA 4ID8A 3MAHA 4U7UD 4TXSA 1X9SA 3NL0A 2YBVA 3ZC4A 4JI4F 2D9OA 1WC3A 1NHVA 1Q5YA 3OVBA 2YKNA 1D9DA 2LEAA 4FF2A 3R27A 1RA6A 2FPHX 3FKBA 5THWA 3M6WA 4CM2A 3G6VA 1RHKB 3PJWA 5SUHA 5IC4B 2XLKA 2N3LA 3OXGA 3IWXA 4DMZA 4P6QA 3CCTA 2I5JA 1U0HB 3FMBA 1CG2A 5KG7A 4X4TA 4NCGA 4DFKA 1JB0C 1R8PA 2PA3A 3PW0A 5CHCB 4LF5F 1AW0A 3HFVA 1EIYB 2HHVA 4FBTA 2VV5A 2GVZA 4G6VB 4WP9A 2LECA 3RB4A 2UU9J 2R2TA 3NS6A 3PRVA 4V1Ak 2EFPA 5B09A 2QZ8A 1TK0A 4NRUA 1AT1B 4E8UA 2AU0A 2FJBB 3M2RA 4DX6A 4A8MP 3MR6A 1QUPA 1JQGA 1U09A 4LQ9A 2HEKA 4TNOA 3NEKA 4WFBQ 4DR1F 4PXEA 4O44B 3KNAA 1XMBA 3IBFB 5H9FK 2FHJD 4O3PA 1L3UA 1U2RA 3DLHA 1T9XA 5KFZA 3VAIA 3S6EA 4EUVA 1HIYA 1U8WA 4DR4F 3KKFA 1F9FA 2FY8A 2MZSA 2R7UA 2V34A 3GQCA 1YJVA 3D9BA 2XMWA 2R8HA 1RSCA 1JLEB 4ZN1A 3BDPA 1S76D 2YQ0A 3S7RA 3UVJA 5A76A 5H9FJ 1L3VA 2BE9B 3DRRA 4HHJA 2IMWP 1OY6A 2DNZA 2Z2LA 2FJVA 1M5KC 3OLBA 4ED1A 3OL8A 3RTVA 1F5AA 4USJC 1JLCB 3MD1A 4Y2IA 4JUZA 4KY3A 1X0FA 1QDUB 1X9WA 1RHUB 1Y10A 2JJ4D 3CDAA 4ZPBA 1FEEA 1X4HA 2GFFA 2MYFA 4MT1A 5IV3A 4FS2A 4F4XA 5K8OA 4ER8A 4XK8C 4RW7B 1T8EA 1IQTA 2NYIA 3G82A 3TEGA 1ARQA 3DGVA 4LFAF 1U7LA 5IM0A 3G87A 4OI2A 4R5PA 2HRUA 1ACMB 3N0VA 1VK3A 2IBOA 5KG6A 4DBQA 3DHWC 4DL7A 2ZBQA 5D3GA 3LH2S 2CRLA 1N4LA 1RP5A 4XDDA 1XERA 2UUWA 2MHNA 3DU6A 3GIKA 4CLYA 2OPPB 3LPEA 4YY3J 2YKAA 4OJ1A 3TZYA 4CLKA 5D78A 1TL5A 2DCUB 2GCFA 3JSYA 3NG8A 2BOAA 3EICA 4C3LA 3MM7A 3ZTPA 5JJBA 2EBGA 2YNIA 3SIPB 2IDLA 4RWWA 3MR2A 2P6SA 4CH1A 4DV0F 4RUAA 2OP5A 1KR4A 3S1TA 5IM0B 4FBUA 1RACB 2V5HG 3AD8C 2A10A 5ETKA 1SJQA 1YJNS 2PN6A 1J2VA 1FRJA 2YWKA 3QWUA 4B3MF 3AA8A 3KJFB 5DDOC 4JV1A 5FDLB 1AUSL 2EKYA 4FVCA 1L3TA 2DNPA 3CNQP 4M5JA 3CDBA 4PCQA 4ZITA 3MM6A 4ZVPB 3M30A 2FVSA 3DM2B 4CWBA 1NPRA 1GXLA 5D0GA 5K20B 1MSWD 4Y3CA 2FJXA 2VPYB 2EFGA 4USIA 2AYEA 4H4KC 1VRTA 2OUGA 3FCWA 4MK9A 3C46A 3LP0B 2R3VA 5LT5A 2UZAA 2KJWA 1FXDA 2PT0A 3TJ9A 4BCAA 2NSCA 2O67A 2DBBA 2HSEB 1SL2A 2DNNA 2PSZA 1TAQA 3TP2A 4NLYA 5HQ8A 3BDEA 1RAHB 3KHGA 4OL8A 5L9XA 5L8RC 1YIJS 2JZ5A 2FC8A 2Y1IA 1QD1A 3EMTA 3Q2SC 1WDDA 4ITSA 2E5JA 3QLHA 3UFCX 3BSOA 1IR1A 1IN0A 2J7WA 2MPUA 3H5SA 5B0DA 4EEYA 1HD1A 3UD3P 4TY8B 4M94A 1FKOB 1BGXT 3PFEA 4ZPDA 3A3NB 2EFVA 3DXSX 3NKYA 1C4AA 3OFEA 4DFPA 3ZZPA 2W9BA 1J27A 1OQ6A 4EU0A 2JLFA 4ZN3A 4Y34A 1X5PA 2UXCJ 2HHHJ 3M32A 3I0SA 1G2EA 1HBOA 3ISZA 5KFJA 2AEJA 2J6SA 3NMRA 4LBHA 2CAXA 5RUBA 4J9RA 1KKHA 3KK1A 3H40A 1N36J 3TANA 4C4WA 4C0BA 2M2BA 2Z2MA 3M1VB 4HI1A 3CO9A 3ETOA 4ELTA 1JLQB 3H87C 1NM2A 1SPBP 1VBKA 3BM7A 3MAAB 1YRXA 2CQGA 1VOMA 3CJ3A 3NXZA 1IBCB 1VQYA 2ZH1A 2GPEA 2IIHA 4CP5A 4DR1J 2AQ4A 1HQUB 1YJ9S 3ZTOA 3K7RA 1EKSA 4L76A 4DHVA 3JTPA 3UI3A 2HVZA 4ZP9A 2D3O1 3NNCA 4K50A 2XTJP 1RTDA 1FDDA 4DF4A 5F8IA 3NS5A 4KGXB 5M2RA 4JYAF 1A7GE 4UUXA 2P6TA 1KLMA 2W25A 3I5CA 1KTQA 1NUEA 2CNNB 1YITS 4B3OB 2AJQA 2KHDA 2JWNA 2K7JA 2MTLA 4NZ0A 3KHRA 4QZVB 3C6TB 4ILMA 4HVZA 1KQKA 4ANCA 2G2OA 2BA3A 2YNHA 1XC9A 2JHEA 3CE8A 2HNZB 1VCTA 2BACA 2KL8A 2B8QA 5LMUF 1KC8T 2W7PA 3AD9C 3W1YC 3H25A 4DSIA 1HNVB 3AY0A 4DU7A 1F9HA 5HAOA 1JLBA 2R42A 2W7OA 1SIZA 4ED4A 3HP6A 1NHKL 8ATCB 2VFSA 3L9ZA 4MH8A 3HHNB 2NXCA 1I1GA 2K8GA 4IFYA 3M05A 2P2CB 3VVUA 1U2FA 2MQLA 5LSRA 4A8KA 1RWWB 3CD5A 1R7IA 3OTOJ 2KZZA 1ZM3A 2J9DE 4K2JA 5CH7B 2P9EA 2XG8A 2E9RX 2AYBA 1T03B 3GG0A 2IM0A 2G2ZA 2VFTA 2F63A 3C15B 3MPDA 2IMOA 2AHOB 2QLBB 1HL6A 1FRKA 2X1BA 1CULA 1S1UB 2VG6B 4DUZF 4QWAA 3TAPA 3UD4P 3T5HA 1H2TZ 1S59A 5E0OA 4F02A 1SKUB 3QGGA 2QFJA 3GWCA 3ONQA 1A0OB 3QWPA 3DLKA 1WD6A 2DGWA 3UPFA 2GO9A 4NLDA 1YJWS 2BRLA 4ATNA 2KT5A 3FZBA 4F0HA 3BO2A 3QGHA 3MAAA 4IH7A 1Y4ZB 1YKWA 4HTJA 2GIRA 5JVHQ 3BR9A 3KLVA 2VHGA 2C3UA 1QUVA 1HKAA 2JSXA 4A8SA 4MKVA 5KFLA 3D67A 3PNIA 2V94A 2E9ZA 2HHHF 1Q7YT 1KFSA 3MXHP 3PR4A 2DJWA 4Q2MA 4J5OA 1RHQB 1VQ6S 1GK8A 3Q83A 2ZH8A 4DV1J 4X4VA 4Q8EA 2ACMA 4PABA 3OR1A 1HBMA 2FDNA 1C1BB 2CNLB 2MKYA 1M0SA 4DU8A 1RAIB 3QZ8A 5IT9U 1BE4A 1RBOB 2L3MA 2AEFA 1Z4UA 2OD4A 3HHLD 1BDVA 2XSJB 3TARA 2DNRA 2R7SA 4PRFA 2ZBRA 4F50A 4C48A 3HHDA 4HT7A 2DIVA 2OEKA 4NPOA 5HMYA 2BV3A 1EAYC 2HQCA 4F67A 4O0IA 3ZO7A 3VEAA 1RTJA 2FC9A 3N6MA 4DI6A 4XO0A 2V8VA 2IRXA 2RDIA 4GMKA 2RD5C 3VV2B 3D5MA 2LKZA 4PG6A 1GX6A 1LW2A 3W9JA 2HQ3A 2HIQA 4JI2F 1PC4A 3PRBA 2JEIA 1TKZB 2KOEA 2QO3A 2V4QA 5CXTA 5HLFB 2I1RA 3OL6A 4NX9A 4ZJLA 3W61A 1UL3A 4RNOA 3CPWR 3OW2R 4C11A 2IPOB 2DT9A 1S0NA 4JI5J 1SQEA 4U6PA 4GC6A 5KFRA 1RT1B 1VQNS 1N88A 3I0SB 2MXYA 4DV3J 1RLCL 4G1QB 1IKXA 4QJVA 5D4LA 1X7VA 4RNFA 1EQ0A 2V2KA 1TUGB 3SV3A 2RKIB 1YBUA 4NOHA 4UQTA 3AODA 4X66F 1LXJA 5DGBA 2VQFF 1XNQF 3F41A 1OWXA 1FEHA 3BGUA 4I69A 3H90A 1NB2A 2ZNZA 3FBFA 2JLEA 3IM9A 2W4CA 1DTTA 1XK8A 4AUKA 1I3OB 4ZVRB 1D9FA 3HKWA 2GNKA 1NKBA 4N41A 1SVDA 3N5BA 4P10A 2Q43A 1UVMA 2MKCA 3PZPA 1WHXA 4RW8B 3MCMA 3LA0A 3T9NA 2WVFA 3DHXA 5J1EB 3JAMU 3EUNA 5E41A 9ATCB 3KK3B 2Q66A 1OHNA 5KFIA 4PG5A 1WF2A 4DQSA 1I51B 5DG8A 2AIRB 1S6PB 1KVKA 4DL0C 1JNRB 1L3KA 1D8ZA 3T5KA 2ZEJA 1S12A 1X31C 1VQKS 4OX9J 3GFYA 1RAFB 1CQNA 1TL3A 1VFJA 4C7QA 1FJEB 3H5YA 2F3JA 2I0XA 3A12A 5IT0A 2XMKA 4EMDA 3M2VB 1FFSB 1H7XA 1B01A 3UCZP 5CQGA 4CYUA 2AN7A 2B4VA 1SJFA 1C0UA 2RT3A 1DHMA 3MM8A 2ZITA 2ASDA 2LU1A 1FKOA 2A3JA 2AMCB 4F3QA 2AX0A 2OSQA 1PIEA 4NLRA 1H6KX 5A8WB 2HQDA 3GONA 2DIUA 2N4CA 4HH1A 1PJ7A 2W8KA 1IUJA 3FCHA 3MR7A 4G1IA 1DZ5A 2V8GA 1R8CA 2CPFA 3CDWA 4OZLA 4ED8A 1VHIA 2WSCC 2MQNA 3DMJA 1PKUA 3LP2B 4DCJB 2XCAA 1T3NA 1WDTA 2KXFA 3C16A 1MG7A 4QW9A 2GAGC 2CVIA 1DAXA 2IA0A 4RW6A 5L38A 2VA2A 1Q53A 2IM1A 4KO0B 4P2XA 4R0EA 1S6PA 3AQPA 1S5ZA 2GA7A 1WI6A 3BYRA 5LSOA 4CLZA 3MEKA 2XNQA 1FCAA 5GAEI 5KFTA 1VQ9S 4PUOB 5KFVA 2BKNA 3B8HA 3IM8A 3OVSA 5H1SV 5G0RA 5A6WA 2V8PA 1SIWA 1T9TA 2XHCA 4K5SA 2RS2A 5H9EK 2DNMA 2EC2A 4YB1P 2FZCB 1GT8A 3T9ZA 3B54A 3Q24A 3MWBA 2XSJA 1WC1A 4L72B 4PR6A 1PJ5A 2EC0A 2Y1LB 2XS7A 1IKYA 4AQYF 1TAUA 2DHHA 4ED3A 1T9VA 1H74A 1SC4B 1RWOB 3QGIA 4OHXA 4NLUA 2VFVA 3KK2A 1S6QB 4QIWD 3T5LA 5L1IA 3IAS9 1Q0NA 3MMJA 1R0CB 4CO4A 5M2PA 4X4SA 5DGAA 1R89A 1QLNA 4O0NA 2NUHA 3FEZA 1FD2A 1S7HA 3GCWP 5LL6d 4LSZB 3NGDA 2KH9A 1VQ4S 3EDQB 4QYZK 3UN2A 3W66A 4USKA 1UJ4A 2WVEA 2EK6A 5KT2A 2DY9A 4BBYA 5KFFA 1VLOA 1TKXA 4J9SA 1V9OA 2BABA 4FYDA 3GYNA 4RW7A 3MECA 5DDRC 1N52B 1SJRA 2HGNA 3DOLB 3SQGB 5KG2A 3R5AA 4JI0F 4F25A 3W5YA 1O51A 4NCGB 4ZPCA 3E3XA 3CW2C 4R0JA 5IQ6A 3DLGA 2RNEA 3BH7B 5CYQB 3MD3A 2RRAA 2ALZA 1K8AT 4Z37A 2JXHA 1TMJA 2DGTA 1EARA 1HBMB 5HN0A 2I9SA 2CVEA 5C2CA 3N9UC 1F60B 1FVQA 1TL3B 1RT4A 4K4ZA 3MR5A 4LFBF 3MCNA 1JLFA 3DCAA 4OHWA 1B4SA 4IR1A 2NXEA 1EB0A 2BJ1A 4IFYB 5D0HA 4DV7F 1ZPVA 1TFWA 2AZ3A 2AX1A 3GIIA 4NRTA 1PYSB 4DV0J 2LFVA 1NLAA 4C0HA 1HBUA 1ZA1B 2NXNA 2E1MC 4B9TA 3ADAC 3AJ2A 3MEEB 2VPWB 3CEDA 3F0NA 4CZCA 4X4PA 1NJIT 1J5EJ 4JI0J 1YBAA 3HJFA 4DR7J 2XY7A 2RHSB 2CQ2A 4FXVA 3U02A 4EGLA 2UUBJ 1N0VC 4I6WA 3B4MA 1HYSA 4RBVA 3MM8B 2IRUA 2IAJB 1HARA 2Q79A 2NXUA 1O0PA 1S79A 1JKHA 3HK2A 1GTHA 3T6JA 2WVBA 3SFGA 3JSRA 3SXLA 1BHNA 4DS5A 4ZCLA 3LAMA 2NZCA 4XIUA 2QIFA 4F4WA 1SV5B 4ZCKA 1OIAA 2VG5B 4LRBA 1ZZNA 2H4YB 2HFVA 1G4CA 4J9OA 4FXEA 4DX5A 2A6MA 4DPWA 3DRPA 2K5JA 2CPEA 1T3OA 4KAIA 2N7YA 1DQAA 2CYYA 3I9V9 2FGOA 3ISNC 4NYOA 2WVDA 4UOHA 1YSJA 2KJVA 3FZ2A 3ZZYA 5EGYA 4GRSA 3PEJA 1N0UA 4J91A 3QIPB 1KS2A 1N5SA 1WHWA 4W4MA 4WK3A 2FVRA 3VTIA 3LF0A 4OYXA 1KBRA 1I6JA 2M3DA 3KNGA 2KVIA 3LOUA 4RW4B 1P9QC 1LK7A 3JAMY 1R8AA 3F56A 1NK4A 1HNXJ 3H4DA 3G5OA 3KUEA 4WTOB 1SBRA 1XBWA 3EGNA 3QBCA 3QRRA 2QMWA 4P73A 3MURP 2K06A 3HCXA 2XLJA 4WXWA 1CULB 2CNOB 2FVQA 1WC0A 4BHQA 3W62A 3W65A 2ZHAA 3OUYB 2DYAA 2A18A 5K9FA 2LXFA 3TI0A 1F3FA 2B9EA 1FA0A 3QYYA 3Q0AA 1VQOS 2H65B 3S8SA 3PKMA 4MMOA 3BQ1A 4ENOA 5H9EJ 4XTTA 2ZVSA 3W2WB 4F7VA 3WQPA 2VPZB 3CIZA 2EK1A 3MFHA 1H38A 4JV2A 3NBPB 1TKXB 1KSPA 3K8VA 1YZ6A 2D9PA 4MKYA 2E5GA 4JBCA 1N5VA 4KYZA 4CCHA 4GKJJ 3LTOA 1W25A 4DDFA 3CCES 1B64A 2KB2A 3TVYA 2UXCF 2IJNA 1N34F 3KJVB 3HHLC 3HT3A 1UVNA 4OX6A 3DRSB 3KJNB 1KRPA 1NSAA 4F3OA 2H5JB 1E6VB 4HEA9 2C2EA 4B9LA 3SCKE 3C6TA 3M8QA 4X62F 4KSEB 4C8LA 1N33F 2RBFA 2HNYA 2O66A 1WEYA 3T1YF 2DO0A 2F9JA 3B6BA 2QA1A 3IBWA 3I6PA 3OXLA 4LREA 1C1BA 1NHUA 4URQU 3IMQJ 5U47A 2W9BB 1XMOJ 2R2UA 1AFIA 2Y3YA 1NSKL 1LK5A 2H5IB 2AJ0A 4CQ1A 2FY1A 4F26A 2IRYA 5LM7E 1N8RT 4K4VA 1F9EB 1FVSA 4DR2J 4LRCA 1Y7PA 2A2DA 2HS4A 4PWWA 5BYRA 5EWGA 1VRUA 5T14A 5IT9Y 4DZ6A 4LF4F 1HWKA 1S9EB 2IYGA 3CJKA 3PJXA 3TZXA 2AP6A 3QGPA 1LWFB 2BW7A 4URSA 5D15A 4X65F 3OTDA 2CFXA 3EZOA 2I2YA 1GEHA 3W3SA 3JS9A 3BYPA 3OTBA 1Y9OA 3L7OA 4KB7A 4CO1A 2OPRA 5J2PA 3QFWA 2ZE2A 4DX8H 3ENQA 1Y0HA 4DV4J 4ZLLA 4IG3B 4NA3A 4P52A 3TZWA 1B70B 5F0UA 2FJAB 5KG4A 1HI0P 5L1LA 2Z57B 2EVZA 4BC7A 3PCOB 4Z7CA 3V81A 4X66J 3VGUA 3PW2A 2CJKA 5F3ZA 3KDOA 4IG0B 4QWBA 3N6NA 2UUCJ 2WW8A 2AGOA 3VEBA 1U1OA 3TWZA 1UJ6A 3H42A 3V6JA 1T0TV 3AH6A 3HHLB 3R97A 2X1FA 2J6TA 4TY8A 2MQPA 1RWXB 3TAMB 4LSNA 5BR8F 3ILLA 4JI1J 3L4BC 2FQQB 1Z2ZA 3CJRA 3M2UB 4F4AA 2UUAJ 2B9WA 2DD8S 3U1MA 2BEFA 1AB8A 2NLWA 3HSJA 3W7BA 2VBYA 1SUQA 3IS9B 4OX8A 4F4KA 1TL1B 4KTQA 3UDEA 4PXBA 2YKQA 1MLAA 2CZ9A 3OHAA 4ELUA 4TLRA 1UVKA 1K0VA 3OR2A 2DITA 4ZVSB 5HJXA 1HD0A 1EHWA 4LF7J 5BR8J 1IRQA 4FVMA 5B0FA 3QRQA 4X4RA 3KLFA 4Z7YA 2V68A 2YWGA 1T05A 5DRKA 1C0TB 4C8MA 4LUBA 1I5OB 4KC5A 7AT1B 4OZ2A 3GJRB 2BOPA 3FC9A 1RTDB 1E6YB 2EBEA 5F8JA 1UVIA 1PAUB 1RU2A 1TVRA 4LT6A 1RKIA 4M1KA 3TX0A 1RAOA 4Z2XA 2N4DA 1Z1ZA 5B0GA 3CCLS 4PQUA 1SXLA 1A6LA 2B0GA 5EUHA 3TRGA 3NY0A 4ED2A 1X60A 2CDQA 1DURA 2LP4A 3C66A 1FNOA 2CPHA 1Q16A 1IR2A 3A13A 2HRTA 1UPMB 3LALA 5IWAJ 3G71S 2E5LJ 1BQMB 1OPZA 2YWEA 4PPDA 3JXOA 3PIOQ 1S99A 4OYOA 3G6XA 4A8QA 3AOAA 4EYHB 1S9FA 3FQKA 4RU9A 2XC9A 3VAFA 4WFXA 4TVAB 1ZA2B 3EVOA 4LR9A 2K6LA 5HK4A 2VJUA 3BBBA 3R7NB 1OY9A 2O3DA 1NZ8A 1QTNB 1RT1A 2D7SA 4MFBB 5BYQA 4R8UB 1XQIA 2DHAA 4ED6A 5AXNA 2V50A 4YQWA 3DN9A 1URNA 1YK9A 1N54B 2GX8A 3DOMA 4Q0BB 3OLAA 2MZJA 3M32B 4I56A 2EKNA 3V4MA 4NXNJ 1NRKA 2CQ0A 2C1EB 1MMLA 3PW7A 1RUSA 2R8KA 1N33J 5I3UA 3M30B 2YWWA 2RE1A 2ZM6J 2VD3A 1RXOB 2E7WA 3E8OA 3VZIA 3HFZB 5K8PA 1WC4A 4LRFA 1NK9A 2QE5A 1HWJA 1P1LA 4DPOA 6FDRA 3J7YI 4J9QA 2HZVA 2NCKL 5A8WA 3OJSA 2CPIA 4DV5F 5IC6B 4OZ1A 3OTEA 1VLYA 3ZNUA 4GKKF 3SBMA 1MWYA 4P7TA 1FWLA 3CMAS 4AYBD 3PEHA 1NH7A 4MTPA 1JJHA 2AV5A 1F0XA 2DHGA 2ZD1A 1WKJA 1X5OA 3M4XA 5SZTA 1JJ2R 1AUDA 4ZP8A 1Q8LA 2MQOA 1UKUA 1PSDA 5A2QU 3KLGA 4U7CA 2GVDB 3W63A 3KLFB 4O23A 4ZVEA 3H98A 2K29A 3LP0A 1WNEA 2CQBA 3TA2A 3CCZA 4EYIB 4ED5A 4PWUA 1Y11A 3PY8A 2NUUG 2OTLS 2J9EA 4CLLA 1M1KT 4ID5A 4LBIA 3VQSA 3G9CA 3UWTA 4E2FB 4K4UA 3CIMA 2EXUA 2OAUA 3WIVA 2ZM6F 2KVQE 2PFFB 3M2RB 1WWHA 2BBEA 4DG1A 4YR0A 3O44A 2DGSA 4RBTA 4UQGA 4FF1A 1UA0A 4A8XA 1ZAXA 1ZETA 1TELA 2CG4A 3MF5A 2BKPA 3V6HA 3CB4A 2K3KA 3SFUA 2KO1A 2LA4A 3FFIA 3KJQB 3UW1A 4HLBA 2C22A 2MLYA 4AE5A 3RG6A 5HMWA 2E1RA 3AQOA 4ZP7A 3O5TB 3I31A 5AXLA 5JXSA 1RTIB 2G0JA 2QA4S 1S0MA 1B3TA 2RKIA 1HNXF 3CMES 5KFYA 1EQMA 2CPGA 3D28A 3ETMA 3IC1A 2JEGA 1S77D 2YNIB 3JSBA 2V0NA 5ETSA 5KFSA 2C3MA 3ILIA 2MLZA 3TVKA 3IO1A 2R9LA 2HVIA 2CPZA 3G6ES 3GP9A 3GV5B 1SKSA 3IRXB 3D6HB 1J5OA 3MM9B 3OR2B 2FHJA 4EBDA 4ZVGA 5ETLA 3FSYA 5F0WA 3ZZOA 5DLGA 3UO0A 1WG4A 5J1EA 3BV8A 2YNFA 2D74B 4M5MA 5MLCV 2VF3A 3A1YG 2YPZA 3I0RA 4YR2A 4ZLNA 3I55S 3ZZUA 1U02A 3QT6A 4USTA 3D3BJ 3D6MB 5ETPA 1YQHA 4DL3A 4XDCA 2DR6A 4PG7A 2VONA 4H54A 2PO4A 3CCWA 2UV8A 2O5DA 2V8DA 3R8YA 3HZGA 2GJ2A 3JSMA 3A4TA 3TA1A 2QTWA 1AA1B 1CPZA 3OTCA 1TU0B 1X5SA 4JI6F 4TN2A 4IG0A 4AAIA 3EZUA 5KOXA 3GB0A 4OI6A 1R27B 2YKNB 3LO3A 4HDHA 4WU3A 2IC3A 2FTRA 2XI2A 2UUAF 4YB5A 3R5JB 4K8RA 4ZVQB 5JVGQ 2LVWA 2F9DA 2W2NP 1WF0A 4OMFG 2I6WA 3VAHA 3RR7A 4B3MJ 3TQ1A 4FF4A 3PXGa 3MHYA 3IR7A 5AJ3F 2RU3A 1TKDA 4UF4A 3O3LA 1TKZA 4WYWA 3PYFA 3K5MA 3N5FA 2KM8B 2DRAA 4X4UA 4ETZA 4F2SA 1PJ6A 1YDLA 1UEUA 2CIMA 2RQ4A 3FMWA 2AJ4A 3GR0A 3I5AA 3NBPA 4K7QA 2XM3A 1UFLA 2CJBA 4X65J 1HWIA 1REGX 3MAQA 2ABYA 3A8IA 3WC2A 1NSQA 3H8YA 1O6XA 1RQ0A 5KG1A 2IC3B 1WTFA 1B7FA 3PO4A 4IRCA 1XEZA 1N32J 1NKCA 4PAAA 3RYLA 3K5OA 1PARA 4NL5A 1PAEX 1KEKA 2OTJS 2HS0A 3AJ1A 1CLFA 3V4IA 3L09A 2D69A 3OR1B 4CO0A 3QNWB 2MSTA 4NWBA 1LWEA 1LV5A 1VQ5S 4L73A 4DUZJ 1IKXB 4UZCA 1FDBA 1X4FA 3RBXA 4CNYA 1NLKL 2G0CA 4DSFA 1TK8A 3P49B 2LEBA 4GVBA 2OEMA 3AT1B 4ECVA 3KJVA 4WKRA 1AXQA 2F8MA 1NJWA 4WJBA 2WB1D 1HBUB 1URRA 5J2PB 4DV2F 2E5IA 3HF5A 1BXNA 1RAJA 3DDIA 4LFAJ 4B17A 1TL7B 4DX7A 3LGNA 5KFXA 2R8JA 2VUGA 3D0HE 1BQNB 3VGSA 1HNVA 1FF2A 1DTQB 3KLHB 1MROA 1RT5A 4AXIA 4ZCMA 3DLKB 3ENAA 5K8NA 1NK0A 1I94F 4G65A 1HBOB 2PEBA 4DR3J 3M6UA 4UW2A 4DLEA 4RR5A 4F4YA 1IBKJ 3HVTB 4C0OC 2DH9A 3RUBL 5J2QB 4IQXA 2D1CA 3HI9A 3BGRA 1PO6A 2D3UA 2FYXA 2NPIA 2M0GB 2Q1LA 3MMBB 1AYEA 1WACA 4KHRA 2RUGA 3VF0B 2QYGA 3WBZA 5KG0A 2HNYB 3VW4A 1KLMB 1WHVA 2MZRA 4ZIVA 3MI7X 4DOZA 1X93A 2W01A 3EVWA 4RKUC 1QSLA 4DSJA 2M70A 2Z2YB 2KTQA 3I4PA 1VQPS 5AE1A 4KPYA 5KT6A 4OV1A 1RT5B 3MCOA 2GMLA 3OQ2A 1XR7A 2O01C 1LFWA 4N47A 4FNIA 4DPTA 4ES3A 2KI2A 3H5UA 1WUUA 1B0TA 1P8GA 4WZMA 4M95A 2NR0A 2VFUA 4CLWA 1UZHA 3PHTA 3RGIA 3MM9A 4I6YA 3EGVA 3A8EA 2FUG9 1HI1A 2HKEA 2JXIA 1IM6A 1JK9B 1LEOA 3W2WA 3W5ZA 4YMEA 5KFQA 1RCXB 4GVBB 3SSQA 2KKEA 2ALYB 3KLEA 1VQMS 2Q2KA 1KHWA 2VG5A 2Z0GA 2ADLA 5IWAF 2Y0BB 4YFUA 1RTZA 2WB4A 2DNQA 2KU7A 3Q89A 1T95A 2PGCA 3DLEB 5K14B 5G4DA 3PYGA 3SI8A 1IBKF 3JB9k 4W90B 5IT4A 2UVVA 1VBYA 3KTQA 4NA2A 4OX9F 4C98A 2NREA 3EXCX 5T7LA 3VR1A 1U0SA 2JDJA 4KKOB 5HVHA 2KELA 1RAEB 3GCXP 2RQKA 4YN3B 2DXFA 1RZMA 3EM1A 2FD2A 4OI1A 4LVNP 2CKWA 2XMUA 5MAOA 3ULHA 3M8RA 2BA9A 1NPPA 3DOKA 1IBMF 2KXNB 3VHQA 4DUYJ 5FLXU 3OV7A 3BSCA 3DRRB 1S0OA 4ZLPA 4NLGA 4NXNF 4I64A 2MHEA 4DV5J 5LJ3Y 2W1BA 1LWCB 4G1PA 2HMIB 1W2IA 4O3OA 2XZDB 3DOMB 2EFNA 4OZ3A 2M88A 3I82A 2OJ3A 4ELVA 4ZP6A 1IM4A 2HNDA 1RBAA 1LW0A 1SCJB 1VDHA 5A8KB 5GADU 2QT7A 2P9CA 3MMAA 3SZ2A 1VC5A 2J76E 1UWBA 2AEMA 2VASA 3V5RA 3VGVA 2DH7A 4M5DA 1N5YA 4JV5F 2CWXA 3TW0A 3JYTA 3GV8B 4EI2A 2L9WA 1XTZA 3T1HJ 3CO0P 4QPTA 3TQEA 1R0AB 4P72A 1WSRA 2B4PA 1S0VA 4JI5F 1S6UA 4USVA 5DM7Q 5F41A 2B5JB 2GGPB 5I3QA 3FEYB 2ZH7A 1Q4RA 2HWTA 3P8BB 4BWMA 2JH3A 4ERDA 1GFWB 2QGFB 4C97A 5C42A 2H3EB 1HQUA 3QSIA 3PIPQ 1H2VZ 3GFXA 3AA9A 3BQ0A 3FBCA 2ROGA 2DHSA 3IFEA 2ZHBA 3RR8A 4WKYA 1FJGF 2DKOB 1MWZA 3NGKA 3M1VA 2LQ9A 4E0DA 3OXFA 1TQLA 2DGXA 1ZH5A 2WW4A 4PYAA 4IR9A 4HHUA 3A3PB 1QM9A 1HW9A 4UY85 4OHVA 3LPYA 1LQ9A 1WOPA 4W98A 4O3NA 2Z8QA 2XYGB 1DQ9A 1Q7LB 2PIIA 3D3CJ 3ENVA 1NBEB 2BMBA 1VR6A 3LP2A 2RQMA 4KBIA 4PXCA 1HNZJ 4RNHA 3UDCA 1CJTB 1OMSA 3NGRA 1NZAA 4ZK7M 3POTB 3J80Y 2QEXS 4KHPF 1R8HA 3CD7A 4L74A 1TR0A 3DI6B 2BX6A 3KLIB 2XNRA 2NPFA 5KG5A 1PBAA 2GAHC 2Y1RI 2JEJA 3HD1A 5EWEA 1H98A 3UN5A 4DL2A 2RUSA 3C19A 4HT5A 1JLCA 4NXMF 1SL1A 3MMCA 1FT8A 3HHLA 2GHVC 3KLIA 3OBIA 2XB2D 4RW9B 2LXIA 2E1CA 4PG8A 4JOUA 1UP1A 4CLTA 2WK4A 1ZM2A 2OHDA 4OI3A 3TJAA 1YJTA 1SC3B 1FESA 3PKYA 4J9VA 4P74A 2DR8A 5D4PA 2DXDA 2N7CA 4MYTA 4N76A 1FDAA 5DZ6A 5A8KA 2VODA 2JLGA 4DS4A 1V3RA 2DXEA 4RNMA 1W2BR 1NB7A 3PFOA 2J6UA 4H4OB 3DLLQ 4FN5A 2M8DB 2BJDA 4JI8J 1X4DA 2QX0A 1TMMA 2KFNA 4ZPWR 2MKIA 4R5PB 1M1GA 1YVFA 4DFJA 3PV8A 1QY7A 2DNOA 4EO8A 3DOKB 5ETNA 4DQQA 3K17A 4JP8A 3PACA 1QAYA 1RB0A 1YG0A 2GIQA 4FZVA 3TYTA 1NH8A 4ED7A 1Y5IB 2HQGA 3K58A 2UU9F 2BRKA 4M5KA 1BWEA 4WIIA 1RJJA 1SIWB 1U8SA 2KRRA 4F04B 5B08A 1REVA 1K0TA 1RAAB 2VBZA 5FLXY 2B6AA 4WCEQ 4CTAB 2RRNA 1IJEB 2CJQA 3QJJA 3TUPA 3HMJG 1FFWB 1C2PA 1RT2A 1N56A 1U24A 2A0FB 2PD1A 1RTHA 2PEHA 3G96A 3BO3A 4QIFA 4WK1A 2OH2A 4Q0BA 1WELA 2ZOFA 3KOAA 4W92B 4DPXA 2VZ9A 1NU4A 3U7JA 2DR5A 4BDPA 4DPYA 4RW6B 1HMVA 4ZKAA 7FDRA 3UCUP 2QN6B 1RI7A 3RRGA 1GMWA 1UETA 4PPZA 4X84A 3A3OB 4K2XA 5CABA 3KK3A 3CVKA 2BE2B 1IKWB 1JX4A 1ZM9A 2OPQA 2ACYA 5HQLA 3HKZD 5L9NA 2ZH3A 2VQEF 3W8PA 4F8RA 4UT4A 2CJXB 1T9UA 4DL5A 5C42B 5KFHA 2U2FA 1QE1A 4OYZA 2ZJQQ 4K5RA 3JQKA 4Y65A 4OJ3A 1VYAA 2W24A 3D54A 3AHPA 3MOZA 5JMNA 1YTYA 5KFGA 3EGZA 4C8YA 1N32F 1OS5A 4CDIA 4Q8FA 1FWPA 2J8AA 2BXJA 2ZH2A 2V69A 3POTA 4CYUB 5DQHA 4WF9Q 3CCSS 2R7RA 1OSDA 2X1GA 1HR0J 1HHTP 4M5DB 1E6VA 4EBEA 4YEAA 2V8HA 5F8HA 3OD2A 3RJMB 3VVTA 2A2BA 3QZ7A 2FB0A 4EFAC 5IZHA 4DV3F 1MNTA 2YKMA 1EETB 3I5BA 2GW8A 1K44A 2R2RA 4O4GA 3VAJA 1KTVA 2OPRB 5GVQA 4NZ7A 1YX2A 1XN9A 1ZM4A 5CD4H 1DLOA 2Z30B 1YLXA 2RU9A 4HACB 1UPPA 3CCQS 5DQIA 3Q8RB 3QMQA 4Y28C 3RZAA 2R8GA 3MEGB 1R43A 2JVRA 3M2UA 4L3NA 2C2DA 1U6ZA 5CYJA 3IG1A 2ZBIA 5GAEU 4QYZJ 1SH2A 1JIHA 4IOCQ 4X4OA 2J0XA 1TV6B 2VG7A 3FUYA 1FKPA 3OVAA 2FLLA 5DS7A 1KNZA 3JYTB 1HNWF 2YX1A 3IR5B 3K57A 1YHQS 4B3SF 3BSNA 3V81B 3QIDA 4CLUA 2E29A 2O1PA 4OLOA 2ZC3A 4FYXB 1KN6A 1S1TB 3W2VB 3LWLA 4RX6A 1LW0B 2VDIA 5CYMA 5HSPA 1SC1B 1MROB 3Q8YA 4FYVB 4EK2A 3PW5A 1JXLA 3J7A1 4OI0A 1VQLS 4QIGA 2XULA 3M8ZA 4LF6F 3BGLA 1DFDA 2WSEC 1JLQA 3LQVA 3MPUB 9RUBA 1N5TA 3EE3A 1WOSA 1P94A 3ZTRA 2EEYA 1VJQA 2BUNA 4FPRA 3RU0A 3UE2A 2AYGA 1CJKA 4AXJA 4A47A 4RZRA 2WOMA 3I96A 4GO5X 1Y00A 1ICEB 1S97A 2F1FA 4QCLA 1U45A 4DR6J 4ES1A 4DV7J 4AL7A 2HGMA 1IQZA 2F5GA 1JXEA 1M1HA 3CJ0A 4RL1A 1DJ0A 3LW5C 5K8MA 4QWDA 2ZBCA 1OJ4A 1T94A 2MJNA 1NDPA 1OQ3A 3D66A 2AY0A 2CJAA 2OI2A 4Y2AA 2ZVIA 3GLJA 3PR5B 3FBBA 3BZQA 3G8SA 4RBUA 4KGVB 2VOOA 3SEOA 1HBNA 4NI2A 4YUDA 4IUFA 3OFGA 1B0VA 4DSLA 3T1HF 3TAQA 4LRDA 2PA8D 3BPDA 4L3KA 2BE7D 4TKTA 1GX5A 3P45B 4DN9A 1VQ7S 3T41A 1HQ2A 3EVMA 1TL7A 3ITHA 5EDWA 2I8EA 3SSRA 1CJUA 2W4DA 4EBCA 3HLUA 1HQEB 4I2PB 1NDCA 1FK9A 4A8OA 2SXLA 3G8QA 2V9KA 2AYMA 4Y2CA 2VL1A 1EETA 2LDIA 1Q5VA 1XIQA 1OPIA 1B7YB 1HI8A 1N5QA 2QL5B 4K4XA 4ANDA 2FZKB 3FJ2A 2G13A 1IR0A 1VK8A 4DUYF 1S1WA 1S9GA 2YWFA 3NOGA 1WC6A 2HQFA 1RTIA 4C8ZA 1JKHB 4F3MA 2VG6A 2KDOA 1JJCB 2B7CB 2B51A 2HVEA 4YDDB 1K47A 4N77A 2YY3A 4NLQA 2FHOB 4WYLA 2ATCB 4LRAA 5E7OB 3IG1B 3FFIB 5ETRA 4DUTA 1IXKA 2XZTB 4B9NA 3FMTA 4JV0A 2HFZA 4HKQA 2HHXA 1FKAF 3WHIA 1ELOA 2IJRA 3DYAA 1UEVA 5CZXA 1JLAA 2E1PA 4DG1B 1BQNA 1HWUA 1VHFA 4NLTA 3J7Z5 3V6DA 5HROA 3CC4S 1NSPA 3G86A 3JQJA 2OLWA 3ITHB 2QMXA 4IO1A 4WU2A 1ZAWA 3SCIE 4IDKB 4BC9A 2DH8A 1WKLA 4X64J 2B3TB 1TP7A 5L1JA 1MNEA 3VQTA 5F9NA 2ERRA 1KLNA 2MLXA 2DK2A 5HMXA 3CC2S 4A8WA 2R7VA 3A8KA 3K5LA 2M4MA 2ZWOA 2BR0A 4M63A 4OFZA 1R0BG 3MPYA 5CYQA 1RE1B 2OFGX 4KRWA 3MMCB 1N36F 5KFPA 2H9ZA 4JI7J 1BY9A 2ZOMA 5GAGI 4HV0A 1U26A 2M5YA 1QAXA 4RU2A 3DI6A 3MEGA 4XPCA 1DRZA 2W2QP 1MYLA 1WI8A 3NS7B 3V2UC 4K4WA 4DV2J 4ECQA 2C28A 1IKWA 1ZYQA 1FX4A 2HQIA 3N6LA 4DL4A 1CEZA 5GAGU 1HHQA 4QIVA 1X4BA 2DGVA 1GQEA 1DBDA 2DISA 3ZXWA 3D0IE 1AZSB 4ZMMA 3HX9A 4B3SJ 1CVJA 4K0KF 1YJRA 5J2NB 1YJUA 2GVDA 3C3LA 1BWVA 4OHZA 1YGYA 3VAGA 2PDAA 2BM1A 3C16B 2YX4A 3MUTP 3K8WA 2ZZMA 1ZZFA 1U47A 3QJPA 1TK5A 4RW8A 4ZOSA 4X4QA 1NO8A 2KRBA 3IA0A 1FKPB 2GV1A 3P96A 5CCMA 2MDAA 2MZ1A 5F8LA 2HG4A 2CA9A 1Q16B 4NA1A 3KYLA 2UUBF 5B0EA 4ECYA 5DETA 3LAKA 2K3IA 1DTTB 2JFKA 4USWA 4PWDB 4U8VA 2CWKA 4WIQA 1Q95G 5DDQC 2CPXA 2H4WB 5ETMA 4UOGA 4J9KA 4DSEA 4J90A 1U6FA 3LGHA 4ECWA 2UXDJ 3B82A 4ZPTR 1S48A 1S1XA 4U8YA 4HACA 1YZ7A 2Z4PA 1Q8IA 1Y5LB 4HR2A 2HYIB 2WZ1A 1H72C 1WF1A 2Q6CA 1C0TA 3MTKA 1GNKA 3HVRA 4X2BA 1K1SA 2HHSA 1F6TA 1U4BA 3P4UB 5IFMA 3K89A 2HVHA 1AZSA 2ADCA 1NPKA 2G9OA 2HLTA 2MQMA 3HSDA 4Y6IA 3X3UA 3VAMA 3CCJS 3C2PA 3GJQB 4P9SA 4JI6J 1PGZA 2VB6A 5D4NA 2YX7A 3DLBA 3TJ8A 2OPSA 3MM6B 3QFHA 4R25A 1REVB 2DNLA 4CT9A 2QMUB 4XAKA 2E44A 3CUNA 4AT1B 2B8PA 3THPA 5J1NA 1WOOA 1S4FA 2V2ZA 2D3OR 4LF4J 4OI4A 4PG4A 1NK7A 2ILZA 2BJ9A 1U0HA 1VMBA 4HTIA 2RIJA 4FYYB 3SQOP 2M9KA 1IBLF 5C7PA 2X7IA 1R8BA 3QSYB 2QA4G 5K14A 1OSCA 3H2VE 2NSBA 4KIAA 3NCQA 4ZJOA 3W9IA 4PUOA 1FRXA 1ARRA 3T1YJ 3R2CJ 2YTCA 5ETTA 3EZ5A 2KZMA 2JC1A 2RILA 4YS2A 3K5NA 4DCPB 1Q1KA 1UEKA 1KONA 4O3SA 2BJ3A 2RDJA 5IV4A 4Q2LA 5KFDA 4JI7F 2A2CA 2QRRA 5HANA 5FD1A 1GXUA 2H51B 5KFKA 2QL9B 4LSLB 2RB7A 1DARA 2FVPA 5I3PA 4RNNA 4FKXA 5HQMA 3ZFVA 5HBMA 1FE4A 4QU7A 4DQPA 3I9ZA 4WP8A 4P2SA 4FXWA 3CJKB 2FVCA 2GC8A 2IDEA 3THTA 1X9MA 4X4NA 1RWNB 5J1PA
chains in the Genus database with same CATH topology
2AY0A 2CADA 1BDTA 3QSIA 3FT7A 1PARA 2H1OE 2JXIA 3H87C 1BDVA 1ARQA 2JXHA 2FGCA 1ARRA 2GPEA 1B01A 2BSQE 1Q5YA 1QTGA 2HZVA 2CAJA 3VW4A 2WVBA 2BJ3A 4ME7E 3FMTA 3VEAA 1X93A 1P94A 2NZCA 2PC6A 1U9PA 3BKFA 2K9IA 3BKTA 2WVCA 2CA9A 3GXQA 1B28A 4FXEA 2K6LA 1IRQA 2BJ1A 2JXGA 2WVEA 2BJ8A 4HV0A 2RBFA 2K5JA 1EA4A 2BNWA 2KELA 1MYLA 2WVFA 4D8JA 2BNZA 1Q5VA 2F1FA 2Y3YA 2WVDA 1NLAA 2HZAA 3OD2A 1MYKA 3LGHA 3VEBA 2BA3A 1BAZA 2BJ7A 3QOQA 2CPGA 2CAXA 3BKUA 2BJ9A 2K1OA 3PHTA 1MNTA 2K29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AY0 A;  2CAD A;  1BDT A;  3QSI A;  3FT7 A;  1PAR A;  2H1O E;  2JXI A;  3H87 C;  1BDV A;  1ARQ A;  2JXH A;  2FGC A;  1ARR A;  2GPE A;  1B01 A;  2BSQ E;  1Q5Y A;  1QTG A;  2HZV A;  2CAJ A;  3VW4 A;  2WVB A;  2BJ3 A;  4ME7 E;  3FMT A;  3VEA A;  1X93 A;  1P94 A;  2NZC A;  2PC6 A;  1U9P A;  3BKF A;  2K9I A;  3BKT A;  2WVC A;  2CA9 A;  3GXQ A;  1B28 A;  4FXE A;  2K6L A;  1IRQ A;  2BJ1 A;  2JXG A;  2WVE A;  2BJ8 A;  4HV0 A;  2RBF A;  2K5J A;  1EA4 A;  2BNW A;  2KEL A;  1MYL A;  2WVF A;  4D8J A;  2BNZ A;  1Q5V A;  2F1F A;  2Y3Y A;  2WVD A;  1NLA A;  2HZA A;  3OD2 A;  1MYK A;  3LGH A;  3VEB A;  2BA3 A;  1BAZ A;  2BJ7 A;  3QOQ A;  2CPG A;  2CAX A;  3BKU A;  2BJ9 A;  2K1O A;  3PHT A;  1MNT A;  2K29 A; 
#chains in the Genus database with same CATH topology
 2DY1 A;  2PMZ D;  4YOE A;  1U6B A;  2W9C A;  3RB3 A;  2CZ4 A;  3R3T A;  1S57 A;  1CC8 A;  4CRJ A;  1SH3 A;  5LJ5 Y;  2XBP A;  1WSV A;  1SQG A;  4OYW A;  1RWU A;  2AW0 A;  3MED A;  4NZ6 A;  1BQX A;  2W4P A;  1E6Y A;  3ZNJ 1;  3ZZR A;  2LQB A;  3CGI A;  3K59 A;  1Q78 A;  3QPI A;  1DQ8 A;  2CQH A;  2JFD A;  3C15 A;  3SYZ A;  1RT7 B;  2KFZ A;  4A48 A;  1ULR A;  4HH0 A;  1GXT A;  2HZC A;  4P2F A;  4LFC F;  1LNQ A;  2RVJ A;  4L6V 3;  5LMN J;  1D8Y A;  4N8N A;  4LIW A;  1QVG R;  4CH0 S;  3O8W A;  4UUW A;  1DTQ A;  4NLW A;  3UCG A;  3ZZZ A;  5D77 A;  2XMJ A;  3KLH A;  1HPZ A;  5KTQ A;  3VWS A;  4PQA A;  2X51 A;  3HJV A;  1ZTW A;  1NAQ A;  2Y8W A;  2GIF A;  3BEG B;  3H0P A;  3RBE A;  2G1D A;  2BZ2 A;  1TL4 A;  4OIX A;  2C2N A;  3ZTS A;  5KT4 A;  4KT0 C;  4EWT A;  4DSK A;  2WBR A;  1VGY A;  1W26 A;  4J7C A;  4OYM A;  2GVZ B;  2KKH A;  4NE9 C;  2BQU A;  3HXM A;  3E2E A;  1RYS A;  2B7B B;  5AXM A;  2DPJ A;  1X4A A;  3EGW B;  4B9S A;  3R1L A;  5ETV A;  5A0Y B;  4J9M A;  1BLU A;  3QRP A;  3BF4 A;  3KMS A;  3V4I B;  4JYA J;  3W60 A;  2ASJ A;  4B3O A;  1IWG A;  3RBZ A;  4ZPV R;  4D3H A;  4LF9 F;  2IY5 B;  2ZH5 A;  1U1R A;  1YWX A;  1NDL A;  2OKQ A;  3I56 S;  4WXO A;  4ZPA A;  1TTH B;  1JLG A;  2FLO A;  3NGS A;  2DRB A;  3EPG A;  2J7U A;  2U1A A;  4LR7 A;  4QWE A;  3NO7 A;  1CJK B;  2C42 A;  5E33 A;  4CH7 A;  1R6V A;  5AT1 B;  4LVO P;  2ZJR Q;  5EWF A;  2XLI A;  1L5U A;  1FK9 B;  4LR8 A;  4MYU A;  1FRL A;  5LXY A;  3Q23 A;  1BDT A;  2B9X A;  5I42 A;  2CQI A;  4KPC A;  2Y0S D;  1APS A;  1TL1 A;  1S4E A;  2ZKT A;  3BH6 B;  4Q44 A;  3B78 A;  2AJ1 A;  3AAW B;  5C5J A;  1MU2 B;  1X8D A;  5EHH A;  1S1T A;  4LSN B;  2FZG B;  4QWC A;  4DJB A;  2QV6 A;  4KKO A;  1CJV B;  1Q8B A;  1R6Y A;  4BS2 A;  3CD6 S;  4FDF A;  1ZTT A;  3NCP A;  1S1U A;  2KHC A;  2Y9H A;  1RT6 A;  2FIU A;  3DLE A;  3JTO A;  4QR0 A;  4MIW A;  1UMJ A;  2BVZ A;  1N5Y B;  4G1Q A;  1U1N A;  2HFN A;  4V19 X;  1WC5 A;  2HIY A;  1UCN A;  3HVW A;  1FX2 A;  5I4M A;  3ET6 A;  1FNM A;  2HK2 A;  1S6O A;  2LCW A;  2ROE A;  2PI4 A;  1YRT A;  3QLH B;  5HP1 B;  1OG7 A;  4B9U A;  4IQM A;  1CBK A;  2B56 A;  2RF2 A;  4M5L A;  1QAI A;  4K4Y A;  2EI5 A;  2ZNY A;  2ZZT A;  4GO7 X;  4IFV B;  4B08 A;  2E9T A;  2FJD B;  2XMA A;  3F73 A;  4BWJ A;  5ADZ A;  3D1Q A;  1NK6 A;  2RQC A;  3WX8 A;  2RF2 B;  2IVM A;  1JLA B;  3IGV A;  2OGU A;  5ETQ A;  2MQQ A;  2UP1 A;  5DG9 A;  1NJZ A;  2XO6 A;  5KAK A;  3OL7 A;  3FK4 A;  1EZZ B;  3LJP A;  1U9P A;  1G3O A;  2HWI A;  1LWX A;  4I7F A;  2DVI A;  3D2W A;  1UVJ A;  2UV8 G;  4RJV A;  1M5V C;  2V63 A;  3DM2 A;  2EW9 A;  1CS4 A;  2YKP A;  1BMQ B;  2BNZ A;  1Y3K A;  2BKO A;  5GMK a;  1U1Q A;  1NND A;  3IAM 9;  4RLE A;  4MJW A;  3QOQ A;  1P6T A;  2EWH A;  2V4J B;  2MMY A;  3PYE A;  1T11 A;  2ZH4 A;  4NLV A;  1QAJ A;  1RCO B;  3TVZ A;  1RT3 B;  2FHM A;  2VBW A;  3MZI A;  3R6G B;  5F8M A;  3M9O B;  3MEC B;  4PXD A;  4U67 Q;  2ZJP Q;  2NS1 B;  3R2D J;  2QLF B;  3CSK A;  1JMT A;  1VQS A;  2R4F A;  3GFZ A;  4Y0F A;  2MKK A;  4QIE A;  3NNE A;  2YNF B;  3B4D A;  4AL6 A;  3AJD A;  1HR0 F;  4QU6 A;  4DR4 J;  1CJU B;  5T41 A;  1JJ4 A;  4QR1 A;  4LFC J;  3BGF A;  3EYZ A;  3LAN A;  3VAL A;  1G6B A;  4OV6 A;  3E01 B;  2F4V F;  1HPZ B;  4MK7 A;  4KE5 A;  4LJM A;  1VIO A;  3U1L A;  2H1Y A;  2AT1 B;  3C14 B;  3C8Y A;  4LRV A;  3KLG B;  3DFE A;  1SJ1 A;  4M5I A;  5F8N A;  3HT0 A;  3FRY A;  3NNA A;  2UVU A;  1SV5 A;  3J81 U;  4TU8 A;  4WFA Q;  2RH3 A;  1RT6 B;  1Z2L A;  4P75 A;  2EG2 A;  2MGZ A;  3QO9 A;  2IAJ A;  1M5P C;  3BSA A;  5A0Y A;  3T6B A;  3KWM A;  2HFO A;  5K5M A;  5EX3 A;  5EX0 A;  1OYE A;  2AF6 A;  2DTJ A;  2I38 A;  3CJ4 A;  1Y5N B;  4USU A;  4CT8 A;  4ZHR A;  2JBV A;  2ASY A;  2B4O A;  2HK3 A;  3CMQ A;  4B9V A;  1BC6 A;  5BXI A;  1S49 A;  2YPY A;  2BAN B;  3KHH A;  3GV7 B;  3CJ2 A;  3KG4 A;  4U96 A;  2D41 A;  1I94 J;  2JOQ A;  5HBM B;  4LMZ A;  2J7K A;  2YH0 A;  4QR2 A;  4MAK A;  1FRI A;  2M8H A;  3G6Y A;  1XNR J;  1VBZ A;  4B02 A;  3SDE A;  2Y1J A;  1RAB B;  2YKM B;  1GMU A;  1JLF B;  3NGU A;  2HBY B;  5CAA A;  4OHY A;  2ZFH A;  3W2V A;  3PX0 A;  4KH0 B;  4YHH J;  4Q45 A;  3RAQ A;  1JLG B;  4O44 A;  1H3D A;  3M9N B;  3RB0 A;  1LKZ A;  2XGP A;  2ZD1 B;  1LWE B;  2KXH A;  3M6V A;  3LWM A;  3QJL A;  2XS2 A;  1SI9 A;  1LXN A;  3NOC A;  4IRD A;  2WON A;  4U7U K;  2GHW A;  3GMG A;  4TYA A;  4C6A A;  1BQM A;  3FEX B;  3KFW X;  4FKY A;  4LF5 J;  2G4B A;  4QW8 A;  4ZCI A;  3X1L B;  2VQF J;  1XNQ J;  3ELH A;  3DU5 A;  1K73 T;  1NDK A;  2F65 A;  3CJQ A;  2E5L F;  3HO1 A;  3ILO A;  3NMA A;  4FPI A;  3AXM A;  4CLS A;  2XY6 A;  4LF8 F;  4PQU B;  1YRU A;  3U27 A;  1A9N B;  2QLJ B;  1FXR A;  5JUM A;  3ENW A;  1WG1 A;  2A1B A;  1C4C A;  2LU2 A;  3R7S B;  4ECZ A;  1X4E A;  2VFR A;  3H7H B;  4UY8 T;  3IBC B;  1RHM B;  2EG1 A;  5LMN F;  3KUG A;  3DXB A;  4OQJ A;  4OJH A;  2FJE B;  3DLJ A;  2X1A A;  1WTB A;  1U25 A;  4LSL A;  2HHQ A;  4MJK A;  1U1P A;  2XWX A;  3EJM A;  3THV A;  2XYH B;  1HA1 A;  4WP3 A;  2YNG B;  1VRT B;  3P3D A;  2UXD F;  4NXM J;  4MFB A;  4FP9 A;  1XWL A;  4Y2M A;  3S01 A;  1F5C A;  4U95 A;  5C25 B;  3P6Y C;  2C3Y A;  4S0M A;  1MMD A;  2LLZ A;  4LF7 F;  5HVF A;  4M5N A;  3IGN A;  2YQ1 A;  1HLW A;  3DC2 A;  4DF8 A;  5KT5 A;  1Y3J A;  1IBL J;  4A8F A;  4F4Z A;  1IKY B;  2RML A;  4CM0 A;  4GVL A;  1HNW J;  3MTJ A;  4NYP A;  3G82 B;  4J9U E;  3PW4 A;  3T3F A;  3QT7 A;  3HSZ A;  5KFE A;  3OPK A;  3P5B P;  5AE3 A;  3T5J A;  2AZ1 A;  5A6P A;  4DR7 F;  4PWD A;  1RU1 A;  4OZJ A;  3J81 Y;  4JI1 F;  5CZV A;  4V19 J;  1M90 T;  1VIS A;  1C0U B;  1GTE A;  3EWG A;  3QO9 B;  1KVI A;  4ES2 A;  4K4S A;  2ZKU A;  5B0B A;  3M8W A;  2BE2 A;  3OFH A;  4OZN A;  1PG5 B;  3UD5 A;  2UVW A;  3C6U B;  3M7V A;  3KHL A;  4YR3 A;  4ID5 B;  4CI0 B;  4ALZ A;  3MM7 B;  3CJS A;  2MSS A;  2CG8 A;  4IYQ A;  3NWR A;  2IVF B;  3TX8 A;  4J9N A;  4DV1 F;  1J5O B;  4NMX A;  5C24 A;  3HM9 A;  2Z56 B;  3GE9 A;  1CSJ A;  2GMJ A;  4IDK A;  2DGU A;  4NLP A;  1UFK A;  4AQY J;  4IH5 A;  2E5H A;  2OPP A;  5E3R A;  1FRH A;  5B0A A;  4QBU A;  2E66 A;  3TUZ C;  2VBX A;  4HL9 A;  1LWC A;  1WHY A;  2IVY A;  3MUV P;  2YQ3 A;  5M2U A;  2CJY B;  1LWF A;  4A4J A;  3H59 A;  2HRY A;  2G0I A;  3GSD A;  1HNI A;  3BBF A;  1S72 S;  3WX4 A;  2FGC A;  3DNC A;  1OO0 B;  2NXJ A;  3VCD A;  1NXI A;  2OML A;  5DJB A;  1NEE A;  4MKB A;  4TLQ A;  4Y00 A;  1T9Y A;  5HMZ A;  4O3R A;  2OIH A;  2RJZ A;  2HFS A;  1CC7 A;  3CDE A;  5KFO A;  4HHH A;  2CQ4 A;  1HW8 A;  2YXL A;  2J9C A;  4CO3 A;  3M2V A;  4LQ3 A;  1SKW A;  4DQI A;  1PYT A;  5FII A;  4CLF A;  3NCR A;  3PVX A;  4USH A;  1UW4 A;  4BLG A;  2DPI A;  3RRK A;  3LGM A;  3RAM A;  2RS8 A;  5C24 B;  1JNZ B;  2GQ2 A;  3OSP A;  2BQ3 A;  2H54 B;  4AFF A;  2LQJ A;  1RK8 A;  1OYD A;  2XWY A;  2VC1 A;  2PFD A;  4P2M A;  3CC7 S;  2MZT A;  2QSW A;  5D3G B;  1XNR F;  2R7W A;  2F4F A;  4X62 J;  4RUC A;  4NCA A;  1IVZ A;  3QAT A;  1RTJ B;  2BNW A;  5GAH U;  4HYK A;  4D8J A;  1VRU B;  2LQ5 A;  3W64 A;  2P5V A;  4IRK A;  5HI7 A;  1FO1 A;  2KN4 A;  3D1O A;  4GKK J;  1RIS A;  3M8Y A;  3TAM A;  1ZOT A;  2JRS A;  1HBN B;  3N79 A;  1KDN A;  2G2Y A;  5LMU J;  3WIU A;  2I5J B;  5ETO A;  2B43 A;  1ZBT A;  1R0A A;  4KGM A;  2ZDO A;  2R2S A;  5D0R A;  1SQF A;  2OMO A;  3MM5 A;  2WAQ D;  3DRX A;  1KOH A;  2CQP A;  1GMV A;  5DZ7 A;  2ATL A;  2JNJ A;  5GME A;  2CPY A;  4I7F B;  2R7O A;  3CDU A;  1T03 A;  1Q79 A;  2J0W A;  4WE1 B;  3UR3 C;  1U1K A;  2WOM B;  5J2N A;  2GZO A;  2C3O A;  6FD1 A;  4TU7 A;  4DR5 F;  4I68 A;  4WFZ A;  1K1Q A;  4R8U A;  4WZQ A;  1B0P A;  1KQS R;  4TU9 A;  2XMV A;  4AD6 A;  1Q82 T;  3BKF A;  3D1H A;  3H2U B;  2MEW A;  3R9L A;  4OYA A;  1SB6 A;  1S1X B;  2QYC A;  3BR8 A;  3IR6 B;  4J9L A;  2OO4 A;  4ECR A;  1F5B A;  2HUR A;  3H2L A;  2L08 A;  1N6Q B;  2RSQ A;  5CYM B;  4JI4 J;  3EDR B;  3ZZ0 A;  4I2Q A;  3FSI A;  4OX7 A;  5LSL A;  3PX4 A;  2IJF A;  1SJ3 P;  2UXB F;  1RAG B;  4TY9 A;  1H7W A;  3K2Y A;  1KWM A;  3I32 A;  3O2I A;  4CIO A;  2FLP A;  1IKV B;  4WWS A;  2V4J A;  3SSS A;  4M5H A;  4PYD A;  2GS8 A;  2BJE A;  4QOT A;  5IOL A;  1W7W A;  1QSS A;  1IKV A;  3K5P A;  5J2Q A;  4TYB A;  1HYS B;  2WHO A;  2R7X A;  1VI7 A;  4Y2K A;  1T05 B;  1MU2 A;  1ZS6 A;  2WVC A;  2HND B;  3CT9 A;  1OY8 A;  3D6F B;  4C11 B;  1UW9 A;  1TZ0 A;  1U1L A;  5LOQ A;  3FNN A;  1YBT A;  3QIP A;  4P71 A;  4RPF A;  1LW2 B;  1K9M T;  3M8P A;  3BKU A;  4RO0 A;  2BYC A;  2W2M P;  1JLB B;  1D9A A;  1X4G A;  3GZ7 A;  1D1U A;  2V6A A;  5E3C A;  1FHT A;  2BDP A;  2ZZN A;  1FE0 A;  2E1A A;  1KHV A;  2KYX A;  1U2C A;  3KG1 A;  2CQ3 A;  1NCL A;  2MZQ A;  4KGZ B;  3CXC R;  1SC6 A;  1FJG J;  1UJ5 A;  1RT4 B;  2N3O A;  2X3D A;  3UDL A;  2JVO A;  1FI4 A;  1O8B A;  2VPX B;  4L75 A;  3FVY A;  1EX8 A;  1QJH A;  3N01 A;  1WOR A;  2QLX A;  3I87 A;  4IH6 A;  3TZZ A;  3HPO A;  2AGQ A;  2ZUA A;  2C2O B;  2KM8 C;  3OT9 A;  2ZH9 A;  2Y8Y A;  3MED B;  2VG7 B;  3BS9 A;  3MMB A;  4N7T A;  3ILJ A;  5B7W A;  3CD0 A;  1AFJ A;  4OYI A;  2E7V A;  4N8O A;  1B28 A;  1D09 B;  4C8O A;  3W5X A;  2DNK A;  4QQB A;  2HHU A;  3FCV A;  1GAO A;  2QA2 A;  3DRS A;  1X0P A;  4CO2 A;  1V6H A;  3RBD A;  2V9W A;  2ZUG A;  4IG3 A;  4KQZ A;  2J5A A;  2W8L A;  1FER A;  1X4C A;  2QJ3 A;  5DG7 A;  2XGQ A;  1F2G A;  2IA6 A;  3WZ0 A;  3IXQ A;  1T9W A;  2OPQ B;  3PTW A;  2XQC A;  1QTM A;  5CCL A;  4K59 A;  4DV4 F;  2EPI A;  3CJ5 A;  2LMI A;  4MIB A;  5D4O A;  4UZB A;  1RGV A;  3KG0 A;  5E3Q A;  4DR2 F;  3CJ8 A;  2OEJ A;  3KUH A;  4H4M B;  3IR7 B;  3GYX B;  5HVG A;  2LXU A;  4Q5V A;  5HP1 A;  3JQM A;  2KT2 A;  4NLO A;  2PMW A;  5KFN A;  3UQS A;  3DKD A;  1C1C A;  2DO4 A;  1RTH B;  3EXY A;  4NI2 B;  4NCB A;  1KVJ A;  2K2P A;  3KMQ A;  2HGL A;  2XEX A;  3GIL A;  3MR3 A;  2MKH A;  5F8G A;  3VAK A;  2HPU A;  2JX2 A;  3G2X A;  4LF9 J;  2C2M B;  3PG9 A;  4OYB A;  1CJV A;  4LF1 A;  1TFY A;  1FJC A;  2PMH A;  1UWA A;  2CJ9 A;  1DY3 A;  4YB6 A;  2W9C B;  2HBR B;  2ZHO A;  3TO8 A;  1VC6 A;  2R7T A;  2AJ2 A;  3KXD A;  4OYP A;  4F0M A;  3TA0 A;  3O1L A;  2CUY A;  2BJ7 A;  5KT3 A;  3QT5 A;  2UXB J;  2UVR A;  3R5C A;  2ZDP A;  4ILL A;  1TUW A;  1RA7 A;  3BB5 A;  3Q8U A;  2WTF A;  2RRB A;  4YP3 A;  1F3V A;  3M8P B;  2R8I A;  4DCO B;  1PIL A;  3MPW A;  4I4B A;  4CLP A;  5HJY A;  5HL7 Q;  2IHR 1;  4KHM A;  3H4B A;  5C2G A;  5CD4 A;  1VS3 A;  2VU5 A;  2C2K B;  2PI5 A;  3HUL A;  1V5I B;  4KO0 A;  1PCA A;  4B3T J;  3IWN C;  5KFW A;  1MN9 A;  1FXL A;  3KK2 B;  3VGT A;  4CNZ A;  3DGP A;  2DEJ A;  1BUX A;  2V4R A;  4DFM A;  4NLS A;  5DM6 Q;  3NP5 A;  2BJ8 A;  2G1H A;  2Q6B A;  1M5H A;  3PHE A;  5KG3 A;  4LF2 A;  5E3P A;  4C3M A;  1RAD B;  4CTA A;  2BQR A;  4RWX A;  3Q2T C;  3TOQ A;  4RUB A;  5KOW A;  3M6X A;  1S1V A;  3SCJ E;  4M8L A;  4YHH F;  2MKS A;  3FQL A;  2J0S D;  4Q7A A;  4DR5 J;  5DO2 A;  4ZIW A;  3OTO F;  5B0C A;  5KFM A;  5HO4 A;  2VQE J;  3GJT B;  5GMD A;  2VIC A;  3KDN A;  2ZWP A;  1N6Q A;  4WPA A;  3HZE A;  3MEE A;  2WRM A;  3L95 X;  2ASL A;  1IJF B;  4ILR A;  4KV8 B;  2RAQ A;  5E3A A;  5AE2 A;  2VC0 A;  4GC7 A;  2HHW A;  2ROP A;  3RB6 A;  2DNY A;  4ME7 E;  3O6Q A;  2K1R A;  5IQQ A;  4ETX A;  1X5T A;  3GR1 A;  3Q8P B;  2CDR B;  3IRX A;  2MY7 A;  3LUY A;  3NLC A;  4NEY A;  3J81 j;  1XJW B;  1YJ7 A;  3G4S S;  1QSY A;  1NME B;  2COL A;  3D6T B;  4GKJ F;  4U9R A;  2DHX A;  2W7A A;  1XMQ F;  2H3A A;  2K1R B;  4QYR A;  3J7Y U;  5KT7 A;  3IWL A;  1RT2 B;  2MY8 A;  4CO5 A;  3CTR A;  1HWL A;  3GPA A;  1BAZ A;  1S10 A;  2DGO A;  4F36 A;  4RW9 A;  1B99 A;  5E5N A;  5GAD I;  2XHW A;  2DEI A;  1UFW A;  4ZVH A;  1HHS A;  2HBQ B;  2IFX A;  5KFU A;  2KG0 A;  2L41 A;  5A2Q Y;  2YVS A;  3CCV S;  2AD9 A;  2B5J A;  2GGP A;  3RW6 A;  2BM0 A;  1D0E A;  2NYH A;  4ZS6 A;  2ADB A;  3F44 A;  3I0R B;  2C3P A;  3PJ9 A;  4I0W A;  1G1X A;  2WON B;  3PX6 A;  2GJI A;  4JI8 F;  2OFH X;  3UVJ B;  3EPI A;  1FTC A;  1DLO B;  1V3S A;  2PC6 A;  4LIR A;  5BJR A;  5L46 A;  3R5D A;  4NML A;  4H4K A;  4EZ9 A;  4EZ6 A;  1ARO P;  4WFY A;  1T7P A;  4LBP A;  1HMV B;  4KR0 B;  5DQG A;  4JI3 F;  4ANE A;  4DR6 F;  2FHK A;  2E7X A;  2VH7 A;  2UUT A;  1ROF A;  4KGK A;  2N82 B;  5AJ3 J;  3D4J A;  1FTR A;  2HMI A;  2CXE A;  2C2Z B;  3PDN A;  5KFB A;  4ECT A;  4NEZ A;  1T02 A;  2MQ8 A;  2XY5 A;  3GFH A;  4B3T F;  2CAD A;  1TKT A;  1RWV B;  2B9Y A;  3GIJ A;  2KYZ A;  1SUQ B;  1YI2 S;  1F1B B;  1P9Y A;  2VKZ G;  4N56 A;  1NK8 A;  4OJG A;  4C2M A;  2F8E X;  2HFU A;  1P27 B;  1JXV A;  3Q86 A;  3MDF A;  2J0Q D;  2VOP A;  4USM A;  3BN7 A;  3QAU A;  2BSQ E;  4MK8 A;  4KHP J;  1WEZ A;  2MJU A;  6AT1 B;  2D3Z A;  1FFG B;  3WDO A;  1RKJ A;  2HBZ B;  1KOO A;  3PYD A;  3TR5 A;  2DB1 A;  3OFF A;  5BYS A;  1CJT A;  2OEL A;  2MKJ A;  5LXR A;  3ISN D;  2RDD A;  3L3C A;  1FJ7 A;  1GH8 A;  4HI2 A;  4B3R F;  4DEZ A;  4ZDN A;  1FD8 A;  3HFK A;  1KP6 A;  1UWB B;  3DDN A;  1HFE L;  1NJY A;  5C25 A;  1J5E F;  2QG9 B;  2IM2 A;  1O5J A;  3C14 A;  3J7Z T;  3MFI A;  3SDE B;  1WEX A;  4MKA A;  3EX7 B;  3AB2 B;  1S6Q A;  1Q86 T;  3FT7 A;  1P1T A;  2VA3 A;  3PO5 A;  2MB0 B;  3C6U A;  3HD2 A;  3R5B A;  3R1H A;  3DMJ B;  3BJY A;  3RW7 A;  4FS1 A;  3UR0 A;  5L39 A;  3QQC D;  3UNY A;  3AOC A;  3R6L B;  5CA5 A;  2AGP A;  4P7V A;  4NLX A;  3I4H X;  5KFA A;  4FXD A;  3NAI A;  1S9E A;  5A8R B;  2WCX A;  4F0K A;  4B9M A;  2P8I A;  3HHK A;  3OHB A;  3CUL A;  1KQG B;  4FF3 A;  2NZ4 A;  2CQ1 A;  4OLP A;  4WFN Q;  2PE8 A;  1PYO B;  3MUM P;  2DR7 A;  3TEH B;  1MMN A;  1RYR A;  3T19 A;  4JB8 B;  4LF8 J;  8AT1 B;  4OZ0 A;  1S1V B;  2R7Q A;  4PZV A;  3NNH A;  1M5S A;  4IO9 Q;  1MW7 A;  2HAI A;  4KFB B;  2WBM A;  2MGZ B;  2HHT A;  3ICL A;  2QLW A;  4DXL A;  3OSN A;  3HHE A;  1RHJ B;  1TKT B;  1VC0 A;  1S1W B;  2FJW A;  2XYP B;  3M8Q B;  4KH1 B;  1JLE A;  2H48 B;  1MYK A;  3NRB A;  3K0J A;  1VQ8 S;  2HHP A;  4K4T A;  2CNK B;  2LQ8 A;  2K1O A;  3KLE B;  1WJ9 A;  4H4O A;  1ZAV A;  4IKA A;  2QFI A;  3Q8Q B;  1M5O C;  4ICL A;  2H1O E;  3G8T A;  2ZE2 B;  5EN1 A;  1N48 A;  4C3K A;  3E01 A;  1RHR B;  1RWK B;  8RUC A;  5KFC A;  2KG1 A;  2XO7 A;  2J8S A;  4EO6 A;  4A8Y A;  3IRW P;  3GJS B;  1QTG A;  2CAJ A;  4IFV A;  5HRO B;  3V6D B;  1RWM B;  2CPD A;  3FBE A;  3LP1 B;  5J2M B;  3BRE A;  4DV6 F;  4YY3 F;  5IS2 A;  3GIR A;  4E98 A;  1CQM A;  1FDN A;  2J9D A;  2BAN A;  4WTY A;  4ED0 A;  2ZOG A;  3D7S B;  2B4U A;  2M7S A;  1ZPW X;  4O3Q A;  1XMO F;  1N34 J;  4DWI A;  2W9A A;  4UOF A;  1TVR B;  1VJW A;  2GQC A;  2LA6 A;  2Q3P A;  2Z2Z A;  3TUI C;  1NKE A;  1IBM J;  3BN4 A;  3OJU A;  1FWK A;  3FGV A;  1CS4 B;  2GJF A;  4FNH A;  1V5V A;  3BGR B;  3ZTQ A;  2ILY A;  2GQQ A;  3UNG C;  4TQS A;  2XZW A;  3GYG A;  4NAS A;  3SCL E;  5D8H B;  1PC5 A;  5DDP C;  2QC3 A;  2XSF A;  1C1C B;  1XR6 A;  4C8K A;  2XCP A;  1V3Z A;  3MMA B;  3UDV A;  4I2Q B;  2KFY A;  4YB7 A;  2ZH6 A;  3RRH A;  1H0H B;  2HAF A;  4OZ5 A;  2NQP A;  2Z58 B;  3L7P A;  1RDR A;  3BO4 A;  2A6O A;  5GAH I;  1EP4 B;  4H4M A;  2APO A;  3N4W A;  1HQE A;  2ZBP A;  3MCS A;  4I2P A;  2CQD A;  2LYV A;  2EFQ A;  2LEP A;  4XPE A;  3CCR S;  3GSI A;  1NJX A;  4DV6 J;  4X64 F;  3FSX A;  4C9D A;  3H5X A;  3SV4 A;  2RHQ B;  4KV8 A;  1UVL A;  2HVD A;  4UTG A;  1Q81 T;  3IS9 A;  1ITP A;  1NK5 A;  5FJ4 A;  3FDS A;  1S7I A;  2JXG A;  2ZC4 A;  1F2H A;  5L1K A;  2C2R A;  1EA4 A;  2V2Q A;  3BBC A;  1BD6 A;  1Q8K A;  1VIX A;  3M9M B;  4Q43 A;  2HNZ A;  4IOA Q;  2QSF A;  1RT3 A;  2X3G A;  2POK A;  3AOB A;  4ECX A;  3Q8V A;  2AWZ A;  4ZHR B;  2YH1 A;  5T7L B;  1EJ7 L;  4O4R A;  3CJT A;  3OUY A;  2IBK A;  2F8H A;  2F4V J;  4KJI A;  3BGO P;  4DPU A;  3Q22 A;  1SKR A;  2V67 A;  1G7C B;  3NAH A;  2AJF E;  2FLN A;  2CQC A;  3MGJ A;  4TQR A;  3JSM B;  4DR3 F;  5DLF A;  2F40 A;  2F7V A;  4WBF A;  3MPV A;  1U49 A;  3R5G A;  2DRD A;  3BQ2 A;  1LFP A;  3DGP B;  4DZD A;  3NGT A;  2HW3 A;  3A8J A;  1UTA A;  3AB4 B;  3CCM S;  5D6G A;  3CWJ A;  1R3N A;  2KT3 A;  2WSF C;  2XI3 A;  4UOC A;  4ECS A;  2XMT A;  3U1N A;  1SJ4 P;  4LF6 J;  5HLF A;  7FD1 A;  1VRQ C;  3GXQ A;  2HS3 A;  2IM3 A;  5HAT A;  2LDY A;  4AL5 A;  1XR5 A;  1H2U X;  4JI2 J;  4DQR A;  1L3S A;  3VZH A;  4I1T A;  4J9P A;  2XS5 A;  4O4G B;  3DYA B;  3GG1 A;  4B3R J;  4ICL B;  2XMM A;  2HZA A;  1GMW D;  2L48 A;  2DGQ A;  4J37 A;  3DRP B;  1R31 A;  1RWP B;  4ZVO B;  4C8N A;  2VIH A;  2OSR A;  2L9N A;  3GTY X;  4I6A A;  3T1A A;  5IXU A;  1SH0 A;  1EKR A;  1KD1 T;  3QAE A;  4ECU A;  1HNZ F;  4N5S A;  4I67 A;  2B6A B;  4YDX A;  1MWQ A;  3BPS P;  3MOJ B;  3CF5 Q;  2IYI A;  5E2Q A;  1S9G B;  3DLG B;  3US5 A;  2V2V A;  3TNV A;  5D0E A;  3HVT A;  2HLU A;  4PEO A;  4DN0 A;  2H5E A;  2HWH A;  4RW4 A;  3TUJ C;  4LFB J;  1UAW A;  1FRM A;  2W2O P;  3W9H A;  1QE1 B;  3H20 A;  4F2R A;  4G3I A;  3AFG A;  1MN7 A;  2VDH A;  3D68 A;  2BW2 A;  4ZVT B;  3HSG A;  2QL7 B;  3PM9 A;  2P9G A;  5A8R A;  4A46 A;  3LP1 A;  5J2M A;  1FNX H;  3L7U A;  3ZZT A;  4ZJQ A;  1UA1 A;  3OL9 A;  3V6K A;  4HDG A;  5AXK A;  5I42 B;  1KQF B;  3Q8S B;  4QPX A;  5F3T A;  4DL6 A;  3RAX A;  2UUC F;  3PRD A;  3IP0 A;  4RUH A;  2DR9 A;  3FRZ A;  2M52 A;  2W2P P;  2DNG A;  4JV5 J;  3JTN A;  1RLD A;  1LOU A;  3E51 A;  4WE1 A;  2VKR A;  2EFO A;  2K7K A;  3ET6 B;  2YKO A;  5ITH A;  1UZD A;  2YNH B;  2DCL A;  4ZVU B;  1RT7 A;  4DLG A;  4MIA A;  2JEF A;  3UN3 A;  2GHP A;  4JI3 J;  3AD7 C;  2JL9 A;  1VBX A;  3IN5 A;  2GO8 A;  3GU0 A;  3HDS A;  1WG5 A;  1D3W A;  2L9D A;  3MM5 B;  4ZLJ A;  1JWW A;  4NYZ A;  4KFB A;  1H73 A;  2AKW B;  3R7B B;  3W8G A;  1TV6 A;  3M8S A;  1U48 A;  5FDL A;  1KFD A;  2K9I A;  3BKT A;  3DRY A;  4ZVF A;  3J80 U;  5F9L A;  3N28 A;  2CPJ A;  4FYW B;  3HVA A;  3P5T L;  4ZA1 A;  4IOB A;  4M5G A;  1RBL A;  3DOL A;  2CZV C;  3SQG A;  2DNH A;  3WC0 A;  4URG A;  2JC0 A;  4K0K J;  3GIM A;  1PBU A;  1TUV A;  2GMH A;  2YWH A;  3D0G E;  1HNI B;  1SL0 A;  1QVF R;  3QT8 A;  3SMZ A;  5G0R B;  1XMQ J;  1IWA A;  4PKD B;  2OD6 A;  2OPS B;  3CCU S;  5I3U B;  1U1M A;  3AXK A;  4D3G A;  1WKK A;  1EP4 A;  3J7A N;  3DDK A;  3KK1 B;  2VJV A;  2YNG A;  3NWG A;  4ID8 A;  3MAH A;  4U7U D;  4TXS A;  1X9S A;  3NL0 A;  2YBV A;  3ZC4 A;  4JI4 F;  2D9O A;  1WC3 A;  1NHV A;  1Q5Y A;  3OVB A;  2YKN A;  1D9D A;  2LEA A;  4FF2 A;  3R27 A;  1RA6 A;  2FPH X;  3FKB A;  5THW A;  3M6W A;  4CM2 A;  3G6V A;  1RHK B;  3PJW A;  5SUH A;  5IC4 B;  2XLK A;  2N3L A;  3OXG A;  3IWX A;  4DMZ A;  4P6Q A;  3CCT A;  2I5J A;  1U0H B;  3FMB A;  1CG2 A;  5KG7 A;  4X4T A;  4NCG A;  4DFK A;  1JB0 C;  1R8P A;  2PA3 A;  3PW0 A;  5CHC B;  4LF5 F;  1AW0 A;  3HFV A;  1EIY B;  2HHV A;  4FBT A;  2VV5 A;  2GVZ A;  4G6V B;  4WP9 A;  2LEC A;  3RB4 A;  2UU9 J;  2R2T A;  3NS6 A;  3PRV A;  4V1A k;  2EFP A;  5B09 A;  2QZ8 A;  1TK0 A;  4NRU A;  1AT1 B;  4E8U A;  2AU0 A;  2FJB B;  3M2R A;  4DX6 A;  4A8M P;  3MR6 A;  1QUP A;  1JQG A;  1U09 A;  4LQ9 A;  2HEK A;  4TNO A;  3NEK A;  4WFB Q;  4DR1 F;  4PXE A;  4O44 B;  3KNA A;  1XMB A;  3IBF B;  5H9F K;  2FHJ D;  4O3P A;  1L3U A;  1U2R A;  3DLH A;  1T9X A;  5KFZ A;  3VAI A;  3S6E A;  4EUV A;  1HIY A;  1U8W A;  4DR4 F;  3KKF A;  1F9F A;  2FY8 A;  2MZS A;  2R7U A;  2V34 A;  3GQC A;  1YJV A;  3D9B A;  2XMW A;  2R8H A;  1RSC A;  1JLE B;  4ZN1 A;  3BDP A;  1S76 D;  2YQ0 A;  3S7R A;  3UVJ A;  5A76 A;  5H9F J;  1L3V A;  2BE9 B;  3DRR A;  4HHJ A;  2IMW P;  1OY6 A;  2DNZ A;  2Z2L A;  2FJV A;  1M5K C;  3OLB A;  4ED1 A;  3OL8 A;  3RTV A;  1F5A A;  4USJ C;  1JLC B;  3MD1 A;  4Y2I A;  4JUZ A;  4KY3 A;  1X0F A;  1QDU B;  1X9W A;  1RHU B;  1Y10 A;  2JJ4 D;  3CDA A;  4ZPB A;  1FEE A;  1X4H A;  2GFF A;  2MYF A;  4MT1 A;  5IV3 A;  4FS2 A;  4F4X A;  5K8O A;  4ER8 A;  4XK8 C;  4RW7 B;  1T8E A;  1IQT A;  2NYI A;  3G82 A;  3TEG A;  1ARQ A;  3DGV A;  4LFA F;  1U7L A;  5IM0 A;  3G87 A;  4OI2 A;  4R5P A;  2HRU A;  1ACM B;  3N0V A;  1VK3 A;  2IBO A;  5KG6 A;  4DBQ A;  3DHW C;  4DL7 A;  2ZBQ A;  5D3G A;  3LH2 S;  2CRL A;  1N4L A;  1RP5 A;  4XDD A;  1XER A;  2UUW A;  2MHN A;  3DU6 A;  3GIK A;  4CLY A;  2OPP B;  3LPE A;  4YY3 J;  2YKA A;  4OJ1 A;  3TZY A;  4CLK A;  5D78 A;  1TL5 A;  2DCU B;  2GCF A;  3JSY A;  3NG8 A;  2BOA A;  3EIC A;  4C3L A;  3MM7 A;  3ZTP A;  5JJB A;  2EBG A;  2YNI A;  3SIP B;  2IDL A;  4RWW A;  3MR2 A;  2P6S A;  4CH1 A;  4DV0 F;  4RUA A;  2OP5 A;  1KR4 A;  3S1T A;  5IM0 B;  4FBU A;  1RAC B;  2V5H G;  3AD8 C;  2A10 A;  5ETK A;  1SJQ A;  1YJN S;  2PN6 A;  1J2V A;  1FRJ A;  2YWK A;  3QWU A;  4B3M F;  3AA8 A;  3KJF B;  5DDO C;  4JV1 A;  5FDL B;  1AUS L;  2EKY A;  4FVC A;  1L3T A;  2DNP A;  3CNQ P;  4M5J A;  3CDB A;  4PCQ A;  4ZIT A;  3MM6 A;  4ZVP B;  3M30 A;  2FVS A;  3DM2 B;  4CWB A;  1NPR A;  1GXL A;  5D0G A;  5K20 B;  1MSW D;  4Y3C A;  2FJX A;  2VPY B;  2EFG A;  4USI A;  2AYE A;  4H4K C;  1VRT A;  2OUG A;  3FCW A;  4MK9 A;  3C46 A;  3LP0 B;  2R3V A;  5LT5 A;  2UZA A;  2KJW A;  1FXD A;  2PT0 A;  3TJ9 A;  4BCA A;  2NSC A;  2O67 A;  2DBB A;  2HSE B;  1SL2 A;  2DNN A;  2PSZ A;  1TAQ A;  3TP2 A;  4NLY A;  5HQ8 A;  3BDE A;  1RAH B;  3KHG A;  4OL8 A;  5L9X A;  5L8R C;  1YIJ S;  2JZ5 A;  2FC8 A;  2Y1I A;  1QD1 A;  3EMT A;  3Q2S C;  1WDD A;  4ITS A;  2E5J A;  3QLH A;  3UFC X;  3BSO A;  1IR1 A;  1IN0 A;  2J7W A;  2MPU A;  3H5S A;  5B0D A;  4EEY A;  1HD1 A;  3UD3 P;  4TY8 B;  4M94 A;  1FKO B;  1BGX T;  3PFE A;  4ZPD A;  3A3N B;  2EFV A;  3DXS X;  3NKY A;  1C4A A;  3OFE A;  4DFP A;  3ZZP A;  2W9B A;  1J27 A;  1OQ6 A;  4EU0 A;  2JLF A;  4ZN3 A;  4Y34 A;  1X5P A;  2UXC J;  2HHH J;  3M32 A;  3I0S A;  1G2E A;  1HBO A;  3ISZ A;  5KFJ A;  2AEJ A;  2J6S A;  3NMR A;  4LBH A;  2CAX A;  5RUB A;  4J9R A;  1KKH A;  3KK1 A;  3H40 A;  1N36 J;  3TAN A;  4C4W A;  4C0B A;  2M2B A;  2Z2M A;  3M1V B;  4HI1 A;  3CO9 A;  3ETO A;  4ELT A;  1JLQ B;  3H87 C;  1NM2 A;  1SPB P;  1VBK A;  3BM7 A;  3MAA B;  1YRX A;  2CQG A;  1VOM A;  3CJ3 A;  3NXZ A;  1IBC B;  1VQY A;  2ZH1 A;  2GPE A;  2IIH A;  4CP5 A;  4DR1 J;  2AQ4 A;  1HQU B;  1YJ9 S;  3ZTO A;  3K7R A;  1EKS A;  4L76 A;  4DHV A;  3JTP A;  3UI3 A;  2HVZ A;  4ZP9 A;  2D3O 1;  3NNC A;  4K50 A;  2XTJ P;  1RTD A;  1FDD A;  4DF4 A;  5F8I A;  3NS5 A;  4KGX B;  5M2R A;  4JYA F;  1A7G E;  4UUX A;  2P6T A;  1KLM A;  2W25 A;  3I5C A;  1KTQ A;  1NUE A;  2CNN B;  1YIT S;  4B3O B;  2AJQ A;  2KHD A;  2JWN A;  2K7J A;  2MTL A;  4NZ0 A;  3KHR A;  4QZV B;  3C6T B;  4ILM A;  4HVZ A;  1KQK A;  4ANC A;  2G2O A;  2BA3 A;  2YNH A;  1XC9 A;  2JHE A;  3CE8 A;  2HNZ B;  1VCT A;  2BAC A;  2KL8 A;  2B8Q A;  5LMU F;  1KC8 T;  2W7P A;  3AD9 C;  3W1Y C;  3H25 A;  4DSI A;  1HNV B;  3AY0 A;  4DU7 A;  1F9H A;  5HAO A;  1JLB A;  2R42 A;  2W7O A;  1SIZ A;  4ED4 A;  3HP6 A;  1NHK L;  8ATC B;  2VFS A;  3L9Z A;  4MH8 A;  3HHN B;  2NXC A;  1I1G A;  2K8G A;  4IFY A;  3M05 A;  2P2C B;  3VVU A;  1U2F A;  2MQL A;  5LSR A;  4A8K A;  1RWW B;  3CD5 A;  1R7I A;  3OTO J;  2KZZ A;  1ZM3 A;  2J9D E;  4K2J A;  5CH7 B;  2P9E A;  2XG8 A;  2E9R X;  2AYB A;  1T03 B;  3GG0 A;  2IM0 A;  2G2Z A;  2VFT A;  2F63 A;  3C15 B;  3MPD A;  2IMO A;  2AHO B;  2QLB B;  1HL6 A;  1FRK A;  2X1B A;  1CUL A;  1S1U B;  2VG6 B;  4DUZ F;  4QWA A;  3TAP A;  3UD4 P;  3T5H A;  1H2T Z;  1S59 A;  5E0O A;  4F02 A;  1SKU B;  3QGG A;  2QFJ A;  3GWC A;  3ONQ A;  1A0O B;  3QWP A;  3DLK A;  1WD6 A;  2DGW A;  3UPF A;  2GO9 A;  4NLD A;  1YJW S;  2BRL A;  4ATN A;  2KT5 A;  3FZB A;  4F0H A;  3BO2 A;  3QGH A;  3MAA A;  4IH7 A;  1Y4Z B;  1YKW A;  4HTJ A;  2GIR A;  5JVH Q;  3BR9 A;  3KLV A;  2VHG A;  2C3U A;  1QUV A;  1HKA A;  2JSX A;  4A8S A;  4MKV A;  5KFL A;  3D67 A;  3PNI A;  2V94 A;  2E9Z A;  2HHH F;  1Q7Y T;  1KFS A;  3MXH P;  3PR4 A;  2DJW A;  4Q2M A;  4J5O A;  1RHQ B;  1VQ6 S;  1GK8 A;  3Q83 A;  2ZH8 A;  4DV1 J;  4X4V A;  4Q8E A;  2ACM A;  4PAB A;  3OR1 A;  1HBM A;  2FDN A;  1C1B B;  2CNL B;  2MKY A;  1M0S A;  4DU8 A;  1RAI B;  3QZ8 A;  5IT9 U;  1BE4 A;  1RBO B;  2L3M A;  2AEF A;  1Z4U A;  2OD4 A;  3HHL D;  1BDV A;  2XSJ B;  3TAR A;  2DNR A;  2R7S A;  4PRF A;  2ZBR A;  4F50 A;  4C48 A;  3HHD A;  4HT7 A;  2DIV A;  2OEK A;  4NPO A;  5HMY A;  2BV3 A;  1EAY C;  2HQC A;  4F67 A;  4O0I A;  3ZO7 A;  3VEA A;  1RTJ A;  2FC9 A;  3N6M A;  4DI6 A;  4XO0 A;  2V8V A;  2IRX A;  2RDI A;  4GMK A;  2RD5 C;  3VV2 B;  3D5M A;  2LKZ A;  4PG6 A;  1GX6 A;  1LW2 A;  3W9J A;  2HQ3 A;  2HIQ A;  4JI2 F;  1PC4 A;  3PRB A;  2JEI A;  1TKZ B;  2KOE A;  2QO3 A;  2V4Q A;  5CXT A;  5HLF B;  2I1R A;  3OL6 A;  4NX9 A;  4ZJL A;  3W61 A;  1UL3 A;  4RNO A;  3CPW R;  3OW2 R;  4C11 A;  2IPO B;  2DT9 A;  1S0N A;  4JI5 J;  1SQE A;  4U6P A;  4GC6 A;  5KFR A;  1RT1 B;  1VQN S;  1N88 A;  3I0S B;  2MXY A;  4DV3 J;  1RLC L;  4G1Q B;  1IKX A;  4QJV A;  5D4L A;  1X7V A;  4RNF A;  1EQ0 A;  2V2K A;  1TUG B;  3SV3 A;  2RKI B;  1YBU A;  4NOH A;  4UQT A;  3AOD A;  4X66 F;  1LXJ A;  5DGB A;  2VQF F;  1XNQ F;  3F41 A;  1OWX A;  1FEH A;  3BGU A;  4I69 A;  3H90 A;  1NB2 A;  2ZNZ A;  3FBF A;  2JLE A;  3IM9 A;  2W4C A;  1DTT A;  1XK8 A;  4AUK A;  1I3O B;  4ZVR B;  1D9F A;  3HKW A;  2GNK A;  1NKB A;  4N41 A;  1SVD A;  3N5B A;  4P10 A;  2Q43 A;  1UVM A;  2MKC A;  3PZP A;  1WHX A;  4RW8 B;  3MCM A;  3LA0 A;  3T9N A;  2WVF A;  3DHX A;  5J1E B;  3JAM U;  3EUN A;  5E41 A;  9ATC B;  3KK3 B;  2Q66 A;  1OHN A;  5KFI A;  4PG5 A;  1WF2 A;  4DQS A;  1I51 B;  5DG8 A;  2AIR B;  1S6P B;  1KVK A;  4DL0 C;  1JNR B;  1L3K A;  1D8Z A;  3T5K A;  2ZEJ A;  1S12 A;  1X31 C;  1VQK S;  4OX9 J;  3GFY A;  1RAF B;  1CQN A;  1TL3 A;  1VFJ A;  4C7Q A;  1FJE B;  3H5Y A;  2F3J A;  2I0X A;  3A12 A;  5IT0 A;  2XMK A;  4EMD A;  3M2V B;  1FFS B;  1H7X A;  1B01 A;  3UCZ P;  5CQG A;  4CYU A;  2AN7 A;  2B4V A;  1SJF A;  1C0U A;  2RT3 A;  1DHM A;  3MM8 A;  2ZIT A;  2ASD A;  2LU1 A;  1FKO A;  2A3J A;  2AMC B;  4F3Q A;  2AX0 A;  2OSQ A;  1PIE A;  4NLR A;  1H6K X;  5A8W B;  2HQD A;  3GON A;  2DIU A;  2N4C A;  4HH1 A;  1PJ7 A;  2W8K A;  1IUJ A;  3FCH A;  3MR7 A;  4G1I A;  1DZ5 A;  2V8G A;  1R8C A;  2CPF A;  3CDW A;  4OZL A;  4ED8 A;  1VHI A;  2WSC C;  2MQN A;  3DMJ A;  1PKU A;  3LP2 B;  4DCJ B;  2XCA A;  1T3N A;  1WDT A;  2KXF A;  3C16 A;  1MG7 A;  4QW9 A;  2GAG C;  2CVI A;  1DAX A;  2IA0 A;  4RW6 A;  5L38 A;  2VA2 A;  1Q53 A;  2IM1 A;  4KO0 B;  4P2X A;  4R0E A;  1S6P A;  3AQP A;  1S5Z A;  2GA7 A;  1WI6 A;  3BYR A;  5LSO A;  4CLZ A;  3MEK A;  2XNQ A;  1FCA A;  5GAE I;  5KFT A;  1VQ9 S;  4PUO B;  5KFV A;  2BKN A;  3B8H A;  3IM8 A;  3OVS A;  5H1S V;  5G0R A;  5A6W A;  2V8P A;  1SIW A;  1T9T A;  2XHC A;  4K5S A;  2RS2 A;  5H9E K;  2DNM A;  2EC2 A;  4YB1 P;  2FZC B;  1GT8 A;  3T9Z A;  3B54 A;  3Q24 A;  3MWB A;  2XSJ A;  1WC1 A;  4L72 B;  4PR6 A;  1PJ5 A;  2EC0 A;  2Y1L B;  2XS7 A;  1IKY A;  4AQY F;  1TAU A;  2DHH A;  4ED3 A;  1T9V A;  1H74 A;  1SC4 B;  1RWO B;  3QGI A;  4OHX A;  4NLU A;  2VFV A;  3KK2 A;  1S6Q B;  4QIW D;  3T5L A;  5L1I A;  3IAS 9;  1Q0N A;  3MMJ A;  1R0C B;  4CO4 A;  5M2P A;  4X4S A;  5DGA A;  1R89 A;  1QLN A;  4O0N A;  2NUH A;  3FEZ A;  1FD2 A;  1S7H A;  3GCW P;  5LL6 d;  4LSZ B;  3NGD A;  2KH9 A;  1VQ4 S;  3EDQ B;  4QYZ K;  3UN2 A;  3W66 A;  4USK A;  1UJ4 A;  2WVE A;  2EK6 A;  5KT2 A;  2DY9 A;  4BBY A;  5KFF A;  1VLO A;  1TKX A;  4J9S A;  1V9O A;  2BAB A;  4FYD A;  3GYN A;  4RW7 A;  3MEC A;  5DDR C;  1N52 B;  1SJR A;  2HGN A;  3DOL B;  3SQG B;  5KG2 A;  3R5A A;  4JI0 F;  4F25 A;  3W5Y A;  1O51 A;  4NCG B;  4ZPC A;  3E3X A;  3CW2 C;  4R0J A;  5IQ6 A;  3DLG A;  2RNE A;  3BH7 B;  5CYQ B;  3MD3 A;  2RRA A;  2ALZ A;  1K8A T;  4Z37 A;  2JXH A;  1TMJ A;  2DGT A;  1EAR A;  1HBM B;  5HN0 A;  2I9S A;  2CVE A;  5C2C A;  3N9U C;  1F60 B;  1FVQ A;  1TL3 B;  1RT4 A;  4K4Z A;  3MR5 A;  4LFB F;  3MCN A;  1JLF A;  3DCA A;  4OHW A;  1B4S A;  4IR1 A;  2NXE A;  1EB0 A;  2BJ1 A;  4IFY B;  5D0H A;  4DV7 F;  1ZPV A;  1TFW A;  2AZ3 A;  2AX1 A;  3GII A;  4NRT A;  1PYS B;  4DV0 J;  2LFV A;  1NLA A;  4C0H A;  1HBU A;  1ZA1 B;  2NXN A;  2E1M C;  4B9T A;  3ADA C;  3AJ2 A;  3MEE B;  2VPW B;  3CED A;  3F0N A;  4CZC A;  4X4P A;  1NJI T;  1J5E J;  4JI0 J;  1YBA A;  3HJF A;  4DR7 J;  2XY7 A;  2RHS B;  2CQ2 A;  4FXV A;  3U02 A;  4EGL A;  2UUB J;  1N0V C;  4I6W A;  3B4M A;  1HYS A;  4RBV A;  3MM8 B;  2IRU A;  2IAJ B;  1HAR A;  2Q79 A;  2NXU A;  1O0P A;  1S79 A;  1JKH A;  3HK2 A;  1GTH A;  3T6J A;  2WVB A;  3SFG A;  3JSR A;  3SXL A;  1BHN A;  4DS5 A;  4ZCL A;  3LAM A;  2NZC A;  4XIU A;  2QIF A;  4F4W A;  1SV5 B;  4ZCK A;  1OIA A;  2VG5 B;  4LRB A;  1ZZN A;  2H4Y B;  2HFV A;  1G4C A;  4J9O A;  4FXE A;  4DX5 A;  2A6M A;  4DPW A;  3DRP A;  2K5J A;  2CPE A;  1T3O A;  4KAI A;  2N7Y A;  1DQA A;  2CYY A;  3I9V 9;  2FGO A;  3ISN C;  4NYO A;  2WVD A;  4UOH A;  1YSJ A;  2KJV A;  3FZ2 A;  3ZZY A;  5EGY A;  4GRS A;  3PEJ A;  1N0U A;  4J91 A;  3QIP B;  1KS2 A;  1N5S A;  1WHW A;  4W4M A;  4WK3 A;  2FVR A;  3VTI A;  3LF0 A;  4OYX A;  1KBR A;  1I6J A;  2M3D A;  3KNG A;  2KVI A;  3LOU A;  4RW4 B;  1P9Q C;  1LK7 A;  3JAM Y;  1R8A A;  3F56 A;  1NK4 A;  1HNX J;  3H4D A;  3G5O A;  3KUE A;  4WTO B;  1SBR A;  1XBW A;  3EGN A;  3QBC A;  3QRR A;  2QMW A;  4P73 A;  3MUR P;  2K06 A;  3HCX A;  2XLJ A;  4WXW A;  1CUL B;  2CNO B;  2FVQ A;  1WC0 A;  4BHQ A;  3W62 A;  3W65 A;  2ZHA A;  3OUY B;  2DYA A;  2A18 A;  5K9F A;  2LXF A;  3TI0 A;  1F3F A;  2B9E A;  1FA0 A;  3QYY A;  3Q0A A;  1VQO S;  2H65 B;  3S8S A;  3PKM A;  4MMO A;  3BQ1 A;  4ENO A;  5H9E J;  4XTT A;  2ZVS A;  3W2W B;  4F7V A;  3WQP A;  2VPZ B;  3CIZ A;  2EK1 A;  3MFH A;  1H38 A;  4JV2 A;  3NBP B;  1TKX B;  1KSP A;  3K8V A;  1YZ6 A;  2D9P A;  4MKY A;  2E5G A;  4JBC A;  1N5V A;  4KYZ A;  4CCH A;  4GKJ J;  3LTO A;  1W25 A;  4DDF A;  3CCE S;  1B64 A;  2KB2 A;  3TVY A;  2UXC F;  2IJN A;  1N34 F;  3KJV B;  3HHL C;  3HT3 A;  1UVN A;  4OX6 A;  3DRS B;  3KJN B;  1KRP A;  1NSA A;  4F3O A;  2H5J B;  1E6V B;  4HEA 9;  2C2E A;  4B9L A;  3SCK E;  3C6T A;  3M8Q A;  4X62 F;  4KSE B;  4C8L A;  1N33 F;  2RBF A;  2HNY A;  2O66 A;  1WEY A;  3T1Y F;  2DO0 A;  2F9J A;  3B6B A;  2QA1 A;  3IBW A;  3I6P A;  3OXL A;  4LRE A;  1C1B A;  1NHU A;  4URQ U;  3IMQ J;  5U47 A;  2W9B B;  1XMO J;  2R2U A;  1AFI A;  2Y3Y A;  1NSK L;  1LK5 A;  2H5I B;  2AJ0 A;  4CQ1 A;  2FY1 A;  4F26 A;  2IRY A;  5LM7 E;  1N8R T;  4K4V A;  1F9E B;  1FVS A;  4DR2 J;  4LRC A;  1Y7P A;  2A2D A;  2HS4 A;  4PWW A;  5BYR A;  5EWG A;  1VRU A;  5T14 A;  5IT9 Y;  4DZ6 A;  4LF4 F;  1HWK A;  1S9E B;  2IYG A;  3CJK A;  3PJX A;  3TZX A;  2AP6 A;  3QGP A;  1LWF B;  2BW7 A;  4URS A;  5D15 A;  4X65 F;  3OTD A;  2CFX A;  3EZO A;  2I2Y A;  1GEH A;  3W3S A;  3JS9 A;  3BYP A;  3OTB A;  1Y9O A;  3L7O A;  4KB7 A;  4CO1 A;  2OPR A;  5J2P A;  3QFW A;  2ZE2 A;  4DX8 H;  3ENQ A;  1Y0H A;  4DV4 J;  4ZLL A;  4IG3 B;  4NA3 A;  4P52 A;  3TZW A;  1B70 B;  5F0U A;  2FJA B;  5KG4 A;  1HI0 P;  5L1L A;  2Z57 B;  2EVZ A;  4BC7 A;  3PCO B;  4Z7C A;  3V81 A;  4X66 J;  3VGU A;  3PW2 A;  2CJK A;  5F3Z A;  3KDO A;  4IG0 B;  4QWB A;  3N6N A;  2UUC J;  2WW8 A;  2AGO A;  3VEB A;  1U1O A;  3TWZ A;  1UJ6 A;  3H42 A;  3V6J A;  1T0T V;  3AH6 A;  3HHL B;  3R97 A;  2X1F A;  2J6T A;  4TY8 A;  2MQP A;  1RWX B;  3TAM B;  4LSN A;  5BR8 F;  3ILL A;  4JI1 J;  3L4B C;  2FQQ B;  1Z2Z A;  3CJR A;  3M2U B;  4F4A A;  2UUA J;  2B9W A;  2DD8 S;  3U1M A;  2BEF A;  1AB8 A;  2NLW A;  3HSJ A;  3W7B A;  2VBY A;  1SUQ A;  3IS9 B;  4OX8 A;  4F4K A;  1TL1 B;  4KTQ A;  3UDE A;  4PXB A;  2YKQ A;  1MLA A;  2CZ9 A;  3OHA A;  4ELU A;  4TLR A;  1UVK A;  1K0V A;  3OR2 A;  2DIT A;  4ZVS B;  5HJX A;  1HD0 A;  1EHW A;  4LF7 J;  5BR8 J;  1IRQ A;  4FVM A;  5B0F A;  3QRQ A;  4X4R A;  3KLF A;  4Z7Y A;  2V68 A;  2YWG A;  1T05 A;  5DRK A;  1C0T B;  4C8M A;  4LUB A;  1I5O B;  4KC5 A;  7AT1 B;  4OZ2 A;  3GJR B;  2BOP A;  3FC9 A;  1RTD B;  1E6Y B;  2EBE A;  5F8J A;  1UVI A;  1PAU B;  1RU2 A;  1TVR A;  4LT6 A;  1RKI A;  4M1K A;  3TX0 A;  1RAO A;  4Z2X A;  2N4D A;  1Z1Z A;  5B0G A;  3CCL S;  4PQU A;  1SXL A;  1A6L A;  2B0G A;  5EUH A;  3TRG A;  3NY0 A;  4ED2 A;  1X60 A;  2CDQ A;  1DUR A;  2LP4 A;  3C66 A;  1FNO A;  2CPH A;  1Q16 A;  1IR2 A;  3A13 A;  2HRT A;  1UPM B;  3LAL A;  5IWA J;  3G71 S;  2E5L J;  1BQM B;  1OPZ A;  2YWE A;  4PPD A;  3JXO A;  3PIO Q;  1S99 A;  4OYO A;  3G6X A;  4A8Q A;  3AOA A;  4EYH B;  1S9F A;  3FQK A;  4RU9 A;  2XC9 A;  3VAF A;  4WFX A;  4TVA B;  1ZA2 B;  3EVO A;  4LR9 A;  2K6L A;  5HK4 A;  2VJU A;  3BBB A;  3R7N B;  1OY9 A;  2O3D A;  1NZ8 A;  1QTN B;  1RT1 A;  2D7S A;  4MFB B;  5BYQ A;  4R8U B;  1XQI A;  2DHA A;  4ED6 A;  5AXN A;  2V50 A;  4YQW A;  3DN9 A;  1URN A;  1YK9 A;  1N54 B;  2GX8 A;  3DOM A;  4Q0B B;  3OLA A;  2MZJ A;  3M32 B;  4I56 A;  2EKN A;  3V4M A;  4NXN J;  1NRK A;  2CQ0 A;  2C1E B;  1MML A;  3PW7 A;  1RUS A;  2R8K A;  1N33 J;  5I3U A;  3M30 B;  2YWW A;  2RE1 A;  2ZM6 J;  2VD3 A;  1RXO B;  2E7W A;  3E8O A;  3VZI A;  3HFZ B;  5K8P A;  1WC4 A;  4LRF A;  1NK9 A;  2QE5 A;  1HWJ A;  1P1L A;  4DPO A;  6FDR A;  3J7Y I;  4J9Q A;  2HZV A;  2NCK L;  5A8W A;  3OJS A;  2CPI A;  4DV5 F;  5IC6 B;  4OZ1 A;  3OTE A;  1VLY A;  3ZNU A;  4GKK F;  3SBM A;  1MWY A;  4P7T A;  1FWL A;  3CMA S;  4AYB D;  3PEH A;  1NH7 A;  4MTP A;  1JJH A;  2AV5 A;  1F0X A;  2DHG A;  2ZD1 A;  1WKJ A;  1X5O A;  3M4X A;  5SZT A;  1JJ2 R;  1AUD A;  4ZP8 A;  1Q8L A;  2MQO A;  1UKU A;  1PSD A;  5A2Q U;  3KLG A;  4U7C A;  2GVD B;  3W63 A;  3KLF B;  4O23 A;  4ZVE A;  3H98 A;  2K29 A;  3LP0 A;  1WNE A;  2CQB A;  3TA2 A;  3CCZ A;  4EYI B;  4ED5 A;  4PWU A;  1Y11 A;  3PY8 A;  2NUU G;  2OTL S;  2J9E A;  4CLL A;  1M1K T;  4ID5 A;  4LBI A;  3VQS A;  3G9C A;  3UWT A;  4E2F B;  4K4U A;  3CIM A;  2EXU A;  2OAU A;  3WIV A;  2ZM6 F;  2KVQ E;  2PFF B;  3M2R B;  1WWH A;  2BBE A;  4DG1 A;  4YR0 A;  3O44 A;  2DGS A;  4RBT A;  4UQG A;  4FF1 A;  1UA0 A;  4A8X A;  1ZAX A;  1ZET A;  1TEL A;  2CG4 A;  3MF5 A;  2BKP A;  3V6H A;  3CB4 A;  2K3K A;  3SFU A;  2KO1 A;  2LA4 A;  3FFI A;  3KJQ B;  3UW1 A;  4HLB A;  2C22 A;  2MLY A;  4AE5 A;  3RG6 A;  5HMW A;  2E1R A;  3AQO A;  4ZP7 A;  3O5T B;  3I31 A;  5AXL A;  5JXS A;  1RTI B;  2G0J A;  2QA4 S;  1S0M A;  1B3T A;  2RKI A;  1HNX F;  3CME S;  5KFY A;  1EQM A;  2CPG A;  3D28 A;  3ETM A;  3IC1 A;  2JEG A;  1S77 D;  2YNI B;  3JSB A;  2V0N A;  5ETS A;  5KFS A;  2C3M A;  3ILI A;  2MLZ A;  3TVK A;  3IO1 A;  2R9L A;  2HVI A;  2CPZ A;  3G6E S;  3GP9 A;  3GV5 B;  1SKS A;  3IRX B;  3D6H B;  1J5O A;  3MM9 B;  3OR2 B;  2FHJ A;  4EBD A;  4ZVG A;  5ETL A;  3FSY A;  5F0W A;  3ZZO A;  5DLG A;  3UO0 A;  1WG4 A;  5J1E A;  3BV8 A;  2YNF A;  2D74 B;  4M5M A;  5MLC V;  2VF3 A;  3A1Y G;  2YPZ A;  3I0R A;  4YR2 A;  4ZLN A;  3I55 S;  3ZZU A;  1U02 A;  3QT6 A;  4UST A;  3D3B J;  3D6M B;  5ETP A;  1YQH A;  4DL3 A;  4XDC A;  2DR6 A;  4PG7 A;  2VON A;  4H54 A;  2PO4 A;  3CCW A;  2UV8 A;  2O5D A;  2V8D A;  3R8Y A;  3HZG A;  2GJ2 A;  3JSM A;  3A4T A;  3TA1 A;  2QTW A;  1AA1 B;  1CPZ A;  3OTC A;  1TU0 B;  1X5S A;  4JI6 F;  4TN2 A;  4IG0 A;  4AAI A;  3EZU A;  5KOX A;  3GB0 A;  4OI6 A;  1R27 B;  2YKN B;  3LO3 A;  4HDH A;  4WU3 A;  2IC3 A;  2FTR A;  2XI2 A;  2UUA F;  4YB5 A;  3R5J B;  4K8R A;  4ZVQ B;  5JVG Q;  2LVW A;  2F9D A;  2W2N P;  1WF0 A;  4OMF G;  2I6W A;  3VAH A;  3RR7 A;  4B3M J;  3TQ1 A;  4FF4 A;  3PXG a;  3MHY A;  3IR7 A;  5AJ3 F;  2RU3 A;  1TKD A;  4UF4 A;  3O3L A;  1TKZ A;  4WYW A;  3PYF A;  3K5M A;  3N5F A;  2KM8 B;  2DRA A;  4X4U A;  4ETZ A;  4F2S A;  1PJ6 A;  1YDL A;  1UEU A;  2CIM A;  2RQ4 A;  3FMW A;  2AJ4 A;  3GR0 A;  3I5A A;  3NBP A;  4K7Q A;  2XM3 A;  1UFL A;  2CJB A;  4X65 J;  1HWI A;  1REG X;  3MAQ A;  2ABY A;  3A8I A;  3WC2 A;  1NSQ A;  3H8Y A;  1O6X A;  1RQ0 A;  5KG1 A;  2IC3 B;  1WTF A;  1B7F A;  3PO4 A;  4IRC A;  1XEZ A;  1N32 J;  1NKC A;  4PAA A;  3RYL A;  3K5O A;  1PAR A;  4NL5 A;  1PAE X;  1KEK A;  2OTJ S;  2HS0 A;  3AJ1 A;  1CLF A;  3V4I A;  3L09 A;  2D69 A;  3OR1 B;  4CO0 A;  3QNW B;  2MST A;  4NWB A;  1LWE A;  1LV5 A;  1VQ5 S;  4L73 A;  4DUZ J;  1IKX B;  4UZC A;  1FDB A;  1X4F A;  3RBX A;  4CNY A;  1NLK L;  2G0C A;  4DSF A;  1TK8 A;  3P49 B;  2LEB A;  4GVB A;  2OEM A;  3AT1 B;  4ECV A;  3KJV A;  4WKR A;  1AXQ A;  2F8M A;  1NJW A;  4WJB A;  2WB1 D;  1HBU B;  1URR A;  5J2P B;  4DV2 F;  2E5I A;  3HF5 A;  1BXN A;  1RAJ A;  3DDI A;  4LFA J;  4B17 A;  1TL7 B;  4DX7 A;  3LGN A;  5KFX A;  2R8J A;  2VUG A;  3D0H E;  1BQN B;  3VGS A;  1HNV A;  1FF2 A;  1DTQ B;  3KLH B;  1MRO A;  1RT5 A;  4AXI A;  4ZCM A;  3DLK B;  3ENA A;  5K8N A;  1NK0 A;  1I94 F;  4G65 A;  1HBO B;  2PEB A;  4DR3 J;  3M6U A;  4UW2 A;  4DLE A;  4RR5 A;  4F4Y A;  1IBK J;  3HVT B;  4C0O C;  2DH9 A;  3RUB L;  5J2Q B;  4IQX A;  2D1C A;  3HI9 A;  3BGR A;  1PO6 A;  2D3U A;  2FYX A;  2NPI A;  2M0G B;  2Q1L A;  3MMB B;  1AYE A;  1WAC A;  4KHR A;  2RUG A;  3VF0 B;  2QYG A;  3WBZ A;  5KG0 A;  2HNY B;  3VW4 A;  1KLM B;  1WHV A;  2MZR A;  4ZIV A;  3MI7 X;  4DOZ A;  1X93 A;  2W01 A;  3EVW A;  4RKU C;  1QSL A;  4DSJ A;  2M70 A;  2Z2Y B;  2KTQ A;  3I4P A;  1VQP S;  5AE1 A;  4KPY A;  5KT6 A;  4OV1 A;  1RT5 B;  3MCO A;  2GML A;  3OQ2 A;  1XR7 A;  2O01 C;  1LFW A;  4N47 A;  4FNI A;  4DPT A;  4ES3 A;  2KI2 A;  3H5U A;  1WUU A;  1B0T A;  1P8G A;  4WZM A;  4M95 A;  2NR0 A;  2VFU A;  4CLW A;  1UZH A;  3PHT A;  3RGI A;  3MM9 A;  4I6Y A;  3EGV A;  3A8E A;  2FUG 9;  1HI1 A;  2HKE A;  2JXI A;  1IM6 A;  1JK9 B;  1LEO A;  3W2W A;  3W5Z A;  4YME A;  5KFQ A;  1RCX B;  4GVB B;  3SSQ A;  2KKE A;  2ALY B;  3KLE A;  1VQM S;  2Q2K A;  1KHW A;  2VG5 A;  2Z0G A;  2ADL A;  5IWA F;  2Y0B B;  4YFU A;  1RTZ A;  2WB4 A;  2DNQ A;  2KU7 A;  3Q89 A;  1T95 A;  2PGC A;  3DLE B;  5K14 B;  5G4D A;  3PYG A;  3SI8 A;  1IBK F;  3JB9 k;  4W90 B;  5IT4 A;  2UVV A;  1VBY A;  3KTQ A;  4NA2 A;  4OX9 F;  4C98 A;  2NRE A;  3EXC X;  5T7L A;  3VR1 A;  1U0S A;  2JDJ A;  4KKO B;  5HVH A;  2KEL A;  1RAE B;  3GCX P;  2RQK A;  4YN3 B;  2DXF A;  1RZM A;  3EM1 A;  2FD2 A;  4OI1 A;  4LVN P;  2CKW A;  2XMU A;  5MAO A;  3ULH A;  3M8R A;  2BA9 A;  1NPP A;  3DOK A;  1IBM F;  2KXN B;  3VHQ A;  4DUY J;  5FLX U;  3OV7 A;  3BSC A;  3DRR B;  1S0O A;  4ZLP A;  4NLG A;  4NXN F;  4I64 A;  2MHE A;  4DV5 J;  5LJ3 Y;  2W1B A;  1LWC B;  4G1P A;  2HMI B;  1W2I A;  4O3O A;  2XZD B;  3DOM B;  2EFN A;  4OZ3 A;  2M88 A;  3I82 A;  2OJ3 A;  4ELV A;  4ZP6 A;  1IM4 A;  2HND A;  1RBA A;  1LW0 A;  1SCJ B;  1VDH A;  5A8K B;  5GAD U;  2QT7 A;  2P9C A;  3MMA A;  3SZ2 A;  1VC5 A;  2J76 E;  1UWB A;  2AEM A;  2VAS A;  3V5R A;  3VGV A;  2DH7 A;  4M5D A;  1N5Y A;  4JV5 F;  2CWX A;  3TW0 A;  3JYT A;  3GV8 B;  4EI2 A;  2L9W A;  1XTZ A;  3T1H J;  3CO0 P;  4QPT A;  3TQE A;  1R0A B;  4P72 A;  1WSR A;  2B4P A;  1S0V A;  4JI5 F;  1S6U A;  4USV A;  5DM7 Q;  5F41 A;  2B5J B;  2GGP B;  5I3Q A;  3FEY B;  2ZH7 A;  1Q4R A;  2HWT A;  3P8B B;  4BWM A;  2JH3 A;  4ERD A;  1GFW B;  2QGF B;  4C97 A;  5C42 A;  2H3E B;  1HQU A;  3QSI A;  3PIP Q;  1H2V Z;  3GFX A;  3AA9 A;  3BQ0 A;  3FBC A;  2ROG A;  2DHS A;  3IFE A;  2ZHB A;  3RR8 A;  4WKY A;  1FJG F;  2DKO B;  1MWZ A;  3NGK A;  3M1V A;  2LQ9 A;  4E0D A;  3OXF A;  1TQL A;  2DGX A;  1ZH5 A;  2WW4 A;  4PYA A;  4IR9 A;  4HHU A;  3A3P B;  1QM9 A;  1HW9 A;  4UY8 5;  4OHV A;  3LPY A;  1LQ9 A;  1WOP A;  4W98 A;  4O3N A;  2Z8Q A;  2XYG B;  1DQ9 A;  1Q7L B;  2PII A;  3D3C J;  3ENV A;  1NBE B;  2BMB A;  1VR6 A;  3LP2 A;  2RQM A;  4KBI A;  4PXC A;  1HNZ J;  4RNH A;  3UDC A;  1CJT B;  1OMS A;  3NGR A;  1NZA A;  4ZK7 M;  3POT B;  3J80 Y;  2QEX S;  4KHP F;  1R8H A;  3CD7 A;  4L74 A;  1TR0 A;  3DI6 B;  2BX6 A;  3KLI B;  2XNR A;  2NPF A;  5KG5 A;  1PBA A;  2GAH C;  2Y1R I;  2JEJ A;  3HD1 A;  5EWE A;  1H98 A;  3UN5 A;  4DL2 A;  2RUS A;  3C19 A;  4HT5 A;  1JLC A;  4NXM F;  1SL1 A;  3MMC A;  1FT8 A;  3HHL A;  2GHV C;  3KLI A;  3OBI A;  2XB2 D;  4RW9 B;  2LXI A;  2E1C A;  4PG8 A;  4JOU A;  1UP1 A;  4CLT A;  2WK4 A;  1ZM2 A;  2OHD A;  4OI3 A;  3TJA A;  1YJT A;  1SC3 B;  1FES A;  3PKY A;  4J9V A;  4P74 A;  2DR8 A;  5D4P A;  2DXD A;  2N7C A;  4MYT A;  4N76 A;  1FDA A;  5DZ6 A;  5A8K A;  2VOD A;  2JLG A;  4DS4 A;  1V3R A;  2DXE A;  4RNM A;  1W2B R;  1NB7 A;  3PFO A;  2J6U A;  4H4O B;  3DLL Q;  4FN5 A;  2M8D B;  2BJD A;  4JI8 J;  1X4D A;  2QX0 A;  1TMM A;  2KFN A;  4ZPW R;  2MKI A;  4R5P B;  1M1G A;  1YVF A;  4DFJ A;  3PV8 A;  1QY7 A;  2DNO A;  4EO8 A;  3DOK B;  5ETN A;  4DQQ A;  3K17 A;  4JP8 A;  3PAC A;  1QAY A;  1RB0 A;  1YG0 A;  2GIQ A;  4FZV A;  3TYT A;  1NH8 A;  4ED7 A;  1Y5I B;  2HQG A;  3K58 A;  2UU9 F;  2BRK A;  4M5K A;  1BWE A;  4WII A;  1RJJ A;  1SIW B;  1U8S A;  2KRR A;  4F04 B;  5B08 A;  1REV A;  1K0T A;  1RAA B;  2VBZ A;  5FLX Y;  2B6A A;  4WCE Q;  4CTA B;  2RRN A;  1IJE B;  2CJQ A;  3QJJ A;  3TUP A;  3HMJ G;  1FFW B;  1C2P A;  1RT2 A;  1N56 A;  1U24 A;  2A0F B;  2PD1 A;  1RTH A;  2PEH A;  3G96 A;  3BO3 A;  4QIF A;  4WK1 A;  2OH2 A;  4Q0B A;  1WEL A;  2ZOF A;  3KOA A;  4W92 B;  4DPX A;  2VZ9 A;  1NU4 A;  3U7J A;  2DR5 A;  4BDP A;  4DPY A;  4RW6 B;  1HMV A;  4ZKA A;  7FDR A;  3UCU P;  2QN6 B;  1RI7 A;  3RRG A;  1GMW A;  1UET A;  4PPZ A;  4X84 A;  3A3O B;  4K2X A;  5CAB A;  3KK3 A;  3CVK A;  2BE2 B;  1IKW B;  1JX4 A;  1ZM9 A;  2OPQ A;  2ACY A;  5HQL A;  3HKZ D;  5L9N A;  2ZH3 A;  2VQE F;  3W8P A;  4F8R A;  4UT4 A;  2CJX B;  1T9U A;  4DL5 A;  5C42 B;  5KFH A;  2U2F A;  1QE1 A;  4OYZ A;  2ZJQ Q;  4K5R A;  3JQK A;  4Y65 A;  4OJ3 A;  1VYA A;  2W24 A;  3D54 A;  3AHP A;  3MOZ A;  5JMN A;  1YTY A;  5KFG A;  3EGZ A;  4C8Y A;  1N32 F;  1OS5 A;  4CDI A;  4Q8F A;  1FWP A;  2J8A A;  2BXJ A;  2ZH2 A;  2V69 A;  3POT A;  4CYU B;  5DQH A;  4WF9 Q;  3CCS S;  2R7R A;  1OSD A;  2X1G A;  1HR0 J;  1HHT P;  4M5D B;  1E6V A;  4EBE A;  4YEA A;  2V8H A;  5F8H A;  3OD2 A;  3RJM B;  3VVT A;  2A2B A;  3QZ7 A;  2FB0 A;  4EFA C;  5IZH A;  4DV3 F;  1MNT A;  2YKM A;  1EET B;  3I5B A;  2GW8 A;  1K44 A;  2R2R A;  4O4G A;  3VAJ A;  1KTV A;  2OPR B;  5GVQ A;  4NZ7 A;  1YX2 A;  1XN9 A;  1ZM4 A;  5CD4 H;  1DLO A;  2Z30 B;  1YLX A;  2RU9 A;  4HAC B;  1UPP A;  3CCQ S;  5DQI A;  3Q8R B;  3QMQ A;  4Y28 C;  3RZA A;  2R8G A;  3MEG B;  1R43 A;  2JVR A;  3M2U A;  4L3N A;  2C2D A;  1U6Z A;  5CYJ A;  3IG1 A;  2ZBI A;  5GAE U;  4QYZ J;  1SH2 A;  1JIH A;  4IOC Q;  4X4O A;  2J0X A;  1TV6 B;  2VG7 A;  3FUY A;  1FKP A;  3OVA A;  2FLL A;  5DS7 A;  1KNZ A;  3JYT B;  1HNW F;  2YX1 A;  3IR5 B;  3K57 A;  1YHQ S;  4B3S F;  3BSN A;  3V81 B;  3QID A;  4CLU A;  2E29 A;  2O1P A;  4OLO A;  2ZC3 A;  4FYX B;  1KN6 A;  1S1T B;  3W2V B;  3LWL A;  4RX6 A;  1LW0 B;  2VDI A;  5CYM A;  5HSP A;  1SC1 B;  1MRO B;  3Q8Y A;  4FYV B;  4EK2 A;  3PW5 A;  1JXL A;  3J7A 1;  4OI0 A;  1VQL S;  4QIG A;  2XUL A;  3M8Z A;  4LF6 F;  3BGL A;  1DFD A;  2WSE C;  1JLQ A;  3LQV A;  3MPU B;  9RUB A;  1N5T A;  3EE3 A;  1WOS A;  1P94 A;  3ZTR A;  2EEY A;  1VJQ A;  2BUN A;  4FPR A;  3RU0 A;  3UE2 A;  2AYG A;  1CJK A;  4AXJ A;  4A47 A;  4RZR A;  2WOM A;  3I96 A;  4GO5 X;  1Y00 A;  1ICE B;  1S97 A;  2F1F A;  4QCL A;  1U45 A;  4DR6 J;  4ES1 A;  4DV7 J;  4AL7 A;  2HGM A;  1IQZ A;  2F5G A;  1JXE A;  1M1H A;  3CJ0 A;  4RL1 A;  1DJ0 A;  3LW5 C;  5K8M A;  4QWD A;  2ZBC A;  1OJ4 A;  1T94 A;  2MJN A;  1NDP A;  1OQ3 A;  3D66 A;  2AY0 A;  2CJA A;  2OI2 A;  4Y2A A;  2ZVI A;  3GLJ A;  3PR5 B;  3FBB A;  3BZQ A;  3G8S A;  4RBU A;  4KGV B;  2VOO A;  3SEO A;  1HBN A;  4NI2 A;  4YUD A;  4IUF A;  3OFG A;  1B0V A;  4DSL A;  3T1H F;  3TAQ A;  4LRD A;  2PA8 D;  3BPD A;  4L3K A;  2BE7 D;  4TKT A;  1GX5 A;  3P45 B;  4DN9 A;  1VQ7 S;  3T41 A;  1HQ2 A;  3EVM A;  1TL7 A;  3ITH A;  5EDW A;  2I8E A;  3SSR A;  1CJU A;  2W4D A;  4EBC A;  3HLU A;  1HQE B;  4I2P B;  1NDC A;  1FK9 A;  4A8O A;  2SXL A;  3G8Q A;  2V9K A;  2AYM A;  4Y2C A;  2VL1 A;  1EET A;  2LDI A;  1Q5V A;  1XIQ A;  1OPI A;  1B7Y B;  1HI8 A;  1N5Q A;  2QL5 B;  4K4X A;  4AND A;  2FZK B;  3FJ2 A;  2G13 A;  1IR0 A;  1VK8 A;  4DUY F;  1S1W A;  1S9G A;  2YWF A;  3NOG A;  1WC6 A;  2HQF A;  1RTI A;  4C8Z A;  1JKH B;  4F3M A;  2VG6 A;  2KDO A;  1JJC B;  2B7C B;  2B51 A;  2HVE A;  4YDD B;  1K47 A;  4N77 A;  2YY3 A;  4NLQ A;  2FHO B;  4WYL A;  2ATC B;  4LRA A;  5E7O B;  3IG1 B;  3FFI B;  5ETR A;  4DUT A;  1IXK A;  2XZT B;  4B9N A;  3FMT A;  4JV0 A;  2HFZ A;  4HKQ A;  2HHX A;  1FKA F;  3WHI A;  1ELO A;  2IJR A;  3DYA A;  1UEV A;  5CZX A;  1JLA A;  2E1P A;  4DG1 B;  1BQN A;  1HWU A;  1VHF A;  4NLT A;  3J7Z 5;  3V6D A;  5HRO A;  3CC4 S;  1NSP A;  3G86 A;  3JQJ A;  2OLW A;  3ITH B;  2QMX A;  4IO1 A;  4WU2 A;  1ZAW A;  3SCI E;  4IDK B;  4BC9 A;  2DH8 A;  1WKL A;  4X64 J;  2B3T B;  1TP7 A;  5L1J A;  1MNE A;  3VQT A;  5F9N A;  2ERR A;  1KLN A;  2MLX A;  2DK2 A;  5HMX A;  3CC2 S;  4A8W A;  2R7V A;  3A8K A;  3K5L A;  2M4M A;  2ZWO A;  2BR0 A;  4M63 A;  4OFZ A;  1R0B G;  3MPY A;  5CYQ A;  1RE1 B;  2OFG X;  4KRW A;  3MMC B;  1N36 F;  5KFP A;  2H9Z A;  4JI7 J;  1BY9 A;  2ZOM A;  5GAG I;  4HV0 A;  1U26 A;  2M5Y A;  1QAX A;  4RU2 A;  3DI6 A;  3MEG A;  4XPC A;  1DRZ A;  2W2Q P;  1MYL A;  1WI8 A;  3NS7 B;  3V2U C;  4K4W A;  4DV2 J;  4ECQ A;  2C28 A;  1IKW A;  1ZYQ A;  1FX4 A;  2HQI A;  3N6L A;  4DL4 A;  1CEZ A;  5GAG U;  1HHQ A;  4QIV A;  1X4B A;  2DGV A;  1GQE A;  1DBD A;  2DIS A;  3ZXW A;  3D0I E;  1AZS B;  4ZMM A;  3HX9 A;  4B3S J;  1CVJ A;  4K0K F;  1YJR A;  5J2N B;  1YJU A;  2GVD A;  3C3L A;  1BWV A;  4OHZ A;  1YGY A;  3VAG A;  2PDA A;  2BM1 A;  3C16 B;  2YX4 A;  3MUT P;  3K8W A;  2ZZM A;  1ZZF A;  1U47 A;  3QJP A;  1TK5 A;  4RW8 A;  4ZOS A;  4X4Q A;  1NO8 A;  2KRB A;  3IA0 A;  1FKP B;  2GV1 A;  3P96 A;  5CCM A;  2MDA A;  2MZ1 A;  5F8L A;  2HG4 A;  2CA9 A;  1Q16 B;  4NA1 A;  3KYL A;  2UUB F;  5B0E A;  4ECY A;  5DET A;  3LAK A;  2K3I A;  1DTT B;  2JFK A;  4USW A;  4PWD B;  4U8V A;  2CWK A;  4WIQ A;  1Q95 G;  5DDQ C;  2CPX A;  2H4W B;  5ETM A;  4UOG A;  4J9K A;  4DSE A;  4J90 A;  1U6F A;  3LGH A;  4ECW A;  2UXD J;  3B82 A;  4ZPT R;  1S48 A;  1S1X A;  4U8Y A;  4HAC A;  1YZ7 A;  2Z4P A;  1Q8I A;  1Y5L B;  4HR2 A;  2HYI B;  2WZ1 A;  1H72 C;  1WF1 A;  2Q6C A;  1C0T A;  3MTK A;  1GNK A;  3HVR A;  4X2B A;  1K1S A;  2HHS A;  1F6T A;  1U4B A;  3P4U B;  5IFM A;  3K89 A;  2HVH A;  1AZS A;  2ADC A;  1NPK A;  2G9O A;  2HLT A;  2MQM A;  3HSD A;  4Y6I A;  3X3U A;  3VAM A;  3CCJ S;  3C2P A;  3GJQ B;  4P9S A;  4JI6 J;  1PGZ A;  2VB6 A;  5D4N A;  2YX7 A;  3DLB A;  3TJ8 A;  2OPS A;  3MM6 B;  3QFH A;  4R25 A;  1REV B;  2DNL A;  4CT9 A;  2QMU B;  4XAK A;  2E44 A;  3CUN A;  4AT1 B;  2B8P A;  3THP A;  5J1N A;  1WOO A;  1S4F A;  2V2Z A;  2D3O R;  4LF4 J;  4OI4 A;  4PG4 A;  1NK7 A;  2ILZ A;  2BJ9 A;  1U0H A;  1VMB A;  4HTI A;  2RIJ A;  4FYY B;  3SQO P;  2M9K A;  1IBL F;  5C7P A;  2X7I A;  1R8B A;  3QSY B;  2QA4 G;  5K14 A;  1OSC A;  3H2V E;  2NSB A;  4KIA A;  3NCQ A;  4ZJO A;  3W9I A;  4PUO A;  1FRX A;  1ARR A;  3T1Y J;  3R2C J;  2YTC A;  5ETT A;  3EZ5 A;  2KZM A;  2JC1 A;  2RIL A;  4YS2 A;  3K5N A;  4DCP B;  1Q1K A;  1UEK A;  1KON A;  4O3S A;  2BJ3 A;  2RDJ A;  5IV4 A;  4Q2L A;  5KFD A;  4JI7 F;  2A2C A;  2QRR A;  5HAN A;  5FD1 A;  1GXU A;  2H51 B;  5KFK A;  2QL9 B;  4LSL B;  2RB7 A;  1DAR A;  2FVP A;  5I3P A;  4RNN A;  4FKX A;  5HQM A;  3ZFV A;  5HBM A;  1FE4 A;  4QU7 A;  4DQP A;  3I9Z A;  4WP8 A;  4P2S A;  4FXW A;  3CJK B;  2FVC A;  2GC8 A;  2IDE A;  3THT A;  1X9M A;  4X4N A;  1RWN B;  5J1P A; 
#chains in the Genus database with same CATH homology
 2AY0 A;  2CAD A;  1BDT A;  3QSI A;  3FT7 A;  1PAR A;  2H1O E;  2JXI A;  3H87 C;  1BDV A;  1ARQ A;  2JXH A;  2FGC A;  1ARR A;  2GPE A;  1B01 A;  2BSQ E;  1Q5Y A;  1QTG A;  2HZV A;  2CAJ A;  3VW4 A;  2WVB A;  2BJ3 A;  4ME7 E;  3FMT A;  3VEA A;  1X93 A;  1P94 A;  2NZC A;  2PC6 A;  1U9P A;  3BKF A;  2K9I A;  3BKT A;  2WVC A;  2CA9 A;  3GXQ A;  1B28 A;  4FXE A;  2K6L A;  1IRQ A;  2BJ1 A;  2JXG A;  2WVE A;  2BJ8 A;  4HV0 A;  2RBF A;  2K5J A;  1EA4 A;  2BNW A;  2KEL A;  1MYL A;  2WVF A;  4D8J A;  2BNZ A;  1Q5V A;  2F1F A;  2Y3Y A;  2WVD A;  1NLA A;  2HZA A;  3OD2 A;  1MYK A;  3LGH A;  3VEB A;  2BA3 A;  1BAZ A;  2BJ7 A;  3QOQ A;  2CPG A;  2CAX A;  3BKU A;  2BJ9 A;  2K1O A;  3PHT A;  1MNT A;  2K29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...