2WVFA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
b'SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDGGQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 35
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvfA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvfA02
2WVEA 2WVFA 1MYKA 3FMTA 1U9PA 3OD2A 3FT7A 1MYLA 2PC6A 3VW4A 2F1FA 3GXQA 2K6LA 2JXGA 2BJ1A 1IRQA 2BJ9A 2CAXA 1Q5VA 2WVBA 2JXHA 2K29A 1PARA 1ARRA 4ME7E 1P94A 2CPGA 3VEBA 2CAJA 1BDVA 2K1OA 3H87C 1B01A 1BDTA 2CADA 3QOQA 2BSQE 3BKFA 4D8JA 1MNTA 2FGCA 1NLAA 2HZVA 2AY0A 2WVCA 2GPEA 2HZAA 2WVDA 1ARQA 2BJ8A 2K9IA 2Y3YA 2BJ3A 4FXEA 2CA9A 2BNWA 3LGHA 1X93A 3VEAA 2NZCA 2K5JA 3BKTA 3QSIA 2BA3A 1Q5YA 2JXIA 4HV0A 2BJ7A 2KELA 1QTGA 2RBFA 1EA4A 1BAZA 3BKUA 2BNZA 2H1OE 3PHTA 1B28A
chains in the Genus database with same CATH superfamily
5LMUF 3OTCA 4B3TJ 3J7ZT 2FLPA 4WXWA 4U96A 3NY0A 5L8RC 1GTEA 2B4VA 1RT6B 1FRHA 3D0GE 2DGVA 1MG7A 1U47A 2KT3A 1M1GA 5DG9A 2ZEJA 1OYDA 4RO0A 1XR7A 1SB6A 1FRIA 5B0FA 1S97A 1KOHA 2GMLA 1JNRB 2FPHX 4FVCA 3HHEA 1SH3A 1NPRA 4UQTA 3W2WA 2CPXA 3JSYA 1R8BA 1X4GA 3W3SA 2VQEF 4LFAJ 1Q95G 5KG5A 4P2FA 3VAHA 2F9JA 2VH7A 1YJRA 2B9EA 5GAGU 4FF3A 4MJKA 4ICLA 3DU5A 3VWSA 2FTRA 3W1YC 1IR0A 1SUQA 2CQ2A 5ETNA 4DXLA 1X5PA 4ED5A 3HPOA 4AL6A 2OJ3A 3S7RA 5KFIA 2BRKA 3HSGA 3BQ2A 4ZVQB 4WPAA 1I3OB 5K8MA 2HQCA 3RJMB 4OI6A 1KSPA 4KQZA 5JUMA 1VQLS 1CQNA 1ZA2B 1U6ZA 2CQIA 5C7PA 4CH1A 5HBMA 2BJDA 2CQ3A 3DOMA 2ZC3A 2NXUA 3EMTA 2N7YA 1WNEA 4FXWA 4JV1A 2FB0A 1KVJA 1BDTA 3DOKA 1B0PA 4ZCLA 2DNQA 4F25A 3NP5A 3CF5Q 3GFYA 1IR1A 3B4MA 4PQUB 3EVMA 4M8LA 4OYPA 2CFXA 5LM7E 5KTQA 1N6QB 4M5DB 3MXHP 3HHLD 2RQMA 4WF9Q 2BNWA 1T05B 4OHZA 2KDOA 4AE5A 2LP4A 3TUPA 1S72S 1S4FA 2DPIA 4LMZA 3NNHA 2YWFA 3MMAA 3VQSA 1U2FA 1R8HA 3L4BC 3MR2A 1HBNA 2LEAA 1S1TA 3D0HE 3HHLB 4ZVSB 4U95A 2W9AA 2ADLA 1PKUA 2MJUA 3OHAA 2FY8A 4B9VA 5JJBA 4MJWA 5LL6d 1BQNA 4NL5A 1FJGF 3MI7X 3GJQB 2HQIA 5HI7A 1APSA 5I3PA 3FZ2A 1Y4ZB 4AQYJ 1N54B 1QE1A 4ZVPB 3W63A 2J9DE 4CH7A 4ENOA 2PGCA 5DQHA 4A8SA 1T0TV 3D1QA 4UUWA 3GG1A 3AOCA 1JKHB 4I7FB 1IXKA 4O23A 3R5BA 5CZVA 3C3LA 1SIZA 1NEEA 1ZZNA 4C3KA 1OY9A 3KXDA 4AT1B 2W9CB 1U1OA 1M0SA 3IN5A 1UWBB 2VA3A 2MYFA 1UVLA 1OYEA 1IKVB 5IV4A 4USIA 3WX8A 4RZRA 5HMWA 1NJWA 2POKA 1KQGB 4RKUC 2V4JB 1VC0A 4LRAA 4KV8B 2IM1A 3DRXA 3QO9A 2XLKA 3HFKA 4M1KA 5J2QB 2WAQD 1HW8A 2C2ZB 2RHQB 2MXYA 4N7TA 2WVBA 1RT5B 5L38A 2ZBIA 2KTQA 4DR1F 1U6BA 2KI2A 4DCJB 2OEKA 3FVYA 3BBFA 4RNMA 4GO7X 2FHKA 4E8UA 3P96A 2F40A 2J0SD 3LA0A 1DQ8A 2I38A 2A10A 1VRUB 3CDEA 2UUTA 3EGNA 3KG4A 1D9FA 3JQJA 1H7XA 4A8WA 1EB0A 5HL7Q 4NPOA 3V4IA 4JUZA 1PC4A 4DR7J 4I2QB 1YQHA 2DT9A 2CPIA 2N82B 2B43A 1NKCA 1N33F 3HJVA 3DOLB 2D7SA 2BV3A 4DFJA 2YKMA 5I4MA 2RNEA 1TVRB 1WEXA 4NZ6A 3IR6B 1DZ5A 1YJTA 4DR4F 3AB2B 2W2MP 2MQNA 3WZ0A 1T3NA 3PRBA 2BNZA 4RUBA 1A6LA 1YLXA 1FO1A 5AJ3J 2BDPA 5DDQC 3D3CJ 1QSSA 3GJRB 4N77A 2IJFA 3NWGA 1RISA 1QUPA 3QSYB 1NJYA 2E5GA 5HP1A 1VHFA 3TZXA 2MHNA 4BC7A 4NLPA 3RB4A 2HBYB 2L3MA 4URSA 3GIIA 4Q0BA 2FVRA 3IAM9 2ZH1A 1SH0A 5DQIA 1UL3A 2RQKA 2Y1JA 1XBWA 5EX0A 3THPA 1VGYA 3TANA 2IM3A 1MMLA 3L3CA 2WONA 5BYSA 1AUDA 5A2QU 4RU9A 3IRWP 1RT2B 1MROB 1ZTWA 4MKVA 2XBPA 5D3GA 3U1NA 2OFHX 4Y6IA 3CD5A 2XLJA 3KJVB 4B3OA 4DUZF 4PG4A 4GKJF 1VQKS 3KKFA 4QPTA 1N88A 1BQMA 1EIYB 4U9RA 2OPSB 2J9EA 3RRGA 4ECRA 1L3TA 3J7YU 1BAZA 1R27B 3PW0A 1OWXA 1TL7B 1XMBA 2VDIA 2DIUA 4JI0F 2I9SA 1VBYA 2VA2A 8ATCB 5IWAF 4YR2A 4V19J 3KJQB 1RT3B 2F1FA 3L7UA 4WCEQ 1RWWB 5D0EA 1B70B 2FYXA 3GCXP 2COLA 2GAHC 2NPFA 2ZHBA 1RWKB 1EARA 2MKHA 1UVIA 1UW9A 3WQPA 4NLRA 2VL1A 4IQXA 1FWLA 2YX7A 5CYJA 3MFIA 4P2SA 4O3NA 3H5SA 2VPZB 2RQCA 1MWYA 2EEYA 2E5LF 1FDAA 3KUGA 2CZVC 5GAEU 2ROGA 2LEBA 2VG7B 5IT9Y 3PV8A 1G4CA 3I9ZA 3GZ7A 3ZTPA 5LSOA 1UEUA 4K4VA 1RTHB 4HACA 2ZOFA 2JC0A 2HVZA 5I42B 5EX3A 3CCQS 3K5PA 2Z2LA 3ISZA 1SCJB 2MZRA 5A8WA 2W25A 4PWDA 3BO4A 2XYHB 4DG1B 2V69A 5A8RA 4ZHRA 4RNFA 1Z1ZA 3EDQB 5J2MB 4H4OB 1RTDB 4GKKF 1T3OA 3T1YJ 4JV5F 2K7KA 3ZZ0A 4LR7A 2M70A 5MLCV 1F3FA 3AQPA 2QZ8A 3TUIC 4V19X 3KWMA 1NB7A 2E1MC 3T41A 1FRKA 3CVKA 2GVDA 4EBEA 3T6JA 1FRXA 2VPYB 3IGNA 4K5RA 3SSQA 1R8PA 1HIYA 2MMYA 4JI2J 3P8BB 4B08A 4Y3CA 3HX9A 4IFYA 4F26A 4KH0B 3MM9A 1RTJB 2AEMA 3OTDA 1EETB 1KS2A 2B9YA 4DX7A 4IG3B 5H9EK 1SJ3P 1S79A 4HHJA 5LMUJ 2QC3A 1SL0A 2OD6A 2UUCF 2CIMA 2ZWOA 1S49A 5LXYA 1SKRA 4QPXA 2KHDA 4KKOB 3JS9A 1T7PA 3THTA 4L76A 4X4PA 2K8GA 1HWUA 4OHWA 3G6YA 5D6GA 2D9PA 5D4OA 3HZEA 1NK9A 2ALZA 2C22A 5CYMA 2ZFHA 2ZWPA 2KL8A 3CNQP 1RAJA 2QL7B 3T5KA 2HBQB 4C3MA 4HI1A 4X65F 3CCJS 1B7YB 2WHOA 7AT1B 4UY8T 1IBMF 4DI6A 2CVEA 5KFCA 2VQEJ 3JAMU 1OJ4A 1WSVA 4QW9A 3NGTA 2NSCA 4ED1A 2ZNYA 1KVKA 4YB7A 5H1SV 5J1PA 4TQSA 4NX9A 1AFJA 2FVPA 3F44A 1VQMS 3MR3A 3NGUA 2AGPA 4C97A 3OBIA 3QSIA 5T14A 4LIWA 3OVSA 3EZ5A 2XY5A 4LR9A 5BYRA 4R25A 2KO1A 3LUYA 1GQEA 4DF8A 2IVFB 2QJ3A 4ECXA 5KT5A 3TAMB 5FIIA 1M5HA 2ILYA 3VW4A 1C2PA 5IV3A 1B0TA 2AEFA 3OW2R 1LEOA 2Z4PA 5HROA 1H3DA 2QMWA 5K14A 1LXNA 1TU0B 2RB7A 2D3OR 2MEWA 1DARA 4HTJA 4OZNA 2KG0A 8AT1B 3GB0A 3GTYX 3TR5A 2VFTA 2NS1B 2F9DA 1NDKA 3Q8QB 3MMJA 3I4HX 3CJ8A 3NGSA 4K4TA 4HLBA 3FSIA 3PDNA 1T9VA 3I96A 2HHSA 3ULHA 3KK3A 2XCAA 3ET6A 1KR4A 2LXFA 3DLEA 2M4MA 4PEOA 2YXLA 4ANEA 4M5LA 3BPSP 1SJ1A 4ZLLA 5KFDA 4BHQA 1S59A 1SKSA 1FJGJ 1WOPA 3QBCA 3FMTA 1TQLA 2XGQA 4DN9A 1JIHA 1EJ7L 2AN7A 1N5QA 2DXFA 3CCMS 1B99A 2Z2YB 4C6AA 2V8VA 2CXEA 5L1LA 3THVA 2DRAA 3A13A 3ZZOA 4UOFA 1YRUA 2OEJA 4ILMA 2XCPA 3BSAA 3DMJA 1K1QA 3MAAB 4HTIA 4GC6A 1NH7A 1P6TA 4ECVA 3PIOQ 1AFIA 2GNKA 2QIFA 1DTQA 5DQGA 4IRDA 5IM0B 3MURP 1MW7A 4FS1A 3D1HA 3FRZA 2HZAA 4USVA 5I3UA 2LECA 4JI6F 2G1HA 4KE5A 1ZH5A 4USUA 3Q8PB 4P72A 4ZP6A 5BXIA 3MM7B 3HJFA 1PYSB 3K2YA 2D74B 3BYRA 2PI5A 3BN4A 5KFYA 4PCQA 3POTA 1BWEA 4NXMF 4J9OA 2DHGA 3HT3A 1JNZB 4KRWA 4KO0A 3QRRA 3CIMA 2SXLA 5KFOA 2H51B 1FXDA 4RPFA 4HH1A 1KFSA 2CPEA 4GC7A 4N47A 3CXCR 2M3DA 5CYQB 3UCGA 2HRYA 4NA3A 4DQIA 2M0GB 4E2FB 2AJ0A 4DR1J 1BC6A 1H2UX 3V6KA 5FD1A 2D3O1 1IBCB 3T1HF 1HWKA 1R43A 2E29A 1C1CA 2JVRA 4PXEA 1CJKB 4NI2A 3NS7B 2PMWA 3QT5A 3KJNB 1EKRA 2GHVC 1IKXB 4YOEA 5F8HA 3M4XA 2CUYA 4J9SA 5E3QA 3DXSX 4RW6B 4U8YA 2Q66A 2HNZA 2CJAA 4DS5A 4AD6A 1X4HA 4NYZA 5EWFA 4F4XA 2K3KA 1JWWA 2C3YA 5C24B 4CI0B 1Q79A 2G2YA 5HAOA 1T9WA 3GQCA 2ZZNA 4DR4J 4ID5A 4DN0A 2LQBA 3FDSA 1CULB 3P6YC 3UR3C 3NMAA 4X4NA 1XWLA 4HDGA 4UTGA 4F0KA 2DO0A 2F7VA 8RUCA 2V2ZA 2GQCA 1ZAXA 1R3NA 3MEKA 2CZ4A 3I4PA 1B28A 1FESA 3K0JA 2JOQA 4CYUB 2LQ9A 4TN2A 3PEJA 1K0VA 3H7HB 1IUJA 2PO4A 5CH7B 4DPOA 3CJKB 2YWWA 1NZ8A 2OEMA 2FHJA 1KLMB 5E3AA 3BREA 3RZAA 3QIPA 3H4BA 1DJ0A 4FXDA 1S0MA 3CC4S 2ZH3A 1HMVB 2ZITA 3SDEA 4C8YA 4UOCA 2NPIA 4DFMA 4F4YA 3C6TB 2GIFA 4FPRA 2D1CA 1LV5A 2EKYA 5HK4A 2VONA 2KJVA 1TAQA 3EICA 4DUZJ 4C8NA 4GKJJ 2WBMA 4F8RA 1MU2A 1J2VA 5L46A 2ZHAA 1LWEB 2MB0B 4CM2A 3CD6S 3E01B 3MMBB 2RHSB 5LOQA 1Q5YA 4QIVA 2V8PA 4JI0J 2RD5C 4FZVA 3AJDA 4CLFA 1UW4A 3KNGA 5H9FK 2HFVA 1WKJA 1R31A 2IIHA 4AXJA 1PYOB 2J8AA 3LTOA 3RR8A 1SJ4P 2GVZB 1IQZA 2FHMA 3QZ8A 3BPDA 5ETQA 1R0CB 3O5TB 5KG2A 4MMOA 5GMEA 3VR1A 3NAHA 1MSWD 3T5HA 3ITHA 4RLEA 3EVOA 2KYZA 3KHLA 2HAFA 2O66A 4DX5A 3GMGA 1VMBA 4Z37A 4IFVA 1PC5A 1S6QA 4KSEB 2DR7A 1FDBA 3I5AA 1B64A 3DHXA 4XDDA 1NU4A 2UXDJ 1RAIB 2HS0A 1F0XA 4IRCA 4XTTA 4KBIA 2X51A 1C4CA 3KJFB 2KG1A 3PRVA 4DR5F 4UOGA 2Y1LB 4UT4A 1OG7A 4GMKA 3V81A 4NMXA 4IKAA 1GXTA 3AJ2A 4NLDA 1ELOA 2KT5A 3ZZZA 2XNQA 4L73A 1RHJB 4FYDA 5KFMA 1VBZA 4C7QA 2E5HA 2Y1RI 3LWLA 2RRAA 3TX0A 2R7UA 4GKKJ 2CG8A 3LO3A 4DPUA 4QBUA 4JV5J 2OPQB 5KFPA 2YWEA 1S9FA 3H8YA 4N41A 4PG7A 3AA9A 4Y34A 3U7JA 2R8KA 2C2MB 2ZH5A 1HLWA 1EKSA 1WHVA 1SQGA 2XS2A 3SXLA 5KFBA 1NSAA 2BE7D 1GTHA 3A8JA 3TZWA 1TKXA 3K5MA 2R7OA 2FGOA 4ES1A 3ZZRA 3GR1A 4BLGA 1NO8A 4L3KA 4WZMA 5GAHU 4OX7A 1J5EF 2CPDA 1YTYA 1I5OB 1UFKA 2IBKA 4LVNP 2PMZD 3UO0A 4ZCMA 3LH2S 4Y2IA 1HYSA 3UCZP 3OT9A 1Y10A 4JI3J 2B7BB 2MKJA 2Y8WA 3AOBA 4DCPB 2PFDA 4Q44A 2RS2A 2DYAA 2ERRA 2HPUA 3LF0A 1KFDA 1NNDA 2HS3A 1FEHA 2W2OP 1UWAA 3RB6A 3NS6A 3OJUA 4K4ZA 5KG4A 1U2CA 3ZTSA 1S6PB 4OI3A 4X65J 2AJ1A 1V6HA 4R8UA 1IBMJ 3NRBA 1CJTB 2FC8A 1RA7A 3BJYA 1AT1B 1UZDA 1ZZFA 5EHHA 2OHDA 4ZPDA 4ZDNA 3LP0B 5K20B 3ZZUA 4DR2J 2J0QD 2I2YA 1I94F 3MTKA 5KT3A 1TV6B 4ZP8A 1H98A 3WIVA 3Q2TC 5HN0A 2R2UA 4U8VA 1IBLJ 2JVOA 2PEBA 3M8QA 3P5BP 1NHKL 4ES2A 3ILOA 4LRFA 4OIXA 3MEGA 2MTLA 2PI4A 3C2PA 1RBLA 3JYTB 2YKAA 3BGRA 1FWKA 2RDJA 1S10A 1K47A 4TY8A 3QYYA 4GVBA 1NZAA 5LXRA 4KIAA 2C3MA 4IO9Q 4WFYA 4DV2F 4WXOA 5DG8A 4I69A 3OUYA 4C9DA 1JLAA 3J7AN 1XN9A 4O3SA 4CCHA 2PA3A 3M8PB 2B0GA 5L9NA 2VG5A 5B0DA 4ZLJA 2WOMB 3LP1A 3KLHA 4OX6A 3HSZA 3PKMA 3LP2B 3L7PA 3V6JA 5E41A 2B7CB 1JLGA 1KP6A 2YKNA 3BQ1A 3BDEA 2ZD1A 1GT8A 2HHTA 3QFHA 2KYXA 4DBQA 3HCXA 4O4GB 1FEEA 3FCWA 1U48A 4WTYA 5CA5A 3UNGC 3QGIA 3QJJA 3DDNA 1G6BA 4NLGA 3G9CA 1WOSA 4CNZA 4R5PA 1C0TA 2OTJS 2HNYB 3CMAS 2B51A 4B9LA 3OR2A 4CLZA 2HRUA 2I6WA 4I56A 1UJ6A 1UFLA 2EBGA 2IDLA 2KHCA 4B9NA 2ZKTA 1ROFA 4XDCA 1QTNB 3O44A 2MLYA 2EK1A 5BJRA 5F9NA 1A0OB 2RILA 2E7VA 4JV2A 1UMJA 3ELHA 4AXIA 4EEYA 4LF1A 3AJ1A 1HBUB 3IWLA 1L5UA 2R8HA 1LK7A 1S1UB 2CPJA 3NKYA 2EXUA 4CLPA 3CTRA 2QGFB 4C48A 1JLQB 4NA2A 3LGNA 3SQGA 2CPFA 1MN7A 4UZBA 3F0NA 3SEOA 2GMJA 5KFSA 2XZTB 5DM7Q 4YS2A 4KAIA 4LREA 4WYWA 3HLUA 2VFRA 4ZJOA 1Y11A 2NLWA 5KFQA 5DDOC 2PDAA 5HVHA 2W8KA 1D0EA 2H4YB 5DZ6A 3H42A 5D78A 4JI6J 3UWTA 3W64A 4QR2A 1FJ7A 1HQUA 1WG4A 3RBZA 3RUBL 4WU3A 1B3TA 4P9SA 3BM7A 3MMCA 3K8VA 4QWBA 2Y0BB 1O8BA 4B3MF 1N5YB 2GC8A 5B0EA 2F65A 3G4SS 4YB1P 1P9QC 2V63A 4USWA 2CPHA 1RZMA 1S77D 4O0NA 2CDRB 4ZIVA 2W8LA 1S4EA 3M1VB 1HWLA 1GMVA 1TL3B 2R8IA 3FEZA 3GIKA 4PABA 4PQAA 3PO4A 2RU9A 2PN6A 3OR1A 1EX8A 2AX0A 3T1HJ 5LT5A 2LA6A 1NSPA 3FQKA 2R2TA 2WRMA 1F9HA 2J6UA 3SYZA 2X3GA 4UF4A 4TYAA 2CQCA 3KFWX 5F8NA 1S0VA 3KLGB 1ARRA 3NLCA 5ETSA 1CG2A 3GSDA 4DQPA 5K8NA 3M9OB 1RWOB 4HH0A 3DGPB 4OZ3A 3CCVS 1RT4A 2BM1A 3QOQA 4ZLPA 3I0RB 1YDLA 1X4FA 4FP9A 2PFFB 2H54B 1U24A 2GAGC 5FDLB 2EFOA 1E6VB 4ELUA 2V6AA 3C16A 5KT2A 4QQBA 2NREA 1BQXA 2CA9A 1PJ7A 1UTAA 3C46A 2W9BB 4IR9A 1AB8A 4J5OA 5CABA 1X93A 2V68A 3QFWA 5C5JA 3BEGB 2IA6A 1WUUA 2G13A 3KTQA 3D66A 1VQSA 4EUVA 3TA1A 1LWFA 3DYAB 1RGVA 2JX2A 3B4DA 1TKTA 4EBCA 4RUHA 3D67A 4C8KA 5THWA 3DLKB 4AAIA 1YI2S 3ZFVA 3BR8A 1GX6A 3W5ZA 4CWBA 2A18A 3DLGB 1BWVA 3P5TL 1NDPA 3MM6B 2EVZA 1N0UA 1Q86T 3N9UC 4LFBF 4C3LA 4M5KA 3J7A1 2A0FB 4I0WA 1SV5A 1OQ6A 1ZM2A 4HVZA 3G87A 1RK8A 3GJSB 2DY9A 3OL7A 4UUXA 3W2VB 3EGWB 1HD0A 3KLIA 3B82A 4LSNB 4X4RA 3HVRA 1VS3A 4Y2KA 5A0YB 2DGWA 3H2VE 2OGUA 1XR5A 2JEJA 3BN7A 2XTJP 5IFMA 5F8IA 3OHBA 1LFPA 4I4BA 4RJVA 2XMMA 4AFFA 1AW0A 3IS9A 4E0DA 3RAXA 1RE1B 5E3RA 2ILZA 2UVRA 2MQPA 3M32B 4DWIA 4OX9F 1GEHA 3RRHA 2DGSA 2QLFB 3MAHA 3EZOA 4MYTA 3L7OA 3IP0A 4URGA 4O44A 4C8MA 2Z2MA 1HWJA 2JRSA 4WFAQ 1HNXF 4DL2A 1M1HA 3QRQA 1HW9A 1NLKL 1VRTA 3CO0P 3TZYA 2A2DA 3C6UB 1LWCA 2MGZB 2ADBA 1S9EA 3MM5B 1ZETA 1HFEL 1VISA 1JMTA 1FTCA 3C15B 2G1DA 3KDNA 3DRSB 4A8XA 3K8WA 5E2QA 4DR5J 3SCIE 1CSJA 1WJ9A 4ECWA 2QFJA 2EKNA 4F4ZA 5FLXY 3BV8A 1M5OC 1NH8A 2A2BA 1UPPA 3PNIA 3BKTA 4ZVGA 1RTIA 5EWEA 2FC9A 2JSXA 2Q79A 2WSEC 2K7JA 4B3TF 3SBMA 3D4JA 1WI8A 4ETZA 1MN9A 3S8SA 3G71S 4MT1A 4ZOSA 3N5BA 2LVWA 5AXMA 2R8JA 5HMXA 3GV8B 1T8EA 1FRJA 2V94A 2ZZTA 1I1GA 1M5SA 4K2JA 1UEVA 2XMUA 2NZ4A 3DLHA 4G6VB 5KFNA 1J5EJ 2QG9B 1Q0NA 2AYEA 4ATNA 4YMEA 4C11A 4DEZA 1B0VA 2IAJA 3MOZA 4IOAQ 3IRXA 1R89A 3HP6A 4A4JA 4KH1B 1E6YA 1D09B 2RF2B 2FJDB 1PILA 4K59A 1V3SA 2DR6A 1PJ5A 2EFVA 4A48A 1ZA1B 4HR2A 3DFEA 3W2WB 2W4PA 2K9IA 1YJVA 3FBFA 3VF0B 1UVKA 4ZVHA 4HDHA 2X1BA 5AXNA 2K3IA 1VC6A 3ZTOA 2JFKA 2RBFA 4ICLB 4S0MA 2MHEA 3W8PA 2WCXA 3O8WA 2DJWA 1SUQB 3AFGA 3IG1A 2KKHA 3OL9A 2QSFA 2IMWP 2RIJA 1NJIT 2EK6A 4DQQA 3HZGA 3BZQA 2VPXB 1U4BA 3HKZD 4F36A 1ZM3A 3HF5A 1X5SA 2NUUG 2J8SA 1FJCA 2EFQA 4ERDA 4ED7A 1OQ3A 4OJHA 1RWNB 4EZ6A 2E1PA 1B01A 2QMUB 5HBMB 1K8AT 1XQIA 3DOMB 4LRVA 3IXQA 2P5VA 4MAKA 3IA0A 4ZPVR 4F02A 3T9ZA 3D68A 4DV2J 3CUNA 3DOKB 3MGJA 1MNEA 3RU0A 4YP3A 2QL9B 3DM2A 3HVAA 4FNIA 2BOPA 1T9TA 3W9JA 3SFGA 3VVTA 1OY8A 2HHWA 2DTJA 2W4DA 2PD1A 3PW2A 4Y00A 3M8WA 5K5MA 1ZPWX 1H6KX 1S0OA 3ETMA 4ILRA 3R27A 1JLEA 2ROPA 3W60A 1HBNB 1VDHA 2BMBA 1RAHB 4FN5A 3MECA 4AQYF 4X66F 2HHPA 1S1TB 2C2NA 1TFWA 1L3SA 2V34A 3JB9k 4ZCKA 1M5VC 3R5GA 2IYIA 1KLNA 3S01A 4PZVA 4DLEA 3CDUA 2W1BA 1WDDA 3FCVA 1QE1B 3VAKA 5LMNJ 1NK7A 4NLVA 2HFOA 3QLHA 3O6QA 3TJ8A 1GXUA 4D3HA 1WOOA 1KQKA 2JL9A 3V2UC 4OI1A 4ED8A 1Q8LA 2E66A 1VC5A 2DISA 5DLFA 5ETVA 4QJVA 4QR1A 4PXDA 4QIEA 4RNOA 2C2KB 4ED3A 2OLWA 3KK1A 4DV7F 3DCAA 3R5CA 2XQCA 4HHHA 4YFUA 2F63A 2IRUA 2HKEA 2L9WA 1P1TA 5IZHA 1MYLA 3DGVA 1SC6A 4DDFA 2RMLA 3BGUA 3SMZA 4H4OA 5T7LA 1RTDA 2BJ9A 3KUHA 2GO8A 3I32A 3UVJA 2YX1A 3PJXA 5KFLA 1Q4RA 2R7VA 2X1AA 3QO9B 1QVFR 1LW0A 1CJUB 2Q43A 3PY8A 3W7BA 1VQ4S 3G8TA 2FY1A 1NKBA 1N5TA 4LF7F 3R7BB 1WHXA 2K1RA 2MKYA 4DUYF 2VBYA 4B3MJ 5B0CA 4G1QA 2HZVA 3H5XA 3VAGA 1FKPB 4WTOB 1RTJA 3I31A 2EPIA 2FZGB 2DGOA 2HQFA 2APOA 2C3PA 2HNDA 1TKZA 1EETA 2NYIA 3EE3A 5H9EJ 2HZCA 3CDAA 2ZUGA 2ZH9A 3V4IB 1CC8A 2XULA 3ONQA 5EUHA 3PYDA 5BR8F 3IBWA 4A8YA 3UE2A 2J5AA 1SIWA 5M2RA 2G0IA 1ZPVA 2QE5A 4ANCA 4LBHA 3JSBA 4K50A 2DHHA 2YKMB 2YTCA 2KT2A 4F0HA 2HHVA 2IVYA 1N34F 1U7LA 2YWGA 2CQPA 3LQVA 4USTA 1PARA 2DNOA 2E5IA 3H4DA 1UETA 1NPPA 3PXGa 2YY3A 5EN1A 3OJSA 1F3VA 3HHKA 1XR6A 2N3OA 4MKBA 2KM8B 4G1PA 4DR3F 4J9QA 5HP1B 3FRYA 4I1TA 1U26A 1VLYA 2ASDA 4WFXA 4Q0BB 2XNRA 4QWAA 2KXHA 3OLAA 3TQ1A 2GPEA 3GONA 2DR9A 4FPIA 3TP2A 1SQEA 3VZIA 3V4MA 3GJTB 2WONB 4FYVB 5D3GB 4RU2A 2GV1A 3FUYA 2RDDA 2KZZA 4B3OB 3J81j 4OYWA 3RTVA 1FRLA 1BQMB 4KPCA 3MDFA 2BOAA 2OP5A 3Q86A 1NMEB 3QQCD 5HVFA 2A1BA 3GXQA 5GMKa 1OSCA 2IHR1 4F67A 5E3PA 1V3RA 4MH8A 3R97A 4LFBJ 2AW0A 4F7VA 1SQFA 2UU9F 3GIJA 3RG6A 4YR3A 4BS2A 1QTMA 1H38A 2ZJQQ 4NCGA 3CJ5A 3N6NA 1IJFB 2Q6BA 1DURA 1QAYA 3D54A 1YRTA 2MPUA 3QT7A 1C0UA 3G8SA 1FCAA 4OYIA 5LSRA 4RBTA 1V5IB 2Y3YA 1Y5NB 3CWJA 3HXMA 4ZCIA 3LALA 1SC3B 5M2PA 5LJ3Y 3ILLA 2XMTA 1WC4A 2CG4A 4CNYA 2JLEA 2FQQB 1QTGA 4OZ5A 2BA9A 4OX9J 2XSJB 1U49A 3MR5A 4DHVA 3EGVA 1WF2A 3RBDA 2QTWA 1S6UA 3N5FA 4IOBA 3H25A 4HACB 1HARA 2XM3A 5CCMA 2UV8G 5A76A 1YJNS 1VHIA 3W9HA 4B02A 2BJ1A 4P2XA 1HNXJ 3SQOP 1JXLA 3OTEA 1ZM4A 3HKWA 3ENWA 5A8WB 4KGXB 5A8RB 1DTTA 2AQ4A 4ZHRB 1ULRA 1N48A 4B3RJ 2IVMA 3GFHA 3BSNA 3S6EA 2DNRA 2DNMA 3VCDA 4TQRA 4P52A 3MEDA 3QGPA 2DB1A 5SUHA 2BSQE 3GP9A 4IH5A 4MYUA 3TYTA 5IOLA 2QO3A 2ACYA 2OPRA 2GVDB 3KHGA 3VHQA 2KN4A 3B54A 2BEFA 1VFJA 1X8DA 1X9SA 1QM9A 3MM7A 3M6UA 1SL2A 1VR6A 2W01A 3TA2A 1FE4A 3PX0A 3UI3A 4BCAA 4IFYB 1JLCA 3MM9B 2RUGA 1HBMA 1G2EA 4ER8A 4PPZA 2NXNA 3PJWA 4IO1A 2F5GA 4OZ1A 2CQBA 2BE9B 4Y2MA 1F1BB 4I2PA 1IRQA 4P2MA 4PG6A 5LSLA 1IKWA 1UAWA 5E5NA 2JJ4D 2UXBF 3IFEA 2VPWB 2F4FA 5CYMB 2F3JA 1X4CA 4LBPA 1Q7LB 2QV6A 4RBVA 4LIRA 1OPIA 2YNHA 4N56A 2CJKA 1TMMA 4WYLA 3TAQA 4ZP9A 5J2NA 1QLNA 1TR0A 2VODA 3BO2A 3VGSA 1N8RT 3HHDA 2CYYA 4OYAA 1VIOA 3FJ2A 3DRRB 4HV0A 1XMOF 3EDRB 4QIFA 2YNGA 3CMES 1NBEB 2CJYB 3WC2A 2FJEB 2ZH6A 5ETLA 3OQ2A 1PBUA 4WWSA 3TARA 4RW4A 3HSJA 5K9FA 5ETMA 3AOAA 2M52A 1WD6A 5CCLA 2YH1A 1HNIB 3N0VA 3CJ0A 3IR5B 2R8GA 2HK3A 5KFVA 4LR8A 2CQHA 3IC1A 3SV3A 4LF8F 1RHRB 3N6MA 1HMVA 1RLCL 2B4PA 5HROB 4ED6A 3CPWR 3NOCA 5RUBA 5K14B 3O2IA 1TUGB 5A6PA 1UJ4A 2FGCA 3CD7A 3BGFA 4KHRA 2IJNA 2DIVA 5KFRA 3JSMA 1T03A 1V5VA 2J7KA 3PJ9A 3K17A 2G2OA 1KRPA 2FVQA 3K7RA 1Z2LA 2ZBQA 2G4BA 2FLLA 1WHWA 1S1VB 5F8LA 1NK6A 4N76A 4MK9A 1F60B 5H9FJ 2AP6A 1LFWA 3QIDA 4X66J 3ET6B 2FVCA 3DDKA 2PC6A 3DLEB 2D3UA 4PR6A 1YJWS 2N3LA 2ZOMA 2IM0A 1G7CB 2ZH7A 3AD7C 4ZN1A 4DV3J 4OL8A 1RTZA 3MAQA 3FMBA 2GGPB 2QRRA 2ALYB 4QIGA 2VFUA 4PYDA 1YJ7A 2GIQA 2GW8A 3ZNUA 2RSQA 2M88A 2YWHA 4KHMA 1HNVA 1KOOA 3I5CA 3PIPQ 2OMLA 2UZAA 1S76D 3LOUA 5KT4A 2HHXA 2HFZA 1F6TA 3JQMA 1EP4A 4OQJA 3RB0A 3DMJB 3CCLS 1N56A 4QR0A 3BH7B 3DLLQ 4B9SA 2WBRA 3FBCA 3X1LB 4ECUA 3L9ZA 3CDBA 1EZZB 2DPJA 1IM6A 1WF0A 4DV7J 4RBUA 3R5JB 2R42A 4Q45A 3HVTA 5I3UB 1S1WA 2BJ7A 4MK7A 4L74A 5F0UA 2DNGA 2LYVA 3VVUA 1RT7A 5DLGA 5F8JA 2AJFE 1RT1A 3HSDA 2R2RA 1CEZA 1HHTP 3POTB 2O67A 2J9DA 2JBVA 4KO0B 3A8IA 1FX2A 2ZE2A 3EX7B 4F4WA 2DH7A 2YKQA 4LF7J 3UDCA 2HHUA 3G82A 3ZO7A 2Q6CA 4DUYJ 1IN0A 4B9TA 4DL5A 5ETPA 4A8FA 3X3UA 1IJEB 3PG9A 2M9KA 4H4KC 2H5IB 2RE1A 1KC8T 2QN6B 1NPKA 3E3XA 1QAJA 1U02A 5KFEA 2KOEA 3VGUA 2HAIA 3DI6A 4NI2B 4X4QA 2P2CB 2ACMA 1RU1A 3AT1B 3FQLA 5A2QY 3R1HA 1KQSR 5BR8J 1GX5A 3PW4A 3NGDA 3U1MA 2HNZB 3TW0A 5CXTA 4XIUA 1QAXA 2KELA 3Q83A 5B0GA 4OJ3A 4ID5B 4HT7A 2CNKB 1N34J 5KFFA 3PYGA 4KHPF 3GCWP 3M9NB 3CIZA 3H2UB 2CJXB 2F8HA 3PX4A 3VALA 2L08A 3A8EA 4ZVRB 2FLNA 1S6PA 1FA0A 2FHJD 2B56A 4DR3J 1O6XA 1U0HA 2DCLA 2VQFF 1XNRF 1HPZA 1SI9A 2HWTA 5GADU 3QWPA 2JLFA 2B6AA 1SPBP 2DNNA 3FK4A 5D4PA 4J7CA 2GJFA 2JZ5A 2LQJA 1MNTA 3NBPA 1Q78A 3T5JA 2BX6A 4O0IA 3SDEB 1KVIA 4WFZA 4J9VA 1S9GA 1O51A 2OPPA 2YNFA 2V2QA 3TX8A 1PBAA 3NGKA 2ASLA 2HLTA 4A47A 1MU2B 3DLJA 4RW9A 1SH2A 1BGXT 2BE2A 2KVQE 1RAFB 3AA8A 3ENVA 1RKJA 5C2GA 3FT7A 2R7WA 3J81U 1S99A 5F8MA 4G1IA 2UU9J 1FT8A 1S7HA 3LP2A 1RCXB 3KLFA 1XJWB 4ITSA 3A1YG 2OTLS 1JJHA 3TO8A 4JOUA 1K44A 1WF1A 4RW8A 3V6DA 5C42A 3IR7A 2B5JA 2VHGA 3CD0A 5E3CA 1Z4UA 2ASYA 5MAOA 2FVSA 2UXDF 1LKZA 2HBZB 2GHWA 4RW7A 2GA7A 3ITHB 1MWQA 1SKUB 4ELVA 4DLGA 3M2UA 2CPZA 2HNYA 2WVDA 5L1IA 4C8LA 1S6QB 2J76E 1VK8A 3CJSA 4LQ3A 1IBKJ 4LF6F 2P8IA 3D1OA 2MSTA 4Y2AA 5IC6B 2YPYA 1Y0HA 1U1QA 3Q89A 4K4UA 1FTRA 1TAUA 2EBEA 3CJTA 4NOHA 1ZBTA 3DRPA 2AYBA 3V81B 1MYKA 1TUVA 3GWCA 1QSYA 4C8OA 4WE1A 3CCUS 1UA1A 1IM4A 1JLQA 2ZBPA 1TP7A 1BXNA 4NMLA 3SCKE 4CDIA 4ZPCA 3T5LA 2IC3A 2U2FA 4XPEA 3BGLA 1UJ5A 3GILA 3LGMA 4CO2A 1VYAA 4JI1F 5GAGI 1C1BA 4DQSA 2DXEA 4EGLA 4Q7AA 2OFGX 1FE0A 5K8OA 4W98A 4YQWA 3JAMY 4HYKA 1TKXB 1DHMA 4JI3F 1N5SA 2XSFA 4DSIA 3NOGA 5KOWA 2B3TB 3IM9A 1R0BG 1YKWA 2C3UA 2RUSA 1S6OA 1WSRA 1WC5A 3BF4A 1JLBA 1SXLA 3PRDA 5DGAA 4PG8A 2KZMA 5CZXA 4Z2XA 1HYSB 2O3DA 3VQTA 1P27B 1Z2ZA 2OKQA 3R2DJ 3UQSA 1XTZA 2F4VF 2BVZA 7FD1A 3R6LB 3LWMA 2VG6A 1TUWA 1U8SA 5CD4A 1VBKA 3AD8C 3U27A 1RB0A 2UXBJ 1UA0A 4GVLA 4EBDA 5ETTA 3EM1A 1GXLA 5KFKA 2Z0GA 4MIAA 3BH6B 2LCWA 3A3OB 4DR2F 1S1XA 2KXFA 2LLZA 4IDKA 3H90A 4R8UB 2RS8A 1IBLF 6AT1B 1BDVA 3BB5A 1VIXA 4UQGA 3FFIA 5HJYA 3PVXA 2XZWA 2CKWA 3AAWB 4DL3A 1YVFA 2XMWA 2GJIA 3BR9A 2BKNA 3GE9A 3NCRA 2LXUA 5B0BA 3G6VA 1XMOJ 4NLSA 1HR0F 2RT3A 3M2RB 1VOMA 3M8QB 2KFNA 2XWXA 3MEGB 1CS4A 2ZJRQ 5L9XA 2M8HA 4WFNQ 9ATCB 3C14A 3BGRB 1N36F 4J9KA 3E2EA 1X5OA 4LRCA 4TY8B 4GVBB 1I6JA 2MDAA 5C25A 1RWPB 2ATLA 1FKAF 3L95X 2OIHA 3CGIA 2EC2A 4OV1A 4Q2LA 3OUYB 1JLAB 4P7VA 2EFGA 1REVA 3D3BJ 1X0FA 1FNOA 3MWBA 4LF8J 1X5TA 2DNLA 3W61A 2F8EX 3CCTA 4LSLA 1LXJA 3I82A 3LP1B 3H59A 3KLHB 3DLGA 3CJ2A 2MZTA 2DNPA 4CRJA 3MM6A 4O3OA 3JTOA 4DCOB 2R2SA 4OV6A 1JLGB 4DSFA 3KYLA 1VI7A 4ZPWR 1WORA 2YKNB 1RLDA 2ZD1B 4DZDA 1FI4A 3NXZA 2V2VA 3MCSA 2DO4A 3PACA 2LEPA 3TOQA 3SSSA 3FKBA 1NLAA 3W2VA 1RHKB 4NLUA 2WVCA 2Y9HA 4F04B 4DL7A 2YX4A 3UR0A 4M94A 1NXIA 3MTJA 4X4TA 4R5PB 1C0TB 1U1KA 2EC0A 3OR2B 2HVIA 1EAYC 1YSJA 1S0NA 1HL6A 2XMKA 4FYYB 1TTHB 4ECQA 4HEA9 3OXLA 4DV4F 1FNXH 2J7UA 4WFBQ 4PAAA 3MD3A 3TEGA 1MMDA 2LU2A 3CJQA 1B7FA 3M32A 2E9RX 4FF4A 4I68A 4TNOA 2DD8S 2B8PA 5J1NA 2PT0A 3D0IE 2J0XA 5EGYA 1P1LA 5A8KA 3KG0A 4HT5A 4Q2MA 3OFGA 1IQTA 4USJC 2BM0A 4ECSA 3SQGB 3J80U 3G8QA 3SV4A 2K1OA 1GAOA 2XY6A 1HKAA 4MIWA 1YBUA 1SC1B 3P45B 2YBVA 4J91A 2HYIB 3FC9A 3QRPA 5HLFA 3CB4A 2VU5A 1FD2A 1D8ZA 4U6PA 1I51B 3ZTQA 1HQUB 1FJEB 3BBBA 3MMCB 2WW4A 4DU7A 3SCLE 2QLWA 4NEYA 1Q53A 3RR7A 2V8HA 3MCOA 3PFEA 2E9ZA 3KLEA 4UZCA 4DMZA 4ZMMA 1NJXA 3VAFA 3LANA 1T9XA 3GLJA 1MWZA 2ATCB 1FK9A 3G5OA 2VV5A 3GR0A 5HQ8A 1HA1A 1H74A 2YPZA 2HMIA 4D3GA 2MQ8A 3OR1B 3OVAA 4BWMA 3JTNA 1NM2A 5KT6A 4F3MA 3HK2A 3UDLA 3UFCX 3BSOA 2KU7A 4QYZK 4L75A 1J5OA 3PM9A 1NSKL 3D6FB 2RF2A 3J7YI 1RBOB 5KFAA 1TK0A 1LW2A 1U1NA 3QJLA 2M5YA 2V67A 1UCNA 1RT4B 2PMHA 2V8GA 1DAXA 2G0CA 4O4RA 4DL0C 3QNWB 4HKQA 4NZ7A 3NNEA 1F5BA 1UP1A 2C2OB 3I0SA 4ID8A 4KHPJ 1G1XA 1X4EA 3C16B 1DLOA 4J9RA 1U2RA 1WTBA 2AJ2A 3V6HA 3AY0A 4USHA 2CWKA 3IAS9 3PW5A 2VQFJ 1XNRJ 4M95A 1LK5A 1NK0A 2H4WB 4QWEA 3MPDA 2XMAA 4JI7F 4I67A 1LWFB 2ZJPQ 3HHNB 1RWUA 4OLOA 4KR0B 2JH3A 3K5LA 1TKTB 3M2VA 5GAEI 1ZOTA 1FDNA 1FF2A 1WG1A 1XNQF 3TEHB 2RQ4A 2AIRB 1YG0A 3H20A 1HI0P 3FMWA 4DPWA 2GIRA 2BBEA 3AB4B 2E9TA 4AL7A 3UCUP 4PXCA 1REGX 2DNYA 4XO0A 2LXIA 4K0KF 1MLAA 1WDTA 2LFVA 2CNNB 2UVWA 5J2PA 5DZ7A 1HQEA 2R7XA 3ISND 3M30A 1SV5B 1X0PA 3D2WA 4U7UD 1U45A 4ZVEA 4C4WA 3MCNA 4P71A 3KLIB 3FCHA 3NG8A 4DSLA 1T94A 2NSBA 4F2RA 2HEKA 2LQ8A 4CTAA 4JP8A 4J9MA 1HBOA 4NLWA 4HL9A 1XIQA 2FIUA 4U7CA 4I64A 3G6XA 1S5ZA 3VTIA 1R0AA 4L3NA 2FJBB 2AZ3A 3W5XA 3EGZA 2YKPA 4Y0FA 1JLFA 1BY9A 3IM8A 3PZPA 4ED2A 1WC3A 3IS9B 4DL6A 3BGOP 4MK8A 4DQRA 1H2TZ 2ZVIA 3QJPA 3A3NB 1RP5A 2VBXA 1UKUA 2AZ1A 4I6YA 5C2CA 4B3SF 4QIWD 2RKIA 3HVWA 4O44B 2GS8A 1VQNS 3TUJC 2B9XA 4DF4A 4M63A 3PHEA 1W2BR 4LF6J 2BW7A 4IH7A 1VRTB 2JNJA 1LWCB 3BSCA 1S9EB 4IG0A 3Q23A 1P8GA 4J90A 1SJRA 2AWZA 2CQGA 1PJ6A 1U6FA 1KHWA 4KGKA 1TZ0A 1TELA 2A3JA 2FZKB 3R5DA 4MFBA 4CLTA 2V9WA 4TKTA 4NCAA 2XMVA 1LNQA 2KRRA 2HWHA 2HW3A 4OHYA 1RTIB 1Y00A 3FGVA 3NAIA 2RVJA 1M5PC 2BANA 5M2UA 2Z2ZA 1WEZA 2AYGA 2FJXA 4JI1J 2BW2A 4DPYA 2L41A 3OXFA 3VGTA 3CULA 4MIBA 1X7VA 4LUBA 1CJUA 4NYOA 2MKCA 1TMJA 2AGOA 5LJ5Y 1RHMB 2DGQA 4PUOA 2KH9A 3MM8A 3Q8VA 4ZVOB 2OUGA 1H72C 5B08A 4C11B 1HNWF 4LT6A 2IAJB 4W4MA 3IRXB 3SFUA 4FXEA 1FKPA 1X4DA 1CJVA 1E6YB 2LQ5A 2ZC4A 4YR0A 1RAEB 2YQ0A 5IS2A 2M2BA 2F4VJ 4USKA 4JI8F 2ZH8A 2YQ1A 3Q0AA 1XEZA 4DSEA 4KFBA 4DV1J 2XS5A 1ZTTA 2ADCA 2O1PA 3LPYA 4QCLA 5F9LA 1W7WA 2RH3A 5ETKA 2U1AA 5D77A 5JVGQ 3OFEA 2E7WA 3H2LA 4H4MA 2JXHA 2MKIA 2ZBRA 2K29A 4J37A 2YNIA 3D5MA 1VQPS 1PAEX 3IG1B 4G65A 1TL1A 3ILJA 1FWPA 2CQ0A 2HQDA 2C2EA 3LW5C 3QAUA 4DSJA 5HMZA 3UNYA 2JHEA 2YH0A 4ECYA 2HURA 4LF2A 4DUTA 1HR0J 1RU2A 1TK8A 2VDHA 3I9V9 2QX0A 2XY7A 5KG6A 1ARQA 4WIQA 5J1EA 3KOAA 2D3ZA 1UFWA 3CDWA 2XI2A 4QU6A 1N36J 2JEGA 4Z7YA 3HMJG 2W7AA 2C2RA 1LOUA 2EG1A 2H65B 3LAKA 5EDWA 3RYLA 4PG5A 2IRYA 4ZKAA 3D6MB 3CJ3A 1K1SA 5G0RA 3DM2B 1X4BA 1FKOA 5DO2A 2VBZA 3TJ9A 2VFVA 4YDDB 5U47A 4KPYA 1L3UA 5D4LA 2VOPA 3MR6A 4L6V3 1Q81T 1P94A 1JLEB 1AZSA 4FKYA 1CC7A 3MECB 4FYWB 1WACA 4TLQA 3HULA 5LMNF 1GMWA 4RR5A 1BE4A 2DHSA 4BC9A 3MPVA 2YWKA 2KM8C 3MFHA 1GFWB 3CCWA 2XHCA 2FD2A 4LRBA 1N0VC 1NUEA 4KY3A 2I5JA 4CP5A 3KK2A 2MZJA 4DX8H 4JYAF 2O5DA 2K5JA 3QLHB 2BA3A 2E1AA 2QMXA 4CO3A 3OSNA 4DV4J 1M90T 4KT0C 4NLOA 1VCTA 1IKYA 4JI5J 2XSJA 1RUSA 1JXVA 3R7NB 2JXGA 4BWJA 3TZZA 3CEDA 3KK1B 2XLIA 4UOHA 3K58A 3OPKA 3CCRS 3C19A 3R5AA 1R6VA 2IRXA 2BQ3A 1HI8A 2KB2A 1AA1B 1YK9A 4GO5X 4P7TA 4ELTA 2Z57B 1Y5LB 1K0TA 3QZ7A 4Y28C 3RGIA 5T7LB 3MEEA 1PG5B 3UVJB 4ZS6A 3BDPA 2CADA 2WB4A 1LW0B 4DPTA 3BKFA 2HFUA 2FHOB 4WZQA 5IT9U 4B9MA 2HHHF 4OMFG 2MKSA 2K1RB 2BJEA 3TNVA 2GQQA 2Z8QA 3D6TB 5E33A 4G1QB 1H2VZ 4ZP7A 1VQ7S 3OFHA 2V2KA 1RYSA 1RT6A 3W8GA 1EA4A 4TLRA 1U1PA 3N79A 4NXNF 4RWWA 4TVAB 2HNDB 1TKZB 4C98A 3O3LA 4ZJQA 3ZTRA 2BZ2A 1YITS 4C8ZA 2J6SA 2BABA 2DY1A 1M5KC 2NXCA 1SIWB 2QSWA 3IGVA 3T1AA 2HGLA 4CO1A 2Q2KA 4OZJA 4N8OA 1T02A 2QA4S 2H3AA 2CAJA 3HDSA 1W26A 2OO4A 1TFYA 1L3KA 1Q16B 4DV6F 3DRYA 4ETXA 3FSYA 3EJMA 4PKDB 4ALZA 2AY0A 1U25A 5ADZA 2C2DA 1W25A 1OS5A 2MZQA 1CBKA 2DHAA 2PSZA 4KGMA 2CQ1A 4N5SA 1V9OA 1YJ9S 3F73A 3DRRA 4PXBA 3MUMP 1RI7A 3H98A 4JI7J 1LQ9A 2EI5A 3CE8A 2DH8A 2FDNA 1TKDA 1SVDA 2W24A 4RUCA 4DJBA 4OHVA 1X60A 3GFXA 2IDEA 4EMDA 1HNIA 1XNQJ 1GMUA 3J7Z5 3QT6A 5HMYA 2QYCA 4PQUA 1VBXA 1CVJA 2CDQA 2VJUA 1WWHA 2P6SA 1OPZA 2V4QA 4K0KJ 3RBXA 3CSKA 4W92B 4K7QA 1N6QA 4M5DA 2AT1B 2ABYA 3F41A 1T05A 1UEKA 3MUVP 3KHHA 2MQOA 1IR2A 1D9AA 3OVBA 1DY3A 4O3QA 4NCGB 2CNLB 1XC9A 1N5VA 3K57A 3HHLA 1KKHA 1C0UB 4OYMA 5KFZA 3AH6A 3KLVA 3PX6A 4EO8A 3FZBA 3MPUB 1N52B 4AYBD 1D3WA 1A9NB 1JK9B 4NLXA 4CH0S 4CM0A 1BUXA 1NSQA 1S1VA 2V5HG 2N4CA 2NXJA 1FHTA 4O3PA 2VJVA 4X62F 2VB6A 3NMRA 4XPCA 3W65A 5GAHI 2M8DB 4OZ2A 3ZNJ1 2X1FA 4CLUA 2X1GA 4LQ9A 2VUGA 3EPIA 2OD4A 5DM6Q 2AU0A 5KFXA 4WBFA 4B3SJ 4B3RF 1JKHA 4I7FA 1F2HA 2GGPA 4WP9A 3HI9A 2ZDPA 3HFZB 2JC1A 7FDRA 2BR0A 1U09A 1SJQA 4LF9F 1QAIA 2W9CA 3MHYA 5KG0A 1UWBA 1DTTB 3Q8RB 4E98A 5CAAA 2Q3PA 4P75A 1WI6A 2OMOA 1YZ7A 2XWYA 1IKVA 2X7IA 1PSDA 3KUEA 1NK5A 3MEDB 3NS5A 4RX6A 2V4JA 1O0PA 2UP1A 4KV8A 3OXGA 9RUBA 3QMQA 1PO6A 2JXIA 2HVHA 2OPRB 5J2QA 1FRMA 2KXNB 3CMQA 2A2CA 1RT5A 4IH6A 3QATA 5E0OA 4NA1A 1GK8A 1HHSA 2IPOB 3D28A 3S1TA 4WKRA 1JLCB 1QY7A 1HBMB 2NYHA 3T19A 4P73A 1P9YA 1XK8A 3OL8A 1QD1A 1VRUA 2IJRA 5IC4B 2YKOA 4LSZB 5HSPA 5G4DA 3W62A 4YDXA 1B4SA 4I2PB 3EUNA 2MZ1A 1RAAB 4L72B 4I2QA 2VF3A 1HNWJ 3HD2A 1IKWB 4FYXB 1FD8A 2V8DA 3TUZC 1QJHA 3DOLA 1RXOB 5IQ6A 1VQ6S 1TVRA 3KMSA 2ZHOA 1NK8A 3UN3A 1PGZA 2HK2A 5IQQA 2MQQA 1N32F 4DR6F 4JI8J 4Z7CA 2MSSA 3BBCA 2YNHB 2DRBA 3M8ZA 4ZVUB 5B7WA 3T3FA 1N33J 5J2NB 3KNAA 3P49B 1RHUB 1X4AA 3BKUA 4OYOA 4M5IA 1D9DA 1FXLA 4ES3A 3VZHA 1VRQC 1UVMA 5IXUA 1V3ZA 2YNGB 4GRSA 2AGQA 2LU1A 5DRKA 3K59A 3EXCX 3A12A 4RW4B 1NHUA 2BXJA 1U8WA 1TL4A 1RT2A 1MROA 3JQKA 4JV0A 5ETOA 2XYGB 5D0HA 4DFPA 3KJVA 4ZPBA 5HQLA 3I87A 1U1MA 4URQU 3I5BA 2R7SA 2OPSA 3D9BA 4CT8A 3AXKA 2MJNA 4ZK7M 2WW8A 1FFSB 1TL7A 3G86A 1WKKA 1KONA 2W2QP 3MMAB 2R4FA 4ZITA 1YHQS 1VQYA 4I6AA 5D4NA 1RT3A 2ZUAA 1CPZA 2Q1LA 3AD9C 3BYPA 2JWNA 3WC0A 1BHNA 2DBBA 3JSMB 1T03B 4K8RA 2WK4A 4O3RA 3WIUA 4LBIA 1HD1A 3Q2SC 5HVGA 4NE9C 2LMIA 3LPEA 4F4AA 5EWGA 4DV3F 1Y9OA 1BQNB 5GMDA 5AE1A 3D7SB 1T9UA 4WU2A 4HHUA 4ZN3A 2VKZG 5IWAJ 4QYRA 2ZM6F 2K06A 5CHCB 2XZDB 4F0MA 4OI4A 2HQ3A 4PYAA 2E44A 2QLBB 5SZTA 4KGVB 4PPDA 2CVIA 3GSIA 4DV0F 4X84A 2VG7A 4WK3A 3IO1A 2MY8A 1YX2A 2E5JA 1U1LA 2J6TA 4CLSA 4JYAJ 3UDVA 4QU7A 1RTHA 1HNVB 1QVGR 3H5YA 3NL0A 2UXCF 3R6GB 5I42A 4X4SA 4EU0A 5KOXA 3MPWA 4K4WA 2E5LJ 4P6QA 5ETRA 1PIEA 3PFOA 4NRUA 1EP4B 3R1LA 4DG1A 4OHXA 2ZOGA 2GX8A 5DS7A 2V4RA 3EWGA 5J2MA 2HGMA 4ZVFA 4DZ6A 4NRTA 4F3OA 3H0PA 2C42A 4DL4A 2H1OE 4KYZA 2VOOA 1BD6A 1VQ8S 2ZH2A 4X4VA 1RADB 3HVTB 2GO9A 4WP8A 1S1WB 1Q8KA 2J7WA 3WX4A 4RUAA 2QLXA 2VC0A 2A6MA 2UUBF 3VAJA 1RT7B 1RT1B 1NHVA 1Q82T 2RDIA 3TQEA 2RJZA 4CIOA 2BYCA 2DVIA 4TU9A 4LF5F 4B17A 2KKEA 2ZE2B 4CO5A 1FVQA 3TAPA 2C1EB 2HHHJ 3G82B 3OTOF 4ZPTR 2OAUA 4FBTA 2LKZA 4DOZA 4WKYA 4IRKA 4IG3A 3M7VA 1IWGA 4IYQA 5KFTA 2MLXA 2AHOB 3L09A 3EPGA 2BJ3A 1WC6A 4DV5F 1ZAVA 2DK2A 1QUVA 4KKOA 3RRKA 4X4UA 2HQGA 4RL1A 2CQ4A 3QGGA 4NXNJ 3DI6B 5HO4A 3BQ0A 2OSRA 2VBWA 5KG3A 2NXEA 4F2SA 2UUCJ 4A8OA 4FF2A 4NLQA 2D9OA 2N7CA 1D8YA 4K4XA 2KRBA 1HHQA 2W7OA 2I0XA 4Q8EA 3W9IA 3NO7A 1HNZF 2CWXA 3CJRA 2D41A 4TXSA 4DV6J 5D8HB 1F5AA 2CPGA 3Q24A 3N6LA 1ICEB 1OMSA 1U0HB 2EFNA 4MTPA 3ZZTA 4A8QA 4H54A 4MKAA 2H5JB 3R7SB 5BYQA 1HPZB 3BO3A 4J9UE 3GPAA 4QW8A 3WHIA 2CZ9A 2E1CA 2IMOA 1KQFB 2B6AB 3PYFA 2E7XA 1SBRA 4XAKA 4ZVTB 5L39A 3U1LA 3NBPB 3UN5A 3VEAA 5F8GA 3M2RA 4WP3A 3TAMA 3KMQA 3ILIA 3UW1A 4NASA 1ITPA 2LDYA 2VFSA 3E8OA 1S9GB 1KTQA 2L48A 4RNHA 4OJ1A 2QL5B 1FX4A 2OPPB 2XMJA 2YNFB 4CO0A 2UVUA 2NQPA 2XGPA 3GG0A 4RW9B 2O01C 3SZ2A 3DNCA 3DU6A 3ICLA 4CO4A 1RAOA 2CAXA 1RDRA 5AXLA 3EVWA 2BE2B 4DS4A 3N4WA 2EG2A 1GNKA 4ZIWA 1OY6A 2KJWA 2HFNA 3TVYA 3M6WA 4JI4F 3UD5A 4DPXA 3KLFB 2DNHA 4X64F 5D0RA 4FXVA 4UY85 4D8JA 4NYPA 4ZJLA 4RW8B 3V6DB 4W90B 5C42B 5IT0A 2B5JB 3IR7B 3GYGA 5L1KA 3M05A 1OSDA 1IBKF 1XERA 2DEIA 2RRBA 2AJQA 4ANDA 4RW7B 4DFKA 5D0GA 2P6TA 1X31C 3C8YA 3M2UB 1WEYA 1RYRA 2KVIA 4X62J 4NEZA 4KC5A 2M7SA 2HIQA 1TK5A 2UUWA 1NKEA 2DGUA 3CW2C 3SI8A 2P9EA 4PWDB 3PHTA 1L3VA 1A7GE 2XI3A 3OD2A 1ZS6A 1NDLA 2DR5A 2R7RA 3R2CJ 3UD3P 1R8AA 2YVSA 1KEKA 3PYEA 5HQMA 3KDOA 3TWZA 3DRPB 3SIPB 4G3IA 3MAAA 1VQ9S 4RNNA 2CJBA 4LF9J 1RCOB 3FBEA 2MY7A 4FVMA 1AYEA 4TU8A 4ME7E 3UN2A 4M5GA 4WE1B 4YUDA 5IM0A 3AQOA 1H7WA 1QDUB 4ECTA 2B4UA 1RJJA 2IC3B 2DGTA 3ENAA 1C1BB 1FFWB 2E1RA 2AMCB 1RKIA 2RU3A 4FNHA 4AL5A 4OZ0A 2AX1A 2ZDOA 4CT9A 5IT4A 4C2MA 3B78A 3LGHA 2W4CA 2UUAF 1ZYQA 2DHXA 4YHHF 4EO6A 2P9GA 1RHQB 5CYQA 1UVJA 4TU7A 1WC0A 2MQMA 4EWTA 5F3ZA 2DXDA 2XC9A 3W66A 4NXMJ 2XB2D 1JLBB 4CLLA 2W7PA 3G2XA 2XO6A 2W2NP 1CJKA 2QA1A 4ECZA 2C28A 1IKXA 3VAMA 4FDFA 3GV5B 2HS4A 3R8YA 1F9EB 2ROEA 2HFSA 3CC2S 2XG8A 4RW6A 2KFYA 2VG6B 2CQDA 1DFDA 3QGHA 4F3QA 5T41A 5C24A 1KTVA 4OYBA 5D15A 4QYZJ 1SC4B 2H48B 2L9NA 2AKWB 2IBOA 1CULA 1N32J 4DR6J 1S1XB 2FLOA 3MUTP 3BS9A 4UW2A 2R7QA 4IDKB 4M5NA 4C0BA 1R7IA 4NLYA 5DETA 3K5OA 3PEHA 2AD9A 3FFIB 3FNNA 2LDIA 4PWUA 3IBCB 4PRFA 4LFCF 1T95A 1RABB 4USMA 4CYUA 3Q8UA 5F41A 1VQOS 2F8MA 1XMQF 2H9ZA 5DJBA 3CJKA 1S57A 1URRA 4Y2CA 1KLMA 3F56A 2WVEA 2BQRA 1NAQA 2I8EA 5E7OB 1CS4B 3NCPA 3PO5A 1RBAA 3C14B 1HI1A 4ILLA 4FBUA 3R9LA 1IVZA 5C25B 3KG1A 3C6TA 3MOJB 4ZLNA 1W2IA 2GMHA 1REVB 2CNOB 2HBRB 2EFPA 1IWAA 3HFVA 2UV8A 2HSEB 4CQ1A 2OI2A 2DEJA 4EFAC 3K89A 4LSLB 1LWEA 1S7IA 2G0JA 1NB2A 3GYXB 2XS7A 3MZIA 2AF6A 3E01A 3MMBA 2NCKL 4YY3F 4FF1A 4LF4F 1Q8IA 2BKPA 1F2GA 3EYZA 3KK3B 1J27A 2PA8D 4DX6A 4BDPA 2VASA 5FJ4A 1ZM9A 5KFUA 1YRXA 5KFHA 5DDRC 2GVZA 1S12A 3GIMA 5CQGA 4M5JA 3OFFA 2EW9A 4OYZA 2I1RA 4QOTA 2JLGA 4IOCQ 1N4LA 4DU8A 2J9CA 1KN6A 2HHQA 1BMQB 4H4KA 3M8RA 2ZM6J 2FJAB 5DDPC 3LAMA 2CJ9A 4OFZA 2WTFA 3UDEA 2AEJA 4WIIA 2H3EB 5ITHA 4DV0J 2XO7A 1D1UA 4P10A 4WJBA 1F9FA 1ACMB 3KHRA 2GJ2A 2UXCJ 1DTQB 3FSXA 1DBDA 5A8KB 5AXKA 1WELA 2DR8A 4ED0A 2K2PA 3DHWC 2DITA 3HT0A 1T11A 1RQ0A 1EHWA 2H1YA 4EZ9A 2OPQA 1U0SA 3MCMA 2KFZA 2C3OA 4X4OA 5HLFB 1RACB 3RW6A 1NRKA 2Z56B 4CLWA 3OLBA 4V1Ak 4WK1A 2UVVA 2UUBJ 3MF5A 3GU0A 1NCLA 3ISNC 5F3TA 4CLKA 3U02A 1LWXA 1FERA 3M9MB 3KLEB 3ENQA 4YEAA 4LF5J 4LRDA 2IA0A 3DXBA 3GIRA 3AHPA 3JXOA 3QPIA 1C1CB 2OH2A 1KBRA 3OTOJ 1SL1A 3DLBA 1FK9B 3HHLC 4KJIA 1PCAA 2JEIA 2VKRA 1U1RA 2Z30B 3M6VA 2HMIB 2A6OA 2CJQA 1FFGB 4DV5J 5FLXU 3DKDA 5I3QA 3LJPA 2QA4G 2B4OA 3M6XA 2GHPA 3A4TA 1WHYA 2WZ1A 2IY5B 4LFAF 5JMNA 1J5OB 1CQMA 3IBFB 3W5YA 4JB8B 2OSQA 3H40A 4A46A 2JDJA 1LW2B 4XK8C 1WTFA 3TI0A 4F4KA 2GFFA 3NCQA 3NWRA 4LJMA 4OLPA 1MMNA 1CJTA 2JFDA 3B8HA 1KD1T 2AV5A 4EI2A 3ZZPA 1UZHA 1K9MT 3FEXB 1HNZJ 3MD1A 1OHNA 3I0SB 1M1KT 1DLOB 5DG7A 3LP0A 3K5NA 4NWBA 3J81Y 2J0WA 1TV6A 1DRZA 6FD1A 3QIPB 4OI0A 2WSCC 5GVQA 3MR7A 1WC1A 3PKYA 4Q5VA 4M5MA 3NNCA 3TJAA 3EXYA 3JYTA 1VLOA 3US5A 3DC2A 1OIAA 3ETOA 2XYPB 3M2VB 2CRLA 1EQ0A 1F5CA 1I94J 1SKWA 1S48A 4KGZB 4R0JA 2V0NA 1C4AA 4K4YA 4X2BA 5F0WA 2HLUA 3TRGA 3CCES 1ZAWA 3M8PA 1AXQA 1O5JA 3CO9A 3GV7B 1RWMB 2WOMA 5J2PB 3TA0A 2GCFA 2RAQA 1HQEB 3M30B 1YWXA 4Y65A 2DGXA 3PCOB 1Q1KA 4EYHB 4LVOP 1RWVB 2QLJB 5KFGA 2DRDA 4QWDA 4ZPAA 2IYGA 4O4GA 4OX8A 4ZA1A 4CTAB 1JJ2R 5KG1A 1HBOB 1RWXB 5HATA 1WKLA 4JI4J 3T9NA 5JXSA 2VICA 1VK3A 2HVEA 3CCZA 1R0AB 4X64J 5A6WA 5KG7A 1PYTA 3RB3A 4M5HA 4IFVB 1JLFB 1JXEA 2BQUA 4A8KA 4NCBA 4Q43A 3RAQA 2ZNZA 1FVSA 1Y3KA 2BRLA 1Q8BA 3RBEA 5K8PA 4QWCA 2BACA 3NEKA 4J9LA 4KB7A 2YQ3A 4I6WA 3VGVA 1AUSL 3M8YA 1KWMA 1H73A 2ZKUA 2RKIB 3A3PB 4K4SA 1HBUA 2LA4A 2B9WA 4OZLA 1K73T 1S1UA 2R7TA 2Y0SD 2XHWA 3QAEA 4NZ0A 5HJXA 4IG0B 3UPFA 4IR1A 2PEHA 4AUKA 3IMQJ 3WDOA 5HANA 3AODA 2QYGA 2ZZMA 2HG4A 4NLTA 4MFBB 4DSKA 4J9NA 4R0EA 4C0HA 5KAKA 3VAIA 3FBBA 1RSCA 3QT8A 2NUHA 2DH9A 3H5UA 4F50A 3OV7A 1Y5IB 2BANB 4ED4A 2HGNA 1VQ5S 3HO1A 1UVNA 1N5YA 3VEBA 4OI2A 2H5EA 3I56S 2P9CA 3GFZA 1T9YA 1KDNA 3TVKA 2L9DA 3C66A 1R6YA 2R9LA 2QT7A 3A8KA 4A8MP 3PW7A 2UUAJ 3M1VA 2HWIA 4N8NA 4YHHJ 2Z58B 2ZVSA 3DN9A 4PUOB 1NDCA 1TL3A 2DCUB 3MM8B 1JJ4A 1KNZA 1JB0C 4DR7F 2ZBCA 2GQ2A 2FJVA 1RAGB 2JEFA 2MZSA 4DV1F 2FJWA 3E51A 4PWWA 1AROP 2EWHA 2D69A 2DNZA 4C0OC 1CJVB 4TYBA 3KLGA 4JBCA 2FZCB 2K6LA 4YN3B 5AJ3F 3RW7A 3CT9A 3DGPA 1FNMA 1G3OA 2V50A 4KFBB 3Q8YA 2BUNA 4Q8FA 3I0RA 3G6ES 3WBZA 3Q22A 3V5RA 2QFIA 2ASJA 2NR0A 5FDLA 2V9KA 4IUFA 2HVDA 2HIYA 2WSFC 3OL6A 2VZ9A 1E6VA 4H4MB 3H87C 1QSLA 2YNIB 2W9BA 2AYMA 3I55S 3JSRA 1FDDA 1TL1B 4KTQA 2VC1A 1Q16A 3CJ4A 2PIIA 1WG5A 4LFCJ 5AT1B 2G2ZA 1R8CA 1RA6A 1XMQJ 5KT7A 3ZZYA 5B0AA 4EYIB 3DYAA 4K5SA 2IM2A 3N28A 1UPMB 1BLUA 1CLFA 5J1EB 3DLKA 1NJZA 1JQGA 3G96A 3GYNA 3DDIA 2VG5B 4TY9A 2WVFA 3FEYB 3SSRA 1TL5A 3UD4P 3D6HB 2IFXA 2X3DA 3HD1A 3T6BA 1VJQA 4YB5A 1H0HB 5G0RB 2DKOB 4RWXA 2N4DA 3RAMA 1FKOB 3NNAA 3HM9A 4CZCA 1HWIA 1Y7PA 1GMWD 2QA2A 4LSNA 1Q7YT 1YJUA 3TVZA 5KFJA 4YY3J 5A0YA 4OJGA 4LF4J 3J80Y 3P4UB 5AE3A 1AZSB 3VV2B 1KHVA 4J9PA 2MQLA 6FDRA 1DQAA 2B8QA 1DQ9A 2ZH4A 1OO0B 4CLYA 2CPYA 3M8SA 2WB1D 4JI5F 2MLZA 2QEXS 4U67Q 3N01A 3AXMA 2I5JB 1YBAA 1GH8A 3KK2B 3B6BA 5DGBA 2FUG9 1VJWA 4IQMA 2Y8YA 1X9WA 3JTPA 1U9PA 4P74A 2W2PP 3QWUA 1Y3JA 5AE2A 1NK4A 3IWXA 1SJFA 1YBTA 2MKKA 3EZUA 1Q5VA 3I6PA 2R3VA 3C6UA 2MGZA 3MM5A 1IKYB 3PR4A 4B9UA 1YGYA 5L1JA 4BBYA 3R3TA 3C15A 3DRSA 4OYXA 3OSPA 2G9OA 3T1YF 2PE8A 3PTWA 3OTBA 2RRNA 1URNA 2GZOA 1JX4A 2Y1IA 5B09A 4FKXA 4YB6A 1YZ6A 2VD3A 3NGRA 4U7UK 1HQ2A 4MKYA 1FXRA 3MEEB 4EK2A 2BKOA 3P3DA 4K2XA 3ZXWA 2BJ8A 2AJ4A 2HRTA 2DNKA 1X9MA 5KFWA 1EQMA 3ADAC 4JI2F 1JJCB 3Q8SB 1PAUB 5CD4H 3SCJE 3ZC4A 2NZCA 2XEXA 4QZVB 3MPYA 2OELA 3CC7S 4FS2A 3CCSS 2VIHA 3O1LA 3IWNC 4HI2A 3PR5B 1YIJS 5JVHQ 5GADI
chains in the Genus database with same CATH topology
2WVEA 2WVFA 1MYKA 3FMTA 1U9PA 3OD2A 3FT7A 1MYLA 2PC6A 3VW4A 2F1FA 3GXQA 2K6LA 2JXGA 2BJ1A 1IRQA 2BJ9A 2CAXA 1Q5VA 2WVBA 2JXHA 2K29A 1PARA 1ARRA 4ME7E 1P94A 2CPGA 3VEBA 2CAJA 1BDVA 2K1OA 3H87C 1B01A 1BDTA 2CADA 3QOQA 2BSQE 3BKFA 4D8JA 1MNTA 2FGCA 1NLAA 2HZVA 2AY0A 2WVCA 2GPEA 2HZAA 2WVDA 1ARQA 2BJ8A 2K9IA 2Y3YA 2BJ3A 4FXEA 2CA9A 2BNWA 3LGHA 1X93A 3VEAA 2NZCA 2K5JA 3BKTA 3QSIA 2BA3A 1Q5YA 2JXIA 4HV0A 2BJ7A 2KELA 1QTGA 2RBFA 1EA4A 1BAZA 3BKUA 2BNZA 2H1OE 3PHTA 1B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVE A;  2WVF A;  1MYK A;  3FMT A;  1U9P A;  3OD2 A;  3FT7 A;  1MYL A;  2PC6 A;  3VW4 A;  2F1F A;  3GXQ A;  2K6L A;  2JXG A;  2BJ1 A;  1IRQ A;  2BJ9 A;  2CAX A;  1Q5V A;  2WVB A;  2JXH A;  2K29 A;  1PAR A;  1ARR A;  4ME7 E;  1P94 A;  2CPG A;  3VEB A;  2CAJ A;  1BDV A;  2K1O A;  3H87 C;  1B01 A;  1BDT A;  2CAD A;  3QOQ A;  2BSQ E;  3BKF A;  4D8J A;  1MNT A;  2FGC A;  1NLA A;  2HZV A;  2AY0 A;  2WVC A;  2GPE A;  2HZA A;  2WVD A;  1ARQ A;  2BJ8 A;  2K9I A;  2Y3Y A;  2BJ3 A;  4FXE A;  2CA9 A;  2BNW A;  3LGH A;  1X93 A;  3VEA A;  2NZC A;  2K5J A;  3BKT A;  3QSI A;  2BA3 A;  1Q5Y A;  2JXI A;  4HV0 A;  2BJ7 A;  2KEL A;  1QTG A;  2RBF A;  1EA4 A;  1BAZ A;  3BKU A;  2BNZ A;  2H1O E;  3PHT A;  1B28 A; 
#chains in the Genus database with same CATH topology
 5LMU F;  3OTC A;  4B3T J;  3J7Z T;  2FLP A;  4WXW A;  4U96 A;  3NY0 A;  5L8R C;  1GTE A;  2B4V A;  1RT6 B;  1FRH A;  3D0G E;  2DGV A;  1MG7 A;  1U47 A;  2KT3 A;  1M1G A;  5DG9 A;  2ZEJ A;  1OYD A;  4RO0 A;  1XR7 A;  1SB6 A;  1FRI A;  5B0F A;  1S97 A;  1KOH A;  2GML A;  1JNR B;  2FPH X;  4FVC A;  3HHE A;  1SH3 A;  1NPR A;  4UQT A;  3W2W A;  2CPX A;  3JSY A;  1R8B A;  1X4G A;  3W3S A;  2VQE F;  4LFA J;  1Q95 G;  5KG5 A;  4P2F A;  3VAH A;  2F9J A;  2VH7 A;  1YJR A;  2B9E A;  5GAG U;  4FF3 A;  4MJK A;  4ICL A;  3DU5 A;  3VWS A;  2FTR A;  3W1Y C;  1IR0 A;  1SUQ A;  2CQ2 A;  5ETN A;  4DXL A;  1X5P A;  4ED5 A;  3HPO A;  4AL6 A;  2OJ3 A;  3S7R A;  5KFI A;  2BRK A;  3HSG A;  3BQ2 A;  4ZVQ B;  4WPA A;  1I3O B;  5K8M A;  2HQC A;  3RJM B;  4OI6 A;  1KSP A;  4KQZ A;  5JUM A;  1VQL S;  1CQN A;  1ZA2 B;  1U6Z A;  2CQI A;  5C7P A;  4CH1 A;  5HBM A;  2BJD A;  2CQ3 A;  3DOM A;  2ZC3 A;  2NXU A;  3EMT A;  2N7Y A;  1WNE A;  4FXW A;  4JV1 A;  2FB0 A;  1KVJ A;  1BDT A;  3DOK A;  1B0P A;  4ZCL A;  2DNQ A;  4F25 A;  3NP5 A;  3CF5 Q;  3GFY A;  1IR1 A;  3B4M A;  4PQU B;  3EVM A;  4M8L A;  4OYP A;  2CFX A;  5LM7 E;  5KTQ A;  1N6Q B;  4M5D B;  3MXH P;  3HHL D;  2RQM A;  4WF9 Q;  2BNW A;  1T05 B;  4OHZ A;  2KDO A;  4AE5 A;  2LP4 A;  3TUP A;  1S72 S;  1S4F A;  2DPI A;  4LMZ A;  3NNH A;  2YWF A;  3MMA A;  3VQS A;  1U2F A;  1R8H A;  3L4B C;  3MR2 A;  1HBN A;  2LEA A;  1S1T A;  3D0H E;  3HHL B;  4ZVS B;  4U95 A;  2W9A A;  2ADL A;  1PKU A;  2MJU A;  3OHA A;  2FY8 A;  4B9V A;  5JJB A;  4MJW A;  5LL6 d;  1BQN A;  4NL5 A;  1FJG F;  3MI7 X;  3GJQ B;  2HQI A;  5HI7 A;  1APS A;  5I3P A;  3FZ2 A;  1Y4Z B;  4AQY J;  1N54 B;  1QE1 A;  4ZVP B;  3W63 A;  2J9D E;  4CH7 A;  4ENO A;  2PGC A;  5DQH A;  4A8S A;  1T0T V;  3D1Q A;  4UUW A;  3GG1 A;  3AOC A;  1JKH B;  4I7F B;  1IXK A;  4O23 A;  3R5B A;  5CZV A;  3C3L A;  1SIZ A;  1NEE A;  1ZZN A;  4C3K A;  1OY9 A;  3KXD A;  4AT1 B;  2W9C B;  1U1O A;  1M0S A;  3IN5 A;  1UWB B;  2VA3 A;  2MYF A;  1UVL A;  1OYE A;  1IKV B;  5IV4 A;  4USI A;  3WX8 A;  4RZR A;  5HMW A;  1NJW A;  2POK A;  1KQG B;  4RKU C;  2V4J B;  1VC0 A;  4LRA A;  4KV8 B;  2IM1 A;  3DRX A;  3QO9 A;  2XLK A;  3HFK A;  4M1K A;  5J2Q B;  2WAQ D;  1HW8 A;  2C2Z B;  2RHQ B;  2MXY A;  4N7T A;  2WVB A;  1RT5 B;  5L38 A;  2ZBI A;  2KTQ A;  4DR1 F;  1U6B A;  2KI2 A;  4DCJ B;  2OEK A;  3FVY A;  3BBF A;  4RNM A;  4GO7 X;  2FHK A;  4E8U A;  3P96 A;  2F40 A;  2J0S D;  3LA0 A;  1DQ8 A;  2I38 A;  2A10 A;  1VRU B;  3CDE A;  2UUT A;  3EGN A;  3KG4 A;  1D9F A;  3JQJ A;  1H7X A;  4A8W A;  1EB0 A;  5HL7 Q;  4NPO A;  3V4I A;  4JUZ A;  1PC4 A;  4DR7 J;  4I2Q B;  1YQH A;  2DT9 A;  2CPI A;  2N82 B;  2B43 A;  1NKC A;  1N33 F;  3HJV A;  3DOL B;  2D7S A;  2BV3 A;  4DFJ A;  2YKM A;  5I4M A;  2RNE A;  1TVR B;  1WEX A;  4NZ6 A;  3IR6 B;  1DZ5 A;  1YJT A;  4DR4 F;  3AB2 B;  2W2M P;  2MQN A;  3WZ0 A;  1T3N A;  3PRB A;  2BNZ A;  4RUB A;  1A6L A;  1YLX A;  1FO1 A;  5AJ3 J;  2BDP A;  5DDQ C;  3D3C J;  1QSS A;  3GJR B;  4N77 A;  2IJF A;  3NWG A;  1RIS A;  1QUP A;  3QSY B;  1NJY A;  2E5G A;  5HP1 A;  1VHF A;  3TZX A;  2MHN A;  4BC7 A;  4NLP A;  3RB4 A;  2HBY B;  2L3M A;  4URS A;  3GII A;  4Q0B A;  2FVR A;  3IAM 9;  2ZH1 A;  1SH0 A;  5DQI A;  1UL3 A;  2RQK A;  2Y1J A;  1XBW A;  5EX0 A;  3THP A;  1VGY A;  3TAN A;  2IM3 A;  1MML A;  3L3C A;  2WON A;  5BYS A;  1AUD A;  5A2Q U;  4RU9 A;  3IRW P;  1RT2 B;  1MRO B;  1ZTW A;  4MKV A;  2XBP A;  5D3G A;  3U1N A;  2OFH X;  4Y6I A;  3CD5 A;  2XLJ A;  3KJV B;  4B3O A;  4DUZ F;  4PG4 A;  4GKJ F;  1VQK S;  3KKF A;  4QPT A;  1N88 A;  1BQM A;  1EIY B;  4U9R A;  2OPS B;  2J9E A;  3RRG A;  4ECR A;  1L3T A;  3J7Y U;  1BAZ A;  1R27 B;  3PW0 A;  1OWX A;  1TL7 B;  1XMB A;  2VDI A;  2DIU A;  4JI0 F;  2I9S A;  1VBY A;  2VA2 A;  8ATC B;  5IWA F;  4YR2 A;  4V19 J;  3KJQ B;  1RT3 B;  2F1F A;  3L7U A;  4WCE Q;  1RWW B;  5D0E A;  1B70 B;  2FYX A;  3GCX P;  2COL A;  2GAH C;  2NPF A;  2ZHB A;  1RWK B;  1EAR A;  2MKH A;  1UVI A;  1UW9 A;  3WQP A;  4NLR A;  2VL1 A;  4IQX A;  1FWL A;  2YX7 A;  5CYJ A;  3MFI A;  4P2S A;  4O3N A;  3H5S A;  2VPZ B;  2RQC A;  1MWY A;  2EEY A;  2E5L F;  1FDA A;  3KUG A;  2CZV C;  5GAE U;  2ROG A;  2LEB A;  2VG7 B;  5IT9 Y;  3PV8 A;  1G4C A;  3I9Z A;  3GZ7 A;  3ZTP A;  5LSO A;  1UEU A;  4K4V A;  1RTH B;  4HAC A;  2ZOF A;  2JC0 A;  2HVZ A;  5I42 B;  5EX3 A;  3CCQ S;  3K5P A;  2Z2L A;  3ISZ A;  1SCJ B;  2MZR A;  5A8W A;  2W25 A;  4PWD A;  3BO4 A;  2XYH B;  4DG1 B;  2V69 A;  5A8R A;  4ZHR A;  4RNF A;  1Z1Z A;  3EDQ B;  5J2M B;  4H4O B;  1RTD B;  4GKK F;  1T3O A;  3T1Y J;  4JV5 F;  2K7K A;  3ZZ0 A;  4LR7 A;  2M70 A;  5MLC V;  1F3F A;  3AQP A;  2QZ8 A;  3TUI C;  4V19 X;  3KWM A;  1NB7 A;  2E1M C;  3T41 A;  1FRK A;  3CVK A;  2GVD A;  4EBE A;  3T6J A;  1FRX A;  2VPY B;  3IGN A;  4K5R A;  3SSQ A;  1R8P A;  1HIY A;  2MMY A;  4JI2 J;  3P8B B;  4B08 A;  4Y3C A;  3HX9 A;  4IFY A;  4F26 A;  4KH0 B;  3MM9 A;  1RTJ B;  2AEM A;  3OTD A;  1EET B;  1KS2 A;  2B9Y A;  4DX7 A;  4IG3 B;  5H9E K;  1SJ3 P;  1S79 A;  4HHJ A;  5LMU J;  2QC3 A;  1SL0 A;  2OD6 A;  2UUC F;  2CIM A;  2ZWO A;  1S49 A;  5LXY A;  1SKR A;  4QPX A;  2KHD A;  4KKO B;  3JS9 A;  1T7P A;  3THT A;  4L76 A;  4X4P A;  2K8G A;  1HWU A;  4OHW A;  3G6Y A;  5D6G A;  2D9P A;  5D4O A;  3HZE A;  1NK9 A;  2ALZ A;  2C22 A;  5CYM A;  2ZFH A;  2ZWP A;  2KL8 A;  3CNQ P;  1RAJ A;  2QL7 B;  3T5K A;  2HBQ B;  4C3M A;  4HI1 A;  4X65 F;  3CCJ S;  1B7Y B;  2WHO A;  7AT1 B;  4UY8 T;  1IBM F;  4DI6 A;  2CVE A;  5KFC A;  2VQE J;  3JAM U;  1OJ4 A;  1WSV A;  4QW9 A;  3NGT A;  2NSC A;  4ED1 A;  2ZNY A;  1KVK A;  4YB7 A;  5H1S V;  5J1P A;  4TQS A;  4NX9 A;  1AFJ A;  2FVP A;  3F44 A;  1VQM S;  3MR3 A;  3NGU A;  2AGP A;  4C97 A;  3OBI A;  3QSI A;  5T14 A;  4LIW A;  3OVS A;  3EZ5 A;  2XY5 A;  4LR9 A;  5BYR A;  4R25 A;  2KO1 A;  3LUY A;  1GQE A;  4DF8 A;  2IVF B;  2QJ3 A;  4ECX A;  5KT5 A;  3TAM B;  5FII A;  1M5H A;  2ILY A;  3VW4 A;  1C2P A;  5IV3 A;  1B0T A;  2AEF A;  3OW2 R;  1LEO A;  2Z4P A;  5HRO A;  1H3D A;  2QMW A;  5K14 A;  1LXN A;  1TU0 B;  2RB7 A;  2D3O R;  2MEW A;  1DAR A;  4HTJ A;  4OZN A;  2KG0 A;  8AT1 B;  3GB0 A;  3GTY X;  3TR5 A;  2VFT A;  2NS1 B;  2F9D A;  1NDK A;  3Q8Q B;  3MMJ A;  3I4H X;  3CJ8 A;  3NGS A;  4K4T A;  4HLB A;  3FSI A;  3PDN A;  1T9V A;  3I96 A;  2HHS A;  3ULH A;  3KK3 A;  2XCA A;  3ET6 A;  1KR4 A;  2LXF A;  3DLE A;  2M4M A;  4PEO A;  2YXL A;  4ANE A;  4M5L A;  3BPS P;  1SJ1 A;  4ZLL A;  5KFD A;  4BHQ A;  1S59 A;  1SKS A;  1FJG J;  1WOP A;  3QBC A;  3FMT A;  1TQL A;  2XGQ A;  4DN9 A;  1JIH A;  1EJ7 L;  2AN7 A;  1N5Q A;  2DXF A;  3CCM S;  1B99 A;  2Z2Y B;  4C6A A;  2V8V A;  2CXE A;  5L1L A;  3THV A;  2DRA A;  3A13 A;  3ZZO A;  4UOF A;  1YRU A;  2OEJ A;  4ILM A;  2XCP A;  3BSA A;  3DMJ A;  1K1Q A;  3MAA B;  4HTI A;  4GC6 A;  1NH7 A;  1P6T A;  4ECV A;  3PIO Q;  1AFI A;  2GNK A;  2QIF A;  1DTQ A;  5DQG A;  4IRD A;  5IM0 B;  3MUR P;  1MW7 A;  4FS1 A;  3D1H A;  3FRZ A;  2HZA A;  4USV A;  5I3U A;  2LEC A;  4JI6 F;  2G1H A;  4KE5 A;  1ZH5 A;  4USU A;  3Q8P B;  4P72 A;  4ZP6 A;  5BXI A;  3MM7 B;  3HJF A;  1PYS B;  3K2Y A;  2D74 B;  3BYR A;  2PI5 A;  3BN4 A;  5KFY A;  4PCQ A;  3POT A;  1BWE A;  4NXM F;  4J9O A;  2DHG A;  3HT3 A;  1JNZ B;  4KRW A;  4KO0 A;  3QRR A;  3CIM A;  2SXL A;  5KFO A;  2H51 B;  1FXD A;  4RPF A;  4HH1 A;  1KFS A;  2CPE A;  4GC7 A;  4N47 A;  3CXC R;  2M3D A;  5CYQ B;  3UCG A;  2HRY A;  4NA3 A;  4DQI A;  2M0G B;  4E2F B;  2AJ0 A;  4DR1 J;  1BC6 A;  1H2U X;  3V6K A;  5FD1 A;  2D3O 1;  1IBC B;  3T1H F;  1HWK A;  1R43 A;  2E29 A;  1C1C A;  2JVR A;  4PXE A;  1CJK B;  4NI2 A;  3NS7 B;  2PMW A;  3QT5 A;  3KJN B;  1EKR A;  2GHV C;  1IKX B;  4YOE A;  5F8H A;  3M4X A;  2CUY A;  4J9S A;  5E3Q A;  3DXS X;  4RW6 B;  4U8Y A;  2Q66 A;  2HNZ A;  2CJA A;  4DS5 A;  4AD6 A;  1X4H A;  4NYZ A;  5EWF A;  4F4X A;  2K3K A;  1JWW A;  2C3Y A;  5C24 B;  4CI0 B;  1Q79 A;  2G2Y A;  5HAO A;  1T9W A;  3GQC A;  2ZZN A;  4DR4 J;  4ID5 A;  4DN0 A;  2LQB A;  3FDS A;  1CUL B;  3P6Y C;  3UR3 C;  3NMA A;  4X4N A;  1XWL A;  4HDG A;  4UTG A;  4F0K A;  2DO0 A;  2F7V A;  8RUC A;  2V2Z A;  2GQC A;  1ZAX A;  1R3N A;  3MEK A;  2CZ4 A;  3I4P A;  1B28 A;  1FES A;  3K0J A;  2JOQ A;  4CYU B;  2LQ9 A;  4TN2 A;  3PEJ A;  1K0V A;  3H7H B;  1IUJ A;  2PO4 A;  5CH7 B;  4DPO A;  3CJK B;  2YWW A;  1NZ8 A;  2OEM A;  2FHJ A;  1KLM B;  5E3A A;  3BRE A;  3RZA A;  3QIP A;  3H4B A;  1DJ0 A;  4FXD A;  1S0M A;  3CC4 S;  2ZH3 A;  1HMV B;  2ZIT A;  3SDE A;  4C8Y A;  4UOC A;  2NPI A;  4DFM A;  4F4Y A;  3C6T B;  2GIF A;  4FPR A;  2D1C A;  1LV5 A;  2EKY A;  5HK4 A;  2VON A;  2KJV A;  1TAQ A;  3EIC A;  4DUZ J;  4C8N A;  4GKJ J;  2WBM A;  4F8R A;  1MU2 A;  1J2V A;  5L46 A;  2ZHA A;  1LWE B;  2MB0 B;  4CM2 A;  3CD6 S;  3E01 B;  3MMB B;  2RHS B;  5LOQ A;  1Q5Y A;  4QIV A;  2V8P A;  4JI0 J;  2RD5 C;  4FZV A;  3AJD A;  4CLF A;  1UW4 A;  3KNG A;  5H9F K;  2HFV A;  1WKJ A;  1R31 A;  2IIH A;  4AXJ A;  1PYO B;  2J8A A;  3LTO A;  3RR8 A;  1SJ4 P;  2GVZ B;  1IQZ A;  2FHM A;  3QZ8 A;  3BPD A;  5ETQ A;  1R0C B;  3O5T B;  5KG2 A;  4MMO A;  5GME A;  3VR1 A;  3NAH A;  1MSW D;  3T5H A;  3ITH A;  4RLE A;  3EVO A;  2KYZ A;  3KHL A;  2HAF A;  2O66 A;  4DX5 A;  3GMG A;  1VMB A;  4Z37 A;  4IFV A;  1PC5 A;  1S6Q A;  4KSE B;  2DR7 A;  1FDB A;  3I5A A;  1B64 A;  3DHX A;  4XDD A;  1NU4 A;  2UXD J;  1RAI B;  2HS0 A;  1F0X A;  4IRC A;  4XTT A;  4KBI A;  2X51 A;  1C4C A;  3KJF B;  2KG1 A;  3PRV A;  4DR5 F;  4UOG A;  2Y1L B;  4UT4 A;  1OG7 A;  4GMK A;  3V81 A;  4NMX A;  4IKA A;  1GXT A;  3AJ2 A;  4NLD A;  1ELO A;  2KT5 A;  3ZZZ A;  2XNQ A;  4L73 A;  1RHJ B;  4FYD A;  5KFM A;  1VBZ A;  4C7Q A;  2E5H A;  2Y1R I;  3LWL A;  2RRA A;  3TX0 A;  2R7U A;  4GKK J;  2CG8 A;  3LO3 A;  4DPU A;  4QBU A;  4JV5 J;  2OPQ B;  5KFP A;  2YWE A;  1S9F A;  3H8Y A;  4N41 A;  4PG7 A;  3AA9 A;  4Y34 A;  3U7J A;  2R8K A;  2C2M B;  2ZH5 A;  1HLW A;  1EKS A;  1WHV A;  1SQG A;  2XS2 A;  3SXL A;  5KFB A;  1NSA A;  2BE7 D;  1GTH A;  3A8J A;  3TZW A;  1TKX A;  3K5M A;  2R7O A;  2FGO A;  4ES1 A;  3ZZR A;  3GR1 A;  4BLG A;  1NO8 A;  4L3K A;  4WZM A;  5GAH U;  4OX7 A;  1J5E F;  2CPD A;  1YTY A;  1I5O B;  1UFK A;  2IBK A;  4LVN P;  2PMZ D;  3UO0 A;  4ZCM A;  3LH2 S;  4Y2I A;  1HYS A;  3UCZ P;  3OT9 A;  1Y10 A;  4JI3 J;  2B7B B;  2MKJ A;  2Y8W A;  3AOB A;  4DCP B;  2PFD A;  4Q44 A;  2RS2 A;  2DYA A;  2ERR A;  2HPU A;  3LF0 A;  1KFD A;  1NND A;  2HS3 A;  1FEH A;  2W2O P;  1UWA A;  3RB6 A;  3NS6 A;  3OJU A;  4K4Z A;  5KG4 A;  1U2C A;  3ZTS A;  1S6P B;  4OI3 A;  4X65 J;  2AJ1 A;  1V6H A;  4R8U A;  1IBM J;  3NRB A;  1CJT B;  2FC8 A;  1RA7 A;  3BJY A;  1AT1 B;  1UZD A;  1ZZF A;  5EHH A;  2OHD A;  4ZPD A;  4ZDN A;  3LP0 B;  5K20 B;  3ZZU A;  4DR2 J;  2J0Q D;  2I2Y A;  1I94 F;  3MTK A;  5KT3 A;  1TV6 B;  4ZP8 A;  1H98 A;  3WIV A;  3Q2T C;  5HN0 A;  2R2U A;  4U8V A;  1IBL J;  2JVO A;  2PEB A;  3M8Q A;  3P5B P;  1NHK L;  4ES2 A;  3ILO A;  4LRF A;  4OIX A;  3MEG A;  2MTL A;  2PI4 A;  3C2P A;  1RBL A;  3JYT B;  2YKA A;  3BGR A;  1FWK A;  2RDJ A;  1S10 A;  1K47 A;  4TY8 A;  3QYY A;  4GVB A;  1NZA A;  5LXR A;  4KIA A;  2C3M A;  4IO9 Q;  4WFY A;  4DV2 F;  4WXO A;  5DG8 A;  4I69 A;  3OUY A;  4C9D A;  1JLA A;  3J7A N;  1XN9 A;  4O3S A;  4CCH A;  2PA3 A;  3M8P B;  2B0G A;  5L9N A;  2VG5 A;  5B0D A;  4ZLJ A;  2WOM B;  3LP1 A;  3KLH A;  4OX6 A;  3HSZ A;  3PKM A;  3LP2 B;  3L7P A;  3V6J A;  5E41 A;  2B7C B;  1JLG A;  1KP6 A;  2YKN A;  3BQ1 A;  3BDE A;  2ZD1 A;  1GT8 A;  2HHT A;  3QFH A;  2KYX A;  4DBQ A;  3HCX A;  4O4G B;  1FEE A;  3FCW A;  1U48 A;  4WTY A;  5CA5 A;  3UNG C;  3QGI A;  3QJJ A;  3DDN A;  1G6B A;  4NLG A;  3G9C A;  1WOS A;  4CNZ A;  4R5P A;  1C0T A;  2OTJ S;  2HNY B;  3CMA S;  2B51 A;  4B9L A;  3OR2 A;  4CLZ A;  2HRU A;  2I6W A;  4I56 A;  1UJ6 A;  1UFL A;  2EBG A;  2IDL A;  2KHC A;  4B9N A;  2ZKT A;  1ROF A;  4XDC A;  1QTN B;  3O44 A;  2MLY A;  2EK1 A;  5BJR A;  5F9N A;  1A0O B;  2RIL A;  2E7V A;  4JV2 A;  1UMJ A;  3ELH A;  4AXI A;  4EEY A;  4LF1 A;  3AJ1 A;  1HBU B;  3IWL A;  1L5U A;  2R8H A;  1LK7 A;  1S1U B;  2CPJ A;  3NKY A;  2EXU A;  4CLP A;  3CTR A;  2QGF B;  4C48 A;  1JLQ B;  4NA2 A;  3LGN A;  3SQG A;  2CPF A;  1MN7 A;  4UZB A;  3F0N A;  3SEO A;  2GMJ A;  5KFS A;  2XZT B;  5DM7 Q;  4YS2 A;  4KAI A;  4LRE A;  4WYW A;  3HLU A;  2VFR A;  4ZJO A;  1Y11 A;  2NLW A;  5KFQ A;  5DDO C;  2PDA A;  5HVH A;  2W8K A;  1D0E A;  2H4Y B;  5DZ6 A;  3H42 A;  5D78 A;  4JI6 J;  3UWT A;  3W64 A;  4QR2 A;  1FJ7 A;  1HQU A;  1WG4 A;  3RBZ A;  3RUB L;  4WU3 A;  1B3T A;  4P9S A;  3BM7 A;  3MMC A;  3K8V A;  4QWB A;  2Y0B B;  1O8B A;  4B3M F;  1N5Y B;  2GC8 A;  5B0E A;  2F65 A;  3G4S S;  4YB1 P;  1P9Q C;  2V63 A;  4USW A;  2CPH A;  1RZM A;  1S77 D;  4O0N A;  2CDR B;  4ZIV A;  2W8L A;  1S4E A;  3M1V B;  1HWL A;  1GMV A;  1TL3 B;  2R8I A;  3FEZ A;  3GIK A;  4PAB A;  4PQA A;  3PO4 A;  2RU9 A;  2PN6 A;  3OR1 A;  1EX8 A;  2AX0 A;  3T1H J;  5LT5 A;  2LA6 A;  1NSP A;  3FQK A;  2R2T A;  2WRM A;  1F9H A;  2J6U A;  3SYZ A;  2X3G A;  4UF4 A;  4TYA A;  2CQC A;  3KFW X;  5F8N A;  1S0V A;  3KLG B;  1ARR A;  3NLC A;  5ETS A;  1CG2 A;  3GSD A;  4DQP A;  5K8N A;  3M9O B;  1RWO B;  4HH0 A;  3DGP B;  4OZ3 A;  3CCV S;  1RT4 A;  2BM1 A;  3QOQ A;  4ZLP A;  3I0R B;  1YDL A;  1X4F A;  4FP9 A;  2PFF B;  2H54 B;  1U24 A;  2GAG C;  5FDL B;  2EFO A;  1E6V B;  4ELU A;  2V6A A;  3C16 A;  5KT2 A;  4QQB A;  2NRE A;  1BQX A;  2CA9 A;  1PJ7 A;  1UTA A;  3C46 A;  2W9B B;  4IR9 A;  1AB8 A;  4J5O A;  5CAB A;  1X93 A;  2V68 A;  3QFW A;  5C5J A;  3BEG B;  2IA6 A;  1WUU A;  2G13 A;  3KTQ A;  3D66 A;  1VQS A;  4EUV A;  3TA1 A;  1LWF A;  3DYA B;  1RGV A;  2JX2 A;  3B4D A;  1TKT A;  4EBC A;  4RUH A;  3D67 A;  4C8K A;  5THW A;  3DLK B;  4AAI A;  1YI2 S;  3ZFV A;  3BR8 A;  1GX6 A;  3W5Z A;  4CWB A;  2A18 A;  3DLG B;  1BWV A;  3P5T L;  1NDP A;  3MM6 B;  2EVZ A;  1N0U A;  1Q86 T;  3N9U C;  4LFB F;  4C3L A;  4M5K A;  3J7A 1;  2A0F B;  4I0W A;  1SV5 A;  1OQ6 A;  1ZM2 A;  4HVZ A;  3G87 A;  1RK8 A;  3GJS B;  2DY9 A;  3OL7 A;  4UUX A;  3W2V B;  3EGW B;  1HD0 A;  3KLI A;  3B82 A;  4LSN B;  4X4R A;  3HVR A;  1VS3 A;  4Y2K A;  5A0Y B;  2DGW A;  3H2V E;  2OGU A;  1XR5 A;  2JEJ A;  3BN7 A;  2XTJ P;  5IFM A;  5F8I A;  3OHB A;  1LFP A;  4I4B A;  4RJV A;  2XMM A;  4AFF A;  1AW0 A;  3IS9 A;  4E0D A;  3RAX A;  1RE1 B;  5E3R A;  2ILZ A;  2UVR A;  2MQP A;  3M32 B;  4DWI A;  4OX9 F;  1GEH A;  3RRH A;  2DGS A;  2QLF B;  3MAH A;  3EZO A;  4MYT A;  3L7O A;  3IP0 A;  4URG A;  4O44 A;  4C8M A;  2Z2M A;  1HWJ A;  2JRS A;  4WFA Q;  1HNX F;  4DL2 A;  1M1H A;  3QRQ A;  1HW9 A;  1NLK L;  1VRT A;  3CO0 P;  3TZY A;  2A2D A;  3C6U B;  1LWC A;  2MGZ B;  2ADB A;  1S9E A;  3MM5 B;  1ZET A;  1HFE L;  1VIS A;  1JMT A;  1FTC A;  3C15 B;  2G1D A;  3KDN A;  3DRS B;  4A8X A;  3K8W A;  5E2Q A;  4DR5 J;  3SCI E;  1CSJ A;  1WJ9 A;  4ECW A;  2QFJ A;  2EKN A;  4F4Z A;  5FLX Y;  3BV8 A;  1M5O C;  1NH8 A;  2A2B A;  1UPP A;  3PNI A;  3BKT A;  4ZVG A;  1RTI A;  5EWE A;  2FC9 A;  2JSX A;  2Q79 A;  2WSE C;  2K7J A;  4B3T F;  3SBM A;  3D4J A;  1WI8 A;  4ETZ A;  1MN9 A;  3S8S A;  3G71 S;  4MT1 A;  4ZOS A;  3N5B A;  2LVW A;  5AXM A;  2R8J A;  5HMX A;  3GV8 B;  1T8E A;  1FRJ A;  2V94 A;  2ZZT A;  1I1G A;  1M5S A;  4K2J A;  1UEV A;  2XMU A;  2NZ4 A;  3DLH A;  4G6V B;  5KFN A;  1J5E J;  2QG9 B;  1Q0N A;  2AYE A;  4ATN A;  4YME A;  4C11 A;  4DEZ A;  1B0V A;  2IAJ A;  3MOZ A;  4IOA Q;  3IRX A;  1R89 A;  3HP6 A;  4A4J A;  4KH1 B;  1E6Y A;  1D09 B;  2RF2 B;  2FJD B;  1PIL A;  4K59 A;  1V3S A;  2DR6 A;  1PJ5 A;  2EFV A;  4A48 A;  1ZA1 B;  4HR2 A;  3DFE A;  3W2W B;  2W4P A;  2K9I A;  1YJV A;  3FBF A;  3VF0 B;  1UVK A;  4ZVH A;  4HDH A;  2X1B A;  5AXN A;  2K3I A;  1VC6 A;  3ZTO A;  2JFK A;  2RBF A;  4ICL B;  4S0M A;  2MHE A;  3W8P A;  2WCX A;  3O8W A;  2DJW A;  1SUQ B;  3AFG A;  3IG1 A;  2KKH A;  3OL9 A;  2QSF A;  2IMW P;  2RIJ A;  1NJI T;  2EK6 A;  4DQQ A;  3HZG A;  3BZQ A;  2VPX B;  1U4B A;  3HKZ D;  4F36 A;  1ZM3 A;  3HF5 A;  1X5S A;  2NUU G;  2J8S A;  1FJC A;  2EFQ A;  4ERD A;  4ED7 A;  1OQ3 A;  4OJH A;  1RWN B;  4EZ6 A;  2E1P A;  1B01 A;  2QMU B;  5HBM B;  1K8A T;  1XQI A;  3DOM B;  4LRV A;  3IXQ A;  2P5V A;  4MAK A;  3IA0 A;  4ZPV R;  4F02 A;  3T9Z A;  3D68 A;  4DV2 J;  3CUN A;  3DOK B;  3MGJ A;  1MNE A;  3RU0 A;  4YP3 A;  2QL9 B;  3DM2 A;  3HVA A;  4FNI A;  2BOP A;  1T9T A;  3W9J A;  3SFG A;  3VVT A;  1OY8 A;  2HHW A;  2DTJ A;  2W4D A;  2PD1 A;  3PW2 A;  4Y00 A;  3M8W A;  5K5M A;  1ZPW X;  1H6K X;  1S0O A;  3ETM A;  4ILR A;  3R27 A;  1JLE A;  2ROP A;  3W60 A;  1HBN B;  1VDH A;  2BMB A;  1RAH B;  4FN5 A;  3MEC A;  4AQY F;  4X66 F;  2HHP A;  1S1T B;  2C2N A;  1TFW A;  1L3S A;  2V34 A;  3JB9 k;  4ZCK A;  1M5V C;  3R5G A;  2IYI A;  1KLN A;  3S01 A;  4PZV A;  4DLE A;  3CDU A;  2W1B A;  1WDD A;  3FCV A;  1QE1 B;  3VAK A;  5LMN J;  1NK7 A;  4NLV A;  2HFO A;  3QLH A;  3O6Q A;  3TJ8 A;  1GXU A;  4D3H A;  1WOO A;  1KQK A;  2JL9 A;  3V2U C;  4OI1 A;  4ED8 A;  1Q8L A;  2E66 A;  1VC5 A;  2DIS A;  5DLF A;  5ETV A;  4QJV A;  4QR1 A;  4PXD A;  4QIE A;  4RNO A;  2C2K B;  4ED3 A;  2OLW A;  3KK1 A;  4DV7 F;  3DCA A;  3R5C A;  2XQC A;  4HHH A;  4YFU A;  2F63 A;  2IRU A;  2HKE A;  2L9W A;  1P1T A;  5IZH A;  1MYL A;  3DGV A;  1SC6 A;  4DDF A;  2RML A;  3BGU A;  3SMZ A;  4H4O A;  5T7L A;  1RTD A;  2BJ9 A;  3KUH A;  2GO8 A;  3I32 A;  3UVJ A;  2YX1 A;  3PJX A;  5KFL A;  1Q4R A;  2R7V A;  2X1A A;  3QO9 B;  1QVF R;  1LW0 A;  1CJU B;  2Q43 A;  3PY8 A;  3W7B A;  1VQ4 S;  3G8T A;  2FY1 A;  1NKB A;  1N5T A;  4LF7 F;  3R7B B;  1WHX A;  2K1R A;  2MKY A;  4DUY F;  2VBY A;  4B3M J;  5B0C A;  4G1Q A;  2HZV A;  3H5X A;  3VAG A;  1FKP B;  4WTO B;  1RTJ A;  3I31 A;  2EPI A;  2FZG B;  2DGO A;  2HQF A;  2APO A;  2C3P A;  2HND A;  1TKZ A;  1EET A;  2NYI A;  3EE3 A;  5H9E J;  2HZC A;  3CDA A;  2ZUG A;  2ZH9 A;  3V4I B;  1CC8 A;  2XUL A;  3ONQ A;  5EUH A;  3PYD A;  5BR8 F;  3IBW A;  4A8Y A;  3UE2 A;  2J5A A;  1SIW A;  5M2R A;  2G0I A;  1ZPV A;  2QE5 A;  4ANC A;  4LBH A;  3JSB A;  4K50 A;  2DHH A;  2YKM B;  2YTC A;  2KT2 A;  4F0H A;  2HHV A;  2IVY A;  1N34 F;  1U7L A;  2YWG A;  2CQP A;  3LQV A;  4UST A;  1PAR A;  2DNO A;  2E5I A;  3H4D A;  1UET A;  1NPP A;  3PXG a;  2YY3 A;  5EN1 A;  3OJS A;  1F3V A;  3HHK A;  1XR6 A;  2N3O A;  4MKB A;  2KM8 B;  4G1P A;  4DR3 F;  4J9Q A;  5HP1 B;  3FRY A;  4I1T A;  1U26 A;  1VLY A;  2ASD A;  4WFX A;  4Q0B B;  2XNR A;  4QWA A;  2KXH A;  3OLA A;  3TQ1 A;  2GPE A;  3GON A;  2DR9 A;  4FPI A;  3TP2 A;  1SQE A;  3VZI A;  3V4M A;  3GJT B;  2WON B;  4FYV B;  5D3G B;  4RU2 A;  2GV1 A;  3FUY A;  2RDD A;  2KZZ A;  4B3O B;  3J81 j;  4OYW A;  3RTV A;  1FRL A;  1BQM B;  4KPC A;  3MDF A;  2BOA A;  2OP5 A;  3Q86 A;  1NME B;  3QQC D;  5HVF A;  2A1B A;  3GXQ A;  5GMK a;  1OSC A;  2IHR 1;  4F67 A;  5E3P A;  1V3R A;  4MH8 A;  3R97 A;  4LFB J;  2AW0 A;  4F7V A;  1SQF A;  2UU9 F;  3GIJ A;  3RG6 A;  4YR3 A;  4BS2 A;  1QTM A;  1H38 A;  2ZJQ Q;  4NCG A;  3CJ5 A;  3N6N A;  1IJF B;  2Q6B A;  1DUR A;  1QAY A;  3D54 A;  1YRT A;  2MPU A;  3QT7 A;  1C0U A;  3G8S A;  1FCA A;  4OYI A;  5LSR A;  4RBT A;  1V5I B;  2Y3Y A;  1Y5N B;  3CWJ A;  3HXM A;  4ZCI A;  3LAL A;  1SC3 B;  5M2P A;  5LJ3 Y;  3ILL A;  2XMT A;  1WC4 A;  2CG4 A;  4CNY A;  2JLE A;  2FQQ B;  1QTG A;  4OZ5 A;  2BA9 A;  4OX9 J;  2XSJ B;  1U49 A;  3MR5 A;  4DHV A;  3EGV A;  1WF2 A;  3RBD A;  2QTW A;  1S6U A;  3N5F A;  4IOB A;  3H25 A;  4HAC B;  1HAR A;  2XM3 A;  5CCM A;  2UV8 G;  5A76 A;  1YJN S;  1VHI A;  3W9H A;  4B02 A;  2BJ1 A;  4P2X A;  1HNX J;  3SQO P;  1JXL A;  3OTE A;  1ZM4 A;  3HKW A;  3ENW A;  5A8W B;  4KGX B;  5A8R B;  1DTT A;  2AQ4 A;  4ZHR B;  1ULR A;  1N48 A;  4B3R J;  2IVM A;  3GFH A;  3BSN A;  3S6E A;  2DNR A;  2DNM A;  3VCD A;  4TQR A;  4P52 A;  3MED A;  3QGP A;  2DB1 A;  5SUH A;  2BSQ E;  3GP9 A;  4IH5 A;  4MYU A;  3TYT A;  5IOL A;  2QO3 A;  2ACY A;  2OPR A;  2GVD B;  3KHG A;  3VHQ A;  2KN4 A;  3B54 A;  2BEF A;  1VFJ A;  1X8D A;  1X9S A;  1QM9 A;  3MM7 A;  3M6U A;  1SL2 A;  1VR6 A;  2W01 A;  3TA2 A;  1FE4 A;  3PX0 A;  3UI3 A;  4BCA A;  4IFY B;  1JLC A;  3MM9 B;  2RUG A;  1HBM A;  1G2E A;  4ER8 A;  4PPZ A;  2NXN A;  3PJW A;  4IO1 A;  2F5G A;  4OZ1 A;  2CQB A;  2BE9 B;  4Y2M A;  1F1B B;  4I2P A;  1IRQ A;  4P2M A;  4PG6 A;  5LSL A;  1IKW A;  1UAW A;  5E5N A;  2JJ4 D;  2UXB F;  3IFE A;  2VPW B;  2F4F A;  5CYM B;  2F3J A;  1X4C A;  4LBP A;  1Q7L B;  2QV6 A;  4RBV A;  4LIR A;  1OPI A;  2YNH A;  4N56 A;  2CJK A;  1TMM A;  4WYL A;  3TAQ A;  4ZP9 A;  5J2N A;  1QLN A;  1TR0 A;  2VOD A;  3BO2 A;  3VGS A;  1N8R T;  3HHD A;  2CYY A;  4OYA A;  1VIO A;  3FJ2 A;  3DRR B;  4HV0 A;  1XMO F;  3EDR B;  4QIF A;  2YNG A;  3CME S;  1NBE B;  2CJY B;  3WC2 A;  2FJE B;  2ZH6 A;  5ETL A;  3OQ2 A;  1PBU A;  4WWS A;  3TAR A;  4RW4 A;  3HSJ A;  5K9F A;  5ETM A;  3AOA A;  2M52 A;  1WD6 A;  5CCL A;  2YH1 A;  1HNI B;  3N0V A;  3CJ0 A;  3IR5 B;  2R8G A;  2HK3 A;  5KFV A;  4LR8 A;  2CQH A;  3IC1 A;  3SV3 A;  4LF8 F;  1RHR B;  3N6M A;  1HMV A;  1RLC L;  2B4P A;  5HRO B;  4ED6 A;  3CPW R;  3NOC A;  5RUB A;  5K14 B;  3O2I A;  1TUG B;  5A6P A;  1UJ4 A;  2FGC A;  3CD7 A;  3BGF A;  4KHR A;  2IJN A;  2DIV A;  5KFR A;  3JSM A;  1T03 A;  1V5V A;  2J7K A;  3PJ9 A;  3K17 A;  2G2O A;  1KRP A;  2FVQ A;  3K7R A;  1Z2L A;  2ZBQ A;  2G4B A;  2FLL A;  1WHW A;  1S1V B;  5F8L A;  1NK6 A;  4N76 A;  4MK9 A;  1F60 B;  5H9F J;  2AP6 A;  1LFW A;  3QID A;  4X66 J;  3ET6 B;  2FVC A;  3DDK A;  2PC6 A;  3DLE B;  2D3U A;  4PR6 A;  1YJW S;  2N3L A;  2ZOM A;  2IM0 A;  1G7C B;  2ZH7 A;  3AD7 C;  4ZN1 A;  4DV3 J;  4OL8 A;  1RTZ A;  3MAQ A;  3FMB A;  2GGP B;  2QRR A;  2ALY B;  4QIG A;  2VFU A;  4PYD A;  1YJ7 A;  2GIQ A;  2GW8 A;  3ZNU A;  2RSQ A;  2M88 A;  2YWH A;  4KHM A;  1HNV A;  1KOO A;  3I5C A;  3PIP Q;  2OML A;  2UZA A;  1S76 D;  3LOU A;  5KT4 A;  2HHX A;  2HFZ A;  1F6T A;  3JQM A;  1EP4 A;  4OQJ A;  3RB0 A;  3DMJ B;  3CCL S;  1N56 A;  4QR0 A;  3BH7 B;  3DLL Q;  4B9S A;  2WBR A;  3FBC A;  3X1L B;  4ECU A;  3L9Z A;  3CDB A;  1EZZ B;  2DPJ A;  1IM6 A;  1WF0 A;  4DV7 J;  4RBU A;  3R5J B;  2R42 A;  4Q45 A;  3HVT A;  5I3U B;  1S1W A;  2BJ7 A;  4MK7 A;  4L74 A;  5F0U A;  2DNG A;  2LYV A;  3VVU A;  1RT7 A;  5DLG A;  5F8J A;  2AJF E;  1RT1 A;  3HSD A;  2R2R A;  1CEZ A;  1HHT P;  3POT B;  2O67 A;  2J9D A;  2JBV A;  4KO0 B;  3A8I A;  1FX2 A;  2ZE2 A;  3EX7 B;  4F4W A;  2DH7 A;  2YKQ A;  4LF7 J;  3UDC A;  2HHU A;  3G82 A;  3ZO7 A;  2Q6C A;  4DUY J;  1IN0 A;  4B9T A;  4DL5 A;  5ETP A;  4A8F A;  3X3U A;  1IJE B;  3PG9 A;  2M9K A;  4H4K C;  2H5I B;  2RE1 A;  1KC8 T;  2QN6 B;  1NPK A;  3E3X A;  1QAJ A;  1U02 A;  5KFE A;  2KOE A;  3VGU A;  2HAI A;  3DI6 A;  4NI2 B;  4X4Q A;  2P2C B;  2ACM A;  1RU1 A;  3AT1 B;  3FQL A;  5A2Q Y;  3R1H A;  1KQS R;  5BR8 J;  1GX5 A;  3PW4 A;  3NGD A;  3U1M A;  2HNZ B;  3TW0 A;  5CXT A;  4XIU A;  1QAX A;  2KEL A;  3Q83 A;  5B0G A;  4OJ3 A;  4ID5 B;  4HT7 A;  2CNK B;  1N34 J;  5KFF A;  3PYG A;  4KHP F;  3GCW P;  3M9N B;  3CIZ A;  3H2U B;  2CJX B;  2F8H A;  3PX4 A;  3VAL A;  2L08 A;  3A8E A;  4ZVR B;  2FLN A;  1S6P A;  1FA0 A;  2FHJ D;  2B56 A;  4DR3 J;  1O6X A;  1U0H A;  2DCL A;  2VQF F;  1XNR F;  1HPZ A;  1SI9 A;  2HWT A;  5GAD U;  3QWP A;  2JLF A;  2B6A A;  1SPB P;  2DNN A;  3FK4 A;  5D4P A;  4J7C A;  2GJF A;  2JZ5 A;  2LQJ A;  1MNT A;  3NBP A;  1Q78 A;  3T5J A;  2BX6 A;  4O0I A;  3SDE B;  1KVI A;  4WFZ A;  4J9V A;  1S9G A;  1O51 A;  2OPP A;  2YNF A;  2V2Q A;  3TX8 A;  1PBA A;  3NGK A;  2ASL A;  2HLT A;  4A47 A;  1MU2 B;  3DLJ A;  4RW9 A;  1SH2 A;  1BGX T;  2BE2 A;  2KVQ E;  1RAF B;  3AA8 A;  3ENV A;  1RKJ A;  5C2G A;  3FT7 A;  2R7W A;  3J81 U;  1S99 A;  5F8M A;  4G1I A;  2UU9 J;  1FT8 A;  1S7H A;  3LP2 A;  1RCX B;  3KLF A;  1XJW B;  4ITS A;  3A1Y G;  2OTL S;  1JJH A;  3TO8 A;  4JOU A;  1K44 A;  1WF1 A;  4RW8 A;  3V6D A;  5C42 A;  3IR7 A;  2B5J A;  2VHG A;  3CD0 A;  5E3C A;  1Z4U A;  2ASY A;  5MAO A;  2FVS A;  2UXD F;  1LKZ A;  2HBZ B;  2GHW A;  4RW7 A;  2GA7 A;  3ITH B;  1MWQ A;  1SKU B;  4ELV A;  4DLG A;  3M2U A;  2CPZ A;  2HNY A;  2WVD A;  5L1I A;  4C8L A;  1S6Q B;  2J76 E;  1VK8 A;  3CJS A;  4LQ3 A;  1IBK J;  4LF6 F;  2P8I A;  3D1O A;  2MST A;  4Y2A A;  5IC6 B;  2YPY A;  1Y0H A;  1U1Q A;  3Q89 A;  4K4U A;  1FTR A;  1TAU A;  2EBE A;  3CJT A;  4NOH A;  1ZBT A;  3DRP A;  2AYB A;  3V81 B;  1MYK A;  1TUV A;  3GWC A;  1QSY A;  4C8O A;  4WE1 A;  3CCU S;  1UA1 A;  1IM4 A;  1JLQ A;  2ZBP A;  1TP7 A;  1BXN A;  4NML A;  3SCK E;  4CDI A;  4ZPC A;  3T5L A;  2IC3 A;  2U2F A;  4XPE A;  3BGL A;  1UJ5 A;  3GIL A;  3LGM A;  4CO2 A;  1VYA A;  4JI1 F;  5GAG I;  1C1B A;  4DQS A;  2DXE A;  4EGL A;  4Q7A A;  2OFG X;  1FE0 A;  5K8O A;  4W98 A;  4YQW A;  3JAM Y;  4HYK A;  1TKX B;  1DHM A;  4JI3 F;  1N5S A;  2XSF A;  4DSI A;  3NOG A;  5KOW A;  2B3T B;  3IM9 A;  1R0B G;  1YKW A;  2C3U A;  2RUS A;  1S6O A;  1WSR A;  1WC5 A;  3BF4 A;  1JLB A;  1SXL A;  3PRD A;  5DGA A;  4PG8 A;  2KZM A;  5CZX A;  4Z2X A;  1HYS B;  2O3D A;  3VQT A;  1P27 B;  1Z2Z A;  2OKQ A;  3R2D J;  3UQS A;  1XTZ A;  2F4V F;  2BVZ A;  7FD1 A;  3R6L B;  3LWM A;  2VG6 A;  1TUW A;  1U8S A;  5CD4 A;  1VBK A;  3AD8 C;  3U27 A;  1RB0 A;  2UXB J;  1UA0 A;  4GVL A;  4EBD A;  5ETT A;  3EM1 A;  1GXL A;  5KFK A;  2Z0G A;  4MIA A;  3BH6 B;  2LCW A;  3A3O B;  4DR2 F;  1S1X A;  2KXF A;  2LLZ A;  4IDK A;  3H90 A;  4R8U B;  2RS8 A;  1IBL F;  6AT1 B;  1BDV A;  3BB5 A;  1VIX A;  4UQG A;  3FFI A;  5HJY A;  3PVX A;  2XZW A;  2CKW A;  3AAW B;  4DL3 A;  1YVF A;  2XMW A;  2GJI A;  3BR9 A;  2BKN A;  3GE9 A;  3NCR A;  2LXU A;  5B0B A;  3G6V A;  1XMO J;  4NLS A;  1HR0 F;  2RT3 A;  3M2R B;  1VOM A;  3M8Q B;  2KFN A;  2XWX A;  3MEG B;  1CS4 A;  2ZJR Q;  5L9X A;  2M8H A;  4WFN Q;  9ATC B;  3C14 A;  3BGR B;  1N36 F;  4J9K A;  3E2E A;  1X5O A;  4LRC A;  4TY8 B;  4GVB B;  1I6J A;  2MDA A;  5C25 A;  1RWP B;  2ATL A;  1FKA F;  3L95 X;  2OIH A;  3CGI A;  2EC2 A;  4OV1 A;  4Q2L A;  3OUY B;  1JLA B;  4P7V A;  2EFG A;  1REV A;  3D3B J;  1X0F A;  1FNO A;  3MWB A;  4LF8 J;  1X5T A;  2DNL A;  3W61 A;  2F8E X;  3CCT A;  4LSL A;  1LXJ A;  3I82 A;  3LP1 B;  3H59 A;  3KLH B;  3DLG A;  3CJ2 A;  2MZT A;  2DNP A;  4CRJ A;  3MM6 A;  4O3O A;  3JTO A;  4DCO B;  2R2S A;  4OV6 A;  1JLG B;  4DSF A;  3KYL A;  1VI7 A;  4ZPW R;  1WOR A;  2YKN B;  1RLD A;  2ZD1 B;  4DZD A;  1FI4 A;  3NXZ A;  2V2V A;  3MCS A;  2DO4 A;  3PAC A;  2LEP A;  3TOQ A;  3SSS A;  3FKB A;  1NLA A;  3W2V A;  1RHK B;  4NLU A;  2WVC A;  2Y9H A;  4F04 B;  4DL7 A;  2YX4 A;  3UR0 A;  4M94 A;  1NXI A;  3MTJ A;  4X4T A;  4R5P B;  1C0T B;  1U1K A;  2EC0 A;  3OR2 B;  2HVI A;  1EAY C;  1YSJ A;  1S0N A;  1HL6 A;  2XMK A;  4FYY B;  1TTH B;  4ECQ A;  4HEA 9;  3OXL A;  4DV4 F;  1FNX H;  2J7U A;  4WFB Q;  4PAA A;  3MD3 A;  3TEG A;  1MMD A;  2LU2 A;  3CJQ A;  1B7F A;  3M32 A;  2E9R X;  4FF4 A;  4I68 A;  4TNO A;  2DD8 S;  2B8P A;  5J1N A;  2PT0 A;  3D0I E;  2J0X A;  5EGY A;  1P1L A;  5A8K A;  3KG0 A;  4HT5 A;  4Q2M A;  3OFG A;  1IQT A;  4USJ C;  2BM0 A;  4ECS A;  3SQG B;  3J80 U;  3G8Q A;  3SV4 A;  2K1O A;  1GAO A;  2XY6 A;  1HKA A;  4MIW A;  1YBU A;  1SC1 B;  3P45 B;  2YBV A;  4J91 A;  2HYI B;  3FC9 A;  3QRP A;  5HLF A;  3CB4 A;  2VU5 A;  1FD2 A;  1D8Z A;  4U6P A;  1I51 B;  3ZTQ A;  1HQU B;  1FJE B;  3BBB A;  3MMC B;  2WW4 A;  4DU7 A;  3SCL E;  2QLW A;  4NEY A;  1Q53 A;  3RR7 A;  2V8H A;  3MCO A;  3PFE A;  2E9Z A;  3KLE A;  4UZC A;  4DMZ A;  4ZMM A;  1NJX A;  3VAF A;  3LAN A;  1T9X A;  3GLJ A;  1MWZ A;  2ATC B;  1FK9 A;  3G5O A;  2VV5 A;  3GR0 A;  5HQ8 A;  1HA1 A;  1H74 A;  2YPZ A;  2HMI A;  4D3G A;  2MQ8 A;  3OR1 B;  3OVA A;  4BWM A;  3JTN A;  1NM2 A;  5KT6 A;  4F3M A;  3HK2 A;  3UDL A;  3UFC X;  3BSO A;  2KU7 A;  4QYZ K;  4L75 A;  1J5O A;  3PM9 A;  1NSK L;  3D6F B;  2RF2 A;  3J7Y I;  1RBO B;  5KFA A;  1TK0 A;  1LW2 A;  1U1N A;  3QJL A;  2M5Y A;  2V67 A;  1UCN A;  1RT4 B;  2PMH A;  2V8G A;  1DAX A;  2G0C A;  4O4R A;  4DL0 C;  3QNW B;  4HKQ A;  4NZ7 A;  3NNE A;  1F5B A;  1UP1 A;  2C2O B;  3I0S A;  4ID8 A;  4KHP J;  1G1X A;  1X4E A;  3C16 B;  1DLO A;  4J9R A;  1U2R A;  1WTB A;  2AJ2 A;  3V6H A;  3AY0 A;  4USH A;  2CWK A;  3IAS 9;  3PW5 A;  2VQF J;  1XNR J;  4M95 A;  1LK5 A;  1NK0 A;  2H4W B;  4QWE A;  3MPD A;  2XMA A;  4JI7 F;  4I67 A;  1LWF B;  2ZJP Q;  3HHN B;  1RWU A;  4OLO A;  4KR0 B;  2JH3 A;  3K5L A;  1TKT B;  3M2V A;  5GAE I;  1ZOT A;  1FDN A;  1FF2 A;  1WG1 A;  1XNQ F;  3TEH B;  2RQ4 A;  2AIR B;  1YG0 A;  3H20 A;  1HI0 P;  3FMW A;  4DPW A;  2GIR A;  2BBE A;  3AB4 B;  2E9T A;  4AL7 A;  3UCU P;  4PXC A;  1REG X;  2DNY A;  4XO0 A;  2LXI A;  4K0K F;  1MLA A;  1WDT A;  2LFV A;  2CNN B;  2UVW A;  5J2P A;  5DZ7 A;  1HQE A;  2R7X A;  3ISN D;  3M30 A;  1SV5 B;  1X0P A;  3D2W A;  4U7U D;  1U45 A;  4ZVE A;  4C4W A;  3MCN A;  4P71 A;  3KLI B;  3FCH A;  3NG8 A;  4DSL A;  1T94 A;  2NSB A;  4F2R A;  2HEK A;  2LQ8 A;  4CTA A;  4JP8 A;  4J9M A;  1HBO A;  4NLW A;  4HL9 A;  1XIQ A;  2FIU A;  4U7C A;  4I64 A;  3G6X A;  1S5Z A;  3VTI A;  1R0A A;  4L3N A;  2FJB B;  2AZ3 A;  3W5X A;  3EGZ A;  2YKP A;  4Y0F A;  1JLF A;  1BY9 A;  3IM8 A;  3PZP A;  4ED2 A;  1WC3 A;  3IS9 B;  4DL6 A;  3BGO P;  4MK8 A;  4DQR A;  1H2T Z;  2ZVI A;  3QJP A;  3A3N B;  1RP5 A;  2VBX A;  1UKU A;  2AZ1 A;  4I6Y A;  5C2C A;  4B3S F;  4QIW D;  2RKI A;  3HVW A;  4O44 B;  2GS8 A;  1VQN S;  3TUJ C;  2B9X A;  4DF4 A;  4M63 A;  3PHE A;  1W2B R;  4LF6 J;  2BW7 A;  4IH7 A;  1VRT B;  2JNJ A;  1LWC B;  3BSC A;  1S9E B;  4IG0 A;  3Q23 A;  1P8G A;  4J90 A;  1SJR A;  2AWZ A;  2CQG A;  1PJ6 A;  1U6F A;  1KHW A;  4KGK A;  1TZ0 A;  1TEL A;  2A3J A;  2FZK B;  3R5D A;  4MFB A;  4CLT A;  2V9W A;  4TKT A;  4NCA A;  2XMV A;  1LNQ A;  2KRR A;  2HWH A;  2HW3 A;  4OHY A;  1RTI B;  1Y00 A;  3FGV A;  3NAI A;  2RVJ A;  1M5P C;  2BAN A;  5M2U A;  2Z2Z A;  1WEZ A;  2AYG A;  2FJX A;  4JI1 J;  2BW2 A;  4DPY A;  2L41 A;  3OXF A;  3VGT A;  3CUL A;  4MIB A;  1X7V A;  4LUB A;  1CJU A;  4NYO A;  2MKC A;  1TMJ A;  2AGO A;  5LJ5 Y;  1RHM B;  2DGQ A;  4PUO A;  2KH9 A;  3MM8 A;  3Q8V A;  4ZVO B;  2OUG A;  1H72 C;  5B08 A;  4C11 B;  1HNW F;  4LT6 A;  2IAJ B;  4W4M A;  3IRX B;  3SFU A;  4FXE A;  1FKP A;  1X4D A;  1CJV A;  1E6Y B;  2LQ5 A;  2ZC4 A;  4YR0 A;  1RAE B;  2YQ0 A;  5IS2 A;  2M2B A;  2F4V J;  4USK A;  4JI8 F;  2ZH8 A;  2YQ1 A;  3Q0A A;  1XEZ A;  4DSE A;  4KFB A;  4DV1 J;  2XS5 A;  1ZTT A;  2ADC A;  2O1P A;  3LPY A;  4QCL A;  5F9L A;  1W7W A;  2RH3 A;  5ETK A;  2U1A A;  5D77 A;  5JVG Q;  3OFE A;  2E7W A;  3H2L A;  4H4M A;  2JXH A;  2MKI A;  2ZBR A;  2K29 A;  4J37 A;  2YNI A;  3D5M A;  1VQP S;  1PAE X;  3IG1 B;  4G65 A;  1TL1 A;  3ILJ A;  1FWP A;  2CQ0 A;  2HQD A;  2C2E A;  3LW5 C;  3QAU A;  4DSJ A;  5HMZ A;  3UNY A;  2JHE A;  2YH0 A;  4ECY A;  2HUR A;  4LF2 A;  4DUT A;  1HR0 J;  1RU2 A;  1TK8 A;  2VDH A;  3I9V 9;  2QX0 A;  2XY7 A;  5KG6 A;  1ARQ A;  4WIQ A;  5J1E A;  3KOA A;  2D3Z A;  1UFW A;  3CDW A;  2XI2 A;  4QU6 A;  1N36 J;  2JEG A;  4Z7Y A;  3HMJ G;  2W7A A;  2C2R A;  1LOU A;  2EG1 A;  2H65 B;  3LAK A;  5EDW A;  3RYL A;  4PG5 A;  2IRY A;  4ZKA A;  3D6M B;  3CJ3 A;  1K1S A;  5G0R A;  3DM2 B;  1X4B A;  1FKO A;  5DO2 A;  2VBZ A;  3TJ9 A;  2VFV A;  4YDD B;  5U47 A;  4KPY A;  1L3U A;  5D4L A;  2VOP A;  3MR6 A;  4L6V 3;  1Q81 T;  1P94 A;  1JLE B;  1AZS A;  4FKY A;  1CC7 A;  3MEC B;  4FYW B;  1WAC A;  4TLQ A;  3HUL A;  5LMN F;  1GMW A;  4RR5 A;  1BE4 A;  2DHS A;  4BC9 A;  3MPV A;  2YWK A;  2KM8 C;  3MFH A;  1GFW B;  3CCW A;  2XHC A;  2FD2 A;  4LRB A;  1N0V C;  1NUE A;  4KY3 A;  2I5J A;  4CP5 A;  3KK2 A;  2MZJ A;  4DX8 H;  4JYA F;  2O5D A;  2K5J A;  3QLH B;  2BA3 A;  2E1A A;  2QMX A;  4CO3 A;  3OSN A;  4DV4 J;  1M90 T;  4KT0 C;  4NLO A;  1VCT A;  1IKY A;  4JI5 J;  2XSJ A;  1RUS A;  1JXV A;  3R7N B;  2JXG A;  4BWJ A;  3TZZ A;  3CED A;  3KK1 B;  2XLI A;  4UOH A;  3K58 A;  3OPK A;  3CCR S;  3C19 A;  3R5A A;  1R6V A;  2IRX A;  2BQ3 A;  1HI8 A;  2KB2 A;  1AA1 B;  1YK9 A;  4GO5 X;  4P7T A;  4ELT A;  2Z57 B;  1Y5L B;  1K0T A;  3QZ7 A;  4Y28 C;  3RGI A;  5T7L B;  3MEE A;  1PG5 B;  3UVJ B;  4ZS6 A;  3BDP A;  2CAD A;  2WB4 A;  1LW0 B;  4DPT A;  3BKF A;  2HFU A;  2FHO B;  4WZQ A;  5IT9 U;  4B9M A;  2HHH F;  4OMF G;  2MKS A;  2K1R B;  2BJE A;  3TNV A;  2GQQ A;  2Z8Q A;  3D6T B;  5E33 A;  4G1Q B;  1H2V Z;  4ZP7 A;  1VQ7 S;  3OFH A;  2V2K A;  1RYS A;  1RT6 A;  3W8G A;  1EA4 A;  4TLR A;  1U1P A;  3N79 A;  4NXN F;  4RWW A;  4TVA B;  2HND B;  1TKZ B;  4C98 A;  3O3L A;  4ZJQ A;  3ZTR A;  2BZ2 A;  1YIT S;  4C8Z A;  2J6S A;  2BAB A;  2DY1 A;  1M5K C;  2NXC A;  1SIW B;  2QSW A;  3IGV A;  3T1A A;  2HGL A;  4CO1 A;  2Q2K A;  4OZJ A;  4N8O A;  1T02 A;  2QA4 S;  2H3A A;  2CAJ A;  3HDS A;  1W26 A;  2OO4 A;  1TFY A;  1L3K A;  1Q16 B;  4DV6 F;  3DRY A;  4ETX A;  3FSY A;  3EJM A;  4PKD B;  4ALZ A;  2AY0 A;  1U25 A;  5ADZ A;  2C2D A;  1W25 A;  1OS5 A;  2MZQ A;  1CBK A;  2DHA A;  2PSZ A;  4KGM A;  2CQ1 A;  4N5S A;  1V9O A;  1YJ9 S;  3F73 A;  3DRR A;  4PXB A;  3MUM P;  1RI7 A;  3H98 A;  4JI7 J;  1LQ9 A;  2EI5 A;  3CE8 A;  2DH8 A;  2FDN A;  1TKD A;  1SVD A;  2W24 A;  4RUC A;  4DJB A;  4OHV A;  1X60 A;  3GFX A;  2IDE A;  4EMD A;  1HNI A;  1XNQ J;  1GMU A;  3J7Z 5;  3QT6 A;  5HMY A;  2QYC A;  4PQU A;  1VBX A;  1CVJ A;  2CDQ A;  2VJU A;  1WWH A;  2P6S A;  1OPZ A;  2V4Q A;  4K0K J;  3RBX A;  3CSK A;  4W92 B;  4K7Q A;  1N6Q A;  4M5D A;  2AT1 B;  2ABY A;  3F41 A;  1T05 A;  1UEK A;  3MUV P;  3KHH A;  2MQO A;  1IR2 A;  1D9A A;  3OVB A;  1DY3 A;  4O3Q A;  4NCG B;  2CNL B;  1XC9 A;  1N5V A;  3K57 A;  3HHL A;  1KKH A;  1C0U B;  4OYM A;  5KFZ A;  3AH6 A;  3KLV A;  3PX6 A;  4EO8 A;  3FZB A;  3MPU B;  1N52 B;  4AYB D;  1D3W A;  1A9N B;  1JK9 B;  4NLX A;  4CH0 S;  4CM0 A;  1BUX A;  1NSQ A;  1S1V A;  2V5H G;  2N4C A;  2NXJ A;  1FHT A;  4O3P A;  2VJV A;  4X62 F;  2VB6 A;  3NMR A;  4XPC A;  3W65 A;  5GAH I;  2M8D B;  4OZ2 A;  3ZNJ 1;  2X1F A;  4CLU A;  2X1G A;  4LQ9 A;  2VUG A;  3EPI A;  2OD4 A;  5DM6 Q;  2AU0 A;  5KFX A;  4WBF A;  4B3S J;  4B3R F;  1JKH A;  4I7F A;  1F2H A;  2GGP A;  4WP9 A;  3HI9 A;  2ZDP A;  3HFZ B;  2JC1 A;  7FDR A;  2BR0 A;  1U09 A;  1SJQ A;  4LF9 F;  1QAI A;  2W9C A;  3MHY A;  5KG0 A;  1UWB A;  1DTT B;  3Q8R B;  4E98 A;  5CAA A;  2Q3P A;  4P75 A;  1WI6 A;  2OMO A;  1YZ7 A;  2XWY A;  1IKV A;  2X7I A;  1PSD A;  3KUE A;  1NK5 A;  3MED B;  3NS5 A;  4RX6 A;  2V4J A;  1O0P A;  2UP1 A;  4KV8 A;  3OXG A;  9RUB A;  3QMQ A;  1PO6 A;  2JXI A;  2HVH A;  2OPR B;  5J2Q A;  1FRM A;  2KXN B;  3CMQ A;  2A2C A;  1RT5 A;  4IH6 A;  3QAT A;  5E0O A;  4NA1 A;  1GK8 A;  1HHS A;  2IPO B;  3D28 A;  3S1T A;  4WKR A;  1JLC B;  1QY7 A;  1HBM B;  2NYH A;  3T19 A;  4P73 A;  1P9Y A;  1XK8 A;  3OL8 A;  1QD1 A;  1VRU A;  2IJR A;  5IC4 B;  2YKO A;  4LSZ B;  5HSP A;  5G4D A;  3W62 A;  4YDX A;  1B4S A;  4I2P B;  3EUN A;  2MZ1 A;  1RAA B;  4L72 B;  4I2Q A;  2VF3 A;  1HNW J;  3HD2 A;  1IKW B;  4FYX B;  1FD8 A;  2V8D A;  3TUZ C;  1QJH A;  3DOL A;  1RXO B;  5IQ6 A;  1VQ6 S;  1TVR A;  3KMS A;  2ZHO A;  1NK8 A;  3UN3 A;  1PGZ A;  2HK2 A;  5IQQ A;  2MQQ A;  1N32 F;  4DR6 F;  4JI8 J;  4Z7C A;  2MSS A;  3BBC A;  2YNH B;  2DRB A;  3M8Z A;  4ZVU B;  5B7W A;  3T3F A;  1N33 J;  5J2N B;  3KNA A;  3P49 B;  1RHU B;  1X4A A;  3BKU A;  4OYO A;  4M5I A;  1D9D A;  1FXL A;  4ES3 A;  3VZH A;  1VRQ C;  1UVM A;  5IXU A;  1V3Z A;  2YNG B;  4GRS A;  2AGQ A;  2LU1 A;  5DRK A;  3K59 A;  3EXC X;  3A12 A;  4RW4 B;  1NHU A;  2BXJ A;  1U8W A;  1TL4 A;  1RT2 A;  1MRO A;  3JQK A;  4JV0 A;  5ETO A;  2XYG B;  5D0H A;  4DFP A;  3KJV A;  4ZPB A;  5HQL A;  3I87 A;  1U1M A;  4URQ U;  3I5B A;  2R7S A;  2OPS A;  3D9B A;  4CT8 A;  3AXK A;  2MJN A;  4ZK7 M;  2WW8 A;  1FFS B;  1TL7 A;  3G86 A;  1WKK A;  1KON A;  2W2Q P;  3MMA B;  2R4F A;  4ZIT A;  1YHQ S;  1VQY A;  4I6A A;  5D4N A;  1RT3 A;  2ZUA A;  1CPZ A;  2Q1L A;  3AD9 C;  3BYP A;  2JWN A;  3WC0 A;  1BHN A;  2DBB A;  3JSM B;  1T03 B;  4K8R A;  2WK4 A;  4O3R A;  3WIU A;  4LBI A;  1HD1 A;  3Q2S C;  5HVG A;  4NE9 C;  2LMI A;  3LPE A;  4F4A A;  5EWG A;  4DV3 F;  1Y9O A;  1BQN B;  5GMD A;  5AE1 A;  3D7S B;  1T9U A;  4WU2 A;  4HHU A;  4ZN3 A;  2VKZ G;  5IWA J;  4QYR A;  2ZM6 F;  2K06 A;  5CHC B;  2XZD B;  4F0M A;  4OI4 A;  2HQ3 A;  4PYA A;  2E44 A;  2QLB B;  5SZT A;  4KGV B;  4PPD A;  2CVI A;  3GSI A;  4DV0 F;  4X84 A;  2VG7 A;  4WK3 A;  3IO1 A;  2MY8 A;  1YX2 A;  2E5J A;  1U1L A;  2J6T A;  4CLS A;  4JYA J;  3UDV A;  4QU7 A;  1RTH A;  1HNV B;  1QVG R;  3H5Y A;  3NL0 A;  2UXC F;  3R6G B;  5I42 A;  4X4S A;  4EU0 A;  5KOX A;  3MPW A;  4K4W A;  2E5L J;  4P6Q A;  5ETR A;  1PIE A;  3PFO A;  4NRU A;  1EP4 B;  3R1L A;  4DG1 A;  4OHX A;  2ZOG A;  2GX8 A;  5DS7 A;  2V4R A;  3EWG A;  5J2M A;  2HGM A;  4ZVF A;  4DZ6 A;  4NRT A;  4F3O A;  3H0P A;  2C42 A;  4DL4 A;  2H1O E;  4KYZ A;  2VOO A;  1BD6 A;  1VQ8 S;  2ZH2 A;  4X4V A;  1RAD B;  3HVT B;  2GO9 A;  4WP8 A;  1S1W B;  1Q8K A;  2J7W A;  3WX4 A;  4RUA A;  2QLX A;  2VC0 A;  2A6M A;  2UUB F;  3VAJ A;  1RT7 B;  1RT1 B;  1NHV A;  1Q82 T;  2RDI A;  3TQE A;  2RJZ A;  4CIO A;  2BYC A;  2DVI A;  4TU9 A;  4LF5 F;  4B17 A;  2KKE A;  2ZE2 B;  4CO5 A;  1FVQ A;  3TAP A;  2C1E B;  2HHH J;  3G82 B;  3OTO F;  4ZPT R;  2OAU A;  4FBT A;  2LKZ A;  4DOZ A;  4WKY A;  4IRK A;  4IG3 A;  3M7V A;  1IWG A;  4IYQ A;  5KFT A;  2MLX A;  2AHO B;  3L09 A;  3EPG A;  2BJ3 A;  1WC6 A;  4DV5 F;  1ZAV A;  2DK2 A;  1QUV A;  4KKO A;  3RRK A;  4X4U A;  2HQG A;  4RL1 A;  2CQ4 A;  3QGG A;  4NXN J;  3DI6 B;  5HO4 A;  3BQ0 A;  2OSR A;  2VBW A;  5KG3 A;  2NXE A;  4F2S A;  2UUC J;  4A8O A;  4FF2 A;  4NLQ A;  2D9O A;  2N7C A;  1D8Y A;  4K4X A;  2KRB A;  1HHQ A;  2W7O A;  2I0X A;  4Q8E A;  3W9I A;  3NO7 A;  1HNZ F;  2CWX A;  3CJR A;  2D41 A;  4TXS A;  4DV6 J;  5D8H B;  1F5A A;  2CPG A;  3Q24 A;  3N6L A;  1ICE B;  1OMS A;  1U0H B;  2EFN A;  4MTP A;  3ZZT A;  4A8Q A;  4H54 A;  4MKA A;  2H5J B;  3R7S B;  5BYQ A;  1HPZ B;  3BO3 A;  4J9U E;  3GPA A;  4QW8 A;  3WHI A;  2CZ9 A;  2E1C A;  2IMO A;  1KQF B;  2B6A B;  3PYF A;  2E7X A;  1SBR A;  4XAK A;  4ZVT B;  5L39 A;  3U1L A;  3NBP B;  3UN5 A;  3VEA A;  5F8G A;  3M2R A;  4WP3 A;  3TAM A;  3KMQ A;  3ILI A;  3UW1 A;  4NAS A;  1ITP A;  2LDY A;  2VFS A;  3E8O A;  1S9G B;  1KTQ A;  2L48 A;  4RNH A;  4OJ1 A;  2QL5 B;  1FX4 A;  2OPP B;  2XMJ A;  2YNF B;  4CO0 A;  2UVU A;  2NQP A;  2XGP A;  3GG0 A;  4RW9 B;  2O01 C;  3SZ2 A;  3DNC A;  3DU6 A;  3ICL A;  4CO4 A;  1RAO A;  2CAX A;  1RDR A;  5AXL A;  3EVW A;  2BE2 B;  4DS4 A;  3N4W A;  2EG2 A;  1GNK A;  4ZIW A;  1OY6 A;  2KJW A;  2HFN A;  3TVY A;  3M6W A;  4JI4 F;  3UD5 A;  4DPX A;  3KLF B;  2DNH A;  4X64 F;  5D0R A;  4FXV A;  4UY8 5;  4D8J A;  4NYP A;  4ZJL A;  4RW8 B;  3V6D B;  4W90 B;  5C42 B;  5IT0 A;  2B5J B;  3IR7 B;  3GYG A;  5L1K A;  3M05 A;  1OSD A;  1IBK F;  1XER A;  2DEI A;  2RRB A;  2AJQ A;  4AND A;  4RW7 B;  4DFK A;  5D0G A;  2P6T A;  1X31 C;  3C8Y A;  3M2U B;  1WEY A;  1RYR A;  2KVI A;  4X62 J;  4NEZ A;  4KC5 A;  2M7S A;  2HIQ A;  1TK5 A;  2UUW A;  1NKE A;  2DGU A;  3CW2 C;  3SI8 A;  2P9E A;  4PWD B;  3PHT A;  1L3V A;  1A7G E;  2XI3 A;  3OD2 A;  1ZS6 A;  1NDL A;  2DR5 A;  2R7R A;  3R2C J;  3UD3 P;  1R8A A;  2YVS A;  1KEK A;  3PYE A;  5HQM A;  3KDO A;  3TWZ A;  3DRP B;  3SIP B;  4G3I A;  3MAA A;  1VQ9 S;  4RNN A;  2CJB A;  4LF9 J;  1RCO B;  3FBE A;  2MY7 A;  4FVM A;  1AYE A;  4TU8 A;  4ME7 E;  3UN2 A;  4M5G A;  4WE1 B;  4YUD A;  5IM0 A;  3AQO A;  1H7W A;  1QDU B;  4ECT A;  2B4U A;  1RJJ A;  2IC3 B;  2DGT A;  3ENA A;  1C1B B;  1FFW B;  2E1R A;  2AMC B;  1RKI A;  2RU3 A;  4FNH A;  4AL5 A;  4OZ0 A;  2AX1 A;  2ZDO A;  4CT9 A;  5IT4 A;  4C2M A;  3B78 A;  3LGH A;  2W4C A;  2UUA F;  1ZYQ A;  2DHX A;  4YHH F;  4EO6 A;  2P9G A;  1RHQ B;  5CYQ A;  1UVJ A;  4TU7 A;  1WC0 A;  2MQM A;  4EWT A;  5F3Z A;  2DXD A;  2XC9 A;  3W66 A;  4NXM J;  2XB2 D;  1JLB B;  4CLL A;  2W7P A;  3G2X A;  2XO6 A;  2W2N P;  1CJK A;  2QA1 A;  4ECZ A;  2C28 A;  1IKX A;  3VAM A;  4FDF A;  3GV5 B;  2HS4 A;  3R8Y A;  1F9E B;  2ROE A;  2HFS A;  3CC2 S;  2XG8 A;  4RW6 A;  2KFY A;  2VG6 B;  2CQD A;  1DFD A;  3QGH A;  4F3Q A;  5T41 A;  5C24 A;  1KTV A;  4OYB A;  5D15 A;  4QYZ J;  1SC4 B;  2H48 B;  2L9N A;  2AKW B;  2IBO A;  1CUL A;  1N32 J;  4DR6 J;  1S1X B;  2FLO A;  3MUT P;  3BS9 A;  4UW2 A;  2R7Q A;  4IDK B;  4M5N A;  4C0B A;  1R7I A;  4NLY A;  5DET A;  3K5O A;  3PEH A;  2AD9 A;  3FFI B;  3FNN A;  2LDI A;  4PWU A;  3IBC B;  4PRF A;  4LFC F;  1T95 A;  1RAB B;  4USM A;  4CYU A;  3Q8U A;  5F41 A;  1VQO S;  2F8M A;  1XMQ F;  2H9Z A;  5DJB A;  3CJK A;  1S57 A;  1URR A;  4Y2C A;  1KLM A;  3F56 A;  2WVE A;  2BQR A;  1NAQ A;  2I8E A;  5E7O B;  1CS4 B;  3NCP A;  3PO5 A;  1RBA A;  3C14 B;  1HI1 A;  4ILL A;  4FBU A;  3R9L A;  1IVZ A;  5C25 B;  3KG1 A;  3C6T A;  3MOJ B;  4ZLN A;  1W2I A;  2GMH A;  1REV B;  2CNO B;  2HBR B;  2EFP A;  1IWA A;  3HFV A;  2UV8 A;  2HSE B;  4CQ1 A;  2OI2 A;  2DEJ A;  4EFA C;  3K89 A;  4LSL B;  1LWE A;  1S7I A;  2G0J A;  1NB2 A;  3GYX B;  2XS7 A;  3MZI A;  2AF6 A;  3E01 A;  3MMB A;  2NCK L;  4YY3 F;  4FF1 A;  4LF4 F;  1Q8I A;  2BKP A;  1F2G A;  3EYZ A;  3KK3 B;  1J27 A;  2PA8 D;  4DX6 A;  4BDP A;  2VAS A;  5FJ4 A;  1ZM9 A;  5KFU A;  1YRX A;  5KFH A;  5DDR C;  2GVZ A;  1S12 A;  3GIM A;  5CQG A;  4M5J A;  3OFF A;  2EW9 A;  4OYZ A;  2I1R A;  4QOT A;  2JLG A;  4IOC Q;  1N4L A;  4DU8 A;  2J9C A;  1KN6 A;  2HHQ A;  1BMQ B;  4H4K A;  3M8R A;  2ZM6 J;  2FJA B;  5DDP C;  3LAM A;  2CJ9 A;  4OFZ A;  2WTF A;  3UDE A;  2AEJ A;  4WII A;  2H3E B;  5ITH A;  4DV0 J;  2XO7 A;  1D1U A;  4P10 A;  4WJB A;  1F9F A;  1ACM B;  3KHR A;  2GJ2 A;  2UXC J;  1DTQ B;  3FSX A;  1DBD A;  5A8K B;  5AXK A;  1WEL A;  2DR8 A;  4ED0 A;  2K2P A;  3DHW C;  2DIT A;  3HT0 A;  1T11 A;  1RQ0 A;  1EHW A;  2H1Y A;  4EZ9 A;  2OPQ A;  1U0S A;  3MCM A;  2KFZ A;  2C3O A;  4X4O A;  5HLF B;  1RAC B;  3RW6 A;  1NRK A;  2Z56 B;  4CLW A;  3OLB A;  4V1A k;  4WK1 A;  2UVV A;  2UUB J;  3MF5 A;  3GU0 A;  1NCL A;  3ISN C;  5F3T A;  4CLK A;  3U02 A;  1LWX A;  1FER A;  3M9M B;  3KLE B;  3ENQ A;  4YEA A;  4LF5 J;  4LRD A;  2IA0 A;  3DXB A;  3GIR A;  3AHP A;  3JXO A;  3QPI A;  1C1C B;  2OH2 A;  1KBR A;  3OTO J;  1SL1 A;  3DLB A;  1FK9 B;  3HHL C;  4KJI A;  1PCA A;  2JEI A;  2VKR A;  1U1R A;  2Z30 B;  3M6V A;  2HMI B;  2A6O A;  2CJQ A;  1FFG B;  4DV5 J;  5FLX U;  3DKD A;  5I3Q A;  3LJP A;  2QA4 G;  2B4O A;  3M6X A;  2GHP A;  3A4T A;  1WHY A;  2WZ1 A;  2IY5 B;  4LFA F;  5JMN A;  1J5O B;  1CQM A;  3IBF B;  3W5Y A;  4JB8 B;  2OSQ A;  3H40 A;  4A46 A;  2JDJ A;  1LW2 B;  4XK8 C;  1WTF A;  3TI0 A;  4F4K A;  2GFF A;  3NCQ A;  3NWR A;  4LJM A;  4OLP A;  1MMN A;  1CJT A;  2JFD A;  3B8H A;  1KD1 T;  2AV5 A;  4EI2 A;  3ZZP A;  1UZH A;  1K9M T;  3FEX B;  1HNZ J;  3MD1 A;  1OHN A;  3I0S B;  1M1K T;  1DLO B;  5DG7 A;  3LP0 A;  3K5N A;  4NWB A;  3J81 Y;  2J0W A;  1TV6 A;  1DRZ A;  6FD1 A;  3QIP B;  4OI0 A;  2WSC C;  5GVQ A;  3MR7 A;  1WC1 A;  3PKY A;  4Q5V A;  4M5M A;  3NNC A;  3TJA A;  3EXY A;  3JYT A;  1VLO A;  3US5 A;  3DC2 A;  1OIA A;  3ETO A;  2XYP B;  3M2V B;  2CRL A;  1EQ0 A;  1F5C A;  1I94 J;  1SKW A;  1S48 A;  4KGZ B;  4R0J A;  2V0N A;  1C4A A;  4K4Y A;  4X2B A;  5F0W A;  2HLU A;  3TRG A;  3CCE S;  1ZAW A;  3M8P A;  1AXQ A;  1O5J A;  3CO9 A;  3GV7 B;  1RWM B;  2WOM A;  5J2P B;  3TA0 A;  2GCF A;  2RAQ A;  1HQE B;  3M30 B;  1YWX A;  4Y65 A;  2DGX A;  3PCO B;  1Q1K A;  4EYH B;  4LVO P;  1RWV B;  2QLJ B;  5KFG A;  2DRD A;  4QWD A;  4ZPA A;  2IYG A;  4O4G A;  4OX8 A;  4ZA1 A;  4CTA B;  1JJ2 R;  5KG1 A;  1HBO B;  1RWX B;  5HAT A;  1WKL A;  4JI4 J;  3T9N A;  5JXS A;  2VIC A;  1VK3 A;  2HVE A;  3CCZ A;  1R0A B;  4X64 J;  5A6W A;  5KG7 A;  1PYT A;  3RB3 A;  4M5H A;  4IFV B;  1JLF B;  1JXE A;  2BQU A;  4A8K A;  4NCB A;  4Q43 A;  3RAQ A;  2ZNZ A;  1FVS A;  1Y3K A;  2BRL A;  1Q8B A;  3RBE A;  5K8P A;  4QWC A;  2BAC A;  3NEK A;  4J9L A;  4KB7 A;  2YQ3 A;  4I6W A;  3VGV A;  1AUS L;  3M8Y A;  1KWM A;  1H73 A;  2ZKU A;  2RKI B;  3A3P B;  4K4S A;  1HBU A;  2LA4 A;  2B9W A;  4OZL A;  1K73 T;  1S1U A;  2R7T A;  2Y0S D;  2XHW A;  3QAE A;  4NZ0 A;  5HJX A;  4IG0 B;  3UPF A;  4IR1 A;  2PEH A;  4AUK A;  3IMQ J;  3WDO A;  5HAN A;  3AOD A;  2QYG A;  2ZZM A;  2HG4 A;  4NLT A;  4MFB B;  4DSK A;  4J9N A;  4R0E A;  4C0H A;  5KAK A;  3VAI A;  3FBB A;  1RSC A;  3QT8 A;  2NUH A;  2DH9 A;  3H5U A;  4F50 A;  3OV7 A;  1Y5I B;  2BAN B;  4ED4 A;  2HGN A;  1VQ5 S;  3HO1 A;  1UVN A;  1N5Y A;  3VEB A;  4OI2 A;  2H5E A;  3I56 S;  2P9C A;  3GFZ A;  1T9Y A;  1KDN A;  3TVK A;  2L9D A;  3C66 A;  1R6Y A;  2R9L A;  2QT7 A;  3A8K A;  4A8M P;  3PW7 A;  2UUA J;  3M1V A;  2HWI A;  4N8N A;  4YHH J;  2Z58 B;  2ZVS A;  3DN9 A;  4PUO B;  1NDC A;  1TL3 A;  2DCU B;  3MM8 B;  1JJ4 A;  1KNZ A;  1JB0 C;  4DR7 F;  2ZBC A;  2GQ2 A;  2FJV A;  1RAG B;  2JEF A;  2MZS A;  4DV1 F;  2FJW A;  3E51 A;  4PWW A;  1ARO P;  2EWH A;  2D69 A;  2DNZ A;  4C0O C;  1CJV B;  4TYB A;  3KLG A;  4JBC A;  2FZC B;  2K6L A;  4YN3 B;  5AJ3 F;  3RW7 A;  3CT9 A;  3DGP A;  1FNM A;  1G3O A;  2V50 A;  4KFB B;  3Q8Y A;  2BUN A;  4Q8F A;  3I0R A;  3G6E S;  3WBZ A;  3Q22 A;  3V5R A;  2QFI A;  2ASJ A;  2NR0 A;  5FDL A;  2V9K A;  4IUF A;  2HVD A;  2HIY A;  2WSF C;  3OL6 A;  2VZ9 A;  1E6V A;  4H4M B;  3H87 C;  1QSL A;  2YNI B;  2W9B A;  2AYM A;  3I55 S;  3JSR A;  1FDD A;  1TL1 B;  4KTQ A;  2VC1 A;  1Q16 A;  3CJ4 A;  2PII A;  1WG5 A;  4LFC J;  5AT1 B;  2G2Z A;  1R8C A;  1RA6 A;  1XMQ J;  5KT7 A;  3ZZY A;  5B0A A;  4EYI B;  3DYA A;  4K5S A;  2IM2 A;  3N28 A;  1UPM B;  1BLU A;  1CLF A;  5J1E B;  3DLK A;  1NJZ A;  1JQG A;  3G96 A;  3GYN A;  3DDI A;  2VG5 B;  4TY9 A;  2WVF A;  3FEY B;  3SSR A;  1TL5 A;  3UD4 P;  3D6H B;  2IFX A;  2X3D A;  3HD1 A;  3T6B A;  1VJQ A;  4YB5 A;  1H0H B;  5G0R B;  2DKO B;  4RWX A;  2N4D A;  3RAM A;  1FKO B;  3NNA A;  3HM9 A;  4CZC A;  1HWI A;  1Y7P A;  1GMW D;  2QA2 A;  4LSN A;  1Q7Y T;  1YJU A;  3TVZ A;  5KFJ A;  4YY3 J;  5A0Y A;  4OJG A;  4LF4 J;  3J80 Y;  3P4U B;  5AE3 A;  1AZS B;  3VV2 B;  1KHV A;  4J9P A;  2MQL A;  6FDR A;  1DQA A;  2B8Q A;  1DQ9 A;  2ZH4 A;  1OO0 B;  4CLY A;  2CPY A;  3M8S A;  2WB1 D;  4JI5 F;  2MLZ A;  2QEX S;  4U67 Q;  3N01 A;  3AXM A;  2I5J B;  1YBA A;  1GH8 A;  3KK2 B;  3B6B A;  5DGB A;  2FUG 9;  1VJW A;  4IQM A;  2Y8Y A;  1X9W A;  3JTP A;  1U9P A;  4P74 A;  2W2P P;  3QWU A;  1Y3J A;  5AE2 A;  1NK4 A;  3IWX A;  1SJF A;  1YBT A;  2MKK A;  3EZU A;  1Q5V A;  3I6P A;  2R3V A;  3C6U A;  2MGZ A;  3MM5 A;  1IKY B;  3PR4 A;  4B9U A;  1YGY A;  5L1J A;  4BBY A;  3R3T A;  3C15 A;  3DRS A;  4OYX A;  3OSP A;  2G9O A;  3T1Y F;  2PE8 A;  3PTW A;  3OTB A;  2RRN A;  1URN A;  2GZO A;  1JX4 A;  2Y1I A;  5B09 A;  4FKX A;  4YB6 A;  1YZ6 A;  2VD3 A;  3NGR A;  4U7U K;  1HQ2 A;  4MKY A;  1FXR A;  3MEE B;  4EK2 A;  2BKO A;  3P3D A;  4K2X A;  3ZXW A;  2BJ8 A;  2AJ4 A;  2HRT A;  2DNK A;  1X9M A;  5KFW A;  1EQM A;  3ADA C;  4JI2 F;  1JJC B;  3Q8S B;  1PAU B;  5CD4 H;  3SCJ E;  3ZC4 A;  2NZC A;  2XEX A;  4QZV B;  3MPY A;  2OEL A;  3CC7 S;  4FS2 A;  3CCS S;  2VIH A;  3O1L A;  3IWN C;  4HI2 A;  3PR5 B;  1YIJ S;  5JVH Q;  5GAD I; 
#chains in the Genus database with same CATH homology
 2WVE A;  2WVF A;  1MYK A;  3FMT A;  1U9P A;  3OD2 A;  3FT7 A;  1MYL A;  2PC6 A;  3VW4 A;  2F1F A;  3GXQ A;  2K6L A;  2JXG A;  2BJ1 A;  1IRQ A;  2BJ9 A;  2CAX A;  1Q5V A;  2WVB A;  2JXH A;  2K29 A;  1PAR A;  1ARR A;  4ME7 E;  1P94 A;  2CPG A;  3VEB A;  2CAJ A;  1BDV A;  2K1O A;  3H87 C;  1B01 A;  1BDT A;  2CAD A;  3QOQ A;  2BSQ E;  3BKF A;  4D8J A;  1MNT A;  2FGC A;  1NLA A;  2HZV A;  2AY0 A;  2WVC A;  2GPE A;  2HZA A;  2WVD A;  1ARQ A;  2BJ8 A;  2K9I A;  2Y3Y A;  2BJ3 A;  4FXE A;  2CA9 A;  2BNW A;  3LGH A;  1X93 A;  3VEA A;  2NZC A;  2K5J A;  3BKT A;  3QSI A;  2BA3 A;  1Q5Y A;  2JXI A;  4HV0 A;  2BJ7 A;  2KEL A;  1QTG A;  2RBF A;  1EA4 A;  1BAZ A;  3BKU A;  2BNZ A;  2H1O E;  3PHT A;  1B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...