2WVDA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
133
Chain Sequence
KDDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLSTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 32
structure length 133
sequence length 136
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvdA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvdA02
2K1OA 1ARRA 2K29A 2BNZA 1Q5VA 2FGCA 2CPGA 2BJ9A 2PC6A 2WVCA 3VEBA 2WVEA 1EA4A 2WVBA 2JXHA 1ARQA 2HZAA 3QOQA 3LGHA 3FMTA 3VW4A 2KELA 4ME7E 3PHTA 2CAXA 2BSQE 1B28A 1Q5YA 4HV0A 2WVFA 3FT7A 3H87C 3BKUA 2GPEA 1PARA 1BAZA 3GXQA 2BJ7A 2WVDA 4D8JA 1QTGA 1B01A 2HZVA 1X93A 1P94A 2AY0A 2K6LA 3OD2A 2H1OE 3BKTA 1MYKA 2RBFA 3VEAA 1BDVA 1MNTA 2BJ3A 2F1FA 2JXGA 2NZCA 2CAJA 1NLAA 2K9IA 3BKFA 2BJ8A 2K5JA 3QSIA 2BNWA 2BA3A 1IRQA 2JXIA 1BDTA 4FXEA 1MYLA 2CADA 1U9PA 2CA9A 2BJ1A 2Y3YA
chains in the Genus database with same CATH superfamily
3H5YA 1Y5NB 4YB5A 4DBQA 3PW2A 2V2VA 1TMMA 2YWEA 3MMAA 5D6GA 2XCAA 3KK3B 5IT9U 2GQQA 2PFDA 4NA3A 3SCKE 2FLOA 3B78A 1N0UA 3UE2A 1S7HA 3NS7B 4NXNF 3FMWA 1JNRB 3K8VA 1V3RA 3QPIA 4O0NA 3SBMA 5AXNA 3HKWA 2R8GA 4W92B 1TQLA 2R7RA 3R2DJ 2NZCA 4EUVA 3A3OB 3GLJA 1S6OA 5KFLA 2YNFB 4QW9A 2H5JB 3E01B 3NWGA 2AGOA 3TI0A 2MSSA 1UVJA 3B4MA 1IBKJ 3EXYA 3AB4B 1Z4UA 2VFSA 4DV7F 1N54B 3RZAA 3ITHB 4DV5J 1HWUA 1KP6A 2EFPA 2JOQA 4OX6A 5HLFA 5I3PA 4K4XA 3CXCR 1U1RA 4KJIA 3BYPA 4U8YA 4M5JA 2BKOA 2IIHA 4LIWA 5IWAF 3CJKB 1UETA 2JLEA 2XWXA 5EGYA 4UQGA 3LGHA 3K89A 2VPWB 4FNIA 3LW5C 2EK1A 4LSLA 4TU7A 4C8OA 1HL6A 2PEHA 4IOCQ 1NZ8A 1R8PA 1UMJA 2CQ1A 5HROA 4HHHA 4X65J 4ZLJA 5CABA 2X7IA 3LO3A 2ACMA 5E7OB 3JSMB 5A8RB 4FXDA 4KFBA 1BQMB 3I4HX 4KB7A 5A2QY 3ET6A 2R42A 3NRBA 3TQEA 5HP1B 1WKJA 4DF8A 4ERDA 2GFFA 2ZBQA 1HR0J 4PCQA 3MUVP 1J27A 4DL4A 1HNZF 1FRXA 2QIFA 4R5PA 5ETRA 3CCVS 2ALZA 2L9DA 3TEHB 1MWYA 4F4XA 4L74A 4HT7A 2LDYA 4CLKA 2MQOA 1C1CA 4JI8F 2P2CB 4GKJJ 1RACB 2MJNA 2RH3A 1FDAA 2XMTA 1JLFB 1TP7A 3S01A 1WSRA 1S12A 5H1SV 3QZ7A 2AZ1A 2HHWA 2CJQA 1NU4A 3FSIA 2QEXS 3IBCB 1S1VA 4G1QB 4B3MJ 3ETMA 2H48B 2QLFB 1OPIA 2ZD1A 1Y7PA 4KV8B 2I5JA 2IFXA 4LRDA 1L3VA 4KV8A 3F41A 1DHMA 4OJHA 3EVOA 3W60A 3VVTA 3PW5A 3KTQA 4UY8T 3NNAA 3HVWA 3MM6B 1XR6A 2CG8A 3N0VA 3UVJB 3PR5B 3PW7A 2IA6A 1W2BR 4P72A 4KYZA 2C2KB 3HXMA 4MKYA 1YX2A 2FUG9 5SUHA 4EGLA 1F9FA 5KOXA 3OD2A 2NUHA 1WC6A 3SFGA 2D41A 1SC3B 3BKFA 4L3NA 1HMVA 2Y1JA 2I6WA 3D6HB 4ECQA 4I2PB 2KG0A 3PV8A 1KLNA 3SIPB 1LKZA 4OX7A 5B0GA 4ECYA 5KT3A 3MCSA 2MZRA 2OPPA 4CLFA 2VA2A 2OPSA 4KGZB 3DOMB 2EFVA 4ECSA 2QG9B 3UNYA 2MHNA 4DL0C 3EXCX 4OYWA 4C98A 4DOZA 1FNOA 3NG8A 4DR7F 4U7UD 3FMBA 1OY6A 1JK9B 3QT6A 3OR1B 4BC9A 2G0CA 2V8VA 1S9GA 4RJVA 4WXOA 4GC6A 3UD3P 2AEJA 3N28A 4H54A 2KOEA 3TP2A 3HK2A 4OX8A 2VODA 4NEYA 1QY7A 3WC0A 1TKXA 2HK2A 2FVCA 4U8VA 2A6OA 1RWXB 3THVA 4PXEA 1REGX 3JQJA 3V81B 2KXHA 1O8BA 3OT9A 1S6QA 3D6MB 3SCIE 3S8SA 3CCRS 3AY0A 3OVBA 1RE1B 3IAM9 3CJ0A 1VRQC 3MM5B 5IT4A 5B0EA 4ZIWA 2FJXA 2L08A 2ZE2A 5FLXY 4L6V3 2CPIA 3HVAA 5J2QB 1T02A 2Y1LB 1F5BA 5D0EA 3ZTOA 2EFGA 5CA5A 2JFKA 3TZXA 1P9QC 4DF4A 2L41A 4EBDA 2RRBA 4J37A 2LQ9A 4I6AA 1VC0A 1T05B 2DCLA 2EC2A 2HNDB 3KLFB 1GEHA 3GV7B 1YTYA 2HQFA 1XR5A 2WONB 4NOHA 4DL7A 4ZP6A 2DJWA 3DRSB 1DTTB 1RKJA 2E44A 5DJBA 4F4AA 4P2MA 1JXVA 4LRBA 3Q86A 2X1FA 3IWXA 3BBCA 3JAMY 2VF3A 5A2QU 3ZTQA 1RGVA 5EX0A 3RAMA 2IAJA 1MNTA 3IM9A 2OTLS 3G8TA 3M2VA 2B43A 4Y2CA 4LF9F 2CJAA 1W25A 3CCJS 3JB9k 3QQCD 1EETB 4RPFA 5E3PA 1QSSA 2XNRA 4KH1B 4LFCF 2MQMA 5DLGA 3K5OA 3HHEA 1ICEB 2DNGA 4F0HA 2AW0A 3W5ZA 4C48A 2VQEJ 1YDLA 3IO1A 3B54A 1DQ9A 1RTJA 1V6HA 2DNZA 1N36J 2MB0B 4RR5A 4C8LA 1QLNA 1CJVA 1PC4A 4OYBA 5FDLA 5GAEU 2E29A 2JVOA 1LWEA 1LQ9A 2KYZA 4OLPA 1MROA 1SL2A 1DQ8A 1X31C 1D9FA 1KHWA 5HANA 3UN5A 1HBMB 4WFAQ 4L73A 4Y2KA 2VL1A 3KNAA 3V6JA 4USHA 1SH2A 3D67A 1VQ9S 3IRXA 2F63A 3FCWA 4USVA 3SSQA 1BGXT 4ZLPA 3G9CA 1DFDA 2KM8C 1RAHB 2Y1RI 2QA2A 3AJ1A 4AL6A 2VQEF 4WXWA 3M8YA 4LUBA 4M94A 3TZYA 5CYMB 4LSNA 1F1BB 1WELA 2Q6CA 4I56A 4EO8A 3NNHA 2QSFA 2EG1A 2QN6B 3G6VA 2FC9A 4ZN3A 4NPOA 3X1LB 4F2SA 4K5SA 1QJHA 3AXMA 1T03A 1NSQA 1NDLA 3ELHA 2CNOB 1RU2A 2W8KA 2HZVA 4AAIA 1FWKA 2HQ3A 1X93A 2K3IA 3A3PB 3MMBA 5LJ3Y 3KHLA 1HLWA 5ETPA 2W9BA 4RWXA 3TO8A 1L3KA 1NO8A 2K7KA 2M9KA 4RBTA 2F3JA 1SC4B 1TMJA 2GQCA 2F7VA 1U1LA 4M95A 4QCLA 4R8UA 2OFHX 3DLKA 1GXLA 2H1YA 1Q16A 4M5LA 1TL7A 3JYTA 1RWOB 1YZ6A 3A8KA 4K2XA 3OTEA 5J1EA 2XMVA 1LWFA 1S0OA 2X1GA 4OX9J 3OR2B 1Z2ZA 5HVFA 4K4WA 4DQSA 5LMUF 4G6VB 3UR3C 4DQRA 1CG2A 2W4DA 3L4BC 2J0SD 5ETVA 4LF8J 1NH8A 1Y00A 2AZ3A 2LQJA 4FYXB 3AJDA 2CQBA 2HRUA 4M63A 4RUAA 2OLWA 1DLOB 1FD2A 3POTB 4HDHA 3ZZTA 2VG6B 3JQMA 3OBIA 1RT5A 1SL0A 5F8NA 1HWJA 4NLSA 3M2RB 5IT0A 2RKIA 4LQ9A 2BM0A 4FF2A 2RJZA 5ETMA 4ES1A 4YP3A 3GP9A 3SEOA 1IBLF 7FD1A 1RTDB 1E6YA 1RAGB 4B9TA 2H9ZA 4PEOA 3SFUA 4WP3A 2I2YA 3DOKB 2JFDA 4BHQA 3AD9C 3M8PB 2POKA 4A8SA 3NBPA 1SV5A 4TVAB 3T1YJ 4DX5A 3KLEB 3UI3A 1B70B 3UN3A 4M5IA 2QLJB 4U95A 3CDEA 1KD1T 1UVIA 3VEBA 2AX0A 4P2XA 3PKYA 1NB2A 2QLXA 1NUEA 1HBOA 1OQ3A 2CAXA 3PX0A 4DSKA 3QMQA 1RT3B 2UXCJ 2GJIA 1EAYC 3PFOA 2XYGB 2R7XA 2C3UA 3RBXA 1F5CA 1QUVA 3IA0A 3AOCA 1WDTA 3NGKA 1RP5A 4GO7X 4HACA 2A2DA 3D0IE 1JLBB 4HACB 2EBEA 1X5OA 3IRXB 1HNZJ 2RMLA 3C15B 4ECRA 4I67A 5KFNA 3CULA 4WFBQ 1WHYA 2P5VA 4AT1B 3QIPB 4F3MA 2VOOA 1ZM9A 3MFIA 2ZJQQ 2LMIA 3H4DA 3D2WA 2W25A 1MROB 3KG0A 2KT3A 3DRYA 4LBHA 3W8GA 2UVRA 1YVFA 1RLCL 2BNZA 2WW4A 4OJ3A 1PILA 5B0AA 2CJKA 3PJ9A 1JXEA 1N6QB 3QAUA 4CLLA 4FYVB 3DLGB 3RUBL 5C2GA 2OFGX 5E41A 5J2PA 3HHNB 1Q81T 4KRWA 5HQMA 2CYYA 2W9AA 1WEYA 2GMHA 4JI4J 4JI3J 4K50A 4IRCA 1J5EJ 2EFNA 5KAKA 4BS2A 1MN7A 1R3NA 1TKTB 4LR8A 4PG7A 5KFVA 4X4TA 1L3SA 1CS4A 1XQIA 1SKSA 1QUPA 3QO9B 3QT7A 1LXJA 4IG3A 2WSCC 2E9TA 3PDNA 2R7UA 3HFKA 3KLGA 1TR0A 1T9VA 3D54A 2CQIA 1B0PA 3WX4A 1UVMA 2NS1B 4YOEA 4DV4J 1Q16B 2WBMA 2DBBA 3MECA 1MU2A 1T0TV 2A2CA 2BA9A 3I55S 3BQ0A 2UVVA 4DV1F 1WC3A 1EETA 3V4MA 4QIFA 1NK6A 2M8DB 2WB1D 1DBDA 4ZVSB 1YLXA 4ZVGA 1ZM2A 3H5XA 2MYFA 1KRPA 2O5DA 2AN7A 1FNMA 3AA9A 4OV6A 3T41A 3T5HA 1S4FA 1YZ7A 3BBFA 1R43A 3C16B 1WF2A 5DLFA 4NYOA 4ECTA 4EMDA 2C22A 2MKSA 4USIA 3CC4S 4FPIA 3FVYA 3RRKA 6FDRA 3HZEA 1FA0A 3DM2B 2Q3PA 3FEXB 5IXUA 1UKUA 3PR4A 2BQRA 2OAUA 3EDQB 2P9CA 2HIYA 3MM5A 2XS7A 1IKVA 1WC4A 1B01A 3DRXA 2R2RA 2CPZA 5ETLA 4DL5A 3LP0A 2HHQA 2CXEA 9RUBA 4RZRA 1AW0A 1OY8A 2OEJA 1RA6A 2GNKA 3LANA 4NLUA 3CUNA 3BQ1A 4OYOA 2F4VJ 4PWDB 1JMTA 1OMSA 3HP6A 1AYEA 4DV1J 1TTHB 2B8QA 2OELA 4OYPA 1LWCA 2OMLA 2ZC4A 2PIIA 5HI7A 3TVKA 4DCJB 1XMQF 3GJQB 2L9WA 4DPWA 1JJ2R 3IN5A 2H5EA 3T5JA 3GFYA 4F0MA 4RUBA 3NL0A 2XHCA 2FD2A 4JI1F 3GONA 3KLGB 1OHNA 1R8CA 2MXYA 3DHXA 1WC5A 5J2NA 2VOPA 1U25A 3I0RB 3PY8A 1SKUB 1WTBA 1TFYA 1S0NA 4ZCIA 1UEVA 2FDNA 1RI7A 2XTJP 4TLRA 1GXTA 3A12A 2ZM6J 3TANA 3Q8VA 1Y3KA 2K3KA 3NKYA 5I3UA 3DC2A 3GZ7A 3H42A 4EBCA 2MQ8A 3KXDA 3R6LB 5B09A 2C3YA 2VFTA 4J9MA 4I7FA 2IM0A 1TV6A 4LF7J 5KFUA 5AT1B 5HQLA 4PWWA 1PO6A 4CLZA 1SJ3P 4DFMA 3CCWA 2EVZA 1RTHB 2EG2A 4ZJLA 1BWVA 4NLXA 1UFWA 2GAGC 5E33A 3BSCA 3W2WB 4RNMA 3OUYA 2R2TA 4K0KJ 1EP4A 1BY9A 4B3OB 4OFZA 2UUTA 4NYPA 2D74B 2V9KA 2CPJA 3C6UA 3QBCA 3K5NA 4DL2A 3OR2A 3OTOJ 2XC9A 3DRRA 3I32A 1RAOA 2B4OA 2V68A 1NHVA 3DLLQ 2WONA 4RBVA 3K58A 3B4DA 5DM6Q 1C0UA 1DTTA 3GILA 1T95A 1PJ5A 2XEXA 4WYLA 2JHEA 5DZ7A 1M1KT 4DXLA 1KBRA 3CB4A 5HSPA 5KG2A 3CCSS 3HSJA 5EUHA 4U7CA 1UPPA 2CJ9A 3PYDA 3Q89A 4MK9A 5ETOA 2ZEJA 3ADAC 5HAOA 3JXOA 4NZ7A 5IS2A 2KH9A 2R7WA 3RB4A 1PYSB 2AWZA 4NLYA 2XB2D 4J9KA 2OTJS 1RQ0A 3ZZ0A 2PI5A 1Q4RA 4B02A 5EX3A 5AE2A 3UD4P 3SZ2A 4DR5J 4ILMA 2SXLA 2K1RB 3VAIA 1U8SA 5K20B 1S6QB 1XBWA 2Q43A 4HR2A 4ECWA 2YY3A 4QBUA 4PPDA 3J7ZT 5L1JA 3GIRA 1CJTA 2YWFA 5HATA 4IRKA 2CVIA 4JV1A 3R5AA 1A6LA 1TK5A 2VG7A 4ZDNA 4DX6A 3NNCA 2NYHA 2XZTB 2XY5A 1ZZFA 1V3SA 3KYLA 2EBGA 4C6AA 2MQLA 3VQTA 1FESA 5BYQA 3MOJB 3JSBA 5LL6d 1B3TA 2QL5B 3E01A 3ZC4A 2PT0A 4Z7YA 4XTTA 3J7A1 4ER8A 3DOMA 3SSSA 2P8IA 2PMWA 2M5YA 2LXIA 3FDSA 2OEKA 5J2NB 2HHPA 3VZHA 2C2NA 2M4MA 2KDOA 2RVJA 3LP1A 5KG4A 4A4JA 2KT5A 2DHGA 1X5PA 1T03B 3NEKA 3GJRB 2MTLA 5DG7A 2FTRA 2OD6A 3N9UC 4MK7A 3NMRA 3SYZA 4DG1B 2CPHA 1YRUA 1XEZA 3OW2R 3RW6A 3M7VA 4FPRA 5KG6A 1RTIB 2BJ3A 2HGMA 3DNCA 4UF4A 3OL8A 4ECZA 5KFZA 1K1QA 2UU9F 2BJ8A 2A18A 1FK9B 1K0VA 1XMBA 2MZ1A 2GS8A 1QAXA 1FXDA 3T19A 1N5YB 2ZKUA 4F7VA 3PFEA 3C2PA 4TN2A 1Q78A 4ZVUB 2QYCA 2ZVIA 3U27A 4XIUA 4NXMF 1VQNS 1FDBA 4GVBB 3U1LA 3KLVA 4JI6J 3I0SA 2WVBA 1S79A 2EEYA 3W5XA 4YR3A 3KK2A 1RAJA 5J2MA 1NK0A 2A1BA 2DR9A 2M8HA 1B7FA 3ISZA 5MAOA 2W9CA 3DM2A 1ZTWA 2E9RX 1RT5B 5LMNJ 2QX0A 4F4WA 1DLOA 1FRLA 1ZBTA 4ZITA 5HO4A 1HWLA 1SQEA 1VK8A 1CBKA 3MAQA 1C1BA 1WOPA 4M5GA 3CO0P 3T6JA 3JAMU 4NLPA 2LEBA 1RTDA 3ZO7A 3KHGA 1IJEB 5T41A 5IQQA 3TA1A 1P1TA 2HKEA 1VJQA 5C25B 1HKAA 3W65A 5KFJA 4UOHA 1ZM3A 2DGXA 1FWPA 1I3OB 1OIAA 3CE8A 2OUGA 4A8OA 4NL5A 4OZNA 2AEMA 4PAAA 4LF5F 2AJQA 1CS4B 3H90A 2NYIA 1REVB 3BO3A 4J9LA 2WVCA 3KUGA 4ZA1A 4UOFA 2QLWA 3DLKB 2E1MC 2AEFA 4JBCA 2JBVA 2YH0A 2LXFA 2ZZTA 4N8OA 3HT3A 2AGQA 4OHYA 2JRSA 4OJGA 3K0JA 4NLDA 1FJ7A 1HHQA 2HPUA 4QR0A 4DV2J 2ROGA 1KTVA 2YWGA 2CPXA 3J80U 3IWNC 4WU2A 3LH2S 2FLLA 4ELTA 3BN4A 4GVBA 2B4UA 3D6TB 2JEJA 3OHAA 4BWJA 4YY3F 1KFSA 3TRGA 3DGPA 1IKXB 3CCZA 4MIWA 4TYBA 2GO9A 1FKOA 3HF5A 1YKWA 1S1WA 2B9XA 2LVWA 4HT5A 4IH6A 3KLIA 4QOTA 2I8EA 2VG5B 5HK4A 3SSRA 5DDOC 2KM8B 4KY3A 2J6TA 1GNKA 2AKWB 3GG0A 1VBZA 4Q45A 4QWDA 3QT8A 3Q8SB 5DS7A 4F4YA 1R27B 3EGNA 1G3OA 5T14A 4CNZA 4RLEA 1IKWB 2BKNA 1TKZA 2WK4A 2LFVA 2QMWA 3D0GE 2V67A 3BGLA 1VBKA 3NBPB 4DV0J 4RW8B 1UWBA 4B3SJ 2M2BA 3NCPA 1U6BA 3BSNA 2IYGA 3K2YA 2OD4A 3PNIA 2GVDB 3R5CA 4H4MB 4Y34A 1KS2A 3IAS9 5KFBA 4X64F 2CPEA 1AUDA 3BJYA 3I4PA 3W8PA 1FD8A 1WJ9A 2O3DA 3AXKA 4ZVHA 3ET6B 1E6VA 1CJVB 1P8GA 2H54B 1ZA2B 1ZAWA 5FDLB 4RUHA 5HMWA 3JTPA 2IMOA 4LFCJ 4R0EA 4V19X 2HQGA 4G65A 3NAIA 3BYRA 5LMUJ 4K4VA 5GADI 1U48A 1U1QA 1HBMA 1P27B 1SJFA 4C2MA 3HVTB 3NGSA 1WNEA 3FGVA 3R5DA 3UW1A 3J81U 2BEFA 4F0KA 1FTRA 5KFOA 2V4RA 1R89A 1YRXA 3BQ2A 3GQCA 2QFJA 3D28A 1DY3A 4TU8A 5CD4H 2MJUA 2ZOFA 2QZ8A 2HHSA 1SUQA 1RBLA 1S1WB 2AYEA 2JC1A 4TYAA 4YB7A 4FBTA 3HMJG 5KFCA 4Q8FA 1XMOJ 1CULA 1YIJS 1RT2A 5HLFB 4LRAA 4NRTA 4JB8B 1M5HA 1L3UA 1R6YA 3Q2SC 2GC8A 4B3RF 1NH7A 3KDOA 1FDDA 2ZZMA 3EGWB 4DR6F 3EM1A 5F41A 4GKJF 4YFUA 2XYPB 1X4HA 3PM9A 4DZ6A 3GSIA 4FYWB 2HHHF 3C14A 5I42A 4JI8J 3LALA 3NGDA 4M8LA 1N88A 2M0GB 2UUWA 1C0TB 1K47A 1PJ6A 1RWKB 2DGWA 2DIUA 2XY7A 1K73T 1AXQA 3IS9A 4A46A 1S6PB 2YX1A 1YBAA 3DRSA 4DQPA 3KLHA 3TX8A 2XS2A 2HWIA 3NGRA 4JP8A 3SCLE 1BWEA 4LF2A 2HFNA 3BREA 2E7XA 4YS2A 1NK8A 3CJ2A 3MECB 4E98A 3HKZD 4Q2LA 2B9WA 1R0AB 1N33J 4QIGA 4ZVPB 2KRBA 3TNVA 4ZLNA 3C46A 2FHOB 3DKDA 1T3OA 2IPOB 2NLWA 3J7Z5 4PQUB 3MPYA 1H7XA 2IY5B 4ZCKA 1S77D 1P94A 3TUZC 5GMDA 2PD1A 5K8OA 2IMWP 2B5JA 6FD1A 1LW0A 2LA4A 2KXFA 4Y0FA 2ROEA 3LP2A 2J7UA 2O67A 3AHPA 4ZVQB 3MZIA 1O51A 2GHWA 3MEEA 3N5FA 4OZLA 1NDKA 4PG5A 4K4UA 3E3XA 2HHVA 2R7TA 4UQTA 3GJSB 1RT4B 1MLAA 1TL5A 2X3GA 1CJKB 1HNIB 4Q7AA 2R2UA 1NJIT 3P6YC 2KFNA 3OUYB 3CDAA 3J7YI 4J9RA 3L7OA 2GA7A 3LAKA 4KPYA 1XNRJ 4W90B 2DTJA 2KTQA 2QA4G 3AQOA 3N5BA 1QTMA 2F8MA 1NM2A 2A3JA 3C66A 1H73A 4X62F 2DHAA 5J2MB 4U6PA 3KK2B 3QIPA 1UWBB 1B0VA 4DV7J 4DR1F 3BS9A 3FSYA 2OPPB 5A0YB 1U6ZA 3FBEA 3OFGA 4DN0A 2EFOA 2NREA 4RW6B 4WE1B 2E5LJ 4EWTA 4EK2A 2DGTA 4OI1A 3KK3A 2X3DA 2VV5A 3FBFA 4DV6F 1VMBA 3WX8A 5F8MA 2HVEA 4IFVA 4JV0A 2W2NP 1NLAA 2UVUA 4NMLA 4DX7A 4PG6A 1JIHA 4MFBB 3HM9A 1PIEA 3CW2C 3C6TB 3MAAA 2QFIA 1ZYQA 2HGNA 3PYGA 3PEJA 4GKKJ 5E3QA 3PRDA 1RAAB 2CJBA 2GGPA 4CIOA 2OI2A 5KFYA 1UVNA 2BANA 1CEZA 2WVEA 3D4JA 4G3IA 1A7GE 2BRKA 1HQ2A 1RWUA 1WC0A 2QE5A 3JTOA 3NP5A 5JXSA 1HNIA 5FLXU 3NGTA 3GV5B 1W26A 2DD8S 3G8QA 1WEZA 5LSOA 5C7PA 1XMQJ 1XNQJ 4AL5A 2RF2A 2OO4A 4KHPJ 4P52A 1M90T 3E8OA 4ZMMA 2GHPA 4MH8A 3G6ES 2CAJA 4UUWA 3LA0A 4JI2J 3GFHA 3CNQP 5JVHQ 2FVQA 1GT8A 4H4KA 2DHHA 4P10A 2JWNA 2VH7A 4I69A 1U2FA 4QPTA 2XGPA 2VBXA 3A8EA 1N32J 2AT1B 2HS3A 3JSMA 2U2FA 1G1XA 1JLGB 2C42A 2YNHA 4IG3B 3CCUS 3A1YG 1S9EA 3ILLA 1S1XB 2G9OA 4OYIA 5DO2A 3MDFA 3TUJC 5KT5A 4EZ6A 4JYAJ 4AE5A 2X1BA 2RHQB 4DZDA 3HD1A 1FVQA 2V69A 3GR0A 3HD2A 1RT6A 2W7OA 1N48A 4A48A 3DRPB 1L3TA 2DKOB 4WP9A 2EPIA 3PEHA 4XDDA 1R6VA 2WRMA 3G2XA 2KZZA 2WAQD 1I94J 1HWKA 1VI7A 2FJBB 2HVZA 3G4SS 3MAHA 4WTOB 3V4IB 5K8MA 2LU1A 1JJ4A 2J6UA 2UXDJ 1QTNB 3O6QA 1PBUA 2BXJA 2ATLA 1FFWB 1WG4A 1QE1B 1V9OA 4USUA 3SCJE 5LSLA 2DRBA 2HWTA 3DDKA 2AD9A 2N4DA 2W2MP 4KH0B 3R8YA 3J81j 4YB1P 4KHMA 4YUDA 3QWPA 1HA1A 3W64A 1JLBA 1UZDA 3VTIA 1XR7A 1QM9A 3VW4A 1IN0A 3UWTA 5DRKA 3KUHA 2C28A 4KGMA 3ENWA 3AODA 5A0YA 4O3NA 4IR9A 1EQ0A 1N5VA 3T5KA 1FE0A 2E9ZA 1WEXA 2HSEB 4DN9A 3EPIA 5BR8F 2B4VA 4OL8A 3W1YC 2MEWA 3EE3A 3ZTSA 2Z8QA 4UOGA 4YY3J 3CCQS 2FLNA 4DR4F 2OH2A 4ZP7A 2AJ0A 5K8NA 3P5BP 3KNGA 5IC6B 4QW8A 4HL9A 1HBUB 2J9EA 1K44A 2JLGA 4ZP8A 4C8MA 4J9PA 1HBUA 1E6YB 5HBMB 3M8PA 3MEGB 4OI3A 3KOAA 3DOKA 4I2PA 1RT7B 2N7YA 2PMZD 3TJ8A 2DPJA 2HQIA 4IYQA 2JDJA 2V0NA 4H4MA 5A8RA 3KLEA 1LW0B 3MGJA 2BX6A 1WD6A 3QGGA 1BXNA 2EXUA 1VK3A 4QU7A 4OIXA 2DT9A 3CJ3A 2E1AA 1IXKA 1RHUB 2HAIA 2XMJA 1FCAA 3OPKA 2C3MA 3M2VB 5KG1A 3T9NA 3W9HA 2VFUA 3NCQA 4Y6IA 1AROP 2V4QA 2DGUA 4EO6A 2CPYA 1HFEL 5CHCB 2C2OB 2E5JA 5D15A 4DPTA 3OHBA 7FDRA 3GE9A 1NJXA 5JJBA 1RSCA 2LLZA 1VOMA 3KKFA 3NO7A 1OJ4A 2P6TA 2O01C 4FP9A 1L5UA 1F2GA 1IKXA 2DGSA 4ZVTB 3N6LA 3ZZRA 1MWQA 1FKOB 2YNFA 4QYZJ 3GPAA 4G1PA 1UVKA 2BVZA 5CAAA 3HI9A 3T1YF 4ED6A 3M8WA 1NK4A 4HHUA 4TKTA 4YN3B 3CD5A 1WG1A 4KGKA 2HK3A 1WSVA 1TAQA 5K8PA 1X9SA 4FN5A 2G4BA 3ICLA 3OFFA 2GMLA 1C2PA 2YNIB 1T8EA 1H98A 1ZAXA 3O3LA 5A8KA 2EK6A 3HSZA 2N7CA 4QU6A 3LQVA 4KGXB 4CQ1A 4P7VA 1NNDA 3K5MA 3UO0A 5HROB 5H9FK 5I42B 1BAZA 2AHOB 2BJ7A 1SBRA 4OLOA 5D78A 3SDEB 4ATNA 4CP5A 3R1HA 2HYIB 4ED5A 1C0UB 2YNHB 1FKAF 3RGIA 4C4WA 1KN6A 4J9QA 3TJ9A 1Y0HA 4RBUA 5CQGA 4DUYF 4TQSA 5H9EK 2FHJD 5KFXA 2RS8A 4X2BA 4NXMJ 1PAUB 1HBNB 1ZAVA 2NCKL 2XZWA 3IBWA 1IR1A 4RO0A 4DJBA 2UUBJ 4LFBJ 3L09A 5SZTA 2J8AA 2I9SA 3EZOA 3GYGA 3R27A 4CH1A 2PFFB 2J9CA 3TWZA 4X4RA 3OVAA 3BV8A 2JZ5A 1YK9A 2YWKA 1TL4A 3MR7A 3O1LA 4DCPB 4X4SA 1ITPA 3GG1A 3BPDA 1RHMB 2UV8G 2NQPA 2M7SA 1M0SA 5HMZA 3AD8C 4WJBA 2EC0A 1LWEB 2QTWA 2E5IA 3O2IA 2CQ0A 3CD0A 4N47A 4WZQA 2DCUB 2DXFA 2W1BA 1FVSA 4QJVA 2PA3A 2EW9A 4M5NA 3T1HF 1DQAA 3K5PA 2J0XA 2H1OE 2XNQA 3D0HE 3EYZA 1TKZB 4TLQA 3A8IA 1UVLA 3DHWC 4ES3A 4F50A 2CPFA 2GW8A 2CVEA 2XZDB 3QRQA 2RAQA 3QRPA 2ADBA 3BSAA 1S7IA 3HSGA 4ID5A 3LJPA 1U2CA 2KHCA 3EUNA 1Q1KA 2WBRA 5KFAA 4F2RA 2MPUA 1UP1A 2XHWA 4RW6A 4WE1A 3AOAA 1RTIA 4LT6A 3H2VE 3SQGA 4DMZA 4CTAB 1QSLA 4USTA 4AD6A 1HYSA 2OGUA 4I0WA 1M5PC 2W8LA 4DR1J 3IGVA 1VQ8S 1JJCB 3MR6A 2JJ4D 3CO9A 2F8EX 2Y8YA 1CC7A 3IGNA 5EWFA 4Y2MA 1SKRA 1VQSA 2ZJPQ 3OFEA 3E51A 5L1KA 4HH1A 2FVRA 5K9FA 4Y2IA 1JJHA 4D3GA 3IBFB 1GMVA 4F8RA 1OO0B 4NASA 4DFPA 1IBKF 3FEYB 4C0OC 1FRIA 2VJVA 1SI9A 4J90A 2MLYA 4E8UA 3EX7B 1UW9A 4DR6J 3KJFB 1F3FA 3D1QA 1N36F 2XSJB 1TKDA 3NOGA 2VG6A 1RDRA 1IKYB 3AA8A 3FBCA 3MHYA 3WQPA 3M2RA 3A3NB 3VAGA 5F8HA 4WKRA 1BHNA 5RUBA 2HHTA 3H5SA 1JLQB 1FKPB 4UTGA 4WBFA 3R7BB 5C5JA 3Q8RB 4NLOA 5C25A 3D6FB 2XMMA 5DGBA 5KFTA 2KVQE 4Z37A 3A4TA 1Y3JA 1S72S 3OJSA 1TL3B 1WF1A 3QO9A 1G7CB 4X66F 2VKRA 3BF4A 4ZCLA 3DLJA 2F65A 2B0GA 5DM7Q 2V2KA 1N6QA 4HI2A 1ZETA 4Q44A 1HHSA 5A8KB 3LWLA 1G2EA 2C2EA 1TUVA 1ZH5A 1N5TA 3B8HA 4YMEA 3TZWA 4PABA 1G4CA 4JI7F 1F2HA 2BMBA 5U47A 2MGZA 1N34F 2AX1A 1RAIB 4AUKA 8ATCB 2XQCA 2YPZA 4X4VA 3QGIA 5ADZA 4ZCMA 4DI6A 1XN9A 1S97A 4O3RA 5LXRA 3MMAB 3G6XA 3VGVA 1IJFB 1KNZA 1GH8A 4OHZA 3TAMB 1QVFR 1TUWA 1U6FA 2QGFB 1NMEB 4FS2A 3RTVA 2GJFA 1EP4B 2VB6A 2YKQA 3CCLS 4B3OA 2RRNA 2QSWA 4URSA 5AXMA 4CLUA 3VGTA 1FWLA 3RR7A 1KTQA 2J0WA 4IKAA 3KK1A 4K0KF 3DYAB 3MPWA 1AT1B 2HBRB 2BYCA 3PHEA 1RA7A 1SQFA 4AXIA 3H59A 3US5A 5BYSA 1VRTA 5L38A 2YKNA 2IDLA 4GO5X 5A6WA 1EQMA 1RYSA 4ZVOB 1NPRA 2RQMA 2ZHOA 3KWMA 2C2MB 2HNYA 1MNEA 1F6TA 2AYMA 4PXDA 4Y00A 2W2PP 2DGOA 1FRHA 1SIWB 4LVNP 1UZHA 1SIWA 1OYDA 1PAEX 4U96A 2RKIB 2IBKA 1S1TA 3LGNA 1CJUA 5CH7B 4PXBA 2KJWA 4KQZA 1T9TA 1KVJA 2DXDA 4DV3F 4ED7A 1DARA 5I3UB 1RJJA 2F5GA 2BZ2A 2VC0A 4F26A 2JEIA 2IDEA 1HIYA 3FCVA 3EGZA 1RT1A 4FXWA 1M1GA 4FDFA 5KG7A 1YI2S 1B0TA 2DR7A 2ZKTA 2ZNZA 3HPOA 1RK8A 1S1VB 4I68A 3BSOA 1HR0F 3H0PA 1WKKA 1K8AT 4P6QA 1JLAB 5CYJA 3CMES 3BGRB 2CZ9A 1QD1A 2MKJA 3DDIA 4KO0A 5F3ZA 1NJWA 4DFKA 4Q8EA 1IRQA 1IKYA 2DNYA 2V63A 3PCOB 3KHRA 1MWZA 1BQNB 2ZFHA 1CPZA 3ILOA 2OHDA 1HQUB 3LP0B 2HGLA 1FF2A 2ILYA 1R0BG 2VPZB 4IO1A 4NLVA 5KG3A 2CPGA 3FC9A 4H4OB 3W66A 1U1NA 3CCTA 2LYVA 3M1VA 1SPBP 2HNDA 1X7VA 3CJ5A 3FK4A 3OXLA 4LJMA 4A47A 3KLFA 1HARA 4B9UA 2CIMA 1YJUA 3I9ZA 4MIBA 3TW0A 1F60B 4OZ3A 4CO2A 3MWBA 4U67Q 2DPIA 3ISND 3Q0AA 1X60A 2B8PA 4AQYJ 2QL7B 2Y8WA 1RT2B 2CWKA 2EFQA 2RHSB 2WW8A 5B0DA 5J2QA 3DN9A 2KFYA 4ILLA 4DX8H 2ZDPA 4HDGA 5C42A 1BDVA 3PRBA 4DEZA 1SJ4P 3CDUA 1Q7LB 1NDPA 1SCJB 3GU0A 4O44B 4ZJQA 3MURP 3M8ZA 1OPZA 3C6TA 3MAAB 1H3DA 5A76A 3V6DA 1SXLA 2H3EB 1TKTA 3I96A 2VASA 5AXKA 2MKIA 1KVIA 5D4OA 3CIMA 1MW7A 2YBVA 4DL3A 2HBYB 2YWHA 5DDPC 1PKUA 2HFUA 2MQNA 4MKBA 4ANCA 2O66A 2VU5A 2HZAA 3EWGA 3WZ0A 1FXLA 1H2TZ 4YDDB 4LSZB 4ZVRB 1FFGB 1N34J 1T3NA 3H87C 4CCHA 3AD7C 4TY8B 4OX9F 1UEKA 5F8GA 3K59A 4C8ZA 1O0PA 2ASJA 3MEKA 5ETNA 1WKLA 2MKCA 1K1SA 3ZNJ1 2MLXA 2OEMA 5KFSA 1QAIA 4B9MA 3THTA 4DL6A 1S59A 3D5MA 3DXBA 3RBDA 4F4KA 4M5MA 4OYAA 5THWA 4FBUA 4JYAF 4WFZA 2PA8D 4XAKA 3TR5A 2BV3A 2WOMB 4YHHF 2DH9A 4DUTA 1U8WA 2B3TB 2OPQA 1GMWA 4ILRA 4MYUA 1NLKL 3UNGC 3UVJA 3V5RA 2ZDOA 3SXLA 1NSAA 3FZ2A 3Q2TC 3Q8YA 2HQCA 2VZ9A 3QWUA 2ASLA 3QAEA 1I94F 1T7PA 2L9NA 4O3OA 2VQFJ 3G6YA 4MJWA 2HEKA 4IH5A 4O3SA 3JTNA 1S99A 2V9WA 4N41A 5A8WA 1LOUA 1ZPVA 1UWAA 1FEHA 4KPCA 3SDEA 2XO6A 2JX2A 4A8YA 2D7SA 3OFHA 4NLWA 5GMEA 1UCNA 1WHXA 9ATCB 2MGZB 3IP0A 5JMNA 4N56A 2CQHA 2OP5A 1KR4A 3FQKA 1HI0P 2R9LA 1Q79A 3BKTA 3PYEA 4MKAA 2C2DA 4JV5J 4N7TA 1VR6A 2L3MA 1NB7A 2RB7A 1VQ6S 1UEUA 2JL9A 2OSRA 3T3FA 1U0HA 2E66A 4HTIA 1S10A 2APOA 2HBQB 2BABA 4U7UK 2R8KA 4LRFA 1BQNA 1MU2B 3AJ2A 3LPEA 1A9NB 5F9LA 3OXGA 4C0BA 1AA1B 4TNOA 2F40A 1MMDA 3MMCA 2VKZG 5BXIA 3SI8A 2YKPA 4JUZA 5ETQA 3GMGA 2HFSA 5I3QA 2R7QA 1TKXB 3I5AA 1BUXA 4NLTA 1EA4A 3NWRA 5HVHA 5B0CA 1U1OA 4RU2A 1RKIA 3POTA 1S1UB 1SIZA 4KHRA 4LBIA 4URQU 3UCUP 1MN9A 4F02A 4OZ1A 4DPUA 1RLDA 2LQBA 5J1EB 4F4ZA 5FIIA 4QR1A 2RT3A 5D4NA 3GIMA 1FX2A 1NHUA 2WTFA 1S0VA 3C14B 4O3PA 2R7SA 3M1VB 3VV2B 1SQGA 3QSIA 4JI5J 3IG1A 4ZHRA 4Q43A 4QWCA 1RT7A 1T94A 2CG4A 1KLMB 5M2PA 2E5HA 3MCNA 1B99A 3H25A 2W4PA 2I1RA 3IR6B 4OHXA 4P73A 4DCOB 3GIJA 2BQUA 2AP6A 1LW2A 2CUYA 2O1PA 4PUOB 1U2RA 3W2VB 1FRMA 3O5TB 3OL7A 2DYAA 2CNKB 1HYSB 2M88A 5GMKa 3F73A 4ZPTR 4MFBA 2FB0A 2R7OA 3RYLA 4B17A 5GAHU 3MR2A 2G2ZA 1IBCB 3MM7B 4CO3A 4QQBA 5J1PA 4DG1A 3MUMP 1HQEA 2DO0A 2C3PA 2XYHB 4WWSA 2VONA 5KT2A 1TELA 2RU3A 2HVHA 2NUUG 2PI4A 4IR1A 2JXGA 2I5JB 4C97A 1CC8A 2RDIA 2NXJA 1ZS6A 2YH1A 3RBEA 2K5JA 5E2QA 1X4EA 3R5JB 4OQJA 2ZH6A 4USWA 3W2WA 2NXUA 3DFEA 1U9PA 2BE7D 1J5EF 3FKBA 3RR8A 1C4CA 2UXBJ 3W61A 3ZZPA 5CCMA 3V6HA 2CJYB 5IFMA 3MI7X 4DV5F 2YTCA 1Q86T 3QATA 4KTQA 3QOQA 2HWHA 2YKOA 4GVLA 2KT2A 2BSQE 4AFFA 2HMIA 4JI1J 1GTEA 2QMXA 2V6AA 3BPSP 4KKOA 1DURA 3CDBA 5EHHA 4DSLA 4M5DB 3GYXB 1U4BA 4Z2XA 1CQMA 4MJKA 5ETSA 1Q7YT 1MYKA 1FDNA 2C2RA 1PC5A 3VQSA 2DNRA 3JSRA 3TAQA 1GMWD 2ERRA 4WP8A 4O3QA 1KWMA 4WIQA 3CJKA 2FZKB 2MZJA 3CTRA 1OSCA 4MT1A 1D3WA 4ZP9A 2BW2A 3PX4A 5B7WA 4N77A 1XNRF 3TZZA 3ZXWA 4B9VA 2RSQA 1NJYA 3PIOQ 4FKYA 2KFZA 2W9BB 4HI1A 3G71S 1D8YA 3QJLA 1OY9A 1EZZB 4DU8A 4CO0A 4BC7A 5F8LA 5KT6A 1UTAA 2AGPA 1WI8A 1PG5B 1V3ZA 1I5OB 4R8UB 3PZPA 3FRZA 5D4PA 2XLJA 1XC9A 2AYGA 2VBZA 3EICA 3EZ5A 5DETA 4QIWD 5AE1A 2P9GA 4OYMA 3UDCA 3DI6A 4UY85 5EN1A 5L9XA 3HCXA 3CMQA 2W7PA 2HBZB 1X4AA 3G82B 4OV1A 4NXNJ 3K8WA 1KOHA 1RCOB 3AQPA 2H51B 5KFWA 2A0FB 4ICLB 5AJ3J 2CQCA 1RXOB 1GK8A 4DSIA 2A2BA 2V8GA 1Q0NA 2N4CA 2XLKA 4LSNB 3WDOA 4ED8A 3DMJA 1Q53A 1JLGA 1NHKL 3CWJA 4USJC 3U1NA 2HHHJ 1IVZA 1KC8T 4IFYA 2KO1A 5KFKA 4IFVB 2WCXA 4L72B 3TA0A 4JI3F 1S1XA 4XPCA 2EKNA 1P1LA 2X1AA 1N33F 1KVKA 2BE2B 1HNVB 1YJWS 1OYEA 2B7BB 4C11B 3NS6A 2KZMA 4JI4F 2IC3B 4J9SA 3TJAA 2IJRA 1XK8A 1ZZNA 1RAFB 3BR8A 1JX4A 4C8KA 2GAHC 2YKMA 1RTJB 2UV8A 3ENVA 3EVMA 3GTYX 3PJWA 3NGUA 1FJGJ 3TUPA 1VBXA 3OTDA 2JLFA 1RUSA 4LBPA 3AB2B 2AJ4A 1RBOB 1FK9A 3HO1A 4IDKB 3I0RA 1U02A 3HHLD 4IDKA 1W2IA 4KT0C 4ZVFA 1DAXA 3W62A 3HFVA 4RW9A 4PR6A 1F9EB 3SV3A 4W98A 1T9XA 3FEZA 4B9SA 2VBWA 1KONA 4NZ0A 4OYZA 1TVRB 2LQ5A 4X4PA 4DUZF 4MTPA 4ELVA 3PXGa 3KJVA 1ACMB 3UD5A 1IM4A 2B5JB 2FJDB 2BOAA 2OSQA 1LWCB 2ALYB 3C15A 3KJNB 4G1QA 2YKAA 4Q2MA 5D4LA 4JI0F 5HL7Q 2E1CA 4J9NA 2G2YA 3IR7B 4WKYA 1N52B 2E5LF 3PIPQ 3IR7A 2UUAJ 1XJWB 2K7JA 3HT0A 4ZIVA 1U45A 2RQCA 4NI2A 2FY8A 5AE3A 4ZPCA 4HVZA 2BRLA 2GJ2A 3BO2A 4CM0A 1HHTP 3M6WA 1NXIA 3GJTB 1CVJA 5C42B 3BGUA 4LF9J 4NLQA 3VEAA 3O44A 2F1FA 1S6UA 5K5MA 1J5OB 3CIZA 3EJMA 3E2EA 1MSWD 2DNQA 2D3UA 3ISNC 4WCEQ 1WG5A 1FHTA 4M1KA 2DRDA 5KFFA 2UXBF 2C1EB 4RL1A 2XGQA 2CQ3A 5IV3A 1KLMA 5ETTA 2LECA 3PYFA 2ZHAA 2DEIA 5DG9A 3PO5A 3MPDA 2K29A 1WI6A 3LGMA 1XWLA 2J9DA 4JI0J 2RUSA 5LXYA 1N5QA 4HH0A 4K59A 3HHDA 1U1MA 4B3SF 4B3TF 3Q8QB 1BD6A 1U7LA 3U02A 2M3DA 1V5IB 1UPMB 3GWCA 4IQMA 3OR1A 3D3CJ 4ED1A 1NPPA 1DTQA 1LWFB 2W24A 3UR0A 3BH6B 2K6LA 3MMCB 4P2FA 4DR3J 4ES2A 3DRRB 1PSDA 3OV7A 1VIOA 1Z2LA 2MKYA 5B0FA 2K1RA 4K7QA 4P74A 7AT1B 3BH7B 2G2OA 3UDEA 4HHJA 2ADCA 1HI8A 2HFZA 1EIYB 4F36A 2VBYA 4WU3A 1YJ7A 5K14B 1VQKS 1TK8A 5T7LB 3GCWP 3PJXA 2BJ1A 4WTYA 4ED2A 1X4BA 1FXRA 2EKYA 2MQQA 3QYYA 3HULA 2RF2B 1S1TB 1NKBA 3MTKA 4DSEA 3CJRA 3U1MA 4A8FA 2XMAA 4E0DA 2KVIA 2ILZA 2F8HA 2IRUA 3DLEB 2HAFA 2P9EA 2MDAA 3CJQA 2NXNA 2RDDA 2BACA 4HV0A 4OZ5A 1FX4A 5D8HB 2MSTA 1C0TA 3D7SB 4RW8A 1VQ4S 1QTGA 1UA1A 2MZTA 5DDRC 1ZOTA 4CDIA 1OS5A 1RHJB 5IM0B 4PYDA 3FJ2A 1VQOS 1U1PA 2HLUA 2E7WA 3QIDA 4LF6J 4FF3A 4C8YA 3PACA 2XMKA 4DR2J 3W3SA 4X4UA 1YJTA 1HBOB 3M8QA 4CTAA 4DR5F 2DEJA 1RT3A 5GAEI 2KJVA 4JI6F 1KKHA 1QDUB 1S4EA 3NOCA 2G1DA 1GFWB 1Y11A 3QT5A 4RW4A 5CCLA 2Z2YB 4USMA 3HVTA 1ZA1B 2B9YA 3HLUA 3MM7A 4WFYA 3VR1A 4CYUA 3PG9A 4URGA 2Q2KA 4FVCA 4FF1A 1PGZA 1X0PA 1JWWA 2YKNB 4LMZA 1VRUA 1URNA 3GFZA 4F25A 1FO1A 3MMJA 4I2QB 4J7CA 3QLHB 4P71A 3VALA 1PARA 1TZ0A 4PKDB 5HN0A 1CSJA 3UCZP 4BDPA 3ZZYA 5HQ8A 4IFYB 4UZCA 1HD1A 3TX0A 4LF4J 1A0OB 2AYBA 4HYKA 4QIEA 3C19A 3KK1B 1HNVA 1IKWA 1OG7A 4D3HA 4WFNQ 1FFSB 1URRA 2LDIA 5DGAA 2HNZB 3UDVA 4S0MA 1YJ9S 2ZBPA 1IWAA 5L9NA 4ID8A 2CADA 3GIIA 1F3VA 1Y9OA 4RNHA 2PMHA 1OQ6A 2XS5A 2ZNYA 4A8XA 3FFIB 5GAGI 3ZZOA 3NAHA 5JUMA 3W2VA 2J6SA 4C7QA 4PUOA 2PE8A 2A6MA 2PN6A 4C3KA 1VHFA 1X4GA 2HS4A 4DPYA 4ECVA 4BWMA 2LCWA 3MM8A 3N79A 4UZBA 1EKSA 1YWXA 1AUSL 4OHVA 3MM8B 4QYRA 1VQPS 4EZ9A 2UXCF 3KUEA 4PWUA 4QIVA 3TA2A 4RU9A 3I0SB 1VHIA 4P9SA 3VWSA 1VQ5S 2NPIA 2CQPA 3J7AN 3AAWB 2LKZA 2Q6BA 1CULB 1RBAA 3L7PA 1I6JA 5K14A 3BGRA 4DPXA 4ZN1A 3KHHA 1B4SA 2BKPA 2UP1A 1PCAA 2VQFF 4PG8A 4NA2A 4C9DA 1NSPA 2GX8A 2K1OA 2FLPA 3BB5A 5HMXA 1FKPA 2HRYA 2IYIA 1R8BA 4ZJOA 3THPA 5CD4A 2RQKA 1FERA 3RAQA 2F9JA 4IG0B 1H38A 3FZBA 1ARQA 1JQGA 2G1HA 3AH6A 4CT8A 2CJXB 3VAHA 3BZQA 4H4KC 1TL1A 2GVZA 4C0HA 4RNNA 4ID5B 5B08A 4JOUA 5KFEA 2KI2A 1NRKA 3IFEA 3P96A 5GAHI 2XLIA 1SB6A 4NLRA 2OPSB 4KKOB 1IBMF 4NCAA 2ZOGA 2NSCA 3VAKA 1FRJA 3R7SB 3O8WA 4M5DA 5KG0A 1GTHA 1V5VA 2KL8A 4ETZA 5CXTA 1C1BB 5AJ3F 3DLGA 4KC5A 5J2PB 3SV4A 1YQHA 1CJUB 3M8RA 2XY6A 2Y0SD 1U09A 2VJUA 4TY9A 4TY8A 1Q95G 3FQLA 3RB6A 2D3OR 4DV4F 3TYTA 2DITA 4U9RA 2NSBA 4A8MP 1F0XA 1ARRA 2HFOA 5F8IA 5DDQC 1BE4A 2BANB 3QRRA 3LP2B 1NDCA 3R7NB 2BJ9A 3R2CJ 2GGPB 4IO9Q 5BYRA 3IRWP 3OLBA 1D9AA 3TAMA 1KOOA 4CRJA 1VDHA 3VF0B 1VQYA 4DR2F 2ZWPA 2R2SA 2E5GA 1M5VC 3EGVA 4TQRA 2ROPA 1H7WA 1UAWA 4A8WA 1IR2A 2YXLA 5L39A 4DLEA 1ELOA 5IV4A 1WOOA 2YX7A 3CMAS 1QAJA 4OZJA 4Q0BA 2PEBA 2PDAA 4Y65A 2GO8A 2JXIA 2M70A 2OPRB 3IS9B 3MPVA 4K8RA 4BLGA 2G0IA 5ITHA 5KFDA 3RB3A 1K0TA 1BQMA 3UFCX 1QSYA 1IKVB 1UJ4A 2QMUB 3ILJA 4E2FB 5KOWA 2FJEB 1GX6A 2CKWA 2D1CA 3UQSA 4FNHA 4YEAA 3FBBA 5GVQA 1C4AA 3WIVA 5LSRA 5KFGA 3SQOP 4RUCA 6AT1B 2D3ZA 3D1HA 2IC3A 2KB2A 2XI3A 2XI2A 4GC7A 3BO4A 1JLCA 3OL6A 4C11A 3SMZA 2GMJA 3OJUA 1U26A 4WFXA 1GMUA 3HJFA 3GR1A 4CLTA 3VHQA 4WIIA 2V5HG 3CJTA 3VAFA 3T1AA 2HLTA 2Z58B 1CQNA 4KO0B 3OLAA 3V6KA 1HWIA 2Y0BB 4WK1A 2DXEA 1U0HB 2YVSA 3ZFVA 1RTHA 3R3TA 3BDPA 2LA6A 4O4GA 3H20A 3IXQA 2MY7A 3HHLA 1TU0B 1TUGB 3ZTRA 2GHVC 3S7RA 2V2QA 1NK7A 4PQAA 4Y28C 2DB1A 2FGCA 3I5CA 3MUTP 3NMAA 3ILIA 1HMVB 4ME7E 2CNNB 2J0QD 3M4XA 3G5OA 2D3O1 3HZGA 2IRXA 3DLBA 1Z1ZA 4ECXA 1VFJA 1PBAA 2HURA 3I87A 3CC7S 2DR6A 3RRGA 2QJ3A 2R7VA 4EEYA 2V8HA 2IA0A 4IQXA 3M2UA 1J5OA 3UDLA 5KG5A 1LFWA 2VPXB 4IRDA 4OYXA 4PXCA 5KT7A 4ZPAA 4OI4A 2WSFC 4LIRA 4F3OA 2UVWA 3R5GA 4NCBA 1JLEB 3CC2S 1T9UA 1SJ1A 5EWGA 3PW0A 1IUJA 4QR2A 2ZH7A 1YJNS 2ATCB 1EKRA 1NK9A 1WUUA 1QE1A 2L48A 1LW2B 4XDCA 2CPDA 1X4FA 4P75A 4CLPA 1VGYA 3HFZB 4ENOA 2FYXA 3IM8A 4MAKA 4X4QA 5HJYA 1S0MA 1WTFA 5HVGA 3VVUA 1Y4ZB 3NY0A 3GXQA 2XG8A 5D0HA 3BN7A 3IMQJ 2ZJRQ 1UL3A 4K4ZA 3LPYA 5IWAJ 5IZHA 4DUYJ 3R6GB 4DQIA 2DNOA 1F9HA 3CJ4A 8RUCA 4OI0A 2BOPA 2J7KA 3TQ1A 3PKMA 5HJXA 5IC4B 3NXZA 1TL1B 2GVZB 1APSA 2A10A 2HNYB 3MEEB 1TL3A 1YITS 3W5YA 2R8JA 3ENQA 2AJ1A 4OI2A 1RU1A 1FRKA 2PO4A 3NLCA 4Y2AA 1HW9A 5L8RC 1SJQA 4C3LA 1KEKA 1RT4A 4DFJA 2VG7B 3WBZA 1HNWJ 2HFVA 1OSDA 1PYTA 1T11A 4QWBA 5GADU 4X62J 2VHGA 2YNGA 3V2UC 2BE2A 2Y1IA 1FE4A 3BR9A 3R97A 4DV3J 5D3GA 3G82A 1LWXA 4O44A 3H40A 2K06A 2QYGA 4HKQA 1VLYA 4ICLA 2VICA 2F4VF 1X9MA 1M5OC 1YSJA 3P4UB 4LF4F 2ZUGA 1S6PA 1AZSA 3I82A 3CVKA 2UUCJ 4YR2A 3MXHP 3F44A 3HHLC 4PRFA 1XMOF 1EJ7L 4M5KA 3PVXA 2RS2A 4ECUA 3H8YA 4FXVA 4V1Ak 3MM9B 2W4CA 2J8SA 1RHKB 1LK7A 4WYWA 3VZIA 3A13A 3QNWB 4FXEA 1P9YA 2KRRA 2FJAB 4JI5F 4FVMA 2D9OA 3BGOP 2ZH2A 4I6YA 2UU9J 4V19J 4YR0A 1UJ5A 2V8DA 1VBYA 4NCGA 4FYYB 1UA0A 5BJRA 1RABB 1JLAA 1SH3A 2CRLA 3KJQB 1S57A 3ULHA 3WC2A 4ELUA 2XSJA 5LM7E 4JI2F 1VQLS 2IJNA 2Q1LA 5DQIA 3ETOA 4EFAC 2B51A 2RBFA 2E7VA 3DXSX 3N6NA 2FY1A 1XNQF 2G0JA 3D66A 2ZC3A 4GMKA 1VS3A 1VYAA 4KIAA 4DWIA 2NPFA 1UJ6A 4J5OA 4AQYF 2JVRA 3Q8UA 3H5UA 1SV5B 2DNMA 2MMYA 2ZBCA 2VC1A 1YHQS 1MMLA 2V4JB 2ZBIA 3CSKA 3FSXA 4YB6A 2V4JA 4HEA9 2NZ4A 4EU0A 3N4WA 1ZTTA 5L1LA 3MOZA 2DY9A 4X66J 1LFPA 1IBMJ 4DSJA 2NXCA 3H2LA 1WDDA 2V94A 4UW2A 2B7CB 2DHXA 4ZPWR 2PSZA 2YQ0A 4ZS6A 2JEGA 1N5YA 4PQUA 4RW4B 3K57A 2Z2MA 1JLEA 1OWXA 3I9V9 2Q66A 1BC6A 2R4FA 1NSKL 2D9PA 4I6WA 3LUYA 4LVOP 3KJVB 2ZD1B 3P49B 3ZZUA 3RBZA 2UXDF 4LRVA 1TAUA 5EDWA 2VD3A 1JKHA 3CJ8A 5G0RB 4RX6A 4L3KA 4LR9A 4ED3A 1HW8A 2MHEA 4USKA 2VPYB 3UPFA 4LR7A 2KKHA 5E3AA 1TL7B 2AIRB 2Z2ZA 4L75A 4LREA 1T9WA 1CJKA 1SVDA 2WZ1A 2ACYA 3T9ZA 3MR5A 2AQ4A 2DY1A 3DI6B 2KN4A 3B6BA 3TVYA 3P45B 5FD1A 2LXUA 4LSLB 1FEEA 1NKEA 2DVIA 1T05A 1KSPA 2BDPA 1B64A 4LF6F 4YDXA 3QZ8A 1Q5YA 1RADB 2HS0A 2ZOMA 1WORA 2H4WB 3OTCA 4Y3CA 5F0UA 2RILA 1T9YA 1Y10A 2WVDA 1YBTA 2BJDA 1AZSB 4N5SA 2BE9B 1AFIA 4N76A 3W9IA 3G8SA 3GSDA 2HHXA 2YX4A 3MFHA 1Q8KA 1DZ5A 4C3MA 2XM3A 1S48A 1WWHA 4P7TA 3L95X 4HTJA 4X64J 4DV0F 4Z7CA 1FT8A 5KFQA 1ZPWX 4DQQA 1Q8IA 4DU7A 5D3GB 2JH3A 3LAMA 4CH7A 1FI4A 2LEPA 2AU0A 1NBEB 1RAEB 3CEDA 2KG1A 1DTQB 3H2UB 5C2CA 2BQ3A 1U24A 2ZH9A 3D68A 1YJRA 4WPAA 3J80Y 1XIQA 1RT1B 3DU6A 3M05A 3TVZA 4NZ6A 1D1UA 1TFWA 2HVIA 4EBEA 3M9NB 3F0NA 1N4LA 4ZPVR 1QAYA 5DQHA 1U47A 1PJ7A 2BW7A 2C2ZB 1YJVA 2XCPA 4I2QA 3CCMS 4OJ1A 3W63A 3FRYA 1VC6A 2FJWA 3N01A 1LNQA 1B7YB 3FT7A 1S49A 2CDRB 2JNJA 4EYIB 2N82B 2RU9A 5HMYA 2ZVSA 3D9BA 2XO7A 3OTOF 2QO3A 2YNIA 3CPWR 4CYUB 2N3OA 2DR8A 4PYAA 4ZVEA 3OSPA 2QA1A 4DV2F 4IH7A 3HSDA 2I38A 4KBIA 1YBUA 4ALZA 1HNXF 4Q0BB 2EWHA 1CLFA 1R8HA 4B3RJ 3K7RA 5DZ6A 3BDEA 2HHUA 2VG5A 3UCGA 2RD5C 5CYMA 1JB0C 1HPZA 2WOMA 5IM0A 3FUYA 3MM6A 2Y3YA 2FHJA 1HPZB 1NEEA 2AF6A 3JS9A 2CZVC 2OPQB 2IVFB 1RHQB 2BUNA 2DNNA 2YPYA 2FZGB 2IAJB 2D69A 3IWLA 4MYTA 5ETKA 1FNXH 2AV5A 3LP1B 3H7HB 1BLUA 2KHDA 5LJ5Y 1WACA 2AJ2A 2MY8A 2B6AB 2GQ2A 3DLEA 2DGQA 4KSEB 3AFGA 4NA1A 5H9FJ 2Z4PA 4DR7J 3M8SA 2ZH5A 1H72C 3MEGA 4X84A 3M32A 4ZHRB 4TU9A 1KQKA 5C24A 1RYRA 2HG4A 3FCHA 2YKMB 3J81Y 4WK3A 1N32F 2DO4A 2RE1A 3RB0A 2WSEC 3TUIC 1HNXJ 3TEGA 5IT9Y 1REVA 2W7AA 3NCRA 4I4BA 4FF4A 2XWYA 3A8JA 1JXLA 4Q5VA 3HVRA 3H98A 1X0FA 5EWEA 2HRTA 5KFHA 1S1UA 1Q82T 1J2VA 1IBLJ 2DR5A 2KXNB 2RIJA 2LP4A 3HHLB 3VGUA 3L3CA 3DYAA 1JLQA 1SC6A 2V2ZA 2VDHA 1HQEB 2PC6A 3R1LA 4XPEA 3QGPA 1IM6A 3LOUA 2IHR1 2B56A 3DGPB 1XTZA 2CDQA 4CLWA 4RW7A 4DSFA 1NK5A 3ONQA 4LRCA 5E5NA 1SKWA 2JSXA 3KLIB 4FS1A 3QJJA 2XMWA 3NNEA 4IOAQ 4B3MF 5CZXA 4CLYA 2EI5A 1AB8A 2J9DE 3MR3A 3K5LA 1FJGF 3LWMA 1Y5LB 1N56A 2DRAA 5CYQA 3W7BA 2B9EA 3EMTA 4CH0S 1H74A 3CF5Q 4MMOA 1VIXA 2J5AA 3CJSA 3DLHA 1ROFA 4J9VA 3BGFA 1EB0A 1NAQA 3RJMB 2ZZNA 3EZUA 2ASYA 2BA3A 1X5TA 1HNWF 3IG1B 2K8GA 5A8WB 3MMBB 1IQTA 1BQXA 3DGVA 2Z57B 3T1HJ 2W2OP 2YQ1A 4LQ3A 4QWEA 4P2SA 4R25A 2IBOA 3QFHA 3ZNUA 5BR8J 4OI6A 2J76E 5E0OA 3Q24A 1JKHB 2IVMA 1H0HB 1UFKA 4NRUA 2E1RA 2CWXA 1Q8BA 3IC1A 3BM7A 3M6VA 2ZH1A 4A8KA 4LF7F 4GKKF 2QL9B 3ZTPA 3G87A 4CT9A 2VUGA 4L76A 4ZKAA 4AXJA 4MK8A 1IWGA 2ZHBA 3X3UA 4FYDA 2FHMA 1TVRA 1N0VC 3MD1A 2NXEA 8AT1B 2WB4A 2AY0A 1RZMA 2ZBRA 4KAIA 5KFMA 4JV2A 3MF5A 2IRYA 4X4OA 1RHRB 3DOLA 4ZPDA 2OIHA 2K9IA 1EX8A 4R0JA 2PGCA 3ZZZA 1D09B 2DNLA 2LU2A 3K17A 4XO0A 1G6BA 4NEZA 1BMQB 4CNYA 2E1PA 1N5SA 2RNEA 4K5RA 4O23A 2AMCB 1KQGB 1WF0A 1SH0A 1X4CA 3P8BB 1UW4A 2DIVA 5CZVA 2BR0A 3D1OA 4O0IA 5JVGQ 3P3DA 2B6AA 2K2PA 2Z0GA 4RKUC 3M6XA 1H2VZ 5HBMA 3I6PA 5DG8A 2C3OA 3EDRB 1VRTB 4ANEA 3MCOA 3V6DB 4OHWA 1AFJA 1YG0A 3HJVA 3I31A 2GVDA 4UUXA 3AT1B 5LT5A 4D8JA 5KTQA 4J9UE 2HVDA 1DJ0A 5D0GA 3DMJB 4PG4A 2JC0A 4UOCA 2IM1A 5M2RA 5F8JA 3D3BJ 5D77A 1RWPB 2W2QP 5E3CA 3VAJA 3I5BA 2QT7A 1HBNA 2ZUAA 4OZ0A 3M8QB 1VC5A 4RW9B 1K9MT 2FZCB 1C1CB 2IM2A 2MZQA 3MM9A 1GXUA 4HLBA 1H2UX 4DUZJ 1SC1B 3F56A 1JLFA 1HI1A 1RB0A 1VCTA 2QC3A 2IVYA 2FC8A 4ZPBA 2QLBB 3T6BA 3PO4A 2VIHA 4WZMA 4H4OA 3RRHA 5I4MA 4DHVA 2M52A 4ZK7M 4NMXA 1O6XA 4QWAA 2R8HA 4DS5A 1GX5A 2MQPA 2F9DA 1WHVA 2MLZA 2Z30B 4B08A 2G13A 2ABYA 3BKUA 2H5IB 2GPEA 1R8AA 3DCAA 5T7LA 4CO4A 4LF8F 5FJ4A 4O4GB 2U1AA 3FNNA 1VQ7S 4IUFA 1RWNB 2ZE2B 1S9EB 1X8DA 5F0WA 5CYQB 1HQUA 3U7JA 2YNGB 4X65F 3RAXA 1LV5A 4CWBA 2UUBF 4QZVB 1I51B 2Q79A 2KU7A 2ZM6F 1HD0A 1RT6B 1Q8LA 2KYXA 5GAGU 4NWBA 4RW7B 2R3VA 3S6EA 2HNZA 1NKCA 2FQQB 5MLCV 2GV1A 4JV5F 1D8ZA 1D9DA 3FFIA 1NZAA 1YRTA 2DGVA 4W4MA 4DDFA 4J9OA 4EYHB 1ULRA 2XSFA 1VJWA 2H4YB 2GIFA 2RUGA 4FZVA 5F3TA 3H4BA 3PX6A 4PWDA 1B28A 1GAOA 1W7WA 1LK5A 3JYTB 3KDNA 4F04B 2V50A 1R0CB 4CI0B 1R0AA 1X9WA 1JLCB 2FVSA 2OKQA 2V8PA 3B82A 1M1HA 1QVGR 1S9FA 5L1IA 5C24B 3PW4A 4G1IA 4B3TJ 1JNZB 4I7FB 1EARA 3VAMA 2DH8A 2OMOA 4PZVA 4CM2A 4UT4A 1GQEA 5J1NA 1RISA 1KDNA 2FPHX 1SJRA 2FGOA 2W01A 4OZ2A 5G0RA 4BCAA 4ZLLA 5F9NA 2UUCF 1KFDA 4JI7J 4QYZK 3J7YU 1Y5IB 2GZOA 2IJFA 2XULA 1FTCA 5AXLA 4BBYA 2HW3A 4NI2B 3G96A 2XBPA 1MYLA 3CGIA 3IR5B 1S76D 1S5ZA 1O5JA 2CQ4A 3VGSA 3M2UB 2FIUA 5KFRA 1Q5VA 3ENAA 3OQ2A 2Z2LA 4K2JA 2ASDA 3RW7A 3C6UB 3R9LA 3TAPA 4GRSA 2QA4S 2P6SA 3M30B 2DISA 2QRRA 3PHTA 4MIAA 2KELA 3DDNA 1LEOA 4DLGA 2RRAA 4NLGA 3QSYB 4RNFA 2HMIB 2LQ8A 3QGHA 4N8NA 4IOBA 3HDSA 4A8QA 1U49A 2B4PA 2I0XA 3WIUA 3S1TA 4DPOA 3R5BA 5A6PA 5HP1A 1DRZA 1E6VB 2DHSA 4AYBD 1PYOB 3RU0A 4R5PB 5H9EJ 1D0EA 4O4RA 1M5SA 1WC1A 3QFWA 2Z56B 4KR0B 2OJ3A 4B9NA 4FKXA 3MTJA 4DR4J 4PPZA 3DRPA 4XK8C 3TOQA 3OVSA 5KT4A 3QJPA 1RWWB 4LFBF 4CLSA 1RCXB 1VLOA 5G4DA 3V4IA 2F4FA 4AL7A 4KGVB 4KFBB 3C16A 1RTZA 5E3RA 2VFVA 3DOLB 3PTWA 2FJVA 3OXFA 3CDWA 1U1KA 4WF9Q 1X4DA 4ZOSA 2JXHA 1RWMB 1R7IA 1WHWA 1ZM4A 2CQ2A 2IM3A 2DK2A 1CJTB 2CQGA 4ITSA 4TXSA 4ETXA 5M2UA 3BEGB 2VFRA 3MEDA 4YQWA 3GCXP 4MKVA 1FJCA 3MEDB 1RWVB 3ITHA 2DNKA 4DS4A 1SL1A 2DNHA 1VISA 3PRVA 4QPXA 4LFAF 2LEAA 3T5LA 2NR0A 4IG0A 1IQZA 2N3LA 3G86A 3KMSA 3TARA 1U0SA 1X5SA 1IR0A 2GIQA 4NCGB 5D0RA 2R8IA 3Q22A 4YHHJ 3KG1A 3EPGA 1XERA 1P6TA 2BM1A 2BJEA 2OPRA 3Q8PB 2BNWA 3M9OB 1TK0A 3GYNA 2JEFA 2ZH3A 3AOBA 2W9CB 5IQ6A 3KLHB 4DV6J 3M9MB 2MZSA 1UFLA 3MD3A 2CA9A 1I1GA 2DH7A 3KG4A 1YGYA 3GIKA 3VCDA 5KFPA 3GB0A 3SQGB 3OTBA 3N6MA 4F67A 4K4TA 4ANDA 4LF1A 3MPUB 3UN2A 1KQFB 2ZH4A 5KFIA 4OMFG 1NJZA 3FMTA 3C3LA 2VA3A 1VQMS 1FJEB 4C8NA 3M32B 3RG6A 1N8RT 3I56S 3P5TL 4K4YA 4LFAJ 3LTOA 2CNLB 3KMQA 2XMUA 3CT9A 5LOQA 1R31A 3HX9A 4I1TA 2ZH8A 5L46A 3CCES 4F3QA 2QV6A 1NPKA 5LMNF 3V81A 1SUQB 3L7UA 2DNPA 2UZAA 2HIQA 2CQDA 3C8YA 4ED0A 5IOLA 2MKHA 4RNOA 4NX9A 1BDTA 3BBBA 2CFXA 1S9GB 2HQDA 4J91A 1KQSR 4KHPF 4K4SA 5DQGA 3Q23A 2CZ4A 2HZCA 3EVWA 2AJFE 4CZCA 3L9ZA 2V34A 2YWWA 4X4NA 2ZWOA 4LF5J 1H6KX 2YQ3A 3CD7A 5B0BA 3KFWX 4B9LA 2MKKA 1WOSA 2H65B 2FVPA 2RQ4A 1TV6B 4CO5A 2H3AA 3CD6S 1VRUB 2X51A 1MMNA 3NS5A 4RWWA 4CO1A 4ED4A 1M5KC 2GIRA 2WVFA 2ZITA 2GCFA 3QLHA 1F5AA 3GV8B 3JQKA 3OL9A 3W9JA 4EI2A 2UUAF 2VDIA 1LXNA 4I64A 2ADLA 2BBEA 1KHVA 3LF0A 4NYZA 3JSYA 3GFXA 3WHIA 2COLA 2FHKA 3M30A 2Y9HA 2J7WA 4M5HA 2KKEA 3M6UA 1EHWA 1MG7A 4DR3F 3OSNA 3DU5A 4KE5A 2WHOA 4NE9C 3HHKA 2RDJA 1NCLA 3Q83A 3MCMA
chains in the Genus database with same CATH topology
2K1OA 1ARRA 2K29A 2BNZA 1Q5VA 2FGCA 2CPGA 2BJ9A 2PC6A 2WVCA 3VEBA 2WVEA 1EA4A 2WVBA 2JXHA 1ARQA 2HZAA 3QOQA 3LGHA 3FMTA 3VW4A 2KELA 4ME7E 3PHTA 2CAXA 2BSQE 1B28A 1Q5YA 4HV0A 2WVFA 3FT7A 3H87C 3BKUA 2GPEA 1PARA 1BAZA 3GXQA 2BJ7A 2WVDA 4D8JA 1QTGA 1B01A 2HZVA 1X93A 1P94A 2AY0A 2K6LA 3OD2A 2H1OE 3BKTA 1MYKA 2RBFA 3VEAA 1BDVA 1MNTA 2BJ3A 2F1FA 2JXGA 2NZCA 2CAJA 1NLAA 2K9IA 3BKFA 2BJ8A 2K5JA 3QSIA 2BNWA 2BA3A 1IRQA 2JXIA 1BDTA 4FXEA 1MYLA 2CADA 1U9PA 2CA9A 2BJ1A 2Y3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1O A;  1ARR A;  2K29 A;  2BNZ A;  1Q5V A;  2FGC A;  2CPG A;  2BJ9 A;  2PC6 A;  2WVC A;  3VEB A;  2WVE A;  1EA4 A;  2WVB A;  2JXH A;  1ARQ A;  2HZA A;  3QOQ A;  3LGH A;  3FMT A;  3VW4 A;  2KEL A;  4ME7 E;  3PHT A;  2CAX A;  2BSQ E;  1B28 A;  1Q5Y A;  4HV0 A;  2WVF A;  3FT7 A;  3H87 C;  3BKU A;  2GPE A;  1PAR A;  1BAZ A;  3GXQ A;  2BJ7 A;  2WVD A;  4D8J A;  1QTG A;  1B01 A;  2HZV A;  1X93 A;  1P94 A;  2AY0 A;  2K6L A;  3OD2 A;  2H1O E;  3BKT A;  1MYK A;  2RBF A;  3VEA A;  1BDV A;  1MNT A;  2BJ3 A;  2F1F A;  2JXG A;  2NZC A;  2CAJ A;  1NLA A;  2K9I A;  3BKF A;  2BJ8 A;  2K5J A;  3QSI A;  2BNW A;  2BA3 A;  1IRQ A;  2JXI A;  1BDT A;  4FXE A;  1MYL A;  2CAD A;  1U9P A;  2CA9 A;  2BJ1 A;  2Y3Y A; 
#chains in the Genus database with same CATH topology
 3H5Y A;  1Y5N B;  4YB5 A;  4DBQ A;  3PW2 A;  2V2V A;  1TMM A;  2YWE A;  3MMA A;  5D6G A;  2XCA A;  3KK3 B;  5IT9 U;  2GQQ A;  2PFD A;  4NA3 A;  3SCK E;  2FLO A;  3B78 A;  1N0U A;  3UE2 A;  1S7H A;  3NS7 B;  4NXN F;  3FMW A;  1JNR B;  3K8V A;  1V3R A;  3QPI A;  4O0N A;  3SBM A;  5AXN A;  3HKW A;  2R8G A;  4W92 B;  1TQL A;  2R7R A;  3R2D J;  2NZC A;  4EUV A;  3A3O B;  3GLJ A;  1S6O A;  5KFL A;  2YNF B;  4QW9 A;  2H5J B;  3E01 B;  3NWG A;  2AGO A;  3TI0 A;  2MSS A;  1UVJ A;  3B4M A;  1IBK J;  3EXY A;  3AB4 B;  1Z4U A;  2VFS A;  4DV7 F;  1N54 B;  3RZA A;  3ITH B;  4DV5 J;  1HWU A;  1KP6 A;  2EFP A;  2JOQ A;  4OX6 A;  5HLF A;  5I3P A;  4K4X A;  3CXC R;  1U1R A;  4KJI A;  3BYP A;  4U8Y A;  4M5J A;  2BKO A;  2IIH A;  4LIW A;  5IWA F;  3CJK B;  1UET A;  2JLE A;  2XWX A;  5EGY A;  4UQG A;  3LGH A;  3K89 A;  2VPW B;  4FNI A;  3LW5 C;  2EK1 A;  4LSL A;  4TU7 A;  4C8O A;  1HL6 A;  2PEH A;  4IOC Q;  1NZ8 A;  1R8P A;  1UMJ A;  2CQ1 A;  5HRO A;  4HHH A;  4X65 J;  4ZLJ A;  5CAB A;  2X7I A;  3LO3 A;  2ACM A;  5E7O B;  3JSM B;  5A8R B;  4FXD A;  4KFB A;  1BQM B;  3I4H X;  4KB7 A;  5A2Q Y;  3ET6 A;  2R42 A;  3NRB A;  3TQE A;  5HP1 B;  1WKJ A;  4DF8 A;  4ERD A;  2GFF A;  2ZBQ A;  1HR0 J;  4PCQ A;  3MUV P;  1J27 A;  4DL4 A;  1HNZ F;  1FRX A;  2QIF A;  4R5P A;  5ETR A;  3CCV S;  2ALZ A;  2L9D A;  3TEH B;  1MWY A;  4F4X A;  4L74 A;  4HT7 A;  2LDY A;  4CLK A;  2MQO A;  1C1C A;  4JI8 F;  2P2C B;  4GKJ J;  1RAC B;  2MJN A;  2RH3 A;  1FDA A;  2XMT A;  1JLF B;  1TP7 A;  3S01 A;  1WSR A;  1S12 A;  5H1S V;  3QZ7 A;  2AZ1 A;  2HHW A;  2CJQ A;  1NU4 A;  3FSI A;  2QEX S;  3IBC B;  1S1V A;  4G1Q B;  4B3M J;  3ETM A;  2H48 B;  2QLF B;  1OPI A;  2ZD1 A;  1Y7P A;  4KV8 B;  2I5J A;  2IFX A;  4LRD A;  1L3V A;  4KV8 A;  3F41 A;  1DHM A;  4OJH A;  3EVO A;  3W60 A;  3VVT A;  3PW5 A;  3KTQ A;  4UY8 T;  3NNA A;  3HVW A;  3MM6 B;  1XR6 A;  2CG8 A;  3N0V A;  3UVJ B;  3PR5 B;  3PW7 A;  2IA6 A;  1W2B R;  4P72 A;  4KYZ A;  2C2K B;  3HXM A;  4MKY A;  1YX2 A;  2FUG 9;  5SUH A;  4EGL A;  1F9F A;  5KOX A;  3OD2 A;  2NUH A;  1WC6 A;  3SFG A;  2D41 A;  1SC3 B;  3BKF A;  4L3N A;  1HMV A;  2Y1J A;  2I6W A;  3D6H B;  4ECQ A;  4I2P B;  2KG0 A;  3PV8 A;  1KLN A;  3SIP B;  1LKZ A;  4OX7 A;  5B0G A;  4ECY A;  5KT3 A;  3MCS A;  2MZR A;  2OPP A;  4CLF A;  2VA2 A;  2OPS A;  4KGZ B;  3DOM B;  2EFV A;  4ECS A;  2QG9 B;  3UNY A;  2MHN A;  4DL0 C;  3EXC X;  4OYW A;  4C98 A;  4DOZ A;  1FNO A;  3NG8 A;  4DR7 F;  4U7U D;  3FMB A;  1OY6 A;  1JK9 B;  3QT6 A;  3OR1 B;  4BC9 A;  2G0C A;  2V8V A;  1S9G A;  4RJV A;  4WXO A;  4GC6 A;  3UD3 P;  2AEJ A;  3N28 A;  4H54 A;  2KOE A;  3TP2 A;  3HK2 A;  4OX8 A;  2VOD A;  4NEY A;  1QY7 A;  3WC0 A;  1TKX A;  2HK2 A;  2FVC A;  4U8V A;  2A6O A;  1RWX B;  3THV A;  4PXE A;  1REG X;  3JQJ A;  3V81 B;  2KXH A;  1O8B A;  3OT9 A;  1S6Q A;  3D6M B;  3SCI E;  3S8S A;  3CCR S;  3AY0 A;  3OVB A;  1RE1 B;  3IAM 9;  3CJ0 A;  1VRQ C;  3MM5 B;  5IT4 A;  5B0E A;  4ZIW A;  2FJX A;  2L08 A;  2ZE2 A;  5FLX Y;  4L6V 3;  2CPI A;  3HVA A;  5J2Q B;  1T02 A;  2Y1L B;  1F5B A;  5D0E A;  3ZTO A;  2EFG A;  5CA5 A;  2JFK A;  3TZX A;  1P9Q C;  4DF4 A;  2L41 A;  4EBD A;  2RRB A;  4J37 A;  2LQ9 A;  4I6A A;  1VC0 A;  1T05 B;  2DCL A;  2EC2 A;  2HND B;  3KLF B;  1GEH A;  3GV7 B;  1YTY A;  2HQF A;  1XR5 A;  2WON B;  4NOH A;  4DL7 A;  4ZP6 A;  2DJW A;  3DRS B;  1DTT B;  1RKJ A;  2E44 A;  5DJB A;  4F4A A;  4P2M A;  1JXV A;  4LRB A;  3Q86 A;  2X1F A;  3IWX A;  3BBC A;  3JAM Y;  2VF3 A;  5A2Q U;  3ZTQ A;  1RGV A;  5EX0 A;  3RAM A;  2IAJ A;  1MNT A;  3IM9 A;  2OTL S;  3G8T A;  3M2V A;  2B43 A;  4Y2C A;  4LF9 F;  2CJA A;  1W25 A;  3CCJ S;  3JB9 k;  3QQC D;  1EET B;  4RPF A;  5E3P A;  1QSS A;  2XNR A;  4KH1 B;  4LFC F;  2MQM A;  5DLG A;  3K5O A;  3HHE A;  1ICE B;  2DNG A;  4F0H A;  2AW0 A;  3W5Z A;  4C48 A;  2VQE J;  1YDL A;  3IO1 A;  3B54 A;  1DQ9 A;  1RTJ A;  1V6H A;  2DNZ A;  1N36 J;  2MB0 B;  4RR5 A;  4C8L A;  1QLN A;  1CJV A;  1PC4 A;  4OYB A;  5FDL A;  5GAE U;  2E29 A;  2JVO A;  1LWE A;  1LQ9 A;  2KYZ A;  4OLP A;  1MRO A;  1SL2 A;  1DQ8 A;  1X31 C;  1D9F A;  1KHW A;  5HAN A;  3UN5 A;  1HBM B;  4WFA Q;  4L73 A;  4Y2K A;  2VL1 A;  3KNA A;  3V6J A;  4USH A;  1SH2 A;  3D67 A;  1VQ9 S;  3IRX A;  2F63 A;  3FCW A;  4USV A;  3SSQ A;  1BGX T;  4ZLP A;  3G9C A;  1DFD A;  2KM8 C;  1RAH B;  2Y1R I;  2QA2 A;  3AJ1 A;  4AL6 A;  2VQE F;  4WXW A;  3M8Y A;  4LUB A;  4M94 A;  3TZY A;  5CYM B;  4LSN A;  1F1B B;  1WEL A;  2Q6C A;  4I56 A;  4EO8 A;  3NNH A;  2QSF A;  2EG1 A;  2QN6 B;  3G6V A;  2FC9 A;  4ZN3 A;  4NPO A;  3X1L B;  4F2S A;  4K5S A;  1QJH A;  3AXM A;  1T03 A;  1NSQ A;  1NDL A;  3ELH A;  2CNO B;  1RU2 A;  2W8K A;  2HZV A;  4AAI A;  1FWK A;  2HQ3 A;  1X93 A;  2K3I A;  3A3P B;  3MMB A;  5LJ3 Y;  3KHL A;  1HLW A;  5ETP A;  2W9B A;  4RWX A;  3TO8 A;  1L3K A;  1NO8 A;  2K7K A;  2M9K A;  4RBT A;  2F3J A;  1SC4 B;  1TMJ A;  2GQC A;  2F7V A;  1U1L A;  4M95 A;  4QCL A;  4R8U A;  2OFH X;  3DLK A;  1GXL A;  2H1Y A;  1Q16 A;  4M5L A;  1TL7 A;  3JYT A;  1RWO B;  1YZ6 A;  3A8K A;  4K2X A;  3OTE A;  5J1E A;  2XMV A;  1LWF A;  1S0O A;  2X1G A;  4OX9 J;  3OR2 B;  1Z2Z A;  5HVF A;  4K4W A;  4DQS A;  5LMU F;  4G6V B;  3UR3 C;  4DQR A;  1CG2 A;  2W4D A;  3L4B C;  2J0S D;  5ETV A;  4LF8 J;  1NH8 A;  1Y00 A;  2AZ3 A;  2LQJ A;  4FYX B;  3AJD A;  2CQB A;  2HRU A;  4M63 A;  4RUA A;  2OLW A;  1DLO B;  1FD2 A;  3POT B;  4HDH A;  3ZZT A;  2VG6 B;  3JQM A;  3OBI A;  1RT5 A;  1SL0 A;  5F8N A;  1HWJ A;  4NLS A;  3M2R B;  5IT0 A;  2RKI A;  4LQ9 A;  2BM0 A;  4FF2 A;  2RJZ A;  5ETM A;  4ES1 A;  4YP3 A;  3GP9 A;  3SEO A;  1IBL F;  7FD1 A;  1RTD B;  1E6Y A;  1RAG B;  4B9T A;  2H9Z A;  4PEO A;  3SFU A;  4WP3 A;  2I2Y A;  3DOK B;  2JFD A;  4BHQ A;  3AD9 C;  3M8P B;  2POK A;  4A8S A;  3NBP A;  1SV5 A;  4TVA B;  3T1Y J;  4DX5 A;  3KLE B;  3UI3 A;  1B70 B;  3UN3 A;  4M5I A;  2QLJ B;  4U95 A;  3CDE A;  1KD1 T;  1UVI A;  3VEB A;  2AX0 A;  4P2X A;  3PKY A;  1NB2 A;  2QLX A;  1NUE A;  1HBO A;  1OQ3 A;  2CAX A;  3PX0 A;  4DSK A;  3QMQ A;  1RT3 B;  2UXC J;  2GJI A;  1EAY C;  3PFO A;  2XYG B;  2R7X A;  2C3U A;  3RBX A;  1F5C A;  1QUV A;  3IA0 A;  3AOC A;  1WDT A;  3NGK A;  1RP5 A;  4GO7 X;  4HAC A;  2A2D A;  3D0I E;  1JLB B;  4HAC B;  2EBE A;  1X5O A;  3IRX B;  1HNZ J;  2RML A;  3C15 B;  4ECR A;  4I67 A;  5KFN A;  3CUL A;  4WFB Q;  1WHY A;  2P5V A;  4AT1 B;  3QIP B;  4F3M A;  2VOO A;  1ZM9 A;  3MFI A;  2ZJQ Q;  2LMI A;  3H4D A;  3D2W A;  2W25 A;  1MRO B;  3KG0 A;  2KT3 A;  3DRY A;  4LBH A;  3W8G A;  2UVR A;  1YVF A;  1RLC L;  2BNZ A;  2WW4 A;  4OJ3 A;  1PIL A;  5B0A A;  2CJK A;  3PJ9 A;  1JXE A;  1N6Q B;  3QAU A;  4CLL A;  4FYV B;  3DLG B;  3RUB L;  5C2G A;  2OFG X;  5E41 A;  5J2P A;  3HHN B;  1Q81 T;  4KRW A;  5HQM A;  2CYY A;  2W9A A;  1WEY A;  2GMH A;  4JI4 J;  4JI3 J;  4K50 A;  4IRC A;  1J5E J;  2EFN A;  5KAK A;  4BS2 A;  1MN7 A;  1R3N A;  1TKT B;  4LR8 A;  4PG7 A;  5KFV A;  4X4T A;  1L3S A;  1CS4 A;  1XQI A;  1SKS A;  1QUP A;  3QO9 B;  3QT7 A;  1LXJ A;  4IG3 A;  2WSC C;  2E9T A;  3PDN A;  2R7U A;  3HFK A;  3KLG A;  1TR0 A;  1T9V A;  3D54 A;  2CQI A;  1B0P A;  3WX4 A;  1UVM A;  2NS1 B;  4YOE A;  4DV4 J;  1Q16 B;  2WBM A;  2DBB A;  3MEC A;  1MU2 A;  1T0T V;  2A2C A;  2BA9 A;  3I55 S;  3BQ0 A;  2UVV A;  4DV1 F;  1WC3 A;  1EET A;  3V4M A;  4QIF A;  1NK6 A;  2M8D B;  2WB1 D;  1DBD A;  4ZVS B;  1YLX A;  4ZVG A;  1ZM2 A;  3H5X A;  2MYF A;  1KRP A;  2O5D A;  2AN7 A;  1FNM A;  3AA9 A;  4OV6 A;  3T41 A;  3T5H A;  1S4F A;  1YZ7 A;  3BBF A;  1R43 A;  3C16 B;  1WF2 A;  5DLF A;  4NYO A;  4ECT A;  4EMD A;  2C22 A;  2MKS A;  4USI A;  3CC4 S;  4FPI A;  3FVY A;  3RRK A;  6FDR A;  3HZE A;  1FA0 A;  3DM2 B;  2Q3P A;  3FEX B;  5IXU A;  1UKU A;  3PR4 A;  2BQR A;  2OAU A;  3EDQ B;  2P9C A;  2HIY A;  3MM5 A;  2XS7 A;  1IKV A;  1WC4 A;  1B01 A;  3DRX A;  2R2R A;  2CPZ A;  5ETL A;  4DL5 A;  3LP0 A;  2HHQ A;  2CXE A;  9RUB A;  4RZR A;  1AW0 A;  1OY8 A;  2OEJ A;  1RA6 A;  2GNK A;  3LAN A;  4NLU A;  3CUN A;  3BQ1 A;  4OYO A;  2F4V J;  4PWD B;  1JMT A;  1OMS A;  3HP6 A;  1AYE A;  4DV1 J;  1TTH B;  2B8Q A;  2OEL A;  4OYP A;  1LWC A;  2OML A;  2ZC4 A;  2PII A;  5HI7 A;  3TVK A;  4DCJ B;  1XMQ F;  3GJQ B;  2L9W A;  4DPW A;  1JJ2 R;  3IN5 A;  2H5E A;  3T5J A;  3GFY A;  4F0M A;  4RUB A;  3NL0 A;  2XHC A;  2FD2 A;  4JI1 F;  3GON A;  3KLG B;  1OHN A;  1R8C A;  2MXY A;  3DHX A;  1WC5 A;  5J2N A;  2VOP A;  1U25 A;  3I0R B;  3PY8 A;  1SKU B;  1WTB A;  1TFY A;  1S0N A;  4ZCI A;  1UEV A;  2FDN A;  1RI7 A;  2XTJ P;  4TLR A;  1GXT A;  3A12 A;  2ZM6 J;  3TAN A;  3Q8V A;  1Y3K A;  2K3K A;  3NKY A;  5I3U A;  3DC2 A;  3GZ7 A;  3H42 A;  4EBC A;  2MQ8 A;  3KXD A;  3R6L B;  5B09 A;  2C3Y A;  2VFT A;  4J9M A;  4I7F A;  2IM0 A;  1TV6 A;  4LF7 J;  5KFU A;  5AT1 B;  5HQL A;  4PWW A;  1PO6 A;  4CLZ A;  1SJ3 P;  4DFM A;  3CCW A;  2EVZ A;  1RTH B;  2EG2 A;  4ZJL A;  1BWV A;  4NLX A;  1UFW A;  2GAG C;  5E33 A;  3BSC A;  3W2W B;  4RNM A;  3OUY A;  2R2T A;  4K0K J;  1EP4 A;  1BY9 A;  4B3O B;  4OFZ A;  2UUT A;  4NYP A;  2D74 B;  2V9K A;  2CPJ A;  3C6U A;  3QBC A;  3K5N A;  4DL2 A;  3OR2 A;  3OTO J;  2XC9 A;  3DRR A;  3I32 A;  1RAO A;  2B4O A;  2V68 A;  1NHV A;  3DLL Q;  2WON A;  4RBV A;  3K58 A;  3B4D A;  5DM6 Q;  1C0U A;  1DTT A;  3GIL A;  1T95 A;  1PJ5 A;  2XEX A;  4WYL A;  2JHE A;  5DZ7 A;  1M1K T;  4DXL A;  1KBR A;  3CB4 A;  5HSP A;  5KG2 A;  3CCS S;  3HSJ A;  5EUH A;  4U7C A;  1UPP A;  2CJ9 A;  3PYD A;  3Q89 A;  4MK9 A;  5ETO A;  2ZEJ A;  3ADA C;  5HAO A;  3JXO A;  4NZ7 A;  5IS2 A;  2KH9 A;  2R7W A;  3RB4 A;  1PYS B;  2AWZ A;  4NLY A;  2XB2 D;  4J9K A;  2OTJ S;  1RQ0 A;  3ZZ0 A;  2PI5 A;  1Q4R A;  4B02 A;  5EX3 A;  5AE2 A;  3UD4 P;  3SZ2 A;  4DR5 J;  4ILM A;  2SXL A;  2K1R B;  3VAI A;  1U8S A;  5K20 B;  1S6Q B;  1XBW A;  2Q43 A;  4HR2 A;  4ECW A;  2YY3 A;  4QBU A;  4PPD A;  3J7Z T;  5L1J A;  3GIR A;  1CJT A;  2YWF A;  5HAT A;  4IRK A;  2CVI A;  4JV1 A;  3R5A A;  1A6L A;  1TK5 A;  2VG7 A;  4ZDN A;  4DX6 A;  3NNC A;  2NYH A;  2XZT B;  2XY5 A;  1ZZF A;  1V3S A;  3KYL A;  2EBG A;  4C6A A;  2MQL A;  3VQT A;  1FES A;  5BYQ A;  3MOJ B;  3JSB A;  5LL6 d;  1B3T A;  2QL5 B;  3E01 A;  3ZC4 A;  2PT0 A;  4Z7Y A;  4XTT A;  3J7A 1;  4ER8 A;  3DOM A;  3SSS A;  2P8I A;  2PMW A;  2M5Y A;  2LXI A;  3FDS A;  2OEK A;  5J2N B;  2HHP A;  3VZH A;  2C2N A;  2M4M A;  2KDO A;  2RVJ A;  3LP1 A;  5KG4 A;  4A4J A;  2KT5 A;  2DHG A;  1X5P A;  1T03 B;  3NEK A;  3GJR B;  2MTL A;  5DG7 A;  2FTR A;  2OD6 A;  3N9U C;  4MK7 A;  3NMR A;  3SYZ A;  4DG1 B;  2CPH A;  1YRU A;  1XEZ A;  3OW2 R;  3RW6 A;  3M7V A;  4FPR A;  5KG6 A;  1RTI B;  2BJ3 A;  2HGM A;  3DNC A;  4UF4 A;  3OL8 A;  4ECZ A;  5KFZ A;  1K1Q A;  2UU9 F;  2BJ8 A;  2A18 A;  1FK9 B;  1K0V A;  1XMB A;  2MZ1 A;  2GS8 A;  1QAX A;  1FXD A;  3T19 A;  1N5Y B;  2ZKU A;  4F7V A;  3PFE A;  3C2P A;  4TN2 A;  1Q78 A;  4ZVU B;  2QYC A;  2ZVI A;  3U27 A;  4XIU A;  4NXM F;  1VQN S;  1FDB A;  4GVB B;  3U1L A;  3KLV A;  4JI6 J;  3I0S A;  2WVB A;  1S79 A;  2EEY A;  3W5X A;  4YR3 A;  3KK2 A;  1RAJ A;  5J2M A;  1NK0 A;  2A1B A;  2DR9 A;  2M8H A;  1B7F A;  3ISZ A;  5MAO A;  2W9C A;  3DM2 A;  1ZTW A;  2E9R X;  1RT5 B;  5LMN J;  2QX0 A;  4F4W A;  1DLO A;  1FRL A;  1ZBT A;  4ZIT A;  5HO4 A;  1HWL A;  1SQE A;  1VK8 A;  1CBK A;  3MAQ A;  1C1B A;  1WOP A;  4M5G A;  3CO0 P;  3T6J A;  3JAM U;  4NLP A;  2LEB A;  1RTD A;  3ZO7 A;  3KHG A;  1IJE B;  5T41 A;  5IQQ A;  3TA1 A;  1P1T A;  2HKE A;  1VJQ A;  5C25 B;  1HKA A;  3W65 A;  5KFJ A;  4UOH A;  1ZM3 A;  2DGX A;  1FWP A;  1I3O B;  1OIA A;  3CE8 A;  2OUG A;  4A8O A;  4NL5 A;  4OZN A;  2AEM A;  4PAA A;  4LF5 F;  2AJQ A;  1CS4 B;  3H90 A;  2NYI A;  1REV B;  3BO3 A;  4J9L A;  2WVC A;  3KUG A;  4ZA1 A;  4UOF A;  2QLW A;  3DLK B;  2E1M C;  2AEF A;  4JBC A;  2JBV A;  2YH0 A;  2LXF A;  2ZZT A;  4N8O A;  3HT3 A;  2AGQ A;  4OHY A;  2JRS A;  4OJG A;  3K0J A;  4NLD A;  1FJ7 A;  1HHQ A;  2HPU A;  4QR0 A;  4DV2 J;  2ROG A;  1KTV A;  2YWG A;  2CPX A;  3J80 U;  3IWN C;  4WU2 A;  3LH2 S;  2FLL A;  4ELT A;  3BN4 A;  4GVB A;  2B4U A;  3D6T B;  2JEJ A;  3OHA A;  4BWJ A;  4YY3 F;  1KFS A;  3TRG A;  3DGP A;  1IKX B;  3CCZ A;  4MIW A;  4TYB A;  2GO9 A;  1FKO A;  3HF5 A;  1YKW A;  1S1W A;  2B9X A;  2LVW A;  4HT5 A;  4IH6 A;  3KLI A;  4QOT A;  2I8E A;  2VG5 B;  5HK4 A;  3SSR A;  5DDO C;  2KM8 B;  4KY3 A;  2J6T A;  1GNK A;  2AKW B;  3GG0 A;  1VBZ A;  4Q45 A;  4QWD A;  3QT8 A;  3Q8S B;  5DS7 A;  4F4Y A;  1R27 B;  3EGN A;  1G3O A;  5T14 A;  4CNZ A;  4RLE A;  1IKW B;  2BKN A;  1TKZ A;  2WK4 A;  2LFV A;  2QMW A;  3D0G E;  2V67 A;  3BGL A;  1VBK A;  3NBP B;  4DV0 J;  4RW8 B;  1UWB A;  4B3S J;  2M2B A;  3NCP A;  1U6B A;  3BSN A;  2IYG A;  3K2Y A;  2OD4 A;  3PNI A;  2GVD B;  3R5C A;  4H4M B;  4Y34 A;  1KS2 A;  3IAS 9;  5KFB A;  4X64 F;  2CPE A;  1AUD A;  3BJY A;  3I4P A;  3W8P A;  1FD8 A;  1WJ9 A;  2O3D A;  3AXK A;  4ZVH A;  3ET6 B;  1E6V A;  1CJV B;  1P8G A;  2H54 B;  1ZA2 B;  1ZAW A;  5FDL B;  4RUH A;  5HMW A;  3JTP A;  2IMO A;  4LFC J;  4R0E A;  4V19 X;  2HQG A;  4G65 A;  3NAI A;  3BYR A;  5LMU J;  4K4V A;  5GAD I;  1U48 A;  1U1Q A;  1HBM A;  1P27 B;  1SJF A;  4C2M A;  3HVT B;  3NGS A;  1WNE A;  3FGV A;  3R5D A;  3UW1 A;  3J81 U;  2BEF A;  4F0K A;  1FTR A;  5KFO A;  2V4R A;  1R89 A;  1YRX A;  3BQ2 A;  3GQC A;  2QFJ A;  3D28 A;  1DY3 A;  4TU8 A;  5CD4 H;  2MJU A;  2ZOF A;  2QZ8 A;  2HHS A;  1SUQ A;  1RBL A;  1S1W B;  2AYE A;  2JC1 A;  4TYA A;  4YB7 A;  4FBT A;  3HMJ G;  5KFC A;  4Q8F A;  1XMO J;  1CUL A;  1YIJ S;  1RT2 A;  5HLF B;  4LRA A;  4NRT A;  4JB8 B;  1M5H A;  1L3U A;  1R6Y A;  3Q2S C;  2GC8 A;  4B3R F;  1NH7 A;  3KDO A;  1FDD A;  2ZZM A;  3EGW B;  4DR6 F;  3EM1 A;  5F41 A;  4GKJ F;  4YFU A;  2XYP B;  1X4H A;  3PM9 A;  4DZ6 A;  3GSI A;  4FYW B;  2HHH F;  3C14 A;  5I42 A;  4JI8 J;  3LAL A;  3NGD A;  4M8L A;  1N88 A;  2M0G B;  2UUW A;  1C0T B;  1K47 A;  1PJ6 A;  1RWK B;  2DGW A;  2DIU A;  2XY7 A;  1K73 T;  1AXQ A;  3IS9 A;  4A46 A;  1S6P B;  2YX1 A;  1YBA A;  3DRS A;  4DQP A;  3KLH A;  3TX8 A;  2XS2 A;  2HWI A;  3NGR A;  4JP8 A;  3SCL E;  1BWE A;  4LF2 A;  2HFN A;  3BRE A;  2E7X A;  4YS2 A;  1NK8 A;  3CJ2 A;  3MEC B;  4E98 A;  3HKZ D;  4Q2L A;  2B9W A;  1R0A B;  1N33 J;  4QIG A;  4ZVP B;  2KRB A;  3TNV A;  4ZLN A;  3C46 A;  2FHO B;  3DKD A;  1T3O A;  2IPO B;  2NLW A;  3J7Z 5;  4PQU B;  3MPY A;  1H7X A;  2IY5 B;  4ZCK A;  1S77 D;  1P94 A;  3TUZ C;  5GMD A;  2PD1 A;  5K8O A;  2IMW P;  2B5J A;  6FD1 A;  1LW0 A;  2LA4 A;  2KXF A;  4Y0F A;  2ROE A;  3LP2 A;  2J7U A;  2O67 A;  3AHP A;  4ZVQ B;  3MZI A;  1O51 A;  2GHW A;  3MEE A;  3N5F A;  4OZL A;  1NDK A;  4PG5 A;  4K4U A;  3E3X A;  2HHV A;  2R7T A;  4UQT A;  3GJS B;  1RT4 B;  1MLA A;  1TL5 A;  2X3G A;  1CJK B;  1HNI B;  4Q7A A;  2R2U A;  1NJI T;  3P6Y C;  2KFN A;  3OUY B;  3CDA A;  3J7Y I;  4J9R A;  3L7O A;  2GA7 A;  3LAK A;  4KPY A;  1XNR J;  4W90 B;  2DTJ A;  2KTQ A;  2QA4 G;  3AQO A;  3N5B A;  1QTM A;  2F8M A;  1NM2 A;  2A3J A;  3C66 A;  1H73 A;  4X62 F;  2DHA A;  5J2M B;  4U6P A;  3KK2 B;  3QIP A;  1UWB B;  1B0V A;  4DV7 J;  4DR1 F;  3BS9 A;  3FSY A;  2OPP B;  5A0Y B;  1U6Z A;  3FBE A;  3OFG A;  4DN0 A;  2EFO A;  2NRE A;  4RW6 B;  4WE1 B;  2E5L J;  4EWT A;  4EK2 A;  2DGT A;  4OI1 A;  3KK3 A;  2X3D A;  2VV5 A;  3FBF A;  4DV6 F;  1VMB A;  3WX8 A;  5F8M A;  2HVE A;  4IFV A;  4JV0 A;  2W2N P;  1NLA A;  2UVU A;  4NML A;  4DX7 A;  4PG6 A;  1JIH A;  4MFB B;  3HM9 A;  1PIE A;  3CW2 C;  3C6T B;  3MAA A;  2QFI A;  1ZYQ A;  2HGN A;  3PYG A;  3PEJ A;  4GKK J;  5E3Q A;  3PRD A;  1RAA B;  2CJB A;  2GGP A;  4CIO A;  2OI2 A;  5KFY A;  1UVN A;  2BAN A;  1CEZ A;  2WVE A;  3D4J A;  4G3I A;  1A7G E;  2BRK A;  1HQ2 A;  1RWU A;  1WC0 A;  2QE5 A;  3JTO A;  3NP5 A;  5JXS A;  1HNI A;  5FLX U;  3NGT A;  3GV5 B;  1W26 A;  2DD8 S;  3G8Q A;  1WEZ A;  5LSO A;  5C7P A;  1XMQ J;  1XNQ J;  4AL5 A;  2RF2 A;  2OO4 A;  4KHP J;  4P52 A;  1M90 T;  3E8O A;  4ZMM A;  2GHP A;  4MH8 A;  3G6E S;  2CAJ A;  4UUW A;  3LA0 A;  4JI2 J;  3GFH A;  3CNQ P;  5JVH Q;  2FVQ A;  1GT8 A;  4H4K A;  2DHH A;  4P10 A;  2JWN A;  2VH7 A;  4I69 A;  1U2F A;  4QPT A;  2XGP A;  2VBX A;  3A8E A;  1N32 J;  2AT1 B;  2HS3 A;  3JSM A;  2U2F A;  1G1X A;  1JLG B;  2C42 A;  2YNH A;  4IG3 B;  3CCU S;  3A1Y G;  1S9E A;  3ILL A;  1S1X B;  2G9O A;  4OYI A;  5DO2 A;  3MDF A;  3TUJ C;  5KT5 A;  4EZ6 A;  4JYA J;  4AE5 A;  2X1B A;  2RHQ B;  4DZD A;  3HD1 A;  1FVQ A;  2V69 A;  3GR0 A;  3HD2 A;  1RT6 A;  2W7O A;  1N48 A;  4A48 A;  3DRP B;  1L3T A;  2DKO B;  4WP9 A;  2EPI A;  3PEH A;  4XDD A;  1R6V A;  2WRM A;  3G2X A;  2KZZ A;  2WAQ D;  1I94 J;  1HWK A;  1VI7 A;  2FJB B;  2HVZ A;  3G4S S;  3MAH A;  4WTO B;  3V4I B;  5K8M A;  2LU1 A;  1JJ4 A;  2J6U A;  2UXD J;  1QTN B;  3O6Q A;  1PBU A;  2BXJ A;  2ATL A;  1FFW B;  1WG4 A;  1QE1 B;  1V9O A;  4USU A;  3SCJ E;  5LSL A;  2DRB A;  2HWT A;  3DDK A;  2AD9 A;  2N4D A;  2W2M P;  4KH0 B;  3R8Y A;  3J81 j;  4YB1 P;  4KHM A;  4YUD A;  3QWP A;  1HA1 A;  3W64 A;  1JLB A;  1UZD A;  3VTI A;  1XR7 A;  1QM9 A;  3VW4 A;  1IN0 A;  3UWT A;  5DRK A;  3KUH A;  2C28 A;  4KGM A;  3ENW A;  3AOD A;  5A0Y A;  4O3N A;  4IR9 A;  1EQ0 A;  1N5V A;  3T5K A;  1FE0 A;  2E9Z A;  1WEX A;  2HSE B;  4DN9 A;  3EPI A;  5BR8 F;  2B4V A;  4OL8 A;  3W1Y C;  2MEW A;  3EE3 A;  3ZTS A;  2Z8Q A;  4UOG A;  4YY3 J;  3CCQ S;  2FLN A;  4DR4 F;  2OH2 A;  4ZP7 A;  2AJ0 A;  5K8N A;  3P5B P;  3KNG A;  5IC6 B;  4QW8 A;  4HL9 A;  1HBU B;  2J9E A;  1K44 A;  2JLG A;  4ZP8 A;  4C8M A;  4J9P A;  1HBU A;  1E6Y B;  5HBM B;  3M8P A;  3MEG B;  4OI3 A;  3KOA A;  3DOK A;  4I2P A;  1RT7 B;  2N7Y A;  2PMZ D;  3TJ8 A;  2DPJ A;  2HQI A;  4IYQ A;  2JDJ A;  2V0N A;  4H4M A;  5A8R A;  3KLE A;  1LW0 B;  3MGJ A;  2BX6 A;  1WD6 A;  3QGG A;  1BXN A;  2EXU A;  1VK3 A;  4QU7 A;  4OIX A;  2DT9 A;  3CJ3 A;  2E1A A;  1IXK A;  1RHU B;  2HAI A;  2XMJ A;  1FCA A;  3OPK A;  2C3M A;  3M2V B;  5KG1 A;  3T9N A;  3W9H A;  2VFU A;  3NCQ A;  4Y6I A;  1ARO P;  2V4Q A;  2DGU A;  4EO6 A;  2CPY A;  1HFE L;  5CHC B;  2C2O B;  2E5J A;  5D15 A;  4DPT A;  3OHB A;  7FDR A;  3GE9 A;  1NJX A;  5JJB A;  1RSC A;  2LLZ A;  1VOM A;  3KKF A;  3NO7 A;  1OJ4 A;  2P6T A;  2O01 C;  4FP9 A;  1L5U A;  1F2G A;  1IKX A;  2DGS A;  4ZVT B;  3N6L A;  3ZZR A;  1MWQ A;  1FKO B;  2YNF A;  4QYZ J;  3GPA A;  4G1P A;  1UVK A;  2BVZ A;  5CAA A;  3HI9 A;  3T1Y F;  4ED6 A;  3M8W A;  1NK4 A;  4HHU A;  4TKT A;  4YN3 B;  3CD5 A;  1WG1 A;  4KGK A;  2HK3 A;  1WSV A;  1TAQ A;  5K8P A;  1X9S A;  4FN5 A;  2G4B A;  3ICL A;  3OFF A;  2GML A;  1C2P A;  2YNI B;  1T8E A;  1H98 A;  1ZAX A;  3O3L A;  5A8K A;  2EK6 A;  3HSZ A;  2N7C A;  4QU6 A;  3LQV A;  4KGX B;  4CQ1 A;  4P7V A;  1NND A;  3K5M A;  3UO0 A;  5HRO B;  5H9F K;  5I42 B;  1BAZ A;  2AHO B;  2BJ7 A;  1SBR A;  4OLO A;  5D78 A;  3SDE B;  4ATN A;  4CP5 A;  3R1H A;  2HYI B;  4ED5 A;  1C0U B;  2YNH B;  1FKA F;  3RGI A;  4C4W A;  1KN6 A;  4J9Q A;  3TJ9 A;  1Y0H A;  4RBU A;  5CQG A;  4DUY F;  4TQS A;  5H9E K;  2FHJ D;  5KFX A;  2RS8 A;  4X2B A;  4NXM J;  1PAU B;  1HBN B;  1ZAV A;  2NCK L;  2XZW A;  3IBW A;  1IR1 A;  4RO0 A;  4DJB A;  2UUB J;  4LFB J;  3L09 A;  5SZT A;  2J8A A;  2I9S A;  3EZO A;  3GYG A;  3R27 A;  4CH1 A;  2PFF B;  2J9C A;  3TWZ A;  4X4R A;  3OVA A;  3BV8 A;  2JZ5 A;  1YK9 A;  2YWK A;  1TL4 A;  3MR7 A;  3O1L A;  4DCP B;  4X4S A;  1ITP A;  3GG1 A;  3BPD A;  1RHM B;  2UV8 G;  2NQP A;  2M7S A;  1M0S A;  5HMZ A;  3AD8 C;  4WJB A;  2EC0 A;  1LWE B;  2QTW A;  2E5I A;  3O2I A;  2CQ0 A;  3CD0 A;  4N47 A;  4WZQ A;  2DCU B;  2DXF A;  2W1B A;  1FVS A;  4QJV A;  2PA3 A;  2EW9 A;  4M5N A;  3T1H F;  1DQA A;  3K5P A;  2J0X A;  2H1O E;  2XNQ A;  3D0H E;  3EYZ A;  1TKZ B;  4TLQ A;  3A8I A;  1UVL A;  3DHW C;  4ES3 A;  4F50 A;  2CPF A;  2GW8 A;  2CVE A;  2XZD B;  3QRQ A;  2RAQ A;  3QRP A;  2ADB A;  3BSA A;  1S7I A;  3HSG A;  4ID5 A;  3LJP A;  1U2C A;  2KHC A;  3EUN A;  1Q1K A;  2WBR A;  5KFA A;  4F2R A;  2MPU A;  1UP1 A;  2XHW A;  4RW6 A;  4WE1 A;  3AOA A;  1RTI A;  4LT6 A;  3H2V E;  3SQG A;  4DMZ A;  4CTA B;  1QSL A;  4UST A;  4AD6 A;  1HYS A;  2OGU A;  4I0W A;  1M5P C;  2W8L A;  4DR1 J;  3IGV A;  1VQ8 S;  1JJC B;  3MR6 A;  2JJ4 D;  3CO9 A;  2F8E X;  2Y8Y A;  1CC7 A;  3IGN A;  5EWF A;  4Y2M A;  1SKR A;  1VQS A;  2ZJP Q;  3OFE A;  3E51 A;  5L1K A;  4HH1 A;  2FVR A;  5K9F A;  4Y2I A;  1JJH A;  4D3G A;  3IBF B;  1GMV A;  4F8R A;  1OO0 B;  4NAS A;  4DFP A;  1IBK F;  3FEY B;  4C0O C;  1FRI A;  2VJV A;  1SI9 A;  4J90 A;  2MLY A;  4E8U A;  3EX7 B;  1UW9 A;  4DR6 J;  3KJF B;  1F3F A;  3D1Q A;  1N36 F;  2XSJ B;  1TKD A;  3NOG A;  2VG6 A;  1RDR A;  1IKY B;  3AA8 A;  3FBC A;  3MHY A;  3WQP A;  3M2R A;  3A3N B;  3VAG A;  5F8H A;  4WKR A;  1BHN A;  5RUB A;  2HHT A;  3H5S A;  1JLQ B;  1FKP B;  4UTG A;  4WBF A;  3R7B B;  5C5J A;  3Q8R B;  4NLO A;  5C25 A;  3D6F B;  2XMM A;  5DGB A;  5KFT A;  2KVQ E;  4Z37 A;  3A4T A;  1Y3J A;  1S72 S;  3OJS A;  1TL3 B;  1WF1 A;  3QO9 A;  1G7C B;  4X66 F;  2VKR A;  3BF4 A;  4ZCL A;  3DLJ A;  2F65 A;  2B0G A;  5DM7 Q;  2V2K A;  1N6Q A;  4HI2 A;  1ZET A;  4Q44 A;  1HHS A;  5A8K B;  3LWL A;  1G2E A;  2C2E A;  1TUV A;  1ZH5 A;  1N5T A;  3B8H A;  4YME A;  3TZW A;  4PAB A;  1G4C A;  4JI7 F;  1F2H A;  2BMB A;  5U47 A;  2MGZ A;  1N34 F;  2AX1 A;  1RAI B;  4AUK A;  8ATC B;  2XQC A;  2YPZ A;  4X4V A;  3QGI A;  5ADZ A;  4ZCM A;  4DI6 A;  1XN9 A;  1S97 A;  4O3R A;  5LXR A;  3MMA B;  3G6X A;  3VGV A;  1IJF B;  1KNZ A;  1GH8 A;  4OHZ A;  3TAM B;  1QVF R;  1TUW A;  1U6F A;  2QGF B;  1NME B;  4FS2 A;  3RTV A;  2GJF A;  1EP4 B;  2VB6 A;  2YKQ A;  3CCL S;  4B3O A;  2RRN A;  2QSW A;  4URS A;  5AXM A;  4CLU A;  3VGT A;  1FWL A;  3RR7 A;  1KTQ A;  2J0W A;  4IKA A;  3KK1 A;  4K0K F;  3DYA B;  3MPW A;  1AT1 B;  2HBR B;  2BYC A;  3PHE A;  1RA7 A;  1SQF A;  4AXI A;  3H59 A;  3US5 A;  5BYS A;  1VRT A;  5L38 A;  2YKN A;  2IDL A;  4GO5 X;  5A6W A;  1EQM A;  1RYS A;  4ZVO B;  1NPR A;  2RQM A;  2ZHO A;  3KWM A;  2C2M B;  2HNY A;  1MNE A;  1F6T A;  2AYM A;  4PXD A;  4Y00 A;  2W2P P;  2DGO A;  1FRH A;  1SIW B;  4LVN P;  1UZH A;  1SIW A;  1OYD A;  1PAE X;  4U96 A;  2RKI B;  2IBK A;  1S1T A;  3LGN A;  1CJU A;  5CH7 B;  4PXB A;  2KJW A;  4KQZ A;  1T9T A;  1KVJ A;  2DXD A;  4DV3 F;  4ED7 A;  1DAR A;  5I3U B;  1RJJ A;  2F5G A;  2BZ2 A;  2VC0 A;  4F26 A;  2JEI A;  2IDE A;  1HIY A;  3FCV A;  3EGZ A;  1RT1 A;  4FXW A;  1M1G A;  4FDF A;  5KG7 A;  1YI2 S;  1B0T A;  2DR7 A;  2ZKT A;  2ZNZ A;  3HPO A;  1RK8 A;  1S1V B;  4I68 A;  3BSO A;  1HR0 F;  3H0P A;  1WKK A;  1K8A T;  4P6Q A;  1JLA B;  5CYJ A;  3CME S;  3BGR B;  2CZ9 A;  1QD1 A;  2MKJ A;  3DDI A;  4KO0 A;  5F3Z A;  1NJW A;  4DFK A;  4Q8E A;  1IRQ A;  1IKY A;  2DNY A;  2V63 A;  3PCO B;  3KHR A;  1MWZ A;  1BQN B;  2ZFH A;  1CPZ A;  3ILO A;  2OHD A;  1HQU B;  3LP0 B;  2HGL A;  1FF2 A;  2ILY A;  1R0B G;  2VPZ B;  4IO1 A;  4NLV A;  5KG3 A;  2CPG A;  3FC9 A;  4H4O B;  3W66 A;  1U1N A;  3CCT A;  2LYV A;  3M1V A;  1SPB P;  2HND A;  1X7V A;  3CJ5 A;  3FK4 A;  3OXL A;  4LJM A;  4A47 A;  3KLF A;  1HAR A;  4B9U A;  2CIM A;  1YJU A;  3I9Z A;  4MIB A;  3TW0 A;  1F60 B;  4OZ3 A;  4CO2 A;  3MWB A;  4U67 Q;  2DPI A;  3ISN D;  3Q0A A;  1X60 A;  2B8P A;  4AQY J;  2QL7 B;  2Y8W A;  1RT2 B;  2CWK A;  2EFQ A;  2RHS B;  2WW8 A;  5B0D A;  5J2Q A;  3DN9 A;  2KFY A;  4ILL A;  4DX8 H;  2ZDP A;  4HDG A;  5C42 A;  1BDV A;  3PRB A;  4DEZ A;  1SJ4 P;  3CDU A;  1Q7L B;  1NDP A;  1SCJ B;  3GU0 A;  4O44 B;  4ZJQ A;  3MUR P;  3M8Z A;  1OPZ A;  3C6T A;  3MAA B;  1H3D A;  5A76 A;  3V6D A;  1SXL A;  2H3E B;  1TKT A;  3I96 A;  2VAS A;  5AXK A;  2MKI A;  1KVI A;  5D4O A;  3CIM A;  1MW7 A;  2YBV A;  4DL3 A;  2HBY B;  2YWH A;  5DDP C;  1PKU A;  2HFU A;  2MQN A;  4MKB A;  4ANC A;  2O66 A;  2VU5 A;  2HZA A;  3EWG A;  3WZ0 A;  1FXL A;  1H2T Z;  4YDD B;  4LSZ B;  4ZVR B;  1FFG B;  1N34 J;  1T3N A;  3H87 C;  4CCH A;  3AD7 C;  4TY8 B;  4OX9 F;  1UEK A;  5F8G A;  3K59 A;  4C8Z A;  1O0P A;  2ASJ A;  3MEK A;  5ETN A;  1WKL A;  2MKC A;  1K1S A;  3ZNJ 1;  2MLX A;  2OEM A;  5KFS A;  1QAI A;  4B9M A;  3THT A;  4DL6 A;  1S59 A;  3D5M A;  3DXB A;  3RBD A;  4F4K A;  4M5M A;  4OYA A;  5THW A;  4FBU A;  4JYA F;  4WFZ A;  2PA8 D;  4XAK A;  3TR5 A;  2BV3 A;  2WOM B;  4YHH F;  2DH9 A;  4DUT A;  1U8W A;  2B3T B;  2OPQ A;  1GMW A;  4ILR A;  4MYU A;  1NLK L;  3UNG C;  3UVJ A;  3V5R A;  2ZDO A;  3SXL A;  1NSA A;  3FZ2 A;  3Q2T C;  3Q8Y A;  2HQC A;  2VZ9 A;  3QWU A;  2ASL A;  3QAE A;  1I94 F;  1T7P A;  2L9N A;  4O3O A;  2VQF J;  3G6Y A;  4MJW A;  2HEK A;  4IH5 A;  4O3S A;  3JTN A;  1S99 A;  2V9W A;  4N41 A;  5A8W A;  1LOU A;  1ZPV A;  1UWA A;  1FEH A;  4KPC A;  3SDE A;  2XO6 A;  2JX2 A;  4A8Y A;  2D7S A;  3OFH A;  4NLW A;  5GME A;  1UCN A;  1WHX A;  9ATC B;  2MGZ B;  3IP0 A;  5JMN A;  4N56 A;  2CQH A;  2OP5 A;  1KR4 A;  3FQK A;  1HI0 P;  2R9L A;  1Q79 A;  3BKT A;  3PYE A;  4MKA A;  2C2D A;  4JV5 J;  4N7T A;  1VR6 A;  2L3M A;  1NB7 A;  2RB7 A;  1VQ6 S;  1UEU A;  2JL9 A;  2OSR A;  3T3F A;  1U0H A;  2E66 A;  4HTI A;  1S10 A;  2APO A;  2HBQ B;  2BAB A;  4U7U K;  2R8K A;  4LRF A;  1BQN A;  1MU2 B;  3AJ2 A;  3LPE A;  1A9N B;  5F9L A;  3OXG A;  4C0B A;  1AA1 B;  4TNO A;  2F40 A;  1MMD A;  3MMC A;  2VKZ G;  5BXI A;  3SI8 A;  2YKP A;  4JUZ A;  5ETQ A;  3GMG A;  2HFS A;  5I3Q A;  2R7Q A;  1TKX B;  3I5A A;  1BUX A;  4NLT A;  1EA4 A;  3NWR A;  5HVH A;  5B0C A;  1U1O A;  4RU2 A;  1RKI A;  3POT A;  1S1U B;  1SIZ A;  4KHR A;  4LBI A;  4URQ U;  3UCU P;  1MN9 A;  4F02 A;  4OZ1 A;  4DPU A;  1RLD A;  2LQB A;  5J1E B;  4F4Z A;  5FII A;  4QR1 A;  2RT3 A;  5D4N A;  3GIM A;  1FX2 A;  1NHU A;  2WTF A;  1S0V A;  3C14 B;  4O3P A;  2R7S A;  3M1V B;  3VV2 B;  1SQG A;  3QSI A;  4JI5 J;  3IG1 A;  4ZHR A;  4Q43 A;  4QWC A;  1RT7 A;  1T94 A;  2CG4 A;  1KLM B;  5M2P A;  2E5H A;  3MCN A;  1B99 A;  3H25 A;  2W4P A;  2I1R A;  3IR6 B;  4OHX A;  4P73 A;  4DCO B;  3GIJ A;  2BQU A;  2AP6 A;  1LW2 A;  2CUY A;  2O1P A;  4PUO B;  1U2R A;  3W2V B;  1FRM A;  3O5T B;  3OL7 A;  2DYA A;  2CNK B;  1HYS B;  2M88 A;  5GMK a;  3F73 A;  4ZPT R;  4MFB A;  2FB0 A;  2R7O A;  3RYL A;  4B17 A;  5GAH U;  3MR2 A;  2G2Z A;  1IBC B;  3MM7 B;  4CO3 A;  4QQB A;  5J1P A;  4DG1 A;  3MUM P;  1HQE A;  2DO0 A;  2C3P A;  2XYH B;  4WWS A;  2VON A;  5KT2 A;  1TEL A;  2RU3 A;  2HVH A;  2NUU G;  2PI4 A;  4IR1 A;  2JXG A;  2I5J B;  4C97 A;  1CC8 A;  2RDI A;  2NXJ A;  1ZS6 A;  2YH1 A;  3RBE A;  2K5J A;  5E2Q A;  1X4E A;  3R5J B;  4OQJ A;  2ZH6 A;  4USW A;  3W2W A;  2NXU A;  3DFE A;  1U9P A;  2BE7 D;  1J5E F;  3FKB A;  3RR8 A;  1C4C A;  2UXB J;  3W61 A;  3ZZP A;  5CCM A;  3V6H A;  2CJY B;  5IFM A;  3MI7 X;  4DV5 F;  2YTC A;  1Q86 T;  3QAT A;  4KTQ A;  3QOQ A;  2HWH A;  2YKO A;  4GVL A;  2KT2 A;  2BSQ E;  4AFF A;  2HMI A;  4JI1 J;  1GTE A;  2QMX A;  2V6A A;  3BPS P;  4KKO A;  1DUR A;  3CDB A;  5EHH A;  4DSL A;  4M5D B;  3GYX B;  1U4B A;  4Z2X A;  1CQM A;  4MJK A;  5ETS A;  1Q7Y T;  1MYK A;  1FDN A;  2C2R A;  1PC5 A;  3VQS A;  2DNR A;  3JSR A;  3TAQ A;  1GMW D;  2ERR A;  4WP8 A;  4O3Q A;  1KWM A;  4WIQ A;  3CJK A;  2FZK B;  2MZJ A;  3CTR A;  1OSC A;  4MT1 A;  1D3W A;  4ZP9 A;  2BW2 A;  3PX4 A;  5B7W A;  4N77 A;  1XNR F;  3TZZ A;  3ZXW A;  4B9V A;  2RSQ A;  1NJY A;  3PIO Q;  4FKY A;  2KFZ A;  2W9B B;  4HI1 A;  3G71 S;  1D8Y A;  3QJL A;  1OY9 A;  1EZZ B;  4DU8 A;  4CO0 A;  4BC7 A;  5F8L A;  5KT6 A;  1UTA A;  2AGP A;  1WI8 A;  1PG5 B;  1V3Z A;  1I5O B;  4R8U B;  3PZP A;  3FRZ A;  5D4P A;  2XLJ A;  1XC9 A;  2AYG A;  2VBZ A;  3EIC A;  3EZ5 A;  5DET A;  4QIW D;  5AE1 A;  2P9G A;  4OYM A;  3UDC A;  3DI6 A;  4UY8 5;  5EN1 A;  5L9X A;  3HCX A;  3CMQ A;  2W7P A;  2HBZ B;  1X4A A;  3G82 B;  4OV1 A;  4NXN J;  3K8W A;  1KOH A;  1RCO B;  3AQP A;  2H51 B;  5KFW A;  2A0F B;  4ICL B;  5AJ3 J;  2CQC A;  1RXO B;  1GK8 A;  4DSI A;  2A2B A;  2V8G A;  1Q0N A;  2N4C A;  2XLK A;  4LSN B;  3WDO A;  4ED8 A;  3DMJ A;  1Q53 A;  1JLG A;  1NHK L;  3CWJ A;  4USJ C;  3U1N A;  2HHH J;  1IVZ A;  1KC8 T;  4IFY A;  2KO1 A;  5KFK A;  4IFV B;  2WCX A;  4L72 B;  3TA0 A;  4JI3 F;  1S1X A;  4XPC A;  2EKN A;  1P1L A;  2X1A A;  1N33 F;  1KVK A;  2BE2 B;  1HNV B;  1YJW S;  1OYE A;  2B7B B;  4C11 B;  3NS6 A;  2KZM A;  4JI4 F;  2IC3 B;  4J9S A;  3TJA A;  2IJR A;  1XK8 A;  1ZZN A;  1RAF B;  3BR8 A;  1JX4 A;  4C8K A;  2GAH C;  2YKM A;  1RTJ B;  2UV8 A;  3ENV A;  3EVM A;  3GTY X;  3PJW A;  3NGU A;  1FJG J;  3TUP A;  1VBX A;  3OTD A;  2JLF A;  1RUS A;  4LBP A;  3AB2 B;  2AJ4 A;  1RBO B;  1FK9 A;  3HO1 A;  4IDK B;  3I0R A;  1U02 A;  3HHL D;  4IDK A;  1W2I A;  4KT0 C;  4ZVF A;  1DAX A;  3W62 A;  3HFV A;  4RW9 A;  4PR6 A;  1F9E B;  3SV3 A;  4W98 A;  1T9X A;  3FEZ A;  4B9S A;  2VBW A;  1KON A;  4NZ0 A;  4OYZ A;  1TVR B;  2LQ5 A;  4X4P A;  4DUZ F;  4MTP A;  4ELV A;  3PXG a;  3KJV A;  1ACM B;  3UD5 A;  1IM4 A;  2B5J B;  2FJD B;  2BOA A;  2OSQ A;  1LWC B;  2ALY B;  3C15 A;  3KJN B;  4G1Q A;  2YKA A;  4Q2M A;  5D4L A;  4JI0 F;  5HL7 Q;  2E1C A;  4J9N A;  2G2Y A;  3IR7 B;  4WKY A;  1N52 B;  2E5L F;  3PIP Q;  3IR7 A;  2UUA J;  1XJW B;  2K7J A;  3HT0 A;  4ZIV A;  1U45 A;  2RQC A;  4NI2 A;  2FY8 A;  5AE3 A;  4ZPC A;  4HVZ A;  2BRL A;  2GJ2 A;  3BO2 A;  4CM0 A;  1HHT P;  3M6W A;  1NXI A;  3GJT B;  1CVJ A;  5C42 B;  3BGU A;  4LF9 J;  4NLQ A;  3VEA A;  3O44 A;  2F1F A;  1S6U A;  5K5M A;  1J5O B;  3CIZ A;  3EJM A;  3E2E A;  1MSW D;  2DNQ A;  2D3U A;  3ISN C;  4WCE Q;  1WG5 A;  1FHT A;  4M1K A;  2DRD A;  5KFF A;  2UXB F;  2C1E B;  4RL1 A;  2XGQ A;  2CQ3 A;  5IV3 A;  1KLM A;  5ETT A;  2LEC A;  3PYF A;  2ZHA A;  2DEI A;  5DG9 A;  3PO5 A;  3MPD A;  2K29 A;  1WI6 A;  3LGM A;  1XWL A;  2J9D A;  4JI0 J;  2RUS A;  5LXY A;  1N5Q A;  4HH0 A;  4K59 A;  3HHD A;  1U1M A;  4B3S F;  4B3T F;  3Q8Q B;  1BD6 A;  1U7L A;  3U02 A;  2M3D A;  1V5I B;  1UPM B;  3GWC A;  4IQM A;  3OR1 A;  3D3C J;  4ED1 A;  1NPP A;  1DTQ A;  1LWF B;  2W24 A;  3UR0 A;  3BH6 B;  2K6L A;  3MMC B;  4P2F A;  4DR3 J;  4ES2 A;  3DRR B;  1PSD A;  3OV7 A;  1VIO A;  1Z2L A;  2MKY A;  5B0F A;  2K1R A;  4K7Q A;  4P74 A;  7AT1 B;  3BH7 B;  2G2O A;  3UDE A;  4HHJ A;  2ADC A;  1HI8 A;  2HFZ A;  1EIY B;  4F36 A;  2VBY A;  4WU3 A;  1YJ7 A;  5K14 B;  1VQK S;  1TK8 A;  5T7L B;  3GCW P;  3PJX A;  2BJ1 A;  4WTY A;  4ED2 A;  1X4B A;  1FXR A;  2EKY A;  2MQQ A;  3QYY A;  3HUL A;  2RF2 B;  1S1T B;  1NKB A;  3MTK A;  4DSE A;  3CJR A;  3U1M A;  4A8F A;  2XMA A;  4E0D A;  2KVI A;  2ILZ A;  2F8H A;  2IRU A;  3DLE B;  2HAF A;  2P9E A;  2MDA A;  3CJQ A;  2NXN A;  2RDD A;  2BAC A;  4HV0 A;  4OZ5 A;  1FX4 A;  5D8H B;  2MST A;  1C0T A;  3D7S B;  4RW8 A;  1VQ4 S;  1QTG A;  1UA1 A;  2MZT A;  5DDR C;  1ZOT A;  4CDI A;  1OS5 A;  1RHJ B;  5IM0 B;  4PYD A;  3FJ2 A;  1VQO S;  1U1P A;  2HLU A;  2E7W A;  3QID A;  4LF6 J;  4FF3 A;  4C8Y A;  3PAC A;  2XMK A;  4DR2 J;  3W3S A;  4X4U A;  1YJT A;  1HBO B;  3M8Q A;  4CTA A;  4DR5 F;  2DEJ A;  1RT3 A;  5GAE I;  2KJV A;  4JI6 F;  1KKH A;  1QDU B;  1S4E A;  3NOC A;  2G1D A;  1GFW B;  1Y11 A;  3QT5 A;  4RW4 A;  5CCL A;  2Z2Y B;  4USM A;  3HVT A;  1ZA1 B;  2B9Y A;  3HLU A;  3MM7 A;  4WFY A;  3VR1 A;  4CYU A;  3PG9 A;  4URG A;  2Q2K A;  4FVC A;  4FF1 A;  1PGZ A;  1X0P A;  1JWW A;  2YKN B;  4LMZ A;  1VRU A;  1URN A;  3GFZ A;  4F25 A;  1FO1 A;  3MMJ A;  4I2Q B;  4J7C A;  3QLH B;  4P71 A;  3VAL A;  1PAR A;  1TZ0 A;  4PKD B;  5HN0 A;  1CSJ A;  3UCZ P;  4BDP A;  3ZZY A;  5HQ8 A;  4IFY B;  4UZC A;  1HD1 A;  3TX0 A;  4LF4 J;  1A0O B;  2AYB A;  4HYK A;  4QIE A;  3C19 A;  3KK1 B;  1HNV A;  1IKW A;  1OG7 A;  4D3H A;  4WFN Q;  1FFS B;  1URR A;  2LDI A;  5DGA A;  2HNZ B;  3UDV A;  4S0M A;  1YJ9 S;  2ZBP A;  1IWA A;  5L9N A;  4ID8 A;  2CAD A;  3GII A;  1F3V A;  1Y9O A;  4RNH A;  2PMH A;  1OQ6 A;  2XS5 A;  2ZNY A;  4A8X A;  3FFI B;  5GAG I;  3ZZO A;  3NAH A;  5JUM A;  3W2V A;  2J6S A;  4C7Q A;  4PUO A;  2PE8 A;  2A6M A;  2PN6 A;  4C3K A;  1VHF A;  1X4G A;  2HS4 A;  4DPY A;  4ECV A;  4BWM A;  2LCW A;  3MM8 A;  3N79 A;  4UZB A;  1EKS A;  1YWX A;  1AUS L;  4OHV A;  3MM8 B;  4QYR A;  1VQP S;  4EZ9 A;  2UXC F;  3KUE A;  4PWU A;  4QIV A;  3TA2 A;  4RU9 A;  3I0S B;  1VHI A;  4P9S A;  3VWS A;  1VQ5 S;  2NPI A;  2CQP A;  3J7A N;  3AAW B;  2LKZ A;  2Q6B A;  1CUL B;  1RBA A;  3L7P A;  1I6J A;  5K14 A;  3BGR A;  4DPX A;  4ZN1 A;  3KHH A;  1B4S A;  2BKP A;  2UP1 A;  1PCA A;  2VQF F;  4PG8 A;  4NA2 A;  4C9D A;  1NSP A;  2GX8 A;  2K1O A;  2FLP A;  3BB5 A;  5HMX A;  1FKP A;  2HRY A;  2IYI A;  1R8B A;  4ZJO A;  3THP A;  5CD4 A;  2RQK A;  1FER A;  3RAQ A;  2F9J A;  4IG0 B;  1H38 A;  3FZB A;  1ARQ A;  1JQG A;  2G1H A;  3AH6 A;  4CT8 A;  2CJX B;  3VAH A;  3BZQ A;  4H4K C;  1TL1 A;  2GVZ A;  4C0H A;  4RNN A;  4ID5 B;  5B08 A;  4JOU A;  5KFE A;  2KI2 A;  1NRK A;  3IFE A;  3P96 A;  5GAH I;  2XLI A;  1SB6 A;  4NLR A;  2OPS B;  4KKO B;  1IBM F;  4NCA A;  2ZOG A;  2NSC A;  3VAK A;  1FRJ A;  3R7S B;  3O8W A;  4M5D A;  5KG0 A;  1GTH A;  1V5V A;  2KL8 A;  4ETZ A;  5CXT A;  1C1B B;  5AJ3 F;  3DLG A;  4KC5 A;  5J2P B;  3SV4 A;  1YQH A;  1CJU B;  3M8R A;  2XY6 A;  2Y0S D;  1U09 A;  2VJU A;  4TY9 A;  4TY8 A;  1Q95 G;  3FQL A;  3RB6 A;  2D3O R;  4DV4 F;  3TYT A;  2DIT A;  4U9R A;  2NSB A;  4A8M P;  1F0X A;  1ARR A;  2HFO A;  5F8I A;  5DDQ C;  1BE4 A;  2BAN B;  3QRR A;  3LP2 B;  1NDC A;  3R7N B;  2BJ9 A;  3R2C J;  2GGP B;  4IO9 Q;  5BYR A;  3IRW P;  3OLB A;  1D9A A;  3TAM A;  1KOO A;  4CRJ A;  1VDH A;  3VF0 B;  1VQY A;  4DR2 F;  2ZWP A;  2R2S A;  2E5G A;  1M5V C;  3EGV A;  4TQR A;  2ROP A;  1H7W A;  1UAW A;  4A8W A;  1IR2 A;  2YXL A;  5L39 A;  4DLE A;  1ELO A;  5IV4 A;  1WOO A;  2YX7 A;  3CMA S;  1QAJ A;  4OZJ A;  4Q0B A;  2PEB A;  2PDA A;  4Y65 A;  2GO8 A;  2JXI A;  2M70 A;  2OPR B;  3IS9 B;  3MPV A;  4K8R A;  4BLG A;  2G0I A;  5ITH A;  5KFD A;  3RB3 A;  1K0T A;  1BQM A;  3UFC X;  1QSY A;  1IKV B;  1UJ4 A;  2QMU B;  3ILJ A;  4E2F B;  5KOW A;  2FJE B;  1GX6 A;  2CKW A;  2D1C A;  3UQS A;  4FNH A;  4YEA A;  3FBB A;  5GVQ A;  1C4A A;  3WIV A;  5LSR A;  5KFG A;  3SQO P;  4RUC A;  6AT1 B;  2D3Z A;  3D1H A;  2IC3 A;  2KB2 A;  2XI3 A;  2XI2 A;  4GC7 A;  3BO4 A;  1JLC A;  3OL6 A;  4C11 A;  3SMZ A;  2GMJ A;  3OJU A;  1U26 A;  4WFX A;  1GMU A;  3HJF A;  3GR1 A;  4CLT A;  3VHQ A;  4WII A;  2V5H G;  3CJT A;  3VAF A;  3T1A A;  2HLT A;  2Z58 B;  1CQN A;  4KO0 B;  3OLA A;  3V6K A;  1HWI A;  2Y0B B;  4WK1 A;  2DXE A;  1U0H B;  2YVS A;  3ZFV A;  1RTH A;  3R3T A;  3BDP A;  2LA6 A;  4O4G A;  3H20 A;  3IXQ A;  2MY7 A;  3HHL A;  1TU0 B;  1TUG B;  3ZTR A;  2GHV C;  3S7R A;  2V2Q A;  1NK7 A;  4PQA A;  4Y28 C;  2DB1 A;  2FGC A;  3I5C A;  3MUT P;  3NMA A;  3ILI A;  1HMV B;  4ME7 E;  2CNN B;  2J0Q D;  3M4X A;  3G5O A;  2D3O 1;  3HZG A;  2IRX A;  3DLB A;  1Z1Z A;  4ECX A;  1VFJ A;  1PBA A;  2HUR A;  3I87 A;  3CC7 S;  2DR6 A;  3RRG A;  2QJ3 A;  2R7V A;  4EEY A;  2V8H A;  2IA0 A;  4IQX A;  3M2U A;  1J5O A;  3UDL A;  5KG5 A;  1LFW A;  2VPX B;  4IRD A;  4OYX A;  4PXC A;  5KT7 A;  4ZPA A;  4OI4 A;  2WSF C;  4LIR A;  4F3O A;  2UVW A;  3R5G A;  4NCB A;  1JLE B;  3CC2 S;  1T9U A;  1SJ1 A;  5EWG A;  3PW0 A;  1IUJ A;  4QR2 A;  2ZH7 A;  1YJN S;  2ATC B;  1EKR A;  1NK9 A;  1WUU A;  1QE1 A;  2L48 A;  1LW2 B;  4XDC A;  2CPD A;  1X4F A;  4P75 A;  4CLP A;  1VGY A;  3HFZ B;  4ENO A;  2FYX A;  3IM8 A;  4MAK A;  4X4Q A;  5HJY A;  1S0M A;  1WTF A;  5HVG A;  3VVU A;  1Y4Z B;  3NY0 A;  3GXQ A;  2XG8 A;  5D0H A;  3BN7 A;  3IMQ J;  2ZJR Q;  1UL3 A;  4K4Z A;  3LPY A;  5IWA J;  5IZH A;  4DUY J;  3R6G B;  4DQI A;  2DNO A;  1F9H A;  3CJ4 A;  8RUC A;  4OI0 A;  2BOP A;  2J7K A;  3TQ1 A;  3PKM A;  5HJX A;  5IC4 B;  3NXZ A;  1TL1 B;  2GVZ B;  1APS A;  2A10 A;  2HNY B;  3MEE B;  1TL3 A;  1YIT S;  3W5Y A;  2R8J A;  3ENQ A;  2AJ1 A;  4OI2 A;  1RU1 A;  1FRK A;  2PO4 A;  3NLC A;  4Y2A A;  1HW9 A;  5L8R C;  1SJQ A;  4C3L A;  1KEK A;  1RT4 A;  4DFJ A;  2VG7 B;  3WBZ A;  1HNW J;  2HFV A;  1OSD A;  1PYT A;  1T11 A;  4QWB A;  5GAD U;  4X62 J;  2VHG A;  2YNG A;  3V2U C;  2BE2 A;  2Y1I A;  1FE4 A;  3BR9 A;  3R97 A;  4DV3 J;  5D3G A;  3G82 A;  1LWX A;  4O44 A;  3H40 A;  2K06 A;  2QYG A;  4HKQ A;  1VLY A;  4ICL A;  2VIC A;  2F4V F;  1X9M A;  1M5O C;  1YSJ A;  3P4U B;  4LF4 F;  2ZUG A;  1S6P A;  1AZS A;  3I82 A;  3CVK A;  2UUC J;  4YR2 A;  3MXH P;  3F44 A;  3HHL C;  4PRF A;  1XMO F;  1EJ7 L;  4M5K A;  3PVX A;  2RS2 A;  4ECU A;  3H8Y A;  4FXV A;  4V1A k;  3MM9 B;  2W4C A;  2J8S A;  1RHK B;  1LK7 A;  4WYW A;  3VZI A;  3A13 A;  3QNW B;  4FXE A;  1P9Y A;  2KRR A;  2FJA B;  4JI5 F;  4FVM A;  2D9O A;  3BGO P;  2ZH2 A;  4I6Y A;  2UU9 J;  4V19 J;  4YR0 A;  1UJ5 A;  2V8D A;  1VBY A;  4NCG A;  4FYY B;  1UA0 A;  5BJR A;  1RAB B;  1JLA A;  1SH3 A;  2CRL A;  3KJQ B;  1S57 A;  3ULH A;  3WC2 A;  4ELU A;  2XSJ A;  5LM7 E;  4JI2 F;  1VQL S;  2IJN A;  2Q1L A;  5DQI A;  3ETO A;  4EFA C;  2B51 A;  2RBF A;  2E7V A;  3DXS X;  3N6N A;  2FY1 A;  1XNQ F;  2G0J A;  3D66 A;  2ZC3 A;  4GMK A;  1VS3 A;  1VYA A;  4KIA A;  4DWI A;  2NPF A;  1UJ6 A;  4J5O A;  4AQY F;  2JVR A;  3Q8U A;  3H5U A;  1SV5 B;  2DNM A;  2MMY A;  2ZBC A;  2VC1 A;  1YHQ S;  1MML A;  2V4J B;  2ZBI A;  3CSK A;  3FSX A;  4YB6 A;  2V4J A;  4HEA 9;  2NZ4 A;  4EU0 A;  3N4W A;  1ZTT A;  5L1L A;  3MOZ A;  2DY9 A;  4X66 J;  1LFP A;  1IBM J;  4DSJ A;  2NXC A;  3H2L A;  1WDD A;  2V94 A;  4UW2 A;  2B7C B;  2DHX A;  4ZPW R;  2PSZ A;  2YQ0 A;  4ZS6 A;  2JEG A;  1N5Y A;  4PQU A;  4RW4 B;  3K57 A;  2Z2M A;  1JLE A;  1OWX A;  3I9V 9;  2Q66 A;  1BC6 A;  2R4F A;  1NSK L;  2D9P A;  4I6W A;  3LUY A;  4LVO P;  3KJV B;  2ZD1 B;  3P49 B;  3ZZU A;  3RBZ A;  2UXD F;  4LRV A;  1TAU A;  5EDW A;  2VD3 A;  1JKH A;  3CJ8 A;  5G0R B;  4RX6 A;  4L3K A;  4LR9 A;  4ED3 A;  1HW8 A;  2MHE A;  4USK A;  2VPY B;  3UPF A;  4LR7 A;  2KKH A;  5E3A A;  1TL7 B;  2AIR B;  2Z2Z A;  4L75 A;  4LRE A;  1T9W A;  1CJK A;  1SVD A;  2WZ1 A;  2ACY A;  3T9Z A;  3MR5 A;  2AQ4 A;  2DY1 A;  3DI6 B;  2KN4 A;  3B6B A;  3TVY A;  3P45 B;  5FD1 A;  2LXU A;  4LSL B;  1FEE A;  1NKE A;  2DVI A;  1T05 A;  1KSP A;  2BDP A;  1B64 A;  4LF6 F;  4YDX A;  3QZ8 A;  1Q5Y A;  1RAD B;  2HS0 A;  2ZOM A;  1WOR A;  2H4W B;  3OTC A;  4Y3C A;  5F0U A;  2RIL A;  1T9Y A;  1Y10 A;  2WVD A;  1YBT A;  2BJD A;  1AZS B;  4N5S A;  2BE9 B;  1AFI A;  4N76 A;  3W9I A;  3G8S A;  3GSD A;  2HHX A;  2YX4 A;  3MFH A;  1Q8K A;  1DZ5 A;  4C3M A;  2XM3 A;  1S48 A;  1WWH A;  4P7T A;  3L95 X;  4HTJ A;  4X64 J;  4DV0 F;  4Z7C A;  1FT8 A;  5KFQ A;  1ZPW X;  4DQQ A;  1Q8I A;  4DU7 A;  5D3G B;  2JH3 A;  3LAM A;  4CH7 A;  1FI4 A;  2LEP A;  2AU0 A;  1NBE B;  1RAE B;  3CED A;  2KG1 A;  1DTQ B;  3H2U B;  5C2C A;  2BQ3 A;  1U24 A;  2ZH9 A;  3D68 A;  1YJR A;  4WPA A;  3J80 Y;  1XIQ A;  1RT1 B;  3DU6 A;  3M05 A;  3TVZ A;  4NZ6 A;  1D1U A;  1TFW A;  2HVI A;  4EBE A;  3M9N B;  3F0N A;  1N4L A;  4ZPV R;  1QAY A;  5DQH A;  1U47 A;  1PJ7 A;  2BW7 A;  2C2Z B;  1YJV A;  2XCP A;  4I2Q A;  3CCM S;  4OJ1 A;  3W63 A;  3FRY A;  1VC6 A;  2FJW A;  3N01 A;  1LNQ A;  1B7Y B;  3FT7 A;  1S49 A;  2CDR B;  2JNJ A;  4EYI B;  2N82 B;  2RU9 A;  5HMY A;  2ZVS A;  3D9B A;  2XO7 A;  3OTO F;  2QO3 A;  2YNI A;  3CPW R;  4CYU B;  2N3O A;  2DR8 A;  4PYA A;  4ZVE A;  3OSP A;  2QA1 A;  4DV2 F;  4IH7 A;  3HSD A;  2I38 A;  4KBI A;  1YBU A;  4ALZ A;  1HNX F;  4Q0B B;  2EWH A;  1CLF A;  1R8H A;  4B3R J;  3K7R A;  5DZ6 A;  3BDE A;  2HHU A;  2VG5 A;  3UCG A;  2RD5 C;  5CYM A;  1JB0 C;  1HPZ A;  2WOM A;  5IM0 A;  3FUY A;  3MM6 A;  2Y3Y A;  2FHJ A;  1HPZ B;  1NEE A;  2AF6 A;  3JS9 A;  2CZV C;  2OPQ B;  2IVF B;  1RHQ B;  2BUN A;  2DNN A;  2YPY A;  2FZG B;  2IAJ B;  2D69 A;  3IWL A;  4MYT A;  5ETK A;  1FNX H;  2AV5 A;  3LP1 B;  3H7H B;  1BLU A;  2KHD A;  5LJ5 Y;  1WAC A;  2AJ2 A;  2MY8 A;  2B6A B;  2GQ2 A;  3DLE A;  2DGQ A;  4KSE B;  3AFG A;  4NA1 A;  5H9F J;  2Z4P A;  4DR7 J;  3M8S A;  2ZH5 A;  1H72 C;  3MEG A;  4X84 A;  3M32 A;  4ZHR B;  4TU9 A;  1KQK A;  5C24 A;  1RYR A;  2HG4 A;  3FCH A;  2YKM B;  3J81 Y;  4WK3 A;  1N32 F;  2DO4 A;  2RE1 A;  3RB0 A;  2WSE C;  3TUI C;  1HNX J;  3TEG A;  5IT9 Y;  1REV A;  2W7A A;  3NCR A;  4I4B A;  4FF4 A;  2XWY A;  3A8J A;  1JXL A;  4Q5V A;  3HVR A;  3H98 A;  1X0F A;  5EWE A;  2HRT A;  5KFH A;  1S1U A;  1Q82 T;  1J2V A;  1IBL J;  2DR5 A;  2KXN B;  2RIJ A;  2LP4 A;  3HHL B;  3VGU A;  3L3C A;  3DYA A;  1JLQ A;  1SC6 A;  2V2Z A;  2VDH A;  1HQE B;  2PC6 A;  3R1L A;  4XPE A;  3QGP A;  1IM6 A;  3LOU A;  2IHR 1;  2B56 A;  3DGP B;  1XTZ A;  2CDQ A;  4CLW A;  4RW7 A;  4DSF A;  1NK5 A;  3ONQ A;  4LRC A;  5E5N A;  1SKW A;  2JSX A;  3KLI B;  4FS1 A;  3QJJ A;  2XMW A;  3NNE A;  4IOA Q;  4B3M F;  5CZX A;  4CLY A;  2EI5 A;  1AB8 A;  2J9D E;  3MR3 A;  3K5L A;  1FJG F;  3LWM A;  1Y5L B;  1N56 A;  2DRA A;  5CYQ A;  3W7B A;  2B9E A;  3EMT A;  4CH0 S;  1H74 A;  3CF5 Q;  4MMO A;  1VIX A;  2J5A A;  3CJS A;  3DLH A;  1ROF A;  4J9V A;  3BGF A;  1EB0 A;  1NAQ A;  3RJM B;  2ZZN A;  3EZU A;  2ASY A;  2BA3 A;  1X5T A;  1HNW F;  3IG1 B;  2K8G A;  5A8W B;  3MMB B;  1IQT A;  1BQX A;  3DGV A;  2Z57 B;  3T1H J;  2W2O P;  2YQ1 A;  4LQ3 A;  4QWE A;  4P2S A;  4R25 A;  2IBO A;  3QFH A;  3ZNU A;  5BR8 J;  4OI6 A;  2J76 E;  5E0O A;  3Q24 A;  1JKH B;  2IVM A;  1H0H B;  1UFK A;  4NRU A;  2E1R A;  2CWX A;  1Q8B A;  3IC1 A;  3BM7 A;  3M6V A;  2ZH1 A;  4A8K A;  4LF7 F;  4GKK F;  2QL9 B;  3ZTP A;  3G87 A;  4CT9 A;  2VUG A;  4L76 A;  4ZKA A;  4AXJ A;  4MK8 A;  1IWG A;  2ZHB A;  3X3U A;  4FYD A;  2FHM A;  1TVR A;  1N0V C;  3MD1 A;  2NXE A;  8AT1 B;  2WB4 A;  2AY0 A;  1RZM A;  2ZBR A;  4KAI A;  5KFM A;  4JV2 A;  3MF5 A;  2IRY A;  4X4O A;  1RHR B;  3DOL A;  4ZPD A;  2OIH A;  2K9I A;  1EX8 A;  4R0J A;  2PGC A;  3ZZZ A;  1D09 B;  2DNL A;  2LU2 A;  3K17 A;  4XO0 A;  1G6B A;  4NEZ A;  1BMQ B;  4CNY A;  2E1P A;  1N5S A;  2RNE A;  4K5R A;  4O23 A;  2AMC B;  1KQG B;  1WF0 A;  1SH0 A;  1X4C A;  3P8B B;  1UW4 A;  2DIV A;  5CZV A;  2BR0 A;  3D1O A;  4O0I A;  5JVG Q;  3P3D A;  2B6A A;  2K2P A;  2Z0G A;  4RKU C;  3M6X A;  1H2V Z;  5HBM A;  3I6P A;  5DG8 A;  2C3O A;  3EDR B;  1VRT B;  4ANE A;  3MCO A;  3V6D B;  4OHW A;  1AFJ A;  1YG0 A;  3HJV A;  3I31 A;  2GVD A;  4UUX A;  3AT1 B;  5LT5 A;  4D8J A;  5KTQ A;  4J9U E;  2HVD A;  1DJ0 A;  5D0G A;  3DMJ B;  4PG4 A;  2JC0 A;  4UOC A;  2IM1 A;  5M2R A;  5F8J A;  3D3B J;  5D77 A;  1RWP B;  2W2Q P;  5E3C A;  3VAJ A;  3I5B A;  2QT7 A;  1HBN A;  2ZUA A;  4OZ0 A;  3M8Q B;  1VC5 A;  4RW9 B;  1K9M T;  2FZC B;  1C1C B;  2IM2 A;  2MZQ A;  3MM9 A;  1GXU A;  4HLB A;  1H2U X;  4DUZ J;  1SC1 B;  3F56 A;  1JLF A;  1HI1 A;  1RB0 A;  1VCT A;  2QC3 A;  2IVY A;  2FC8 A;  4ZPB A;  2QLB B;  3T6B A;  3PO4 A;  2VIH A;  4WZM A;  4H4O A;  3RRH A;  5I4M A;  4DHV A;  2M52 A;  4ZK7 M;  4NMX A;  1O6X A;  4QWA A;  2R8H A;  4DS5 A;  1GX5 A;  2MQP A;  2F9D A;  1WHV A;  2MLZ A;  2Z30 B;  4B08 A;  2G13 A;  2ABY A;  3BKU A;  2H5I B;  2GPE A;  1R8A A;  3DCA A;  5T7L A;  4CO4 A;  4LF8 F;  5FJ4 A;  4O4G B;  2U1A A;  3FNN A;  1VQ7 S;  4IUF A;  1RWN B;  2ZE2 B;  1S9E B;  1X8D A;  5F0W A;  5CYQ B;  1HQU A;  3U7J A;  2YNG B;  4X65 F;  3RAX A;  1LV5 A;  4CWB A;  2UUB F;  4QZV B;  1I51 B;  2Q79 A;  2KU7 A;  2ZM6 F;  1HD0 A;  1RT6 B;  1Q8L A;  2KYX A;  5GAG U;  4NWB A;  4RW7 B;  2R3V A;  3S6E A;  2HNZ A;  1NKC A;  2FQQ B;  5MLC V;  2GV1 A;  4JV5 F;  1D8Z A;  1D9D A;  3FFI A;  1NZA A;  1YRT A;  2DGV A;  4W4M A;  4DDF A;  4J9O A;  4EYH B;  1ULR A;  2XSF A;  1VJW A;  2H4Y B;  2GIF A;  2RUG A;  4FZV A;  5F3T A;  3H4B A;  3PX6 A;  4PWD A;  1B28 A;  1GAO A;  1W7W A;  1LK5 A;  3JYT B;  3KDN A;  4F04 B;  2V50 A;  1R0C B;  4CI0 B;  1R0A A;  1X9W A;  1JLC B;  2FVS A;  2OKQ A;  2V8P A;  3B82 A;  1M1H A;  1QVG R;  1S9F A;  5L1I A;  5C24 B;  3PW4 A;  4G1I A;  4B3T J;  1JNZ B;  4I7F B;  1EAR A;  3VAM A;  2DH8 A;  2OMO A;  4PZV A;  4CM2 A;  4UT4 A;  1GQE A;  5J1N A;  1RIS A;  1KDN A;  2FPH X;  1SJR A;  2FGO A;  2W01 A;  4OZ2 A;  5G0R A;  4BCA A;  4ZLL A;  5F9N A;  2UUC F;  1KFD A;  4JI7 J;  4QYZ K;  3J7Y U;  1Y5I B;  2GZO A;  2IJF A;  2XUL A;  1FTC A;  5AXL A;  4BBY A;  2HW3 A;  4NI2 B;  3G96 A;  2XBP A;  1MYL A;  3CGI A;  3IR5 B;  1S76 D;  1S5Z A;  1O5J A;  2CQ4 A;  3VGS A;  3M2U B;  2FIU A;  5KFR A;  1Q5V A;  3ENA A;  3OQ2 A;  2Z2L A;  4K2J A;  2ASD A;  3RW7 A;  3C6U B;  3R9L A;  3TAP A;  4GRS A;  2QA4 S;  2P6S A;  3M30 B;  2DIS A;  2QRR A;  3PHT A;  4MIA A;  2KEL A;  3DDN A;  1LEO A;  4DLG A;  2RRA A;  4NLG A;  3QSY B;  4RNF A;  2HMI B;  2LQ8 A;  3QGH A;  4N8N A;  4IOB A;  3HDS A;  4A8Q A;  1U49 A;  2B4P A;  2I0X A;  3WIU A;  3S1T A;  4DPO A;  3R5B A;  5A6P A;  5HP1 A;  1DRZ A;  1E6V B;  2DHS A;  4AYB D;  1PYO B;  3RU0 A;  4R5P B;  5H9E J;  1D0E A;  4O4R A;  1M5S A;  1WC1 A;  3QFW A;  2Z56 B;  4KR0 B;  2OJ3 A;  4B9N A;  4FKX A;  3MTJ A;  4DR4 J;  4PPZ A;  3DRP A;  4XK8 C;  3TOQ A;  3OVS A;  5KT4 A;  3QJP A;  1RWW B;  4LFB F;  4CLS A;  1RCX B;  1VLO A;  5G4D A;  3V4I A;  2F4F A;  4AL7 A;  4KGV B;  4KFB B;  3C16 A;  1RTZ A;  5E3R A;  2VFV A;  3DOL B;  3PTW A;  2FJV A;  3OXF A;  3CDW A;  1U1K A;  4WF9 Q;  1X4D A;  4ZOS A;  2JXH A;  1RWM B;  1R7I A;  1WHW A;  1ZM4 A;  2CQ2 A;  2IM3 A;  2DK2 A;  1CJT B;  2CQG A;  4ITS A;  4TXS A;  4ETX A;  5M2U A;  3BEG B;  2VFR A;  3MED A;  4YQW A;  3GCX P;  4MKV A;  1FJC A;  3MED B;  1RWV B;  3ITH A;  2DNK A;  4DS4 A;  1SL1 A;  2DNH A;  1VIS A;  3PRV A;  4QPX A;  4LFA F;  2LEA A;  3T5L A;  2NR0 A;  4IG0 A;  1IQZ A;  2N3L A;  3G86 A;  3KMS A;  3TAR A;  1U0S A;  1X5S A;  1IR0 A;  2GIQ A;  4NCG B;  5D0R A;  2R8I A;  3Q22 A;  4YHH J;  3KG1 A;  3EPG A;  1XER A;  1P6T A;  2BM1 A;  2BJE A;  2OPR A;  3Q8P B;  2BNW A;  3M9O B;  1TK0 A;  3GYN A;  2JEF A;  2ZH3 A;  3AOB A;  2W9C B;  5IQ6 A;  3KLH B;  4DV6 J;  3M9M B;  2MZS A;  1UFL A;  3MD3 A;  2CA9 A;  1I1G A;  2DH7 A;  3KG4 A;  1YGY A;  3GIK A;  3VCD A;  5KFP A;  3GB0 A;  3SQG B;  3OTB A;  3N6M A;  4F67 A;  4K4T A;  4AND A;  4LF1 A;  3MPU B;  3UN2 A;  1KQF B;  2ZH4 A;  5KFI A;  4OMF G;  1NJZ A;  3FMT A;  3C3L A;  2VA3 A;  1VQM S;  1FJE B;  4C8N A;  3M32 B;  3RG6 A;  1N8R T;  3I56 S;  3P5T L;  4K4Y A;  4LFA J;  3LTO A;  2CNL B;  3KMQ A;  2XMU A;  3CT9 A;  5LOQ A;  1R31 A;  3HX9 A;  4I1T A;  2ZH8 A;  5L46 A;  3CCE S;  4F3Q A;  2QV6 A;  1NPK A;  5LMN F;  3V81 A;  1SUQ B;  3L7U A;  2DNP A;  2UZA A;  2HIQ A;  2CQD A;  3C8Y A;  4ED0 A;  5IOL A;  2MKH A;  4RNO A;  4NX9 A;  1BDT A;  3BBB A;  2CFX A;  1S9G B;  2HQD A;  4J91 A;  1KQS R;  4KHP F;  4K4S A;  5DQG A;  3Q23 A;  2CZ4 A;  2HZC A;  3EVW A;  2AJF E;  4CZC A;  3L9Z A;  2V34 A;  2YWW A;  4X4N A;  2ZWO A;  4LF5 J;  1H6K X;  2YQ3 A;  3CD7 A;  5B0B A;  3KFW X;  4B9L A;  2MKK A;  1WOS A;  2H65 B;  2FVP A;  2RQ4 A;  1TV6 B;  4CO5 A;  2H3A A;  3CD6 S;  1VRU B;  2X51 A;  1MMN A;  3NS5 A;  4RWW A;  4CO1 A;  4ED4 A;  1M5K C;  2GIR A;  2WVF A;  2ZIT A;  2GCF A;  3QLH A;  1F5A A;  3GV8 B;  3JQK A;  3OL9 A;  3W9J A;  4EI2 A;  2UUA F;  2VDI A;  1LXN A;  4I64 A;  2ADL A;  2BBE A;  1KHV A;  3LF0 A;  4NYZ A;  3JSY A;  3GFX A;  3WHI A;  2COL A;  2FHK A;  3M30 A;  2Y9H A;  2J7W A;  4M5H A;  2KKE A;  3M6U A;  1EHW A;  1MG7 A;  4DR3 F;  3OSN A;  3DU5 A;  4KE5 A;  2WHO A;  4NE9 C;  3HHK A;  2RDJ A;  1NCL A;  3Q83 A;  3MCM A; 
#chains in the Genus database with same CATH homology
 2K1O A;  1ARR A;  2K29 A;  2BNZ A;  1Q5V A;  2FGC A;  2CPG A;  2BJ9 A;  2PC6 A;  2WVC A;  3VEB A;  2WVE A;  1EA4 A;  2WVB A;  2JXH A;  1ARQ A;  2HZA A;  3QOQ A;  3LGH A;  3FMT A;  3VW4 A;  2KEL A;  4ME7 E;  3PHT A;  2CAX A;  2BSQ E;  1B28 A;  1Q5Y A;  4HV0 A;  2WVF A;  3FT7 A;  3H87 C;  3BKU A;  2GPE A;  1PAR A;  1BAZ A;  3GXQ A;  2BJ7 A;  2WVD A;  4D8J A;  1QTG A;  1B01 A;  2HZV A;  1X93 A;  1P94 A;  2AY0 A;  2K6L A;  3OD2 A;  2H1O E;  3BKT A;  1MYK A;  2RBF A;  3VEA A;  1BDV A;  1MNT A;  2BJ3 A;  2F1F A;  2JXG A;  2NZC A;  2CAJ A;  1NLA A;  2K9I A;  3BKF A;  2BJ8 A;  2K5J A;  3QSI A;  2BNW A;  2BA3 A;  1IRQ A;  2JXI A;  1BDT A;  4FXE A;  1MYL A;  2CAD A;  1U9P A;  2CA9 A;  2BJ1 A;  2Y3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...