2WVFA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDGGQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 35
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvfA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvfA02
2JXIA 2CPGA 1P94A 3OD2A 2RBFA 1BDTA 2GPEA 2JXHA 3QOQA 2BJ1A 1ARRA 3PHTA 2WVEA 2K5JA 2KELA 2K9IA 1BAZA 1EA4A 2BNWA 2H1OE 2JXGA 3FMTA 1NLAA 2BJ9A 1QTGA 2K6LA 1B28A 1Q5YA 1MNTA 2CADA 2BSQE 1X93A 1BDVA 2CA9A 3LGHA 1IRQA 4FXEA 1U9PA 2K29A 4HV0A 3VEAA 1ARQA 3QSIA 2FGCA 3BKFA 2WVDA 1Q5VA 2BNZA 1MYKA 4D8JA 2PC6A 2Y3YA 4ME7E 2WVCA 1PARA 2BJ7A 2BJ8A 2BA3A 2K1OA 2CAJA 3BKTA 3BKUA 2WVFA 2WVBA 3VEBA 2CAXA 3VW4A 3FT7A 2F1FA 2HZAA 2AY0A 1MYLA 2NZCA 1B01A 2HZVA 3H87C 3GXQA 2BJ3A
chains in the Genus database with same CATH superfamily
3TAMB 2IJNA 3CWJA 1YI2S 3L7UA 2DR7A 1WI8A 2VH7A 3O44A 4DR1F 5ETPA 3AD8C 2ZNZA 5CXTA 1BAZA 3NOGA 3A8IA 3QATA 2VQFF 1QSLA 2PI5A 3DLHA 4OLPA 4H4MB 2HQFA 2NLWA 1H7WA 4ZP8A 1M0SA 1WUUA 1WKLA 4MK8A 3UO0A 7AT1B 3HHEA 1FHTA 3FKBA 1FEEA 1VK3A 3EPGA 2KI2A 1RAJA 2FZGB 1DTTB 2OH2A 4DR4J 4PG7A 1FKAF 1JLCA 4WF9Q 1XC9A 2DRBA 3RGIA 2GVZA 3MEGB 4UQTA 3ZO7A 4C11A 1SBRA 5L39A 2NUHA 4WCEQ 3IAS9 1FRLA 1TAQA 3K17A 1YJUA 3NOCA 1OPIA 2RS8A 3CULA 1YJVA 2FVRA 4R5PB 5HL7Q 5C2GA 2XGPA 1JIHA 3GIKA 3H8YA 1FX2A 2C2EA 4N41A 2V6AA 2M7SA 5D0RA 1HYSA 2O01C 4C6AA 3LP1B 1MNEA 1EZZB 4N5SA 3KK2A 2HHXA 3AOBA 3FSIA 2PT0A 1WTBA 2OKQA 5LSOA 2J76E 5D3GB 2Y8YA 1UW4A 2CQBA 3NO7A 1YVFA 3DGVA 3DI6A 4G1QA 2R2TA 5F8GA 2H1YA 1RWKB 2CZ4A 2WVCA 2GHWA 3TW0A 4I6AA 3W2WB 4QW9A 1S59A 3UCZP 1RSCA 2EFPA 3CPWR 1APSA 4ZVPB 2CXEA 2D74B 2IHR1 2WW8A 5C25B 2F1FA 2ZDOA 3JSYA 1HNVA 5KTQA 4DS5A 1GT8A 3SV3A 5JXSA 2HQCA 5KFRA 1BQMA 2C2OB 2VC0A 4QPTA 4DCOB 3GP9A 4O3PA 1W25A 4KPCA 1O5JA 4BCAA 1UMJA 3Q89A 4Q0BA 2K1RA 4Y65A 4EZ6A 2CPHA 4ELVA 2GGPB 1NKCA 1ICEB 2E9ZA 1M5HA 2PE8A 1I1GA 4IG0A 4NYZA 2RDJA 4KGXB 1IUJA 3Q22A 3G2XA 1F1BB 2CYYA 4IR9A 1QAIA 1B3TA 3HFZB 3EGNA 2AIRB 2MJNA 4CYUB 3TUIC 4NI2A 1BQXA 2E5HA 3N4WA 4WIIA 1KFSA 4ZVTB 3PNIA 2MQ8A 1WG1A 2YNHB 1SJFA 5KFHA 1PJ7A 2E5IA 4DSJA 2B4UA 4FXDA 4HI1A 3QT8A 4ZP7A 1FDBA 1DY3A 2CQDA 2JX2A 2FJBB 1TK5A 2EK6A 2QL5B 1AB8A 3IC1A 1PILA 1S7IA 1CJVA 3FQLA 3ET6A 3ETMA 3IS9B 4RBVA 3VF0B 2C2RA 1SL0A 1RAOA 5K9FA 4CDIA 4JV5J 3MFIA 4IFYB 2QFJA 1E6VB 1E6YA 1IR1A 1VQ4S 2KHDA 4O4RA 2C1EB 2MZJA 4LJMA 3SCJE 3ELHA 1AUDA 5CZXA 3HXMA 4FF3A 1YWXA 1F2GA 3CE8A 3CJQA 2E66A 3K5PA 3H5SA 5H9EJ 2DHSA 1SJ4P 1U02A 1ZYQA 1TL7B 4JI8J 2HK2A 2PMWA 2HNZA 2RILA 4DUYF 2VPWB 3IRWP 3PFEA 4Y3CA 1X31C 3GPAA 3T5LA 1NMEB 2QA1A 2Z0GA 3CCSS 3T1HF 4X4NA 2KDOA 1LWEA 2V8GA 3AJ2A 4DL5A 3M2RB 3C14B 4LF1A 2KT2A 1WHWA 5KG4A 1VRTA 3JTNA 1IBMF 2CVEA 2YKOA 4RW4B 3ZZZA 1LW2A 3DM2B 2KO1A 2DIVA 3ADAC 2BXJA 3H7HB 2N3LA 5FDLA 5BJRA 2E7XA 4ECXA 1WD6A 1SIWA 4EMDA 3E3XA 1RTZA 5KFFA 3I82A 2UVVA 4OX8A 3MPDA 4C3LA 2CDQA 4IH5A 2VICA 3QRQA 1RWVB 3HVTA 3DOMB 3VEAA 1NB2A 5KT5A 3VQTA 1FKPB 1FE4A 1RHRB 4CM2A 5HQLA 5HJXA 3Q83A 3VGVA 2QLXA 4FPRA 2VQEJ 2MKYA 5FDLB 1LW2B 3WIVA 2CQCA 4CT9A 4DSFA 2WOMB 2RQCA 3SYZA 2E9TA 3DGPB 2QLWA 1F9HA 3N28A 5E7OB 3VGUA 3C14A 3IR5B 1QSYA 2B9WA 2C2ZB 3OLAA 2MJUA 4OYIA 5D78A 1S1XB 2FC9A 1PJ6A 1ZA2B 3MXHP 1CQMA 4M5DB 4DFKA 2DKOB 4MH8A 3WHIA 3QPIA 2HNZB 2VPYB 2AU0A 2MMYA 2Q6CA 4DS4A 1V3RA 3TUZC 1NJWA 3I0RA 1PYSB 2ZC4A 1BLUA 4TU8A 4ERDA 1Q0NA 1ZZFA 4NLVA 3CCWA 4Q44A 2V63A 3R7SB 1FKOB 1N0UA 3P8BB 5ADZA 3SCLE 3M2VB 3K58A 3LAMA 3R5AA 2ASDA 4LSZB 2ASJA 2BABA 3GYNA 3HKZD 1A6LA 2LCWA 1RKIA 3ISND 2MSSA 4IFYA 3TWZA 4Z7CA 2VJUA 1W2BR 2H51B 3MHYA 4N56A 4X65F 2R7WA 4ECWA 1IBMJ 4E0DA 4OJ1A 1IVZA 2C3MA 2QL7B 3HX9A 3KKFA 1S1UA 2FHJA 2AN7A 3N6MA 4ZJOA 3R2DJ 4QWAA 4YOEA 2LDIA 4LF4F 1HFEL 1VQ6S 2EKNA 2F40A 2NYHA 1P1TA 2YNHA 1FRMA 1GNKA 3I31A 3ISNC 3TYTA 2QTWA 5BXIA 1GH8A 3DHXA 4NI2B 4MJKA 3KTQA 2BEFA 1YRXA 3MM5B 1LEOA 5F8MA 2FVPA 4CO3A 5DDOC 3HVRA 2X1BA 1RTHA 5KFQA 2OSQA 1GXTA 3M7VA 1OYEA 1GMWD 1RT5A 2QX0A 2FVQA 1BMQB 3K89A 2KU7A 3LO3A 1LV5A 4LQ3A 2BVZA 4NRTA 2WCXA 1HR0J 4ZN1A 4RL1A 4RNNA 1UEVA 1A9NB 1R8CA 3VHQA 3B54A 3MM5A 3BGRA 3UD3P 4NCBA 5HP1A 2IM0A 4X4RA 2IPOB 1HWIA 3G86A 2LQ8A 4QIGA 2BKNA 2AYBA 1AFIA 1H72C 4F0MA 2XHCA 3ILJA 3MAAB 4AXIA 1C1BA 4J90A 4HHUA 5M2UA 1DTQB 1Q79A 3CJ4A 2H54B 4OHVA 2VV5A 3D6HB 3K5OA 1RLDA 2K7JA 2NSCA 2GAGC 1EB0A 2RSQA 3FZ2A 5ETMA 3W2WA 2XBPA 2LQ9A 3NGTA 3DI6B 3M2VA 3NGKA 2HQDA 3MGJA 3PIOQ 2R8KA 1T9WA 1Y4ZB 1QLNA 1FWPA 2OMLA 3UD4P 4LRVA 3LQVA 2Y1IA 1IXKA 5GAGI 1FXLA 3MEDB 3CXCR 3LGHA 4Q43A 3CCRS 1IWAA 2VA2A 3DC2A 4TLRA 4M95A 1RT2A 4ZPDA 1B7FA 3WC2A 1GAOA 2LEPA 3SSSA 4A46A 3J7YU 2BRKA 3UN2A 1IBLF 2X1FA 4M5DA 1W2IA 2BUNA 3OXGA 4UOCA 1TELA 4R5PA 4DV6J 2EC0A 3HHDA 5AJ3J 1YZ7A 3D1QA 3FEZA 2MKKA 2KXNB 3HPOA 3R2CJ 1RWNB 2CIMA 5KG0A 1FRIA 3D7SB 3PYGA 4PCQA 1SB6A 3RR7A 3HLUA 4YDDB 9RUBA 4DCPB 4Q2MA 1RB0A 2X3DA 2XZWA 3A3NB 1DTTA 2EFQA 4C0OC 3PYFA 4LUBA 4ZMMA 2PIIA 1ARRA 3DOMA 1H73A 1U7LA 5LXRA 1FO1A 2HAFA 3FSYA 2ZH6A 4DR3J 2VPZB 3AXKA 4C8YA 1RAEB 2CQPA 1R8AA 5HMZA 2V34A 2D3ZA 3M8QB 2RU3A 1SIWB 1LFWA 1HARA 1VGYA 2C3OA 3FBCA 2QLFB 4G3IA 2JOQA 3ITHA 4RLEA 3TUPA 3LPYA 1VR6A 3IA0A 4X4SA 3T5KA 1WKKA 2KVIA 2B56A 4CLUA 1WF1A 2UXCF 2L08A 4X4QA 2VBWA 3KLHB 1K0TA 2EG2A 4JV0A 2EI5A 3N6LA 4DL6A 5KFOA 4KPYA 1UFKA 2DRDA 1XR6A 3CD5A 3DLJA 4J7CA 3M8YA 4MIWA 2EFVA 1FERA 2V94A 4DX7A 4MKBA 2B6AA 1DJ0A 1S7HA 5E3AA 5DQHA 4ZP6A 3PRVA 1NEEA 1ZTTA 1NHUA 3EJMA 4KV8A 3DMJB 4QW8A 2XY6A 5DQGA 4EU0A 3EE3A 4FYVB 4GKKF 1FF2A 2BJ9A 3AAWB 4CWBA 1WSRA 4OZJA 4MYUA 5KG7A 3P4UB 4PRFA 4LFCJ 5T7LA 5CQGA 1RYRA 2QMWA 4H4KA 2VG5B 2C2NA 2E5GA 1E6YB 1IKVA 2MY8A 1HWLA 2YX4A 3WZ0A 2IJRA 4NLGA 3VAGA 1RYSA 3ET6B 3IS9A 1CJVB 2VD3A 1TL4A 1QJHA 1I5OB 3DHWC 4U8VA 5J2NB 4JI3J 2RMLA 5J2MB 3SI8A 2KVQE 2MXYA 1VQOS 2DGTA 2Z8QA 1Q7YT 4YHHJ 3CJSA 3SCIE 4OYPA 3IM8A 1VQNS 4NZ6A 1UVIA 2CRLA 2FZKB 2VHGA 1CULA 2ABYA 3T1YF 1T8EA 3OL7A 3MM8A 3GJRB 3I87A 4NLUA 4ETZA 1NDPA 1FWLA 1NDKA 2DNZA 4K4WA 3DYAA 2ZHBA 1NSKL 4LF6J 4LF4J 1CSJA 1N88A 2CJYB 2XYHB 3TEHB 3KHRA 1BY9A 1PC5A 3B82A 1ARQA 3UVJA 4DQQA 4FPIA 4MK9A 4LF5J 2K1RB 1RA7A 2ZOGA 4H4OA 4QBUA 4FXWA 4ZIVA 2XY7A 2YNGB 4K4UA 4OLOA 1Y10A 4TYAA 1B64A 1HWKA 4H54A 1F3VA 2Z2ZA 2HHVA 2OGUA 2DPIA 3DCAA 3ZTPA 3L9ZA 5ETTA 1M90T 2GO8A 2HZAA 1MLAA 1EJ7L 3VZHA 4B3SJ 4OHXA 8ATCB 1BD6A 3EMTA 4O3NA 5IV4A 4DR4F 2MLYA 2DRAA 2E1MC 1TL1A 3MM6B 1IR2A 3FBFA 3DRXA 2BANA 5ITHA 1JNZB 1PAUB 2ADBA 1XBWA 3QRRA 1RWWB 1NPPA 3VZIA 4X2BA 3PDNA 2K6LA 1UPPA 5D4PA 4IRCA 5IM0A 1S49A 2JLEA 3BR9A 5L1KA 4NXMF 1TUGB 2N3OA 2A2BA 3HCXA 3C15A 2ZE2A 2ZKUA 2ZH3A 4B3OB 3IGNA 1H74A 1N54B 2I38A 1RTIB 1PYOB 3OHBA 4IFVA 1RTDA 2DPJA 4M1KA 3GQCA 4P7TA 4C11B 3C8YA 2D69A 3ILLA 5ETRA 3A3OB 4FS1A 2XMKA 4ES3A 4YY3J 1RUSA 2PSZA 4OJHA 5DG8A 3DOLB 2V9KA 4ECQA 4K7QA 3BYPA 4ZVRB 5K14A 3VQSA 4CLPA 1URRA 4LVNP 2YWKA 5KFTA 4NX9A 4ES2A 4EBCA 1U09A 2XMVA 3DDNA 4DF8A 2PI4A 3GWCA 1L5UA 3TVKA 5KOXA 2DGXA 2DH7A 1DAXA 2NYIA 3AJ1A 3ZZUA 4CO2A 4NLXA 3C6UB 4DU8A 2XLJA 1KTQA 1MMNA 1XR7A 4PAAA 3KLFA 4WJBA 1FXDA 1WI6A 1M1HA 4RO0A 1HW9A 1HNXJ 3PEHA 4HH1A 4WXWA 5J1NA 3TAMA 1Q82T 3BKTA 4JBCA 3OR1B 2A6MA 2DH9A 2QSWA 3THPA 4LRFA 4MTPA 3A8EA 3MM9B 1AYEA 1GTHA 4KHPF 1FD8A 4U67Q 3GIRA 2HBZB 3V5RA 1YHQS 2L9DA 4OMFG 2WTFA 2IDEA 3VVUA 2IA6A 4YB7A 2PMZD 2W7OA 1D9FA 3ZNJ1 4K0KJ 2VG6B 1EQMA 3SEOA 3T41A 3K59A 5HN0A 4Y2AA 2G2YA 2P9CA 1Q5YA 2D1CA 2HURA 4P2FA 4YP3A 3Q8SB 1G7CB 2YKMA 4PABA 2B5JB 2Y1JA 2ALZA 2U1AA 2ALYB 2WONA 4ZVFA 4PG6A 1VISA 4QIEA 5H9FJ 1VQMS 1ZPWX 2J8AA 3I5AA 3KXDA 3M1VA 1P27B 3CJTA 1NSQA 2YKMB 3SXLA 4ECVA 2YX1A 4TVAB 2DVIA 3N5FA 3HHLD 3PR5B 5LOQA 1OO0B 2IDLA 4J9VA 3RB4A 1BUXA 2VG6A 2A1BA 5E3RA 3OSPA 2FLPA 2B0GA 1ZETA 3KLEA 3S6EA 3UDLA 4JI2F 2CPXA 5ETVA 3ZZTA 3DRSB 3GONA 2W4CA 4WFAQ 3K5LA 4DQIA 2JWNA 1HQEB 3UDCA 4RBTA 4DBQA 2QLJB 4ETXA 5KFBA 2R8HA 4U8YA 4DN9A 1EHWA 2W7AA 3SSQA 1S48A 5HLFA 3DLLQ 2WBMA 3PRDA 4NCAA 1D3WA 1V6HA 1N6QB 1S79A 4OYAA 3W2VA 1SC4B 4AFFA 1S0MA 4DSEA 5CAAA 1QUPA 4ILLA 4JUZA 3C66A 3DLBA 2GIRA 3EUNA 4ILRA 1HNIA 2BOAA 2JZ5A 3GJTB 1DRZA 1T9UA 2DNHA 3IFEA 3M9OB 4A8WA 3DOLA 3X3UA 3UW1A 1HQUB 1U2CA 2M2BA 2BBEA 2MQOA 1L3VA 3EGVA 2H48B 3H5YA 1UAWA 3PRBA 3RZAA 3D1OA 1FEHA 5FIIA 1A7GE 2CG8A 5DM6Q 1OYDA 2RE1A 3BF4A 3BKUA 3CJ2A 4M8LA 1RTDB 2ZHOA 1XWLA 2MKHA 1VBKA 2JLFA 4QIVA 3IR7A 2L9NA 3BN7A 3G82A 4P7VA 1X4AA 2EWHA 3C15B 5E3PA 1D9DA 4PEOA 4LF7J 1NDLA 2BA3A 2KG0A 3NL0A 2Q43A 1T94A 5FD1A 5DDQC 5IM0B 1RGVA 1WOSA 3SDEA 5T14A 2NSBA 1XNRF 2QV6A 1OSCA 1DARA 3AD7C 4LRCA 5E2QA 4ANCA 5A8RB 4KQZA 4OI4A 3MM6A 2LP4A 5B08A 4DV7F 3KLIA 3NNAA 6FDRA 3BPSP 1GK8A 2I2YA 2RU9A 3Q24A 4LF8F 2XS2A 2KZZA 2B9YA 2VFVA 3DLGA 1H2TZ 3VAMA 3AA9A 2OPRB 3MDFA 2O1PA 5E3QA 4WFNQ 2J0XA 4CLYA 1QVGR 1U8WA 2HNDB 4FN5A 4B9NA 2HHWA 2F5GA 1PG5B 2XCPA 2OEMA 1IJFB 2ZBQA 1F0XA 2WB4A 4HVZA 4ZCKA 1GMWA 4MAKA 1KN6A 1RAGB 3UI3A 1I51B 2XO6A 2YWHA 2G0CA 2O5DA 4GO7X 4NZ7A 3QIPB 3BREA 2ADLA 2YWGA 4H4OB 2APOA 5KFGA 2VBXA 3KK1B 5F8NA 5GMEA 3HM9A 2WB1D 1SKUB 2YKNB 5JJBA 3K57A 3PY8A 4ZITA 3V4IB 2H5JB 1QTNB 3CVKA 2GAHC 2FHMA 3PKMA 1VQ9S 3MM8B 3N79A 3P3DA 4C0BA 5C42B 2ZHAA 1JMTA 1LKZA 4ICLB 3KHHA 5I42B 2HFNA 2K06A 4KHMA 2IYIA 1JJHA 3CCZA 1UEKA 4ZIWA 1K1QA 2J7WA 3ENVA 5EGYA 2YVSA 4DQPA 2A2DA 5J2MA 5J2NA 2MQLA 2QJ3A 4DHVA 2FHKA 3CEDA 3OTCA 3JQJA 1YBAA 4NYOA 3HF5A 2HVHA 1YX2A 3HFVA 5G0RA 3J7Z5 2GIQA 1XJWB 2BKPA 1FK9A 4EYIB 5IT4A 1U0HB 4TYBA 4C3MA 3D6FB 5RUBA 2W9CB 3FCHA 3K5MA 1KP6A 2JNJA 2POKA 4BBYA 1U0SA 2Z4PA 3H2UB 3NCPA 1YK9A 4RW8B 3RG6A 4OI0A 4FF1A 3CDUA 1WEYA 3ZTRA 1LK5A 1Q95G 2MKCA 4IG3A 1ULRA 3I4PA 4RW9A 4ZPTR 3L3CA 2KTQA 5IQ6A 3M30A 1XMQJ 3E01A 3PKYA 3PO4A 4NXNF 3MCMA 1KLMB 3U1MA 1T3OA 4EZ9A 2XY5A 2FLNA 3ZZ0A 2MZ1A 4C8OA 3MCNA 3PJWA 5HROB 2F9JA 4P10A 1UKUA 4LBIA 1SXLA 4TNOA 1QSSA 4FBUA 4DFJA 3SSRA 1FDAA 5B09A 4G6VB 2BM0A 2NS1B 4QWCA 1J5EJ 2AX1A 2VG7A 1Q8BA 2VBZA 2ZZMA 4RW7A 1PO6A 1Z1ZA 4Y34A 2VOPA 4FXEA 5MLCV 1NK6A 4JV2A 3BBCA 1LWCA 2MZRA 4OHZA 2IMWP 5L1LA 3ILIA 3GV8B 2M9KA 1B0VA 3NWRA 4NASA 3M8QA 3EWGA 1NJIT 2QG9B 4OZ1A 3T19A 4W4MA 1XNRJ 1CS4B 1WTFA 3M8PB 1O6XA 3MECA 2BZ2A 2YH1A 4ZCIA 2GVDA 4L74A 5LL6d 2ATLA 4OI2A 5GVQA 3KJVA 1RJJA 3BEGB 4PQUA 2DGOA 2XWYA 3TARA 3MMCA 2J0QD 1VQLS 4HHJA 1T11A 1WOOA 3A3PB 3W8GA 1FE0A 2YBVA 5LMNF 2NUUG 1RACB 1MWQA 1HR0F 2DNGA 4WE1B 3T3FA 1BXNA 3FBBA 4LSNB 1MWZA 2CQ4A 1DQ9A 1HNXF 3MPYA 2WK4A 4KSEB 4I1TA 3DFEA 3CMAS 3MCSA 5GMKa 4QR0A 4N77A 2V8DA 3M2UA 3UE2A 3P49B 1FTCA 2W24A 4KY3A 3GIJA 1OPZA 2VKZG 1VQ5S 2YQ1A 2B4PA 3QGPA 3CGIA 3BQ2A 2ZH1A 4AQYJ 2WSFC 3OTBA 4EBEA 4GO5X 3ISZA 4ZN3A 4ALZA 2KT5A 3R3TA 1FX4A 2HLUA 1D9AA 1S4EA 2YQ0A 3A8JA 4K2XA 1C1CB 1VI7A 1X5SA 4IOCQ 4YS2A 4MKYA 1UFWA 3L7OA 4M5IA 2ZH2A 5HK4A 4LT6A 1UP1A 3M32B 2BDPA 2K2PA 2FYXA 1HI0P 3MAAA 1CC8A 4J5OA 4PXCA 4J9OA 5HANA 4A48A 4DG1B 3G6ES 3EX7B 1O8BA 2O3DA 4BLGA 1TKTA 3D54A 3TQEA 4DV6F 2UUCF 5GAEU 2HNYA 1VQPS 3BGRB 3HZEA 1MROA 4B3RJ 2JBVA 1SV5A 3TO8A 4C48A 5D8HB 2MQNA 3AQOA 3LPEA 5A8WA 1SJ3P 4MK7A 2NREA 2ZC3A 2IFXA 5M2RA 5KFVA 1RT5B 3PW4A 3I96A 3S7RA 1Y5LB 1N8RT 1RTHB 1N56A 2FVSA 4KR0B 1TKDA 4JI5J 1YITS 4FF2A 2R7TA 2R7XA 3QMQA 1C2PA 3CMQA 3HHLA 4JI0F 2IJFA 2NCKL 1S9EA 4DR7F 1DQAA 1LXNA 1QD1A 1Y3KA 1R0BG 2JXHA 3QOQA 4UW2A 1TAUA 3LP0A 4YY3F 3GJQB 4LFCF 4UY85 2CWKA 2GHPA 4C8MA 3ZZYA 3MR3A 3UWTA 3RBXA 4O3RA 4LR8A 4YMEA 1NK5A 1CVJA 3UN5A 1U1OA 2HQIA 1AT1B 2X7IA 4FYWB 4L3KA 4JI0J 2OPQB 4D8JA 2XNRA 1R27B 3CSKA 3FFIA 4P74A 1FRKA 3GMGA 3EZOA 1T9YA 3PJ9A 4R0EA 1WC6A 4RWXA 5CH7B 4HTIA 4UQGA 3HJFA 3OFGA 1TP7A 4C8ZA 2MQMA 3MEEB 3H20A 2DGUA 4DV3F 3CCTA 2M3DA 6AT1B 3I0RB 5DGAA 4DQRA 1OY8A 1VMBA 1BC6A 3CJKB 1PBUA 3MOZA 1JKHA 2AZ1A 2KM8C 2IRXA 4I69A 3GSIA 3O2IA 4J9KA 3NLCA 4DV5F 3AT1B 2EEYA 1NK9A 2HW3A 4DPTA 3SZ2A 2UVRA 4GMKA 1RISA 4K8RA 5DS7A 3TA1A 4DUYJ 4MT1A 4BC7A 2QZ8A 4EK2A 2HSEB 1IQTA 1BWVA 4X65J 1C0UA 4WZMA 3SFGA 1NSAA 2OUGA 5DO2A 4L6V3 4TU9A 1ELOA 1JX4A 1FKPA 2ACYA 3D6TB 2UP1A 4Q5VA 2NZ4A 1X4EA 2IM3A 3HVTB 4NCGB 2LEBA 2C3PA 2K8GA 2CAXA 2DK2A 2CJBA 2EPIA 2EFNA 2PEHA 4ZPBA 3T1HJ 2GJIA 1JLGA 3MR7A 5BR8J 5M2PA 5AJ3F 2DISA 2FHJD 4KE5A 4MFBA 5DDPC 3JYTA 1LQ9A 1MN9A 2LA4A 3IGVA 1T05B 5LSLA 2UU9F 1SPBP 2NXCA 3DM2A 3MMAA 2CQHA 4RW4A 2DH8A 1NDCA 2AEMA 2G1DA 2NXNA 4NLQA 4XDCA 1VRTB 4GVLA 3HVAA 3NRBA 4NE9C 2ZBCA 2ZH5A 1ZTWA 3M2RA 1HPZB 2JEJA 1LWEB 1MMLA 2E29A 4ED4A 4ELTA 1FJGF 1WDDA 2OO4A 2LMIA 7FDRA 5L46A 3DDKA 3B6BA 3EGZA 3WX8A 3JQMA 2XWXA 4CP5A 1U49A 4HDHA 3RB6A 4CLTA 4JB8B 1TTHB 3CCLS 5C5JA 1H7XA 1CQNA 1RK8A 1WHVA 1T9VA 1UJ5A 2RIJA 2RHSB 4J91A 1R0AB 2AEFA 2DR6A 5DZ6A 4TY8A 2H5EA 3PR4A 2R9LA 3AOAA 2K1OA 5G4DA 5BYSA 2RHQB 4O0IA 3G5OA 3Q23A 1BDTA 2HYIB 5C24A 2R7VA 1IBLJ 2XSFA 7FD1A 2OP5A 1N36J 1FRXA 1RLCL 1J2VA 2ACMA 2YKPA 2KRRA 2VOOA 1VQSA 4AQYF 5J2QB 3GYGA 3D0IE 1YIJS 2ZBIA 3EZ5A 2XMWA 3W61A 1DLOB 3TUJC 5EHHA 4G1IA 3Q86A 3BO4A 1OWXA 3GTYX 4RUAA 3D2WA 1RT1A 4ZA1A 3KMSA 2IRYA 3V6DB 3CJRA 1TVRA 1BHNA 1X0FA 3RR8A 1SH2A 1NJXA 2H65B 2LKZA 2YPZA 4IRKA 1WF2A 3G9CA 4WFXA 1FJEB 1EKRA 4C0HA 1NZ8A 1ZZNA 1YQHA 2J9EA 2IVMA 3TP2A 1ZM4A 2PO4A 2QYGA 5AXKA 5KG2A 2GGPA 4ED8A 4DR3F 3LGMA 2V2VA 5K8NA 3MM7A 4I6WA 2HS0A 4BWMA 4ECUA 1BE4A 1REGX 3W5YA 2B9XA 1EAYC 3VAIA 2KB2A 2OFHX 2V0NA 5L38A 3V4IA 2XMTA 2QN6B 1HNVB 1J5OA 2CPZA 4OHWA 2AGOA 5C25A 3KLGA 2CPJA 2V67A 1LXJA 2BR0A 4F67A 3W9IA 4ECTA 3P45B 2H5IB 3GV5B 3BDPA 2VDHA 3GYXB 1G3OA 2DITA 1FD2A 1SC3B 3BKFA 4Q45A 2R2UA 1UZDA 5MAOA 2BJ7A 1VYAA 4Y28C 1NO8A 1RBOB 5D3GA 1Y5IB 3MPVA 4USUA 4A8SA 4CNYA 4JI6J 2A0FB 1B7YB 3JTPA 2LVWA 4HL9A 4P2XA 5KFJA 3KK2B 1RBLA 3W66A 2NZCA 3W3SA 5KFUA 3BO3A 3TX0A 2HWTA 1KVJA 1D8YA 3R1HA 4NMLA 4B3RF 2D41A 4RX6A 2DO0A 2AYEA 2LU2A 3FUYA 2V69A 3OTDA 2RKIA 5IXUA 3IMQJ 4M5HA 3DLKA 3CC7S 1N48A 4O4GB 1ITPA 1EA4A 1UVJA 1O0PA 3MEGA 3G4SS 2GVZB 4OFZA 3O6QA 3CO0P 4C2MA 2DBBA 1BDVA 2NR0A 4UY8T 2HVDA 3AXMA 1JLCB 2KKHA 1VOMA 5AE1A 1NCLA 1HBNB 3D67A 2UUBF 2ZD1B 3NG8A 4LF8J 3N0VA 4DR7J 3KG1A 1YRTA 4HH0A 4X4PA 4DV0F 1HWJA 3QJJA 2AJ0A 2W9BB 4DX8H 2FJEB 2FY8A 2C3UA 5B7WA 2IBOA 2QA4G 1GEHA 2KJVA 1OQ6A 2C2MB 2HZVA 1ZM3A 2K3KA 1QTMA 1KQFB 2XMJA 2ZM6F 2JXIA 5B0BA 3PZPA 2ERRA 2XMMA 2W01A 2J5AA 5LJ5Y 3IO1A 2Y1LB 4L76A 2IBKA 4OYBA 4PZVA 3DN9A 2OELA 4F4WA 2O66A 1LWFA 3BSAA 2LXUA 4OV6A 5L8RC 1EETA 1F5BA 1RT4B 1I94J 2BMBA 3GCWP 1F6TA 1F9EB 2ROEA 2EK1A 4U95A 4AL6A 1T03B 1SQFA 1UVMA 1IKWA 1DQ8A 4X66F 2UXDF 2ADCA 3BQ0A 1R0CB 2AZ3A 1A0OB 3SMZA 4O44A 3SIPB 2M4MA 2BV3A 1CJUA 2XSJA 3NKYA 1PIEA 2HMIA 4OQJA 4FF4A 4WPAA 2ROGA 5IFMA 4ECRA 2OTLS 2EBEA 3MUTP 3IRXA 4I67A 3M8ZA 3CCVS 2GHVC 3RU0A 1MYLA 4J9QA 4QYZJ 1XNQJ 2C42A 2ZH4A 2MKSA 3SQOP 1RADB 3G8QA 1RU1A 2GQQA 4GVBA 1CJKA 4F8RA 1X9MA 5HJYA 2HWHA 2YXLA 2CKWA 1XMOJ 2BJ1A 4NLPA 5HQMA 1M5OC 4J37A 1UZHA 2YH0A 3BGLA 2XG8A 3BM7A 4PPDA 1QAJA 4IQMA 3H90A 3VAHA 1QE1A 3TQ1A 3THVA 3P6YC 4NLRA 1IQZA 4E98A 4QYRA 5CCLA 5AE3A 3PM9A 3HT0A 1VC6A 4X84A 1WHXA 1DHMA 1B0PA 5J2PA 4JI8F 4IQXA 2N4CA 4PG5A 1V3ZA 1S6PB 1HBMB 1NJYA 4JI5F 2DEIA 2ZBRA 3QLHB 3NAIA 4WP3A 3KK3B 1KR4A 1R3NA 2JLGA 1JLEB 1R31A 5AXMA 4F3OA 1IBKF 1X4GA 4CH0S 2R7UA 3O8WA 4JI6F 1FNOA 2DYAA 2UUTA 3V81B 1YKWA 2MGZB 3K0JA 1AZSB 2XS5A 3OL8A 1KVKA 2DNQA 2JRSA 3TX8A 5U47A 4C7QA 5K8OA 3OFFA 4DR1J 2FB0A 4DL0C 5L1IA 2ZJRQ 4QWEA 1Q16A 1JLFA 2UUWA 1Q1KA 2F8EX 3CIMA 3NXZA 4ZVHA 2MQQA 2G0JA 3J7YI 1AROP 1VHFA 1HHQA 1M1KT 2W2QP 3C16B 3NBPA 2I5JB 1R7IA 3UNGC 3OT9A 2DY9A 4GKKJ 2E7WA 2QSFA 1TK0A 3U02A 4A8FA 3CD0A 3H2VE 4K5RA 2HQGA 1OG7A 2E9RX 1X9SA 4DV2J 2BNZA 3EZUA 1MYKA 4OI3A 4Y00A 2UUBJ 3L4BC 1XR5A 3CO9A 3QJPA 3D4JA 2HZCA 3GG0A 3H40A 3N5BA 2G4BA 1X0PA 3EVWA 2W9AA 1RU2A 3A13A 4EI2A 4NLWA 4R8UB 1VC0A 3C2PA 3PYDA 4DL4A 4KHRA 4OYZA 2DEJA 4PWDA 3CW2C 1NK7A 2CQ3A 4HLBA 5KFWA 3OXFA 4P6QA 4LRBA 4RNFA 1WACA 1PKUA 2LQBA 3A8KA 3DRRB 3N9UC 3OR2A 4G1PA 4NLOA 3AHPA 3WC0A 2RD5C 5HSPA 3MUMP 1S1VB 3OL6A 4J9NA 1ZAXA 2D9OA 2R4FA 3IAM9 4DUZF 1QAXA 4RBUA 4OIXA 3RJMB 1NKEA 2CFXA 5AT1B 4FYYB 3RB3A 3FVYA 3BPDA 3TA2A 3LWMA 1UA0A 4LBHA 3CDEA 4TKTA 1U9PA 2CQ2A 4DSLA 4DR5F 5H1SV 2XSJB 3JSMB 2AYGA 4O44B 3C6TB 4QIWD 1EKSA 3VGTA 4J9LA 4DQSA 2FJXA 2PC6A 4OZ3A 4PUOB 3X1LB 2P9GA 4CQ1A 4RU9A 1JLAB 3LTOA 3FQKA 4CI0B 2L3MA 3VEBA 3B78A 1DBDA 5A8KB 5DG7A 2YPYA 2QYCA 1D1UA 2XHWA 5D4OA 4BDPA 4URQU 5HAOA 5D6GA 4EGLA 1KVIA 2CPDA 1C4CA 1SVDA 1FESA 3OD2A 1VIOA 2V68A 2YNIA 4D3HA 2RRAA 2LQ5A 4DZDA 4DUTA 4ZLPA 3EPIA 4EBDA 4AL5A 1FJGJ 4C4WA 3M9MB 2BNWA 2YTCA 2FQQB 3B8HA 3UCGA 1TFWA 2HHSA 2FVCA 5E33A 4AAIA 2RQ4A 2AT1B 3RBEA 1Q53A 1Q78A 1F3FA 1S5ZA 1VLOA 2QA2A 2IA0A 5JVHQ 2HGLA 1H6KX 2W9BA 4DV2F 4O3SA 1ZS6A 2HEKA 3OPKA 3G8TA 3QRPA 1TKXA 1NPRA 2GJ2A 1LW0A 3PACA 5CCMA 4I2PB 2UXBF 2VFSA 1PBAA 1NZAA 2KYZA 2KG1A 1LOUA 2RQKA 2D3OR 1S57A 1XTZA 4XPEA 4DV0J 2ZH8A 2MZQA 4F4ZA 3MAQA 1WNEA 2OD6A 3HHNB 4CTAB 3AB4B 5CYJA 5GAHU 4ID5A 2W7PA 3LWLA 2IC3B 1RWUA 4IDKB 3RAMA 2HBRB 4DOZA 2PFFB 1HIYA 3R97A 1N0VC 2FJAB 4A8OA 1X4HA 1VQ8S 4ZVQB 1SH3A 4CCHA 2UXBJ 4U6PA 3I4HX 2VU5A 1HNZF 1RAHB 4NL5A 1SC6A 5KG5A 4DV5J 1CJTB 1X7VA 2BX6A 2VL1A 4ANEA 3D28A 1KONA 2V2ZA 3EXCX 5KFYA 1X5OA 1SJRA 2GNKA 5ETOA 1RT6B 5LT5A 5IT0A 3ILOA 1JLBB 2Y0BB 1ZOTA 4DPYA 4YHHF 5LMUF 2Z2YB 3KJQB 1HKAA 3W63A 2EKYA 3BGOP 1RKJA 1PAEX 3V4MA 3I9ZA 4HT5A 2UVUA 2IIHA 3GR1A 5JVGQ 2LECA 3JB9k 4LRDA 2BJDA 2AGQA 5D4NA 1J5OB 2F4FA 3MPUB 1U1NA 1UWBA 1N33J 2AP6A 3AY0A 2V4JB 3CJ3A 4F25A 3K5NA 3UPFA 3MZIA 4K4YA 1S10A 3MOJB 2CPYA 3QGHA 5CZVA 2WVEA 1MU2B 3TZYA 3TJ9A 1HI1A 3JQKA 2KELA 1T95A 2ZVSA 5B0EA 1C0TA 2YNFB 2HLTA 4ZPAA 4OI1A 5F8LA 3NMRA 1YGYA 2OPSB 2G9OA 1S99A 4I7FB 1OY6A 1NLKL 1R6YA 2H9ZA 2KHCA 5CYQB 5ETSA 3LUYA 5L1JA 4K4XA 5IQQA 2IY5B 4GC6A 2NPIA 4WU2A 2GMLA 2KT3A 4DPXA 3KUEA 4QWDA 3GCXP 1P9YA 1XIQA 4KFBA 5KFMA 3SCKE 5IWAJ 1DLOA 1WHYA 2V4QA 4F2SA 1BGXT 4NEYA 2YWWA 2HBYB 3F0NA 2V5HG 3BYRA 5I3UA 2FJWA 1RT3A 1FFSB 4ITSA 1TV6A 3CJ8A 2D9PA 2DNMA 3FCWA 1ZM9A 3GU0A 1HBUB 2DT9A 1TL3A 2JFKA 1U6FA 4NA2A 4C3KA 2XYPB 1SL2A 4M94A 2CWXA 3PO5A 1HNZJ 3R6LB 1TR0A 3AQPA 5JMNA 2HS4A 4JI4F 5GAGU 1Q86T 4C8LA 4V19J 1JLQB 3BSNA 2CA9A 1N5VA 1WEZA 1X4CA 3HJVA 3Q2SC 3R5GA 1Y5NB 4KO0B 1NBEB 2D7SA 5HATA 4N8OA 3RUBL 4DXLA 4ED2A 1N36F 2UV8A 2AX0A 3LAKA 5KFZA 4AUKA 3PYEA 4FYXB 1BQNA 4RZRA 2R2RA 4N8NA 1S72S 3VV2B 4KKOB 2W1BA 3DRPB 3HFKA 2GMHA 3HKWA 4YR3A 1HPZA 4KGMA 3RYLA 3W60A 2V2KA 4JI4J 3I55S 2R7OA 1IWGA 4P9SA 4YDXA 2BJEA 3GFZA 4OJ3A 3MWBA 1P94A 1K9MT 3MMAB 2DR8A 1V5VA 3J80U 4PXBA 2DR9A 3I9V9 2VF3A 5KG3A 3OQ2A 1X4BA 3THTA 3R6GB 2KFNA 1JLGB 2OPPB 3D6MB 4CLZA 4KB7A 4F36A 1P9QC 1FRHA 2B7CB 2Z57B 1WORA 2A18A 3MMBA 1RTJA 1IKXB 1PYTA 2MHNA 4R0JA 2KJWA 2WHOA 2L41A 1B70B 1U26A 3QSIA 4Y0FA 3PVXA 2KRBA 5AE2A 2CJAA 2W2MP 5IS2A 3I56S 2B9EA 1KBRA 2VFUA 3W8PA 3OJSA 2LA6A 2CJXB 5B0FA 3BV8A 5DQIA 1QUVA 2F8HA 3TZWA 1CLFA 4IOAQ 3M4XA 1N4LA 2VBYA 1I6JA 1YJ9S 3CC4S 3FT7A 3VVTA 4F2RA 2JJ4D 1VQKS 2F4VJ 2MZTA 2WRMA 4CO5A 1D09B 2DXDA 2DD8S 1X5PA 4PWUA 4F4XA 3S01A 2P2CB 4LVOP 3ETOA 2GPEA 1T02A 3EXYA 1KC8T 3U27A 4I0WA 3FMWA 3FC9A 4O0NA 1VS3A 4J9RA 2M52A 4DU7A 2MHEA 3QFHA 2COLA 1AW0A 1WKJA 1YJ7A 4KC5A 3POTB 1Q7LB 4YB5A 3U7JA 1UWAA 3DKDA 4CH7A 4UOGA 2QEXS 1KRPA 2GW8A 4WK3A 1S9FA 2RDIA 4DX6A 1VHIA 3A1YG 2ZVIA 2CPFA 1SJ1A 3ENWA 3K2YA 3W65A 4KH1B 2OJ3A 2I0XA 4LR9A 4FDFA 4X66J 2DNYA 1HHSA 2BKOA 4YN3B 1IKYA 1YRUA 1U4BA 1P1LA 2FC8A 4RKUC 4HT7A 2J8SA 4HTJA 2B4VA 3MMJA 2MDAA 1VRUA 2X3GA 3PEJA 3G6YA 1OY9A 1RT7B 5KFSA 5L9NA 2Q66A 1S9EB 4JV5F 3UD5A 4IRDA 4U7UD 2LQJA 1U45A 3BGFA 3HDSA 1IKXA 2P6SA 2XM3A 1VFJA 5ETLA 1FXRA 3DOKA 1X93A 3M8SA 5IOLA 3V6JA 3RB0A 1S1TA 5A8WB 1RCXB 1CG2A 4LSLB 3ULHA 4ZVGA 4ZPVR 1Q5VA 1FCAA 2AJ2A 5ETKA 1K8AT 3GFHA 2IAJB 4ER8A 3V2UC 2HS3A 2EFOA 5F8JA 3BO2A 2UXCJ 2N82B 3M32A 3Q8YA 4NRUA 1FWKA 3QT5A 2Q1LA 3B4MA 4QZVB 3CCQS 1BQNB 3FGVA 2DY1A 4U9RA 2VASA 4B17A 4NXNJ 5CYMB 5BR8F 2QL9B 4QPXA 1X5TA 1R8HA 1SIZA 3NEKA 4KO0A 4USMA 3UCUP 1IBCB 4NWBA 1K47A 4W90B 3KG4A 3RTVA 3MUVP 5CYMA 2AD9A 4F02A 4WWSA 1CC7A 1KQGB 1X8DA 1TL3B 1NXIA 3H42A 5KFLA 1QDUB 2HFZA 1HQ2A 1TV6B 3CT9A 3GB0A 3KFWX 1RT3B 3QWUA 5I3UB 1H38A 3F56A 4LSNA 1XK8A 1XMBA 4ZHRA 5KAKA 1TL5A 4WE1A 3S1TA 5EWGA 4UOHA 1N5QA 2HHHJ 2AY0A 3UR0A 4RU2A 2ZZNA 2GFFA 4IOBA 1WC5A 1VRQC 2UV8G 4K4ZA 3HMJG 2IAJA 3OW2R 2XMAA 1HNWF 2ZWOA 2DO4A 2CQ0A 2P6TA 1BWEA 1JK9B 3IWNC 2KZMA 2OFGX 2YQ3A 2JEIA 1S1TB 3MR5A 4NLDA 2GVDB 1S0OA 1L3UA 1S0VA 5IWAF 1CS4A 3K8WA 3R5DA 3H25A 2OLWA 2N7YA 2HVEA 3QGIA 2G2ZA 2YNFA 4WYLA 2NPFA 2K29A 1YDLA 3CJ5A 3OFHA 3KHGA 5LMNJ 3J81j 4ES1A 4TQSA 2VQEF 1Z4UA 2CZVC 1RT7A 3Q8UA 4OYMA 4A4JA 3TVYA 2V4JA 5HMWA 3KNAA 4DEZA 2OEKA 2PA8D 4USJC 1NPKA 2OHDA 1P8GA 3I0SB 1KTVA 3DNCA 4UUXA 5DLGA 4B3SF 1VQYA 1UEUA 1IKYB 4RW7B 4DMZA 5EWFA 3RW7A 2FLLA 3DLEB 4C8NA 2PEBA 3PW5A 1S6QA 4HACB 2GCFA 3JSRA 1U1KA 1JLBA 1NHKL 2X51A 4ZS6A 1RT6A 3GFXA 5KFCA 1SKWA 4DN0A 3RAXA 4DI6A 1CJTA 4LRAA 4X62J 2PFDA 4TLQA 3E01B 1Q8LA 1SUQB 2F4VF 4TU7A 1NLAA 2SXLA 2VB6A 3LF0A 4MMOA 4RW9B 2E1RA 4P71A 5LSRA 4LFBF 4HV0A 3MR2A 3F41A 1RAIB 3U1NA 2F8MA 2IC3A 4M5NA 3HULA 4ID5B 4BC9A 4QQBA 4CLWA 3W5XA 1I3OB 5KG6A 1ROFA 3CDWA 4QWBA 3R5JB 3K8VA 2AJ1A 4A8KA 3R1LA 2DNPA 4LFAF 4EO6A 1NKBA 2WVFA 1FK9B 1H2VZ 2G0IA 2GMJA 3ENAA 3HD1A 4K59A 5G0RB 1TKZA 1RQ0A 4OHYA 1S97A 2R42A 2F65A 1SQGA 2JSXA 4P72A 1HHTP 1WELA 2QC3A 4GKJJ 2MSTA 4KGZB 3QFWA 1YG0A 1XMOF 4ECZA 2Z56B 1RP5A 4UZCA 2LXFA 3CMES 3I5BA 2CUYA 2G1HA 1V3SA 3LP2A 3VCDA 1PJ5A 3IN5A 5D0GA 4X4VA 3RRHA 1SKSA 2JC1A 4YR0A 3QAUA 2B8PA 2MPUA 1KDNA 2PA3A 2YKNA 3OTOJ 4NLSA 1M5KC 1TMJA 1QAYA 2MY7A 3M6XA 4WYWA 5BYQA 5C2CA 3ZZPA 1V5IB 2QGFB 3P5BP 5HVFA 1ZPVA 4KT0C 4XIUA 1GQEA 5E3CA 3Q0AA 1RHUB 2BA9A 3OFEA 3VGSA 2JL9A 3VR1A 1ZH5A 1WOPA 2HRYA 2WVBA 1HA1A 1KOHA 2MYFA 3V6HA 2CQ1A 5KFDA 3QWPA 5A8KA 4USVA 5F3TA 1TK8A 1IBKJ 1REVB 5A0YB 3J81U 3OJUA 4B9LA 2C22A 2JEFA 2VC1A 3K7RA 5CA5A 4ZKAA 3EVMA 3GV7B 3IG1B 4WTYA 3D0HE 3HP6A 4ZP9A 1VIXA 2E5LJ 4ZCLA 3R7BB 3M6UA 5DETA 2MQPA 2Q6BA 1HNWJ 5A8RA 1NH8A 2DCLA 4WFYA 4OYWA 1JLQA 4ZJQA 5LXYA 2ZM6J 3NGSA 3WIUA 3CCES 2AHOB 2RF2A 1W7WA 2DIUA 3HHLC 4RNHA 3TJ8A 1NK4A 4ZLLA 1ZAWA 4CRJA 1LNQA 1ZBTA 5BYRA 3SFUA 1LWXA 1P6TA 5B0GA 3LALA 1MG7A 3KUHA 4BHQA 3OR2B 4LREA 2RH3A 3JXOA 1IM6A 1NM2A 2Q79A 1O51A 3VAJA 1S1WB 1XEZA 3HVWA 4KYZA 1VK8A 4S0MA 3J81Y 1WF0A 4CLSA 1JWWA 4YUDA 2CQGA 3EM1A 4QR1A 1UFLA 4K5SA 1NU4A 2C2DA 1PCAA 4KGVB 1VJQA 3NNHA 4I56A 3BB5A 1U6ZA 2M8HA 4Y6IA 3NNEA 2FLOA 2AJ4A 2J9DE 2J7UA 4EEYA 1HNIB 3C16A 3W64A 2P9EA 3CC2S 2BE2A 2W2PP 5IT9Y 4YQWA 4B3TF 4B3MJ 2AW0A 2R3VA 3NWGA 2HK3A 3PW2A 3OUYB 1AXQA 1R8BA 2CPEA 5KFAA 2RJZA 2EFGA 5KOWA 1UWBB 1DFDA 4YR2A 3PX6A 5ETNA 3D1HA 1S76D 2MGZA 5J1EB 2XULA 3W9HA 3O1LA 1SCJB 1IR0A 4IH7A 5LM7E 2R2SA 1PSDA 5HBMB 1ZM2A 4X64F 1RDRA 4USKA 4EWTA 2KM8B 3MFHA 4XTTA 2E44A 3QLHA 5B0AA 3CB4A 3KK3A 4JI1F 3OVBA 1S6PA 3D3CJ 2C3YA 2XB2D 4D3GA 2GO9A 3S8SA 2CPGA 5DLFA 4ZVSB 3W62A 3MTJA 5KFXA 4AYBD 5J2PB 4RNMA 4WK1A 1U1PA 2KXHA 2AQ4A 1JXLA 1VDHA 3Q8VA 3T9ZA 5KG1A 3L09A 2HGNA 4QIFA 3SQGA 1YBTA 2FJDB 1EP4A 1WG5A 2FDNA 4K2JA 4XK8C 4CLLA 2BSQE 1QE1B 3ZC4A 4E2FB 4X64J 4BS2A 3TAPA 2HBQB 3AJDA 2HPUA 2FJVA 2HIQA 1MN7A 2ROPA 1K44A 1JJ4A 3DXBA 2LXIA 3DXSX 4GVBB 4PQAA 1B4SA 1HBOA 4R25A 4WBFA 2J0SD 3WQPA 4F4AA 5DZ7A 1L3TA 4X4UA 1CPZA 2Y9HA 2H3EB 1LFPA 4O3OA 1IJEB 1FVQA 2RRNA 5DM7Q 1NJZA 2AMCB 1Q81T 1XN9A 2B4OA 2BACA 1WG4A 5F0WA 4YB6A 4B9UA 2KYXA 4DV7J 4ZVUB 4Z2XA 1NSPA 4Z7YA 1IKWB 2OMOA 2CDRB 2W2NP 3OSNA 5EX0A 2HGMA 4FKXA 1MNTA 2H1OE 1EETB 1GMVA 4GRSA 4I2QB 3V6KA 3DDIA 2PN6A 5KT3A 3E51A 5B0CA 2ZDPA 3OR1A 5THWA 4XO0A 2ASLA 3LA0A 1U6BA 3T5JA 4JI2J 2YNIB 3M8WA 1F60B 2X1GA 4FVCA 4W92B 5HI7A 4QYZK 2QRRA 2Z58B 3KLFB 1XNQF 1FFGB 4I2QA 4RPFA 4DV1F 3C6UA 3JAMY 4DR2J 3UNYA 4UTGA 2EG1A 5GADU 4Q7AA 4TXSA 4DDFA 3JAMU 2BJ3A 1G1XA 1HLWA 5SZTA 3G8SA 5JUMA 4HI2A 4PUOA 2W4DA 3C6TA 1M5SA 4QOTA 2D3UA 3JSMA 5HMYA 1H3DA 2CNOB 2JC0A 3MPWA 1HBNA 2MKJA 4OZ0A 5I3QA 4QU7A 2B51A 1HW8A 4B3TJ 4LF6F 4MKVA 5KFIA 3FZBA 2BW7A 4DWIA 4UT4A 3FRYA 1IRQA 1HBOB 1WC0A 3PJXA 3SBMA 4P2MA 4IFVB 2JVRA 2XMUA 2XLKA 3DLKB 2RKIB 3OVAA 2XS7A 3OVSA 1J27A 3Q8QB 2KH9A 4DV4J 1C4AA 3IBCB 2BQ3A 1PARA 1TFYA 1YLXA 4KAIA 4P2SA 4Y2MA 2JHEA 3PG9A 1ACMB 1JJCB 1JNRB 1Y3JA 2JDJA 2JH3A 4NLYA 1WC4A 4TQRA 4ED7A 1SKRA 4LF5F 4ENOA 1EP4B 1GMUA 5EDWA 2HHHF 3M05A 1JQGA 3SQGB 4LFBJ 1JB0C 9ATCB 2MLZA 4ANDA 4U7CA 2VIHA 1N32F 2BANB 2DCUB 3LJPA 2GIFA 2YY3A 2GA7A 2M70A 1KQKA 2Y0SD 3UR3C 1UA1A 4B9VA 4P52A 4NPOA 1VJWA 4EYHB 1N5SA 3R5CA 1G2EA 1FNMA 3QYYA 2I5JA 3FMBA 3Q8RB 1JXEA 2YWEA 3FMTA 2MKIA 5HBMA 4JI3F 4ED6A 1H98A 2XLIA 4ED5A 3Q2TC 3KLGB 2KFZA 1DZ5A 2FD2A 5J1EA 4RUCA 4DR6F 1L3KA 1JLFB 1Q16B 2EC2A 2ZOFA 2EVZA 1QM9A 3I5CA 2KKEA 4IO1A 1RHJB 4PG8A 3GJSB 3A4TA 2QFIA 3FJ2A 4QR2A 2H4YB 2HRTA 1Z2ZA 4ELUA 4WKYA 2OAUA 4ME7E 2RT3A 3IBWA 3OUYA 1UVNA 2BJ8A 3BGUA 1GX5A 3D66A 4M5KA 1ZAVA 3BN4A 1KHVA 2BE2B 4MYTA 3UVJB 4EUVA 4ED3A 4LF2A 2B3TB 4DX5A 1AA1B 5E41A 3KWMA 4L3NA 1B01A 4L75A 1VCTA 4WP9A 2D3O1 1QVFR 4K4VA 5D0HA 2J7KA 1NRKA 4F50A 1HD0A 1CULB 1YZ6A 4DL2A 3RBDA 4PXEA 1B99A 3PHTA 3TVZA 1EIYB 3V6DA 2NXEA 3GZ7A 5SUHA 2BOPA 5F0UA 4N7TA 4Q8FA 2GS8A 4V1Ak 2ZUGA 3IR6B 1S6OA 1KWMA 3QZ8A 3IXQA 1S1WA 4ED1A 1J5EF 2FGOA 4XAKA 2ZITA 4F3QA 1IN0A 3NS7B 4FNHA 3FCVA 1YJNS 4OI6A 5C24B 1RBAA 4Q8EA 3TI0A 5DJBA 1IKVB 5HVHA 4FS2A 1RAFB 4LR7A 2L9WA 3PW7A 5T7LB 4USTA 3J80Y 2RF2B 4DR2F 3GR0A 2RB7A 3IRXB 3QSYB 2DHXA 3GFYA 4HR2A 3WBZA 1CJUB 1W26A 4X4TA 4FKYA 4KV8B 4JP8A 1OQ3A 1FTRA 1K0VA 2CJQA 4QCLA 4KTQA 3IG1A 2B6AB 4KBIA 1T3NA 3FBEA 3ONQA 1G6BA 1H0HB 1REVA 3FK4A 5A0YA 2XCAA 2JXGA 2V8VA 2ZFHA 1AUSL 4NA3A 2ZKTA 1S4FA 2RUSA 3OLBA 1WSVA 3H59A 4IR1A 3BH7B 3JTOA 2VA3A 4CH1A 3ITHB 1RCOB 3PX4A 4V19X 2CNLB 3AOCA 4I4BA 2FPHX 4MFBB 2LYVA 3JYTB 3BZQA 5LMUJ 3N6NA 4ZOSA 2E1CA 1T7PA 1OSDA 5H9FK 5F41A 4OV1A 3KG0A 3IWXA 1K1SA 1M5VC 3LP2B 1F9FA 1F2HA 1N34J 1S0NA 1MWYA 2QT7A 2KFYA 4NCGA 2FZCB 2XC9A 4A8MP 1GXUA 2AYMA 1RABB 4P75A 4J9SA 4OX6A 5ETQA 2E5LF 2ZD1A 4B9MA 2YWFA 4QU6A 2HWIA 1U47A 5E0OA 1KEKA 2HVZA 1X60A 4A8XA 1VLYA 2R8GA 1TKZB 4CO4A 5KT7A 3F73A 2CADA 3T6BA 2RRBA 4O4GA 1R6VA 2ZZTA 4Q2LA 2CZ9A 3EDQB 3D0GE 4X62F 3T9NA 2GQCA 2HHPA 4DPOA 4DPWA 3UDVA 4OX9J 3D3BJ 3CJKA 1RT2B 4U96A 5FLXU 3MD1A 2DHGA 4WFBQ 1UW9A 3TZXA 5IZHA 1NUEA 3MEDA 3AFGA 4RNOA 4IKAA 3HSGA 1HL6A 1SUQA 2XZDB 2Q3PA 3MEEA 1U2RA 3NCRA 3UDEA 4RJVA 8RUCA 5F3ZA 5J1PA 2VJVA 4NZ0A 3VWSA 3CD6S 3EGWB 3ZTQA 3AB2B 3FFIB 2HHQA 2OPQA 3UQSA 1R8PA 1PGZA 3H4BA 1VBYA 4DZ6A 2W8KA 3DU5A 1YTYA 1S6QB 4HACA 4B3MF 2IVFB 3DLEA 3FRZA 4OZNA 2DB1A 4FYDA 1DTQA 1KQSR 4OYOA 3T1AA 2Y3YA 1MMDA 2HIYA 3EICA 3I0SA 1C1BB 3QT6A 4ID8A 2BRLA 2BQRA 4XPCA 4MIBA 2LEAA 2U2FA 3LP0B 5FJ4A 2BYCA 3MM7B 3MTKA 2Y8WA 4ZLNA 1GXLA 5HP1B 2ZH9A 4K4SA 5LJ3Y 1F5AA 4X4OA 3PV8A 3ZNUA 4F0KA 3P5TL 3C3LA 1TZ0A 2KOEA 1U24A 2RNEA 2CJ9A 2K7KA 1RZMA 1T0TV 4FBTA 3GLJA 1D8ZA 1SV5B 3W9JA 4DV4F 1TVRB 1RHKB 2IRUA 1N33F 5GADI 1RT1B 1TU0B 1YBUA 4MKAA 4I6YA 3KLVA 5DRKA 3CUNA 1S1UB 4QJVA 4ZHRB 1U1MA 1QY7A 2GQ2A 4KIAA 5J2QA 4PYAA 3H98A 1KD1T 4C8KA 2BE9B 2WAQD 4LFAJ 3ZFVA 2ASYA 3AA8A 1YJTA 3AODA 4JYAF 3H4DA 3ZZOA 4TY8B 3PCOB 4IO9Q 4PPZA 3ZTOA 4AL7A 3OTEA 2VODA 4KHPJ 3BDEA 1FKOA 5D15A 4CM0A 5D77A 4E8UA 3G71S 3TANA 1R0AA 3A12A 4Y2KA 1VBXA 2XNQA 3PIPQ 4DLEA 4PG4A 5I3PA 2HFOA 2DNNA 1OHNA 4HEA9 2WZ1A 4M5JA 5GAEI 5FLXY 2R7QA 3C19A 4DR5J 1S1XA 2EW9A 3OBIA 3OTOF 1U1RA 3LW5C 3PFOA 1FI4A 3AD9C 3FNNA 3UN3A 4USIA 2P8IA 1JXVA 2PGCA 3CCMS 4F4YA 1KOOA 1WWHA 5IC4B 4MJWA 3DGPA 4GC7A 4DFMA 3ZXWA 3BS9A 3BSOA 2WOMA 2V4RA 1M1GA 2QO3A 1OIAA 1YJRA 3MMCB 4OX9F 5HMXA 4PQUB 3NMAA 3MCOA 1T05A 1RWMB 4LSLA 4A47A 1MSWD 3KJVB 4NA1A 1X4DA 3ENQA 3P96A 2JFDA 2F9DA 1R43A 3DOKB 3MECB 3RAQA 2OIHA 2VONA 3EDRB 3CDAA 4DV1J 4UOFA 2WW4A 4WXOA 1Y0HA 4F0HA 4F4KA 1FNXH 1CEZA 3MD3A 3O5TB 1FFWB 3TEGA 3CF5Q 4PXDA 1VRUB 1T9TA 1UVKA 1LWCB 3WX4A 1C0UB 2VDIA 5CABA 2HHTA 2UZAA 4RR5A 2HG4A 3CIZA 2X1AA 1N34F 1TMMA 1KNZA 2KL8A 2HFVA 4XDDA 1M5PC 3E8OA 4DV3J 3HK2A 2NXJA 4ZLJA 2XI3A 3KOAA 5EN1A 2XTJP 2I1RA 1RXOB 2GZOA 1WC3A 1DURA 2VFTA 3G6VA 4NOHA 5A6PA 5C7PA 4YFUA 1JKHB 3W1YC 1U1LA 1TL7A 3IM9A 3L95X 2WSEC 1SI9A 2N4DA 3POTA 4LIRA 2N7CA 1N32J 3M30B 1UETA 3MAHA 2J6SA 3KYLA 2EBGA 2LFVA 3D68A 3NGRA 3PX0A 1OMSA 1UTAA 5AXLA 2MLXA 2ILYA 4Y2CA 2FIUA 3T1YJ 1E6VA 2DJWA 5DG9A 2W9CA 4JV1A 1Q8IA 3LH2S 4FNIA 5EX3A 2A6OA 5D0EA 1RAAB 2K5JA 1U0HA 4W98A 4CIOA 4DSKA 4NXMJ 2CVIA 2V50A 4PR6A 4JOUA 4DJBA 2DXEA 4HDGA 2ZOMA 3I6PA 3IP0A 4A8QA 3RW6A 2M0GB 3OXLA 1Y9OA 1TUVA 1GTEA 4IYQA 4ZDNA 3HT3A 2H3AA 1UPMB 2ZH7A 2WVDA 3M8RA 1RA6A 2UUAF 2BM1A 4EFAC 4CYUA 1YSJA 3HHLB 2IM2A 1RWPB 5I42A 5H9EK 2UU9J 4ICLA 2UUCJ 1RHMB 1FJCA 5A6WA 1RTJB 4P73A 4JI1J 3FDSA 3MMBB 3NP5A 3VTIA 2LDYA 4IG0B 1KSPA 4WIQA 5KFPA 1URNA 2OPPA 1R89A 2MZSA 5E5NA 5AXNA 4USHA 4ECSA 4C9DA 4KJIA 2V8HA 3KK1A 1MROB 5GAHI 2HNYB 4Q0BB 4O23A 3QZ7A 3LGNA 1TKTB 3I32A 4KH0B 1SC1B 2UUAJ 4WKRA 4DG1A 4RUHA 2FUG9 2OI2A 5D4LA 2YKQA 4AXJA 5CD4A 2FY1A 2AGPA 2V8PA 1BQMB 4Z37A 3BH6B 3HI9A 3U1LA 2RAQA 2QMXA 3IWLA 4Y2IA 3DRPA 4AT1B 1D0EA 4KKOA 2PD1A 3KJFB 3PW0A 3IBFB 5T41A 2HQ3A 2QIFA 3HHKA 4B02A 1KKHA 3DLGB 1C1CA 4ZPCA 4JI7F 5A2QU 2J0WA 3KLIB 1KFDA 4G1QB 2Y1RI 2HFUA 2KXFA 3BBFA 4DR6J 5KFKA 3AH6A 1SL1A 3QIDA 3NY0A 2JVOA 3VW4A 4F3MA 2DNOA 3NCQA 3QAEA 3LP1A 1B0TA 5IC6B 2W25A 3KJNB 3SDEB 4O3QA 3WDOA 1HYSB 3M2UB 2V2QA 3SV4A 3TR5A 1HBUA 4F04B 1NNDA 4A8YA 3GIIA 3CCJS 3O3LA 3IR7B 2DHHA 4URGA 5CD4H 2UVWA 4B9SA 2DR5A 2IMOA 2ILZA 8AT1B 1EQ0A 3VAKA 4KFBB 1U8SA 5F8IA 2L48A 2P5VA 2XI2A 5B0DA 3C46A 2AV5A 2ZJQQ 3CNQP 2Z2LA 2M5YA 3DU6A 2LU1A 1KHWA 1HQUA 1XQIA 3QNWB 4C97A 2XO7A 3CTRA 3GG1A 2GJFA 1NK8A 2UXDJ 3EVOA 4GKJF 4RWWA 1LK7A 1XMQF 3CD7A 5CYQA 3M8PA 3MR6A 2E7VA 4I7FA 3W7BA 2OPSA 2J6UA 4K50A 2VPXB 4H4MA 3HO1A 1C0TB 1UCNA 4CT8A 3L7PA 4ED0A 4OL8A 1CBKA 2PMHA 1MU2A 2OSRA 2K3IA 3KDNA 5KT4A 3KHLA 5K20B 4JYAJ 3W2VB 1FT8A 2XEXA 3H0PA 2OD4A 1HI8A 2AJFE 3HSDA 1N6QA 4KRWA 1IM4A 3FEYB 4I68A 5F9NA 5HLFB 2K9IA 2VKRA 1U48A 2B7BB 2QMUB 2DGQA 2HKEA 3UFCX 3BJYA 2DGWA 2VG7B 1U2FA 1UVLA 3QJLA 4OZLA 1L3SA 4YEAA 1HQEA 1NAQA 4ILMA 1AFJA 1TUWA 1H2UX 2ZWPA 4RUBA 3MURP 2W8LA 5HROA 5IT9U 3HSZA 2C28A 3VAFA 2HRUA 2Z2MA 4DL3A 3TZZA 1KLMA 4M5LA 1N52B 3KLEB 1K73T 4M5MA 2CQIA 4NYPA 3MI7X 2MEWA 1WDTA 4K4TA 2CPIA 4ZK7M 2R7RA 1RWXB 2DNKA 1OS5A 2DTJA 2GV1A 4IG3B 1FVSA 4PYDA 1N5YB 4IDKA 2FTRA 3RBZA 4PKDB 4RW8A 2ZEJA 4C98A 4CTAA 1SJQA 1S77D 1RWOB 4LF9J 4N76A 1HWUA 2VFRA 3ICLA 2YX7A 3M6WA 5F9LA 2ATCB 1VBZA 2WONB 4I64A 4EO8A 3NGDA 4DF4A 4F7VA 4TN2A 3TRGA 1B28A 3GIMA 4I2PA 1Y00A 1LW0B 3MEKA 1TKXB 3H2LA 4ZCMA 4USWA 3TOQA 3CCUS 2QLBB 4J9UE 4LF9F 2Q2KA 2RVJA 1NK0A 2A3JA 5K8PA 3B4DA 5C42A 1VQ7S 3G96A 5HQ8A 3J7AN 1U25A 3MF5A 1Y11A 3MM9A 4M63A 4CLFA 4WZQA 3BBBA 3M6VA 3QGGA 3KUGA 2J9DA 4NMXA 4H4KC 5HO4A 2R7SA 1RE1B 2J9CA 3QIPA 2E1AA 2F3JA 5I4MA 4L73A 3OV7A 4LQ9A 2WBRA 3LOUA 1UJ6A 1XERA 4UZBA 1U1QA 4PWWA 1X9WA 4DPUA 2IVYA 2OEJA 4WFZA 3QQCD 1WC1A 2AF6A 2W2OP 3VALA 1YJWS 2HNDA 1NB7A 3OL9A 1S12A 3RRKA 1Y7PA 1QTGA 3JSBA 4AE5A 5DDRC 1UL3A 2XYGB 1JLAA 1HMVB 2C2KB 1SH0A 2OPRA 2CNKB 5DGBA 2F63A 2DNRA 4DUZJ 4K0KF 2DHAA 2IYGA 2QA4S 4LF7F 3R5BA 3FSXA 3R27A 5K14B 4LBPA 2RDDA 4IH6A 3HSJA 2I6WA 3TAQA 2JEGA 2DGVA 4CO1A 2AJQA 4FP9A 4DCJB 2BQUA 3KNGA 4RW6B 2A2CA 2AWZA 1JJ2R 1SQEA 3BR8A 3N01A 4ZVOB 1S9GA 3QO9B 5K8MA 1S1VA 1F5CA 1WEXA 3LANA 3EYZA 4DFPA 2CJKA 1RTIA 3G82B 3KDOA 2RBFA 1RI7A 2B43A 2F7VA 3DRRA 4MIAA 4TY9A 2ZE2B 4B3OA 3HZGA 2HVIA 1EARA 4M5GA 2G13A 1S9GB 3QO9A 2J6TA 2GX8A 5KT2A 2ZJPQ 4PWDB 2XGQA 5KT6A 4RW6A 3D9BA 2MB0B 4R8UA 3NNCA 2FHOB 2V9WA 2VQFJ 2LLZA 4URSA 2Z30B 4WTOB 4HKQA 3J7A1 4FVMA 2FGCA 1N5TA 1ZA1B 1TL1B 2VUGA 3DRYA 5L9XA 2OTJS 5A76A 1HD1A 1VC5A 1KS2A 2RQMA 3GILA 4UUWA 4DSIA 3T6JA 2CAJA 4BWJA 3GSDA 1NH7A 2E1PA 1OJ4A 3GE9A 3NBPB 4OZ5A 5CHCB 5EUHA 1HMVA 2YKAA 3ZTSA 4B9TA 1Q8KA 3E2EA 2WSCC 4FXVA 3JS9A 1TQLA 3NS6A 3BSCA 2NQPA 3H87C 3GXQA 1GFWB 3R7NB 4AD6A 3KMQA 3Q8PB 2KN4A 2W4PA 3NGUA 3NS5A 4ZVEA 2YNGA 1AZSA 4L72B 4J9PA 1S6UA 1T9XA 6FD1A 4U7UK 3V81A 3F44A 1FDNA 3H5XA 1G4CA 4NEZA 3QBCA 1JLEA 4OX7A 5A2QY 5IV3A 4CNZA 2ZNYA 4UF4A 4CZCA 2PDAA 1I94F 1HBMA 3DYAB 3NAHA 2RUGA 2CG4A 3PHEA 3PTWA 4OZ2A 1RHQB 2XZTB 3OHAA 3DRSA 4NLTA 4ZPWR 2I9SA 5KFNA 2ZBPA 5KFEA 4OYXA 2E5JA 2IM1A 4HHHA 4CLKA 4ECYA 2M8DB 1V9OA 2R8JA 4ATNA 3PXGa 4B08A 3RRGA 2AKWB 3CJ0A 4F26A 3G6XA 1WJ9A 2BW2A 2HFSA 1Q4RA 4DL7A 1MW7A 2B8QA 2BE7D 2O67A 4YB1P 4KGKA 4CO0A 3W5ZA 5GMDA 3M1VB 3H5UA 5K5MA 2HAIA 2QE5A 1Z2LA 4WU3A 1NHVA 1FDDA 3CDBA 1X4FA 3TA0A 1CJKB 1FRJA 3T5HA 2GC8A 1UJ4A 2VZ9A 4WP8A 1FJ7A 3J7ZT 2VG5A 2B5JA 2AEJA 3G87A 5F8HA 4IUFA 2NXUA 1N5YA 4FZVA 2HHUA 2DXFA 2I8EA 4LIWA 3QT7A 1EX8A 3FEXB 2G2OA 2DGSA 2DNLA 3DMJA 4G65A 4DLGA 2ZUAA 2HMIB 4N47A 4JI7J 2CNNB 4OJGA 3TJAA 2RS2A 3HD2A 1KLNA 2MTLA 2R8IA 5HVGA 3R9LA 1T03A 3M9NB 3ZZRA 4J9MA 2M88A 3R8YA 1RT4A 3TNVA 2XQCA 4LMZA 2H4WB 1LWFB 3KLHA 3BQ1A 4HYKA 1PC4A 2A10A 1FA0A 4ZJLA 3US5A 2EXUA 3D5MA 5EWEA 1GX6A
chains in the Genus database with same CATH topology
2JXIA 2CPGA 1P94A 3OD2A 2RBFA 1BDTA 2GPEA 2JXHA 3QOQA 2BJ1A 1ARRA 3PHTA 2WVEA 2K5JA 2KELA 2K9IA 1BAZA 1EA4A 2BNWA 2H1OE 2JXGA 3FMTA 1NLAA 2BJ9A 1QTGA 2K6LA 1B28A 1Q5YA 1MNTA 2CADA 2BSQE 1X93A 1BDVA 2CA9A 3LGHA 1IRQA 4FXEA 1U9PA 2K29A 4HV0A 3VEAA 1ARQA 3QSIA 2FGCA 3BKFA 2WVDA 1Q5VA 2BNZA 1MYKA 4D8JA 2PC6A 2Y3YA 4ME7E 2WVCA 1PARA 2BJ7A 2BJ8A 2BA3A 2K1OA 2CAJA 3BKTA 3BKUA 2WVFA 2WVBA 3VEBA 2CAXA 3VW4A 3FT7A 2F1FA 2HZAA 2AY0A 1MYLA 2NZCA 1B01A 2HZVA 3H87C 3GXQA 2BJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXI A;  2CPG A;  1P94 A;  3OD2 A;  2RBF A;  1BDT A;  2GPE A;  2JXH A;  3QOQ A;  2BJ1 A;  1ARR A;  3PHT A;  2WVE A;  2K5J A;  2KEL A;  2K9I A;  1BAZ A;  1EA4 A;  2BNW A;  2H1O E;  2JXG A;  3FMT A;  1NLA A;  2BJ9 A;  1QTG A;  2K6L A;  1B28 A;  1Q5Y A;  1MNT A;  2CAD A;  2BSQ E;  1X93 A;  1BDV A;  2CA9 A;  3LGH A;  1IRQ A;  4FXE A;  1U9P A;  2K29 A;  4HV0 A;  3VEA A;  1ARQ A;  3QSI A;  2FGC A;  3BKF A;  2WVD A;  1Q5V A;  2BNZ A;  1MYK A;  4D8J A;  2PC6 A;  2Y3Y A;  4ME7 E;  2WVC A;  1PAR A;  2BJ7 A;  2BJ8 A;  2BA3 A;  2K1O A;  2CAJ A;  3BKT A;  3BKU A;  2WVF A;  2WVB A;  3VEB A;  2CAX A;  3VW4 A;  3FT7 A;  2F1F A;  2HZA A;  2AY0 A;  1MYL A;  2NZC A;  1B01 A;  2HZV A;  3H87 C;  3GXQ A;  2BJ3 A; 
#chains in the Genus database with same CATH topology
 3TAM B;  2IJN A;  3CWJ A;  1YI2 S;  3L7U A;  2DR7 A;  1WI8 A;  2VH7 A;  3O44 A;  4DR1 F;  5ETP A;  3AD8 C;  2ZNZ A;  5CXT A;  1BAZ A;  3NOG A;  3A8I A;  3QAT A;  2VQF F;  1QSL A;  2PI5 A;  3DLH A;  4OLP A;  4H4M B;  2HQF A;  2NLW A;  1H7W A;  4ZP8 A;  1M0S A;  1WUU A;  1WKL A;  4MK8 A;  3UO0 A;  7AT1 B;  3HHE A;  1FHT A;  3FKB A;  1FEE A;  1VK3 A;  3EPG A;  2KI2 A;  1RAJ A;  2FZG B;  1DTT B;  2OH2 A;  4DR4 J;  4PG7 A;  1FKA F;  1JLC A;  4WF9 Q;  1XC9 A;  2DRB A;  3RGI A;  2GVZ A;  3MEG B;  4UQT A;  3ZO7 A;  4C11 A;  1SBR A;  5L39 A;  2NUH A;  4WCE Q;  3IAS 9;  1FRL A;  1TAQ A;  3K17 A;  1YJU A;  3NOC A;  1OPI A;  2RS8 A;  3CUL A;  1YJV A;  2FVR A;  4R5P B;  5HL7 Q;  5C2G A;  2XGP A;  1JIH A;  3GIK A;  3H8Y A;  1FX2 A;  2C2E A;  4N41 A;  2V6A A;  2M7S A;  5D0R A;  1HYS A;  2O01 C;  4C6A A;  3LP1 B;  1MNE A;  1EZZ B;  4N5S A;  3KK2 A;  2HHX A;  3AOB A;  3FSI A;  2PT0 A;  1WTB A;  2OKQ A;  5LSO A;  2J76 E;  5D3G B;  2Y8Y A;  1UW4 A;  2CQB A;  3NO7 A;  1YVF A;  3DGV A;  3DI6 A;  4G1Q A;  2R2T A;  5F8G A;  2H1Y A;  1RWK B;  2CZ4 A;  2WVC A;  2GHW A;  3TW0 A;  4I6A A;  3W2W B;  4QW9 A;  1S59 A;  3UCZ P;  1RSC A;  2EFP A;  3CPW R;  1APS A;  4ZVP B;  2CXE A;  2D74 B;  2IHR 1;  2WW8 A;  5C25 B;  2F1F A;  2ZDO A;  3JSY A;  1HNV A;  5KTQ A;  4DS5 A;  1GT8 A;  3SV3 A;  5JXS A;  2HQC A;  5KFR A;  1BQM A;  2C2O B;  2VC0 A;  4QPT A;  4DCO B;  3GP9 A;  4O3P A;  1W25 A;  4KPC A;  1O5J A;  4BCA A;  1UMJ A;  3Q89 A;  4Q0B A;  2K1R A;  4Y65 A;  4EZ6 A;  2CPH A;  4ELV A;  2GGP B;  1NKC A;  1ICE B;  2E9Z A;  1M5H A;  2PE8 A;  1I1G A;  4IG0 A;  4NYZ A;  2RDJ A;  4KGX B;  1IUJ A;  3Q22 A;  3G2X A;  1F1B B;  2CYY A;  4IR9 A;  1QAI A;  1B3T A;  3HFZ B;  3EGN A;  2AIR B;  2MJN A;  4CYU B;  3TUI C;  4NI2 A;  1BQX A;  2E5H A;  3N4W A;  4WII A;  1KFS A;  4ZVT B;  3PNI A;  2MQ8 A;  1WG1 A;  2YNH B;  1SJF A;  5KFH A;  1PJ7 A;  2E5I A;  4DSJ A;  2B4U A;  4FXD A;  4HI1 A;  3QT8 A;  4ZP7 A;  1FDB A;  1DY3 A;  2CQD A;  2JX2 A;  2FJB B;  1TK5 A;  2EK6 A;  2QL5 B;  1AB8 A;  3IC1 A;  1PIL A;  1S7I A;  1CJV A;  3FQL A;  3ET6 A;  3ETM A;  3IS9 B;  4RBV A;  3VF0 B;  2C2R A;  1SL0 A;  1RAO A;  5K9F A;  4CDI A;  4JV5 J;  3MFI A;  4IFY B;  2QFJ A;  1E6V B;  1E6Y A;  1IR1 A;  1VQ4 S;  2KHD A;  4O4R A;  2C1E B;  2MZJ A;  4LJM A;  3SCJ E;  3ELH A;  1AUD A;  5CZX A;  3HXM A;  4FF3 A;  1YWX A;  1F2G A;  3CE8 A;  3CJQ A;  2E66 A;  3K5P A;  3H5S A;  5H9E J;  2DHS A;  1SJ4 P;  1U02 A;  1ZYQ A;  1TL7 B;  4JI8 J;  2HK2 A;  2PMW A;  2HNZ A;  2RIL A;  4DUY F;  2VPW B;  3IRW P;  3PFE A;  4Y3C A;  1X31 C;  3GPA A;  3T5L A;  1NME B;  2QA1 A;  2Z0G A;  3CCS S;  3T1H F;  4X4N A;  2KDO A;  1LWE A;  2V8G A;  3AJ2 A;  4DL5 A;  3M2R B;  3C14 B;  4LF1 A;  2KT2 A;  1WHW A;  5KG4 A;  1VRT A;  3JTN A;  1IBM F;  2CVE A;  2YKO A;  4RW4 B;  3ZZZ A;  1LW2 A;  3DM2 B;  2KO1 A;  2DIV A;  3ADA C;  2BXJ A;  3H7H B;  2N3L A;  5FDL A;  5BJR A;  2E7X A;  4ECX A;  1WD6 A;  1SIW A;  4EMD A;  3E3X A;  1RTZ A;  5KFF A;  3I82 A;  2UVV A;  4OX8 A;  3MPD A;  4C3L A;  2CDQ A;  4IH5 A;  2VIC A;  3QRQ A;  1RWV B;  3HVT A;  3DOM B;  3VEA A;  1NB2 A;  5KT5 A;  3VQT A;  1FKP B;  1FE4 A;  1RHR B;  4CM2 A;  5HQL A;  5HJX A;  3Q83 A;  3VGV A;  2QLX A;  4FPR A;  2VQE J;  2MKY A;  5FDL B;  1LW2 B;  3WIV A;  2CQC A;  4CT9 A;  4DSF A;  2WOM B;  2RQC A;  3SYZ A;  2E9T A;  3DGP B;  2QLW A;  1F9H A;  3N28 A;  5E7O B;  3VGU A;  3C14 A;  3IR5 B;  1QSY A;  2B9W A;  2C2Z B;  3OLA A;  2MJU A;  4OYI A;  5D78 A;  1S1X B;  2FC9 A;  1PJ6 A;  1ZA2 B;  3MXH P;  1CQM A;  4M5D B;  4DFK A;  2DKO B;  4MH8 A;  3WHI A;  3QPI A;  2HNZ B;  2VPY B;  2AU0 A;  2MMY A;  2Q6C A;  4DS4 A;  1V3R A;  3TUZ C;  1NJW A;  3I0R A;  1PYS B;  2ZC4 A;  1BLU A;  4TU8 A;  4ERD A;  1Q0N A;  1ZZF A;  4NLV A;  3CCW A;  4Q44 A;  2V63 A;  3R7S B;  1FKO B;  1N0U A;  3P8B B;  5ADZ A;  3SCL E;  3M2V B;  3K58 A;  3LAM A;  3R5A A;  2ASD A;  4LSZ B;  2ASJ A;  2BAB A;  3GYN A;  3HKZ D;  1A6L A;  2LCW A;  1RKI A;  3ISN D;  2MSS A;  4IFY A;  3TWZ A;  4Z7C A;  2VJU A;  1W2B R;  2H51 B;  3MHY A;  4N56 A;  4X65 F;  2R7W A;  4ECW A;  1IBM J;  4E0D A;  4OJ1 A;  1IVZ A;  2C3M A;  2QL7 B;  3HX9 A;  3KKF A;  1S1U A;  2FHJ A;  2AN7 A;  3N6M A;  4ZJO A;  3R2D J;  4QWA A;  4YOE A;  2LDI A;  4LF4 F;  1HFE L;  1VQ6 S;  2EKN A;  2F40 A;  2NYH A;  1P1T A;  2YNH A;  1FRM A;  1GNK A;  3I31 A;  3ISN C;  3TYT A;  2QTW A;  5BXI A;  1GH8 A;  3DHX A;  4NI2 B;  4MJK A;  3KTQ A;  2BEF A;  1YRX A;  3MM5 B;  1LEO A;  5F8M A;  2FVP A;  4CO3 A;  5DDO C;  3HVR A;  2X1B A;  1RTH A;  5KFQ A;  2OSQ A;  1GXT A;  3M7V A;  1OYE A;  1GMW D;  1RT5 A;  2QX0 A;  2FVQ A;  1BMQ B;  3K89 A;  2KU7 A;  3LO3 A;  1LV5 A;  4LQ3 A;  2BVZ A;  4NRT A;  2WCX A;  1HR0 J;  4ZN1 A;  4RL1 A;  4RNN A;  1UEV A;  1A9N B;  1R8C A;  3VHQ A;  3B54 A;  3MM5 A;  3BGR A;  3UD3 P;  4NCB A;  5HP1 A;  2IM0 A;  4X4R A;  2IPO B;  1HWI A;  3G86 A;  2LQ8 A;  4QIG A;  2BKN A;  2AYB A;  1AFI A;  1H72 C;  4F0M A;  2XHC A;  3ILJ A;  3MAA B;  4AXI A;  1C1B A;  4J90 A;  4HHU A;  5M2U A;  1DTQ B;  1Q79 A;  3CJ4 A;  2H54 B;  4OHV A;  2VV5 A;  3D6H B;  3K5O A;  1RLD A;  2K7J A;  2NSC A;  2GAG C;  1EB0 A;  2RSQ A;  3FZ2 A;  5ETM A;  3W2W A;  2XBP A;  2LQ9 A;  3NGT A;  3DI6 B;  3M2V A;  3NGK A;  2HQD A;  3MGJ A;  3PIO Q;  2R8K A;  1T9W A;  1Y4Z B;  1QLN A;  1FWP A;  2OML A;  3UD4 P;  4LRV A;  3LQV A;  2Y1I A;  1IXK A;  5GAG I;  1FXL A;  3MED B;  3CXC R;  3LGH A;  4Q43 A;  3CCR S;  1IWA A;  2VA2 A;  3DC2 A;  4TLR A;  4M95 A;  1RT2 A;  4ZPD A;  1B7F A;  3WC2 A;  1GAO A;  2LEP A;  3SSS A;  4A46 A;  3J7Y U;  2BRK A;  3UN2 A;  1IBL F;  2X1F A;  4M5D A;  1W2I A;  2BUN A;  3OXG A;  4UOC A;  1TEL A;  4R5P A;  4DV6 J;  2EC0 A;  3HHD A;  5AJ3 J;  1YZ7 A;  3D1Q A;  3FEZ A;  2MKK A;  2KXN B;  3HPO A;  3R2C J;  1RWN B;  2CIM A;  5KG0 A;  1FRI A;  3D7S B;  3PYG A;  4PCQ A;  1SB6 A;  3RR7 A;  3HLU A;  4YDD B;  9RUB A;  4DCP B;  4Q2M A;  1RB0 A;  2X3D A;  2XZW A;  3A3N B;  1DTT A;  2EFQ A;  4C0O C;  3PYF A;  4LUB A;  4ZMM A;  2PII A;  1ARR A;  3DOM A;  1H73 A;  1U7L A;  5LXR A;  1FO1 A;  2HAF A;  3FSY A;  2ZH6 A;  4DR3 J;  2VPZ B;  3AXK A;  4C8Y A;  1RAE B;  2CQP A;  1R8A A;  5HMZ A;  2V34 A;  2D3Z A;  3M8Q B;  2RU3 A;  1SIW B;  1LFW A;  1HAR A;  1VGY A;  2C3O A;  3FBC A;  2QLF B;  4G3I A;  2JOQ A;  3ITH A;  4RLE A;  3TUP A;  3LPY A;  1VR6 A;  3IA0 A;  4X4S A;  3T5K A;  1WKK A;  2KVI A;  2B56 A;  4CLU A;  1WF1 A;  2UXC F;  2L08 A;  4X4Q A;  2VBW A;  3KLH B;  1K0T A;  2EG2 A;  4JV0 A;  2EI5 A;  3N6L A;  4DL6 A;  5KFO A;  4KPY A;  1UFK A;  2DRD A;  1XR6 A;  3CD5 A;  3DLJ A;  4J7C A;  3M8Y A;  4MIW A;  2EFV A;  1FER A;  2V94 A;  4DX7 A;  4MKB A;  2B6A A;  1DJ0 A;  1S7H A;  5E3A A;  5DQH A;  4ZP6 A;  3PRV A;  1NEE A;  1ZTT A;  1NHU A;  3EJM A;  4KV8 A;  3DMJ B;  4QW8 A;  2XY6 A;  5DQG A;  4EU0 A;  3EE3 A;  4FYV B;  4GKK F;  1FF2 A;  2BJ9 A;  3AAW B;  4CWB A;  1WSR A;  4OZJ A;  4MYU A;  5KG7 A;  3P4U B;  4PRF A;  4LFC J;  5T7L A;  5CQG A;  1RYR A;  2QMW A;  4H4K A;  2VG5 B;  2C2N A;  2E5G A;  1E6Y B;  1IKV A;  2MY8 A;  1HWL A;  2YX4 A;  3WZ0 A;  2IJR A;  4NLG A;  3VAG A;  1RYS A;  3ET6 B;  3IS9 A;  1CJV B;  2VD3 A;  1TL4 A;  1QJH A;  1I5O B;  3DHW C;  4U8V A;  5J2N B;  4JI3 J;  2RML A;  5J2M B;  3SI8 A;  2KVQ E;  2MXY A;  1VQO S;  2DGT A;  2Z8Q A;  1Q7Y T;  4YHH J;  3CJS A;  3SCI E;  4OYP A;  3IM8 A;  1VQN S;  4NZ6 A;  1UVI A;  2CRL A;  2FZK B;  2VHG A;  1CUL A;  2ABY A;  3T1Y F;  1T8E A;  3OL7 A;  3MM8 A;  3GJR B;  3I87 A;  4NLU A;  4ETZ A;  1NDP A;  1FWL A;  1NDK A;  2DNZ A;  4K4W A;  3DYA A;  2ZHB A;  1NSK L;  4LF6 J;  4LF4 J;  1CSJ A;  1N88 A;  2CJY B;  2XYH B;  3TEH B;  3KHR A;  1BY9 A;  1PC5 A;  3B82 A;  1ARQ A;  3UVJ A;  4DQQ A;  4FPI A;  4MK9 A;  4LF5 J;  2K1R B;  1RA7 A;  2ZOG A;  4H4O A;  4QBU A;  4FXW A;  4ZIV A;  2XY7 A;  2YNG B;  4K4U A;  4OLO A;  1Y10 A;  4TYA A;  1B64 A;  1HWK A;  4H54 A;  1F3V A;  2Z2Z A;  2HHV A;  2OGU A;  2DPI A;  3DCA A;  3ZTP A;  3L9Z A;  5ETT A;  1M90 T;  2GO8 A;  2HZA A;  1MLA A;  1EJ7 L;  3VZH A;  4B3S J;  4OHX A;  8ATC B;  1BD6 A;  3EMT A;  4O3N A;  5IV4 A;  4DR4 F;  2MLY A;  2DRA A;  2E1M C;  1TL1 A;  3MM6 B;  1IR2 A;  3FBF A;  3DRX A;  2BAN A;  5ITH A;  1JNZ B;  1PAU B;  2ADB A;  1XBW A;  3QRR A;  1RWW B;  1NPP A;  3VZI A;  4X2B A;  3PDN A;  2K6L A;  1UPP A;  5D4P A;  4IRC A;  5IM0 A;  1S49 A;  2JLE A;  3BR9 A;  5L1K A;  4NXM F;  1TUG B;  2N3O A;  2A2B A;  3HCX A;  3C15 A;  2ZE2 A;  2ZKU A;  2ZH3 A;  4B3O B;  3IGN A;  1H74 A;  1N54 B;  2I38 A;  1RTI B;  1PYO B;  3OHB A;  4IFV A;  1RTD A;  2DPJ A;  4M1K A;  3GQC A;  4P7T A;  4C11 B;  3C8Y A;  2D69 A;  3ILL A;  5ETR A;  3A3O B;  4FS1 A;  2XMK A;  4ES3 A;  4YY3 J;  1RUS A;  2PSZ A;  4OJH A;  5DG8 A;  3DOL B;  2V9K A;  4ECQ A;  4K7Q A;  3BYP A;  4ZVR B;  5K14 A;  3VQS A;  4CLP A;  1URR A;  4LVN P;  2YWK A;  5KFT A;  4NX9 A;  4ES2 A;  4EBC A;  1U09 A;  2XMV A;  3DDN A;  4DF8 A;  2PI4 A;  3GWC A;  1L5U A;  3TVK A;  5KOX A;  2DGX A;  2DH7 A;  1DAX A;  2NYI A;  3AJ1 A;  3ZZU A;  4CO2 A;  4NLX A;  3C6U B;  4DU8 A;  2XLJ A;  1KTQ A;  1MMN A;  1XR7 A;  4PAA A;  3KLF A;  4WJB A;  1FXD A;  1WI6 A;  1M1H A;  4RO0 A;  1HW9 A;  1HNX J;  3PEH A;  4HH1 A;  4WXW A;  5J1N A;  3TAM A;  1Q82 T;  3BKT A;  4JBC A;  3OR1 B;  2A6M A;  2DH9 A;  2QSW A;  3THP A;  4LRF A;  4MTP A;  3A8E A;  3MM9 B;  1AYE A;  1GTH A;  4KHP F;  1FD8 A;  4U67 Q;  3GIR A;  2HBZ B;  3V5R A;  1YHQ S;  2L9D A;  4OMF G;  2WTF A;  2IDE A;  3VVU A;  2IA6 A;  4YB7 A;  2PMZ D;  2W7O A;  1D9F A;  3ZNJ 1;  4K0K J;  2VG6 B;  1EQM A;  3SEO A;  3T41 A;  3K59 A;  5HN0 A;  4Y2A A;  2G2Y A;  2P9C A;  1Q5Y A;  2D1C A;  2HUR A;  4P2F A;  4YP3 A;  3Q8S B;  1G7C B;  2YKM A;  4PAB A;  2B5J B;  2Y1J A;  2ALZ A;  2U1A A;  2ALY B;  2WON A;  4ZVF A;  4PG6 A;  1VIS A;  4QIE A;  5H9F J;  1VQM S;  1ZPW X;  2J8A A;  3I5A A;  3KXD A;  3M1V A;  1P27 B;  3CJT A;  1NSQ A;  2YKM B;  3SXL A;  4ECV A;  2YX1 A;  4TVA B;  2DVI A;  3N5F A;  3HHL D;  3PR5 B;  5LOQ A;  1OO0 B;  2IDL A;  4J9V A;  3RB4 A;  1BUX A;  2VG6 A;  2A1B A;  5E3R A;  3OSP A;  2FLP A;  2B0G A;  1ZET A;  3KLE A;  3S6E A;  3UDL A;  4JI2 F;  2CPX A;  5ETV A;  3ZZT A;  3DRS B;  3GON A;  2W4C A;  4WFA Q;  3K5L A;  4DQI A;  2JWN A;  1HQE B;  3UDC A;  4RBT A;  4DBQ A;  2QLJ B;  4ETX A;  5KFB A;  2R8H A;  4U8Y A;  4DN9 A;  1EHW A;  2W7A A;  3SSQ A;  1S48 A;  5HLF A;  3DLL Q;  2WBM A;  3PRD A;  4NCA A;  1D3W A;  1V6H A;  1N6Q B;  1S79 A;  4OYA A;  3W2V A;  1SC4 B;  4AFF A;  1S0M A;  4DSE A;  5CAA A;  1QUP A;  4ILL A;  4JUZ A;  3C66 A;  3DLB A;  2GIR A;  3EUN A;  4ILR A;  1HNI A;  2BOA A;  2JZ5 A;  3GJT B;  1DRZ A;  1T9U A;  2DNH A;  3IFE A;  3M9O B;  4A8W A;  3DOL A;  3X3U A;  3UW1 A;  1HQU B;  1U2C A;  2M2B A;  2BBE A;  2MQO A;  1L3V A;  3EGV A;  2H48 B;  3H5Y A;  1UAW A;  3PRB A;  3RZA A;  3D1O A;  1FEH A;  5FII A;  1A7G E;  2CG8 A;  5DM6 Q;  1OYD A;  2RE1 A;  3BF4 A;  3BKU A;  3CJ2 A;  4M8L A;  1RTD B;  2ZHO A;  1XWL A;  2MKH A;  1VBK A;  2JLF A;  4QIV A;  3IR7 A;  2L9N A;  3BN7 A;  3G82 A;  4P7V A;  1X4A A;  2EWH A;  3C15 B;  5E3P A;  1D9D A;  4PEO A;  4LF7 J;  1NDL A;  2BA3 A;  2KG0 A;  3NL0 A;  2Q43 A;  1T94 A;  5FD1 A;  5DDQ C;  5IM0 B;  1RGV A;  1WOS A;  3SDE A;  5T14 A;  2NSB A;  1XNR F;  2QV6 A;  1OSC A;  1DAR A;  3AD7 C;  4LRC A;  5E2Q A;  4ANC A;  5A8R B;  4KQZ A;  4OI4 A;  3MM6 A;  2LP4 A;  5B08 A;  4DV7 F;  3KLI A;  3NNA A;  6FDR A;  3BPS P;  1GK8 A;  2I2Y A;  2RU9 A;  3Q24 A;  4LF8 F;  2XS2 A;  2KZZ A;  2B9Y A;  2VFV A;  3DLG A;  1H2T Z;  3VAM A;  3AA9 A;  2OPR B;  3MDF A;  2O1P A;  5E3Q A;  4WFN Q;  2J0X A;  4CLY A;  1QVG R;  1U8W A;  2HND B;  4FN5 A;  4B9N A;  2HHW A;  2F5G A;  1PG5 B;  2XCP A;  2OEM A;  1IJF B;  2ZBQ A;  1F0X A;  2WB4 A;  4HVZ A;  4ZCK A;  1GMW A;  4MAK A;  1KN6 A;  1RAG B;  3UI3 A;  1I51 B;  2XO6 A;  2YWH A;  2G0C A;  2O5D A;  4GO7 X;  4NZ7 A;  3QIP B;  3BRE A;  2ADL A;  2YWG A;  4H4O B;  2APO A;  5KFG A;  2VBX A;  3KK1 B;  5F8N A;  5GME A;  3HM9 A;  2WB1 D;  1SKU B;  2YKN B;  5JJB A;  3K57 A;  3PY8 A;  4ZIT A;  3V4I B;  2H5J B;  1QTN B;  3CVK A;  2GAH C;  2FHM A;  3PKM A;  1VQ9 S;  3MM8 B;  3N79 A;  3P3D A;  4C0B A;  5C42 B;  2ZHA A;  1JMT A;  1LKZ A;  4ICL B;  3KHH A;  5I42 B;  2HFN A;  2K06 A;  4KHM A;  2IYI A;  1JJH A;  3CCZ A;  1UEK A;  4ZIW A;  1K1Q A;  2J7W A;  3ENV A;  5EGY A;  2YVS A;  4DQP A;  2A2D A;  5J2M A;  5J2N A;  2MQL A;  2QJ3 A;  4DHV A;  2FHK A;  3CED A;  3OTC A;  3JQJ A;  1YBA A;  4NYO A;  3HF5 A;  2HVH A;  1YX2 A;  3HFV A;  5G0R A;  3J7Z 5;  2GIQ A;  1XJW B;  2BKP A;  1FK9 A;  4EYI B;  5IT4 A;  1U0H B;  4TYB A;  4C3M A;  3D6F B;  5RUB A;  2W9C B;  3FCH A;  3K5M A;  1KP6 A;  2JNJ A;  2POK A;  4BBY A;  1U0S A;  2Z4P A;  3H2U B;  3NCP A;  1YK9 A;  4RW8 B;  3RG6 A;  4OI0 A;  4FF1 A;  3CDU A;  1WEY A;  3ZTR A;  1LK5 A;  1Q95 G;  2MKC A;  4IG3 A;  1ULR A;  3I4P A;  4RW9 A;  4ZPT R;  3L3C A;  2KTQ A;  5IQ6 A;  3M30 A;  1XMQ J;  3E01 A;  3PKY A;  3PO4 A;  4NXN F;  3MCM A;  1KLM B;  3U1M A;  1T3O A;  4EZ9 A;  2XY5 A;  2FLN A;  3ZZ0 A;  2MZ1 A;  4C8O A;  3MCN A;  3PJW A;  5HRO B;  2F9J A;  4P10 A;  1UKU A;  4LBI A;  1SXL A;  4TNO A;  1QSS A;  4FBU A;  4DFJ A;  3SSR A;  1FDA A;  5B09 A;  4G6V B;  2BM0 A;  2NS1 B;  4QWC A;  1J5E J;  2AX1 A;  2VG7 A;  1Q8B A;  2VBZ A;  2ZZM A;  4RW7 A;  1PO6 A;  1Z1Z A;  4Y34 A;  2VOP A;  4FXE A;  5MLC V;  1NK6 A;  4JV2 A;  3BBC A;  1LWC A;  2MZR A;  4OHZ A;  2IMW P;  5L1L A;  3ILI A;  3GV8 B;  2M9K A;  1B0V A;  3NWR A;  4NAS A;  3M8Q A;  3EWG A;  1NJI T;  2QG9 B;  4OZ1 A;  3T19 A;  4W4M A;  1XNR J;  1CS4 B;  1WTF A;  3M8P B;  1O6X A;  3MEC A;  2BZ2 A;  2YH1 A;  4ZCI A;  2GVD A;  4L74 A;  5LL6 d;  2ATL A;  4OI2 A;  5GVQ A;  3KJV A;  1RJJ A;  3BEG B;  4PQU A;  2DGO A;  2XWY A;  3TAR A;  3MMC A;  2J0Q D;  1VQL S;  4HHJ A;  1T11 A;  1WOO A;  3A3P B;  3W8G A;  1FE0 A;  2YBV A;  5LMN F;  2NUU G;  1RAC B;  1MWQ A;  1HR0 F;  2DNG A;  4WE1 B;  3T3F A;  1BXN A;  3FBB A;  4LSN B;  1MWZ A;  2CQ4 A;  1DQ9 A;  1HNX F;  3MPY A;  2WK4 A;  4KSE B;  4I1T A;  3DFE A;  3CMA S;  3MCS A;  5GMK a;  4QR0 A;  4N77 A;  2V8D A;  3M2U A;  3UE2 A;  3P49 B;  1FTC A;  2W24 A;  4KY3 A;  3GIJ A;  1OPZ A;  2VKZ G;  1VQ5 S;  2YQ1 A;  2B4P A;  3QGP A;  3CGI A;  3BQ2 A;  2ZH1 A;  4AQY J;  2WSF C;  3OTB A;  4EBE A;  4GO5 X;  3ISZ A;  4ZN3 A;  4ALZ A;  2KT5 A;  3R3T A;  1FX4 A;  2HLU A;  1D9A A;  1S4E A;  2YQ0 A;  3A8J A;  4K2X A;  1C1C B;  1VI7 A;  1X5S A;  4IOC Q;  4YS2 A;  4MKY A;  1UFW A;  3L7O A;  4M5I A;  2ZH2 A;  5HK4 A;  4LT6 A;  1UP1 A;  3M32 B;  2BDP A;  2K2P A;  2FYX A;  1HI0 P;  3MAA A;  1CC8 A;  4J5O A;  4PXC A;  4J9O A;  5HAN A;  4A48 A;  4DG1 B;  3G6E S;  3EX7 B;  1O8B A;  2O3D A;  4BLG A;  1TKT A;  3D54 A;  3TQE A;  4DV6 F;  2UUC F;  5GAE U;  2HNY A;  1VQP S;  3BGR B;  3HZE A;  1MRO A;  4B3R J;  2JBV A;  1SV5 A;  3TO8 A;  4C48 A;  5D8H B;  2MQN A;  3AQO A;  3LPE A;  5A8W A;  1SJ3 P;  4MK7 A;  2NRE A;  2ZC3 A;  2IFX A;  5M2R A;  5KFV A;  1RT5 B;  3PW4 A;  3I96 A;  3S7R A;  1Y5L B;  1N8R T;  1RTH B;  1N56 A;  2FVS A;  4KR0 B;  1TKD A;  4JI5 J;  1YIT S;  4FF2 A;  2R7T A;  2R7X A;  3QMQ A;  1C2P A;  3CMQ A;  3HHL A;  4JI0 F;  2IJF A;  2NCK L;  1S9E A;  4DR7 F;  1DQA A;  1LXN A;  1QD1 A;  1Y3K A;  1R0B G;  2JXH A;  3QOQ A;  4UW2 A;  1TAU A;  3LP0 A;  4YY3 F;  3GJQ B;  4LFC F;  4UY8 5;  2CWK A;  2GHP A;  4C8M A;  3ZZY A;  3MR3 A;  3UWT A;  3RBX A;  4O3R A;  4LR8 A;  4YME A;  1NK5 A;  1CVJ A;  3UN5 A;  1U1O A;  2HQI A;  1AT1 B;  2X7I A;  4FYW B;  4L3K A;  4JI0 J;  2OPQ B;  4D8J A;  2XNR A;  1R27 B;  3CSK A;  3FFI A;  4P74 A;  1FRK A;  3GMG A;  3EZO A;  1T9Y A;  3PJ9 A;  4R0E A;  1WC6 A;  4RWX A;  5CH7 B;  4HTI A;  4UQG A;  3HJF A;  3OFG A;  1TP7 A;  4C8Z A;  2MQM A;  3MEE B;  3H20 A;  2DGU A;  4DV3 F;  3CCT A;  2M3D A;  6AT1 B;  3I0R B;  5DGA A;  4DQR A;  1OY8 A;  1VMB A;  1BC6 A;  3CJK B;  1PBU A;  3MOZ A;  1JKH A;  2AZ1 A;  2KM8 C;  2IRX A;  4I69 A;  3GSI A;  3O2I A;  4J9K A;  3NLC A;  4DV5 F;  3AT1 B;  2EEY A;  1NK9 A;  2HW3 A;  4DPT A;  3SZ2 A;  2UVR A;  4GMK A;  1RIS A;  4K8R A;  5DS7 A;  3TA1 A;  4DUY J;  4MT1 A;  4BC7 A;  2QZ8 A;  4EK2 A;  2HSE B;  1IQT A;  1BWV A;  4X65 J;  1C0U A;  4WZM A;  3SFG A;  1NSA A;  2OUG A;  5DO2 A;  4L6V 3;  4TU9 A;  1ELO A;  1JX4 A;  1FKP A;  2ACY A;  3D6T B;  2UP1 A;  4Q5V A;  2NZ4 A;  1X4E A;  2IM3 A;  3HVT B;  4NCG B;  2LEB A;  2C3P A;  2K8G A;  2CAX A;  2DK2 A;  2CJB A;  2EPI A;  2EFN A;  2PEH A;  4ZPB A;  3T1H J;  2GJI A;  1JLG A;  3MR7 A;  5BR8 J;  5M2P A;  5AJ3 F;  2DIS A;  2FHJ D;  4KE5 A;  4MFB A;  5DDP C;  3JYT A;  1LQ9 A;  1MN9 A;  2LA4 A;  3IGV A;  1T05 B;  5LSL A;  2UU9 F;  1SPB P;  2NXC A;  3DM2 A;  3MMA A;  2CQH A;  4RW4 A;  2DH8 A;  1NDC A;  2AEM A;  2G1D A;  2NXN A;  4NLQ A;  4XDC A;  1VRT B;  4GVL A;  3HVA A;  3NRB A;  4NE9 C;  2ZBC A;  2ZH5 A;  1ZTW A;  3M2R A;  1HPZ B;  2JEJ A;  1LWE B;  1MML A;  2E29 A;  4ED4 A;  4ELT A;  1FJG F;  1WDD A;  2OO4 A;  2LMI A;  7FDR A;  5L46 A;  3DDK A;  3B6B A;  3EGZ A;  3WX8 A;  3JQM A;  2XWX A;  4CP5 A;  1U49 A;  4HDH A;  3RB6 A;  4CLT A;  4JB8 B;  1TTH B;  3CCL S;  5C5J A;  1H7X A;  1CQN A;  1RK8 A;  1WHV A;  1T9V A;  1UJ5 A;  2RIJ A;  2RHS B;  4J91 A;  1R0A B;  2AEF A;  2DR6 A;  5DZ6 A;  4TY8 A;  2H5E A;  3PR4 A;  2R9L A;  3AOA A;  2K1O A;  5G4D A;  5BYS A;  2RHQ B;  4O0I A;  3G5O A;  3Q23 A;  1BDT A;  2HYI B;  5C24 A;  2R7V A;  1IBL J;  2XSF A;  7FD1 A;  2OP5 A;  1N36 J;  1FRX A;  1RLC L;  1J2V A;  2ACM A;  2YKP A;  2KRR A;  2VOO A;  1VQS A;  4AQY F;  5J2Q B;  3GYG A;  3D0I E;  1YIJ S;  2ZBI A;  3EZ5 A;  2XMW A;  3W61 A;  1DLO B;  3TUJ C;  5EHH A;  4G1I A;  3Q86 A;  3BO4 A;  1OWX A;  3GTY X;  4RUA A;  3D2W A;  1RT1 A;  4ZA1 A;  3KMS A;  2IRY A;  3V6D B;  3CJR A;  1TVR A;  1BHN A;  1X0F A;  3RR8 A;  1SH2 A;  1NJX A;  2H65 B;  2LKZ A;  2YPZ A;  4IRK A;  1WF2 A;  3G9C A;  4WFX A;  1FJE B;  1EKR A;  4C0H A;  1NZ8 A;  1ZZN A;  1YQH A;  2J9E A;  2IVM A;  3TP2 A;  1ZM4 A;  2PO4 A;  2QYG A;  5AXK A;  5KG2 A;  2GGP A;  4ED8 A;  4DR3 F;  3LGM A;  2V2V A;  5K8N A;  3MM7 A;  4I6W A;  2HS0 A;  4BWM A;  4ECU A;  1BE4 A;  1REG X;  3W5Y A;  2B9X A;  1EAY C;  3VAI A;  2KB2 A;  2OFH X;  2V0N A;  5L38 A;  3V4I A;  2XMT A;  2QN6 B;  1HNV B;  1J5O A;  2CPZ A;  4OHW A;  2AGO A;  5C25 A;  3KLG A;  2CPJ A;  2V67 A;  1LXJ A;  2BR0 A;  4F67 A;  3W9I A;  4ECT A;  3P45 B;  2H5I B;  3GV5 B;  3BDP A;  2VDH A;  3GYX B;  1G3O A;  2DIT A;  1FD2 A;  1SC3 B;  3BKF A;  4Q45 A;  2R2U A;  1UZD A;  5MAO A;  2BJ7 A;  1VYA A;  4Y28 C;  1NO8 A;  1RBO B;  5D3G A;  1Y5I B;  3MPV A;  4USU A;  4A8S A;  4CNY A;  4JI6 J;  2A0F B;  1B7Y B;  3JTP A;  2LVW A;  4HL9 A;  4P2X A;  5KFJ A;  3KK2 B;  1RBL A;  3W66 A;  2NZC A;  3W3S A;  5KFU A;  3BO3 A;  3TX0 A;  2HWT A;  1KVJ A;  1D8Y A;  3R1H A;  4NML A;  4B3R F;  2D41 A;  4RX6 A;  2DO0 A;  2AYE A;  2LU2 A;  3FUY A;  2V69 A;  3OTD A;  2RKI A;  5IXU A;  3IMQ J;  4M5H A;  3DLK A;  3CC7 S;  1N48 A;  4O4G B;  1ITP A;  1EA4 A;  1UVJ A;  1O0P A;  3MEG A;  3G4S S;  2GVZ B;  4OFZ A;  3O6Q A;  3CO0 P;  4C2M A;  2DBB A;  1BDV A;  2NR0 A;  4UY8 T;  2HVD A;  3AXM A;  1JLC B;  2KKH A;  1VOM A;  5AE1 A;  1NCL A;  1HBN B;  3D67 A;  2UUB F;  2ZD1 B;  3NG8 A;  4LF8 J;  3N0V A;  4DR7 J;  3KG1 A;  1YRT A;  4HH0 A;  4X4P A;  4DV0 F;  1HWJ A;  3QJJ A;  2AJ0 A;  2W9B B;  4DX8 H;  2FJE B;  2FY8 A;  2C3U A;  5B7W A;  2IBO A;  2QA4 G;  1GEH A;  2KJV A;  1OQ6 A;  2C2M B;  2HZV A;  1ZM3 A;  2K3K A;  1QTM A;  1KQF B;  2XMJ A;  2ZM6 F;  2JXI A;  5B0B A;  3PZP A;  2ERR A;  2XMM A;  2W01 A;  2J5A A;  5LJ5 Y;  3IO1 A;  2Y1L B;  4L76 A;  2IBK A;  4OYB A;  4PZV A;  3DN9 A;  2OEL A;  4F4W A;  2O66 A;  1LWF A;  3BSA A;  2LXU A;  4OV6 A;  5L8R C;  1EET A;  1F5B A;  1RT4 B;  1I94 J;  2BMB A;  3GCW P;  1F6T A;  1F9E B;  2ROE A;  2EK1 A;  4U95 A;  4AL6 A;  1T03 B;  1SQF A;  1UVM A;  1IKW A;  1DQ8 A;  4X66 F;  2UXD F;  2ADC A;  3BQ0 A;  1R0C B;  2AZ3 A;  1A0O B;  3SMZ A;  4O44 A;  3SIP B;  2M4M A;  2BV3 A;  1CJU A;  2XSJ A;  3NKY A;  1PIE A;  2HMI A;  4OQJ A;  4FF4 A;  4WPA A;  2ROG A;  5IFM A;  4ECR A;  2OTL S;  2EBE A;  3MUT P;  3IRX A;  4I67 A;  3M8Z A;  3CCV S;  2GHV C;  3RU0 A;  1MYL A;  4J9Q A;  4QYZ J;  1XNQ J;  2C42 A;  2ZH4 A;  2MKS A;  3SQO P;  1RAD B;  3G8Q A;  1RU1 A;  2GQQ A;  4GVB A;  1CJK A;  4F8R A;  1X9M A;  5HJY A;  2HWH A;  2YXL A;  2CKW A;  1XMO J;  2BJ1 A;  4NLP A;  5HQM A;  1M5O C;  4J37 A;  1UZH A;  2YH0 A;  3BGL A;  2XG8 A;  3BM7 A;  4PPD A;  1QAJ A;  4IQM A;  3H90 A;  3VAH A;  1QE1 A;  3TQ1 A;  3THV A;  3P6Y C;  4NLR A;  1IQZ A;  4E98 A;  4QYR A;  5CCL A;  5AE3 A;  3PM9 A;  3HT0 A;  1VC6 A;  4X84 A;  1WHX A;  1DHM A;  1B0P A;  5J2P A;  4JI8 F;  4IQX A;  2N4C A;  4PG5 A;  1V3Z A;  1S6P B;  1HBM B;  1NJY A;  4JI5 F;  2DEI A;  2ZBR A;  3QLH B;  3NAI A;  4WP3 A;  3KK3 B;  1KR4 A;  1R3N A;  2JLG A;  1JLE B;  1R31 A;  5AXM A;  4F3O A;  1IBK F;  1X4G A;  4CH0 S;  2R7U A;  3O8W A;  4JI6 F;  1FNO A;  2DYA A;  2UUT A;  3V81 B;  1YKW A;  2MGZ B;  3K0J A;  1AZS B;  2XS5 A;  3OL8 A;  1KVK A;  2DNQ A;  2JRS A;  3TX8 A;  5U47 A;  4C7Q A;  5K8O A;  3OFF A;  4DR1 J;  2FB0 A;  4DL0 C;  5L1I A;  2ZJR Q;  4QWE A;  1Q16 A;  1JLF A;  2UUW A;  1Q1K A;  2F8E X;  3CIM A;  3NXZ A;  4ZVH A;  2MQQ A;  2G0J A;  3J7Y I;  1ARO P;  1VHF A;  1HHQ A;  1M1K T;  2W2Q P;  3C16 B;  3NBP A;  2I5J B;  1R7I A;  3UNG C;  3OT9 A;  2DY9 A;  4GKK J;  2E7W A;  2QSF A;  1TK0 A;  3U02 A;  4A8F A;  3CD0 A;  3H2V E;  4K5R A;  2HQG A;  1OG7 A;  2E9R X;  1X9S A;  4DV2 J;  2BNZ A;  3EZU A;  1MYK A;  4OI3 A;  4Y00 A;  2UUB J;  3L4B C;  1XR5 A;  3CO9 A;  3QJP A;  3D4J A;  2HZC A;  3GG0 A;  3H40 A;  3N5B A;  2G4B A;  1X0P A;  3EVW A;  2W9A A;  1RU2 A;  3A13 A;  4EI2 A;  4NLW A;  4R8U B;  1VC0 A;  3C2P A;  3PYD A;  4DL4 A;  4KHR A;  4OYZ A;  2DEJ A;  4PWD A;  3CW2 C;  1NK7 A;  2CQ3 A;  4HLB A;  5KFW A;  3OXF A;  4P6Q A;  4LRB A;  4RNF A;  1WAC A;  1PKU A;  2LQB A;  3A8K A;  3DRR B;  3N9U C;  3OR2 A;  4G1P A;  4NLO A;  3AHP A;  3WC0 A;  2RD5 C;  5HSP A;  3MUM P;  1S1V B;  3OL6 A;  4J9N A;  1ZAX A;  2D9O A;  2R4F A;  3IAM 9;  4DUZ F;  1QAX A;  4RBU A;  4OIX A;  3RJM B;  1NKE A;  2CFX A;  5AT1 B;  4FYY B;  3RB3 A;  3FVY A;  3BPD A;  3TA2 A;  3LWM A;  1UA0 A;  4LBH A;  3CDE A;  4TKT A;  1U9P A;  2CQ2 A;  4DSL A;  4DR5 F;  5H1S V;  2XSJ B;  3JSM B;  2AYG A;  4O44 B;  3C6T B;  4QIW D;  1EKS A;  3VGT A;  4J9L A;  4DQS A;  2FJX A;  2PC6 A;  4OZ3 A;  4PUO B;  3X1L B;  2P9G A;  4CQ1 A;  4RU9 A;  1JLA B;  3LTO A;  3FQK A;  4CI0 B;  2L3M A;  3VEB A;  3B78 A;  1DBD A;  5A8K B;  5DG7 A;  2YPY A;  2QYC A;  1D1U A;  2XHW A;  5D4O A;  4BDP A;  4URQ U;  5HAO A;  5D6G A;  4EGL A;  1KVI A;  2CPD A;  1C4C A;  1SVD A;  1FES A;  3OD2 A;  1VIO A;  2V68 A;  2YNI A;  4D3H A;  2RRA A;  2LQ5 A;  4DZD A;  4DUT A;  4ZLP A;  3EPI A;  4EBD A;  4AL5 A;  1FJG J;  4C4W A;  3M9M B;  2BNW A;  2YTC A;  2FQQ B;  3B8H A;  3UCG A;  1TFW A;  2HHS A;  2FVC A;  5E33 A;  4AAI A;  2RQ4 A;  2AT1 B;  3RBE A;  1Q53 A;  1Q78 A;  1F3F A;  1S5Z A;  1VLO A;  2QA2 A;  2IA0 A;  5JVH Q;  2HGL A;  1H6K X;  2W9B A;  4DV2 F;  4O3S A;  1ZS6 A;  2HEK A;  3OPK A;  3G8T A;  3QRP A;  1TKX A;  1NPR A;  2GJ2 A;  1LW0 A;  3PAC A;  5CCM A;  4I2P B;  2UXB F;  2VFS A;  1PBA A;  1NZA A;  2KYZ A;  2KG1 A;  1LOU A;  2RQK A;  2D3O R;  1S57 A;  1XTZ A;  4XPE A;  4DV0 J;  2ZH8 A;  2MZQ A;  4F4Z A;  3MAQ A;  1WNE A;  2OD6 A;  3HHN B;  4CTA B;  3AB4 B;  5CYJ A;  5GAH U;  4ID5 A;  2W7P A;  3LWL A;  2IC3 B;  1RWU A;  4IDK B;  3RAM A;  2HBR B;  4DOZ A;  2PFF B;  1HIY A;  3R97 A;  1N0V C;  2FJA B;  4A8O A;  1X4H A;  1VQ8 S;  4ZVQ B;  1SH3 A;  4CCH A;  2UXB J;  4U6P A;  3I4H X;  2VU5 A;  1HNZ F;  1RAH B;  4NL5 A;  1SC6 A;  5KG5 A;  4DV5 J;  1CJT B;  1X7V A;  2BX6 A;  2VL1 A;  4ANE A;  3D28 A;  1KON A;  2V2Z A;  3EXC X;  5KFY A;  1X5O A;  1SJR A;  2GNK A;  5ETO A;  1RT6 B;  5LT5 A;  5IT0 A;  3ILO A;  1JLB B;  2Y0B B;  1ZOT A;  4DPY A;  4YHH F;  5LMU F;  2Z2Y B;  3KJQ B;  1HKA A;  3W63 A;  2EKY A;  3BGO P;  1RKJ A;  1PAE X;  3V4M A;  3I9Z A;  4HT5 A;  2UVU A;  2IIH A;  3GR1 A;  5JVG Q;  2LEC A;  3JB9 k;  4LRD A;  2BJD A;  2AGQ A;  5D4N A;  1J5O B;  2F4F A;  3MPU B;  1U1N A;  1UWB A;  1N33 J;  2AP6 A;  3AY0 A;  2V4J B;  3CJ3 A;  4F25 A;  3K5N A;  3UPF A;  3MZI A;  4K4Y A;  1S10 A;  3MOJ B;  2CPY A;  3QGH A;  5CZV A;  2WVE A;  1MU2 B;  3TZY A;  3TJ9 A;  1HI1 A;  3JQK A;  2KEL A;  1T95 A;  2ZVS A;  5B0E A;  1C0T A;  2YNF B;  2HLT A;  4ZPA A;  4OI1 A;  5F8L A;  3NMR A;  1YGY A;  2OPS B;  2G9O A;  1S99 A;  4I7F B;  1OY6 A;  1NLK L;  1R6Y A;  2H9Z A;  2KHC A;  5CYQ B;  5ETS A;  3LUY A;  5L1J A;  4K4X A;  5IQQ A;  2IY5 B;  4GC6 A;  2NPI A;  4WU2 A;  2GML A;  2KT3 A;  4DPX A;  3KUE A;  4QWD A;  3GCX P;  1P9Y A;  1XIQ A;  4KFB A;  5KFM A;  3SCK E;  5IWA J;  1DLO A;  1WHY A;  2V4Q A;  4F2S A;  1BGX T;  4NEY A;  2YWW A;  2HBY B;  3F0N A;  2V5H G;  3BYR A;  5I3U A;  2FJW A;  1RT3 A;  1FFS B;  4ITS A;  1TV6 A;  3CJ8 A;  2D9P A;  2DNM A;  3FCW A;  1ZM9 A;  3GU0 A;  1HBU B;  2DT9 A;  1TL3 A;  2JFK A;  1U6F A;  4NA2 A;  4C3K A;  2XYP B;  1SL2 A;  4M94 A;  2CWX A;  3PO5 A;  1HNZ J;  3R6L B;  1TR0 A;  3AQP A;  5JMN A;  2HS4 A;  4JI4 F;  5GAG U;  1Q86 T;  4C8L A;  4V19 J;  1JLQ B;  3BSN A;  2CA9 A;  1N5V A;  1WEZ A;  1X4C A;  3HJV A;  3Q2S C;  3R5G A;  1Y5N B;  4KO0 B;  1NBE B;  2D7S A;  5HAT A;  4N8O A;  3RUB L;  4DXL A;  4ED2 A;  1N36 F;  2UV8 A;  2AX0 A;  3LAK A;  5KFZ A;  4AUK A;  3PYE A;  4FYX B;  1BQN A;  4RZR A;  2R2R A;  4N8N A;  1S72 S;  3VV2 B;  4KKO B;  2W1B A;  3DRP B;  3HFK A;  2GMH A;  3HKW A;  4YR3 A;  1HPZ A;  4KGM A;  3RYL A;  3W60 A;  2V2K A;  4JI4 J;  3I55 S;  2R7O A;  1IWG A;  4P9S A;  4YDX A;  2BJE A;  3GFZ A;  4OJ3 A;  3MWB A;  1P94 A;  1K9M T;  3MMA B;  2DR8 A;  1V5V A;  3J80 U;  4PXB A;  2DR9 A;  3I9V 9;  2VF3 A;  5KG3 A;  3OQ2 A;  1X4B A;  3THT A;  3R6G B;  2KFN A;  1JLG B;  2OPP B;  3D6M B;  4CLZ A;  4KB7 A;  4F36 A;  1P9Q C;  1FRH A;  2B7C B;  2Z57 B;  1WOR A;  2A18 A;  3MMB A;  1RTJ A;  1IKX B;  1PYT A;  2MHN A;  4R0J A;  2KJW A;  2WHO A;  2L41 A;  1B70 B;  1U26 A;  3QSI A;  4Y0F A;  3PVX A;  2KRB A;  5AE2 A;  2CJA A;  2W2M P;  5IS2 A;  3I56 S;  2B9E A;  1KBR A;  2VFU A;  3W8P A;  3OJS A;  2LA6 A;  2CJX B;  5B0F A;  3BV8 A;  5DQI A;  1QUV A;  2F8H A;  3TZW A;  1CLF A;  4IOA Q;  3M4X A;  1N4L A;  2VBY A;  1I6J A;  1YJ9 S;  3CC4 S;  3FT7 A;  3VVT A;  4F2R A;  2JJ4 D;  1VQK S;  2F4V J;  2MZT A;  2WRM A;  4CO5 A;  1D09 B;  2DXD A;  2DD8 S;  1X5P A;  4PWU A;  4F4X A;  3S01 A;  2P2C B;  4LVO P;  3ETO A;  2GPE A;  1T02 A;  3EXY A;  1KC8 T;  3U27 A;  4I0W A;  3FMW A;  3FC9 A;  4O0N A;  1VS3 A;  4J9R A;  2M52 A;  4DU7 A;  2MHE A;  3QFH A;  2COL A;  1AW0 A;  1WKJ A;  1YJ7 A;  4KC5 A;  3POT B;  1Q7L B;  4YB5 A;  3U7J A;  1UWA A;  3DKD A;  4CH7 A;  4UOG A;  2QEX S;  1KRP A;  2GW8 A;  4WK3 A;  1S9F A;  2RDI A;  4DX6 A;  1VHI A;  3A1Y G;  2ZVI A;  2CPF A;  1SJ1 A;  3ENW A;  3K2Y A;  3W65 A;  4KH1 B;  2OJ3 A;  2I0X A;  4LR9 A;  4FDF A;  4X66 J;  2DNY A;  1HHS A;  2BKO A;  4YN3 B;  1IKY A;  1YRU A;  1U4B A;  1P1L A;  2FC8 A;  4RKU C;  4HT7 A;  2J8S A;  4HTJ A;  2B4V A;  3MMJ A;  2MDA A;  1VRU A;  2X3G A;  3PEJ A;  3G6Y A;  1OY9 A;  1RT7 B;  5KFS A;  5L9N A;  2Q66 A;  1S9E B;  4JV5 F;  3UD5 A;  4IRD A;  4U7U D;  2LQJ A;  1U45 A;  3BGF A;  3HDS A;  1IKX A;  2P6S A;  2XM3 A;  1VFJ A;  5ETL A;  1FXR A;  3DOK A;  1X93 A;  3M8S A;  5IOL A;  3V6J A;  3RB0 A;  1S1T A;  5A8W B;  1RCX B;  1CG2 A;  4LSL B;  3ULH A;  4ZVG A;  4ZPV R;  1Q5V A;  1FCA A;  2AJ2 A;  5ETK A;  1K8A T;  3GFH A;  2IAJ B;  4ER8 A;  3V2U C;  2HS3 A;  2EFO A;  5F8J A;  3BO2 A;  2UXC J;  2N82 B;  3M32 A;  3Q8Y A;  4NRU A;  1FWK A;  3QT5 A;  2Q1L A;  3B4M A;  4QZV B;  3CCQ S;  1BQN B;  3FGV A;  2DY1 A;  4U9R A;  2VAS A;  4B17 A;  4NXN J;  5CYM B;  5BR8 F;  2QL9 B;  4QPX A;  1X5T A;  1R8H A;  1SIZ A;  3NEK A;  4KO0 A;  4USM A;  3UCU P;  1IBC B;  4NWB A;  1K47 A;  4W90 B;  3KG4 A;  3RTV A;  3MUV P;  5CYM A;  2AD9 A;  4F02 A;  4WWS A;  1CC7 A;  1KQG B;  1X8D A;  1TL3 B;  1NXI A;  3H42 A;  5KFL A;  1QDU B;  2HFZ A;  1HQ2 A;  1TV6 B;  3CT9 A;  3GB0 A;  3KFW X;  1RT3 B;  3QWU A;  5I3U B;  1H38 A;  3F56 A;  4LSN A;  1XK8 A;  1XMB A;  4ZHR A;  5KAK A;  1TL5 A;  4WE1 A;  3S1T A;  5EWG A;  4UOH A;  1N5Q A;  2HHH J;  2AY0 A;  3UR0 A;  4RU2 A;  2ZZN A;  2GFF A;  4IOB A;  1WC5 A;  1VRQ C;  2UV8 G;  4K4Z A;  3HMJ G;  2IAJ A;  3OW2 R;  2XMA A;  1HNW F;  2ZWO A;  2DO4 A;  2CQ0 A;  2P6T A;  1BWE A;  1JK9 B;  3IWN C;  2KZM A;  2OFG X;  2YQ3 A;  2JEI A;  1S1T B;  3MR5 A;  4NLD A;  2GVD B;  1S0O A;  1L3U A;  1S0V A;  5IWA F;  1CS4 A;  3K8W A;  3R5D A;  3H25 A;  2OLW A;  2N7Y A;  2HVE A;  3QGI A;  2G2Z A;  2YNF A;  4WYL A;  2NPF A;  2K29 A;  1YDL A;  3CJ5 A;  3OFH A;  3KHG A;  5LMN J;  3J81 j;  4ES1 A;  4TQS A;  2VQE F;  1Z4U A;  2CZV C;  1RT7 A;  3Q8U A;  4OYM A;  4A4J A;  3TVY A;  2V4J A;  5HMW A;  3KNA A;  4DEZ A;  2OEK A;  2PA8 D;  4USJ C;  1NPK A;  2OHD A;  1P8G A;  3I0S B;  1KTV A;  3DNC A;  4UUX A;  5DLG A;  4B3S F;  1VQY A;  1UEU A;  1IKY B;  4RW7 B;  4DMZ A;  5EWF A;  3RW7 A;  2FLL A;  3DLE B;  4C8N A;  2PEB A;  3PW5 A;  1S6Q A;  4HAC B;  2GCF A;  3JSR A;  1U1K A;  1JLB A;  1NHK L;  2X51 A;  4ZS6 A;  1RT6 A;  3GFX A;  5KFC A;  1SKW A;  4DN0 A;  3RAX A;  4DI6 A;  1CJT A;  4LRA A;  4X62 J;  2PFD A;  4TLQ A;  3E01 B;  1Q8L A;  1SUQ B;  2F4V F;  4TU7 A;  1NLA A;  2SXL A;  2VB6 A;  3LF0 A;  4MMO A;  4RW9 B;  2E1R A;  4P71 A;  5LSR A;  4LFB F;  4HV0 A;  3MR2 A;  3F41 A;  1RAI B;  3U1N A;  2F8M A;  2IC3 A;  4M5N A;  3HUL A;  4ID5 B;  4BC9 A;  4QQB A;  4CLW A;  3W5X A;  1I3O B;  5KG6 A;  1ROF A;  3CDW A;  4QWB A;  3R5J B;  3K8V A;  2AJ1 A;  4A8K A;  3R1L A;  2DNP A;  4LFA F;  4EO6 A;  1NKB A;  2WVF A;  1FK9 B;  1H2V Z;  2G0I A;  2GMJ A;  3ENA A;  3HD1 A;  4K59 A;  5G0R B;  1TKZ A;  1RQ0 A;  4OHY A;  1S97 A;  2R42 A;  2F65 A;  1SQG A;  2JSX A;  4P72 A;  1HHT P;  1WEL A;  2QC3 A;  4GKJ J;  2MST A;  4KGZ B;  3QFW A;  1YG0 A;  1XMO F;  4ECZ A;  2Z56 B;  1RP5 A;  4UZC A;  2LXF A;  3CME S;  3I5B A;  2CUY A;  2G1H A;  1V3S A;  3LP2 A;  3VCD A;  1PJ5 A;  3IN5 A;  5D0G A;  4X4V A;  3RRH A;  1SKS A;  2JC1 A;  4YR0 A;  3QAU A;  2B8P A;  2MPU A;  1KDN A;  2PA3 A;  2YKN A;  3OTO J;  4NLS A;  1M5K C;  1TMJ A;  1QAY A;  2MY7 A;  3M6X A;  4WYW A;  5BYQ A;  5C2C A;  3ZZP A;  1V5I B;  2QGF B;  3P5B P;  5HVF A;  1ZPV A;  4KT0 C;  4XIU A;  1GQE A;  5E3C A;  3Q0A A;  1RHU B;  2BA9 A;  3OFE A;  3VGS A;  2JL9 A;  3VR1 A;  1ZH5 A;  1WOP A;  2HRY A;  2WVB A;  1HA1 A;  1KOH A;  2MYF A;  3V6H A;  2CQ1 A;  5KFD A;  3QWP A;  5A8K A;  4USV A;  5F3T A;  1TK8 A;  1IBK J;  1REV B;  5A0Y B;  3J81 U;  3OJU A;  4B9L A;  2C22 A;  2JEF A;  2VC1 A;  3K7R A;  5CA5 A;  4ZKA A;  3EVM A;  3GV7 B;  3IG1 B;  4WTY A;  3D0H E;  3HP6 A;  4ZP9 A;  1VIX A;  2E5L J;  4ZCL A;  3R7B B;  3M6U A;  5DET A;  2MQP A;  2Q6B A;  1HNW J;  5A8R A;  1NH8 A;  2DCL A;  4WFY A;  4OYW A;  1JLQ A;  4ZJQ A;  5LXY A;  2ZM6 J;  3NGS A;  3WIU A;  3CCE S;  2AHO B;  2RF2 A;  1W7W A;  2DIU A;  3HHL C;  4RNH A;  3TJ8 A;  1NK4 A;  4ZLL A;  1ZAW A;  4CRJ A;  1LNQ A;  1ZBT A;  5BYR A;  3SFU A;  1LWX A;  1P6T A;  5B0G A;  3LAL A;  1MG7 A;  3KUH A;  4BHQ A;  3OR2 B;  4LRE A;  2RH3 A;  3JXO A;  1IM6 A;  1NM2 A;  2Q79 A;  1O51 A;  3VAJ A;  1S1W B;  1XEZ A;  3HVW A;  4KYZ A;  1VK8 A;  4S0M A;  3J81 Y;  1WF0 A;  4CLS A;  1JWW A;  4YUD A;  2CQG A;  3EM1 A;  4QR1 A;  1UFL A;  4K5S A;  1NU4 A;  2C2D A;  1PCA A;  4KGV B;  1VJQ A;  3NNH A;  4I56 A;  3BB5 A;  1U6Z A;  2M8H A;  4Y6I A;  3NNE A;  2FLO A;  2AJ4 A;  2J9D E;  2J7U A;  4EEY A;  1HNI B;  3C16 A;  3W64 A;  2P9E A;  3CC2 S;  2BE2 A;  2W2P P;  5IT9 Y;  4YQW A;  4B3T F;  4B3M J;  2AW0 A;  2R3V A;  3NWG A;  2HK3 A;  3PW2 A;  3OUY B;  1AXQ A;  1R8B A;  2CPE A;  5KFA A;  2RJZ A;  2EFG A;  5KOW A;  1UWB B;  1DFD A;  4YR2 A;  3PX6 A;  5ETN A;  3D1H A;  1S76 D;  2MGZ A;  5J1E B;  2XUL A;  3W9H A;  3O1L A;  1SCJ B;  1IR0 A;  4IH7 A;  5LM7 E;  2R2S A;  1PSD A;  5HBM B;  1ZM2 A;  4X64 F;  1RDR A;  4USK A;  4EWT A;  2KM8 B;  3MFH A;  4XTT A;  2E44 A;  3QLH A;  5B0A A;  3CB4 A;  3KK3 A;  4JI1 F;  3OVB A;  1S6P A;  3D3C J;  2C3Y A;  2XB2 D;  4D3G A;  2GO9 A;  3S8S A;  2CPG A;  5DLF A;  4ZVS B;  3W62 A;  3MTJ A;  5KFX A;  4AYB D;  5J2P B;  4RNM A;  4WK1 A;  1U1P A;  2KXH A;  2AQ4 A;  1JXL A;  1VDH A;  3Q8V A;  3T9Z A;  5KG1 A;  3L09 A;  2HGN A;  4QIF A;  3SQG A;  1YBT A;  2FJD B;  1EP4 A;  1WG5 A;  2FDN A;  4K2J A;  4XK8 C;  4CLL A;  2BSQ E;  1QE1 B;  3ZC4 A;  4E2F B;  4X64 J;  4BS2 A;  3TAP A;  2HBQ B;  3AJD A;  2HPU A;  2FJV A;  2HIQ A;  1MN7 A;  2ROP A;  1K44 A;  1JJ4 A;  3DXB A;  2LXI A;  3DXS X;  4GVB B;  4PQA A;  1B4S A;  1HBO A;  4R25 A;  4WBF A;  2J0S D;  3WQP A;  4F4A A;  5DZ7 A;  1L3T A;  4X4U A;  1CPZ A;  2Y9H A;  2H3E B;  1LFP A;  4O3O A;  1IJE B;  1FVQ A;  2RRN A;  5DM7 Q;  1NJZ A;  2AMC B;  1Q81 T;  1XN9 A;  2B4O A;  2BAC A;  1WG4 A;  5F0W A;  4YB6 A;  4B9U A;  2KYX A;  4DV7 J;  4ZVU B;  4Z2X A;  1NSP A;  4Z7Y A;  1IKW B;  2OMO A;  2CDR B;  2W2N P;  3OSN A;  5EX0 A;  2HGM A;  4FKX A;  1MNT A;  2H1O E;  1EET B;  1GMV A;  4GRS A;  4I2Q B;  3V6K A;  3DDI A;  2PN6 A;  5KT3 A;  3E51 A;  5B0C A;  2ZDP A;  3OR1 A;  5THW A;  4XO0 A;  2ASL A;  3LA0 A;  1U6B A;  3T5J A;  4JI2 J;  2YNI B;  3M8W A;  1F60 B;  2X1G A;  4FVC A;  4W92 B;  5HI7 A;  4QYZ K;  2QRR A;  2Z58 B;  3KLF B;  1XNQ F;  1FFG B;  4I2Q A;  4RPF A;  4DV1 F;  3C6U A;  3JAM Y;  4DR2 J;  3UNY A;  4UTG A;  2EG1 A;  5GAD U;  4Q7A A;  4TXS A;  4DDF A;  3JAM U;  2BJ3 A;  1G1X A;  1HLW A;  5SZT A;  3G8S A;  5JUM A;  4HI2 A;  4PUO A;  2W4D A;  3C6T A;  1M5S A;  4QOT A;  2D3U A;  3JSM A;  5HMY A;  1H3D A;  2CNO B;  2JC0 A;  3MPW A;  1HBN A;  2MKJ A;  4OZ0 A;  5I3Q A;  4QU7 A;  2B51 A;  1HW8 A;  4B3T J;  4LF6 F;  4MKV A;  5KFI A;  3FZB A;  2BW7 A;  4DWI A;  4UT4 A;  3FRY A;  1IRQ A;  1HBO B;  1WC0 A;  3PJX A;  3SBM A;  4P2M A;  4IFV B;  2JVR A;  2XMU A;  2XLK A;  3DLK B;  2RKI B;  3OVA A;  2XS7 A;  3OVS A;  1J27 A;  3Q8Q B;  2KH9 A;  4DV4 J;  1C4A A;  3IBC B;  2BQ3 A;  1PAR A;  1TFY A;  1YLX A;  4KAI A;  4P2S A;  4Y2M A;  2JHE A;  3PG9 A;  1ACM B;  1JJC B;  1JNR B;  1Y3J A;  2JDJ A;  2JH3 A;  4NLY A;  1WC4 A;  4TQR A;  4ED7 A;  1SKR A;  4LF5 F;  4ENO A;  1EP4 B;  1GMU A;  5EDW A;  2HHH F;  3M05 A;  1JQG A;  3SQG B;  4LFB J;  1JB0 C;  9ATC B;  2MLZ A;  4AND A;  4U7C A;  2VIH A;  1N32 F;  2BAN B;  2DCU B;  3LJP A;  2GIF A;  2YY3 A;  2GA7 A;  2M70 A;  1KQK A;  2Y0S D;  3UR3 C;  1UA1 A;  4B9V A;  4P52 A;  4NPO A;  1VJW A;  4EYH B;  1N5S A;  3R5C A;  1G2E A;  1FNM A;  3QYY A;  2I5J A;  3FMB A;  3Q8R B;  1JXE A;  2YWE A;  3FMT A;  2MKI A;  5HBM A;  4JI3 F;  4ED6 A;  1H98 A;  2XLI A;  4ED5 A;  3Q2T C;  3KLG B;  2KFZ A;  1DZ5 A;  2FD2 A;  5J1E A;  4RUC A;  4DR6 F;  1L3K A;  1JLF B;  1Q16 B;  2EC2 A;  2ZOF A;  2EVZ A;  1QM9 A;  3I5C A;  2KKE A;  4IO1 A;  1RHJ B;  4PG8 A;  3GJS B;  3A4T A;  2QFI A;  3FJ2 A;  4QR2 A;  2H4Y B;  2HRT A;  1Z2Z A;  4ELU A;  4WKY A;  2OAU A;  4ME7 E;  2RT3 A;  3IBW A;  3OUY A;  1UVN A;  2BJ8 A;  3BGU A;  1GX5 A;  3D66 A;  4M5K A;  1ZAV A;  3BN4 A;  1KHV A;  2BE2 B;  4MYT A;  3UVJ B;  4EUV A;  4ED3 A;  4LF2 A;  2B3T B;  4DX5 A;  1AA1 B;  5E41 A;  3KWM A;  4L3N A;  1B01 A;  4L75 A;  1VCT A;  4WP9 A;  2D3O 1;  1QVF R;  4K4V A;  5D0H A;  2J7K A;  1NRK A;  4F50 A;  1HD0 A;  1CUL B;  1YZ6 A;  4DL2 A;  3RBD A;  4PXE A;  1B99 A;  3PHT A;  3TVZ A;  1EIY B;  3V6D A;  2NXE A;  3GZ7 A;  5SUH A;  2BOP A;  5F0U A;  4N7T A;  4Q8F A;  2GS8 A;  4V1A k;  2ZUG A;  3IR6 B;  1S6O A;  1KWM A;  3QZ8 A;  3IXQ A;  1S1W A;  4ED1 A;  1J5E F;  2FGO A;  4XAK A;  2ZIT A;  4F3Q A;  1IN0 A;  3NS7 B;  4FNH A;  3FCV A;  1YJN S;  4OI6 A;  5C24 B;  1RBA A;  4Q8E A;  3TI0 A;  5DJB A;  1IKV B;  5HVH A;  4FS2 A;  1RAF B;  4LR7 A;  2L9W A;  3PW7 A;  5T7L B;  4UST A;  3J80 Y;  2RF2 B;  4DR2 F;  3GR0 A;  2RB7 A;  3IRX B;  3QSY B;  2DHX A;  3GFY A;  4HR2 A;  3WBZ A;  1CJU B;  1W26 A;  4X4T A;  4FKY A;  4KV8 B;  4JP8 A;  1OQ3 A;  1FTR A;  1K0V A;  2CJQ A;  4QCL A;  4KTQ A;  3IG1 A;  2B6A B;  4KBI A;  1T3N A;  3FBE A;  3ONQ A;  1G6B A;  1H0H B;  1REV A;  3FK4 A;  5A0Y A;  2XCA A;  2JXG A;  2V8V A;  2ZFH A;  1AUS L;  4NA3 A;  2ZKT A;  1S4F A;  2RUS A;  3OLB A;  1WSV A;  3H59 A;  4IR1 A;  3BH7 B;  3JTO A;  2VA3 A;  4CH1 A;  3ITH B;  1RCO B;  3PX4 A;  4V19 X;  2CNL B;  3AOC A;  4I4B A;  2FPH X;  4MFB B;  2LYV A;  3JYT B;  3BZQ A;  5LMU J;  3N6N A;  4ZOS A;  2E1C A;  1T7P A;  1OSD A;  5H9F K;  5F41 A;  4OV1 A;  3KG0 A;  3IWX A;  1K1S A;  1M5V C;  3LP2 B;  1F9F A;  1F2H A;  1N34 J;  1S0N A;  1MWY A;  2QT7 A;  2KFY A;  4NCG A;  2FZC B;  2XC9 A;  4A8M P;  1GXU A;  2AYM A;  1RAB B;  4P75 A;  4J9S A;  4OX6 A;  5ETQ A;  2E5L F;  2ZD1 A;  4B9M A;  2YWF A;  4QU6 A;  2HWI A;  1U47 A;  5E0O A;  1KEK A;  2HVZ A;  1X60 A;  4A8X A;  1VLY A;  2R8G A;  1TKZ B;  4CO4 A;  5KT7 A;  3F73 A;  2CAD A;  3T6B A;  2RRB A;  4O4G A;  1R6V A;  2ZZT A;  4Q2L A;  2CZ9 A;  3EDQ B;  3D0G E;  4X62 F;  3T9N A;  2GQC A;  2HHP A;  4DPO A;  4DPW A;  3UDV A;  4OX9 J;  3D3B J;  3CJK A;  1RT2 B;  4U96 A;  5FLX U;  3MD1 A;  2DHG A;  4WFB Q;  1UW9 A;  3TZX A;  5IZH A;  1NUE A;  3MED A;  3AFG A;  4RNO A;  4IKA A;  3HSG A;  1HL6 A;  1SUQ A;  2XZD B;  2Q3P A;  3MEE A;  1U2R A;  3NCR A;  3UDE A;  4RJV A;  8RUC A;  5F3Z A;  5J1P A;  2VJV A;  4NZ0 A;  3VWS A;  3CD6 S;  3EGW B;  3ZTQ A;  3AB2 B;  3FFI B;  2HHQ A;  2OPQ A;  3UQS A;  1R8P A;  1PGZ A;  3H4B A;  1VBY A;  4DZ6 A;  2W8K A;  3DU5 A;  1YTY A;  1S6Q B;  4HAC A;  4B3M F;  2IVF B;  3DLE A;  3FRZ A;  4OZN A;  2DB1 A;  4FYD A;  1DTQ A;  1KQS R;  4OYO A;  3T1A A;  2Y3Y A;  1MMD A;  2HIY A;  3EIC A;  3I0S A;  1C1B B;  3QT6 A;  4ID8 A;  2BRL A;  2BQR A;  4XPC A;  4MIB A;  2LEA A;  2U2F A;  3LP0 B;  5FJ4 A;  2BYC A;  3MM7 B;  3MTK A;  2Y8W A;  4ZLN A;  1GXL A;  5HP1 B;  2ZH9 A;  4K4S A;  5LJ3 Y;  1F5A A;  4X4O A;  3PV8 A;  3ZNU A;  4F0K A;  3P5T L;  3C3L A;  1TZ0 A;  2KOE A;  1U24 A;  2RNE A;  2CJ9 A;  2K7K A;  1RZM A;  1T0T V;  4FBT A;  3GLJ A;  1D8Z A;  1SV5 B;  3W9J A;  4DV4 F;  1TVR B;  1RHK B;  2IRU A;  1N33 F;  5GAD I;  1RT1 B;  1TU0 B;  1YBU A;  4MKA A;  4I6Y A;  3KLV A;  5DRK A;  3CUN A;  1S1U B;  4QJV A;  4ZHR B;  1U1M A;  1QY7 A;  2GQ2 A;  4KIA A;  5J2Q A;  4PYA A;  3H98 A;  1KD1 T;  4C8K A;  2BE9 B;  2WAQ D;  4LFA J;  3ZFV A;  2ASY A;  3AA8 A;  1YJT A;  3AOD A;  4JYA F;  3H4D A;  3ZZO A;  4TY8 B;  3PCO B;  4IO9 Q;  4PPZ A;  3ZTO A;  4AL7 A;  3OTE A;  2VOD A;  4KHP J;  3BDE A;  1FKO A;  5D15 A;  4CM0 A;  5D77 A;  4E8U A;  3G71 S;  3TAN A;  1R0A A;  3A12 A;  4Y2K A;  1VBX A;  2XNQ A;  3PIP Q;  4DLE A;  4PG4 A;  5I3P A;  2HFO A;  2DNN A;  1OHN A;  4HEA 9;  2WZ1 A;  4M5J A;  5GAE I;  5FLX Y;  2R7Q A;  3C19 A;  4DR5 J;  1S1X A;  2EW9 A;  3OBI A;  3OTO F;  1U1R A;  3LW5 C;  3PFO A;  1FI4 A;  3AD9 C;  3FNN A;  3UN3 A;  4USI A;  2P8I A;  1JXV A;  2PGC A;  3CCM S;  4F4Y A;  1KOO A;  1WWH A;  5IC4 B;  4MJW A;  3DGP A;  4GC7 A;  4DFM A;  3ZXW A;  3BS9 A;  3BSO A;  2WOM A;  2V4R A;  1M1G A;  2QO3 A;  1OIA A;  1YJR A;  3MMC B;  4OX9 F;  5HMX A;  4PQU B;  3NMA A;  3MCO A;  1T05 A;  1RWM B;  4LSL A;  4A47 A;  1MSW D;  3KJV B;  4NA1 A;  1X4D A;  3ENQ A;  3P96 A;  2JFD A;  2F9D A;  1R43 A;  3DOK B;  3MEC B;  3RAQ A;  2OIH A;  2VON A;  3EDR B;  3CDA A;  4DV1 J;  4UOF A;  2WW4 A;  4WXO A;  1Y0H A;  4F0H A;  4F4K A;  1FNX H;  1CEZ A;  3MD3 A;  3O5T B;  1FFW B;  3TEG A;  3CF5 Q;  4PXD A;  1VRU B;  1T9T A;  1UVK A;  1LWC B;  3WX4 A;  1C0U B;  2VDI A;  5CAB A;  2HHT A;  2UZA A;  4RR5 A;  2HG4 A;  3CIZ A;  2X1A A;  1N34 F;  1TMM A;  1KNZ A;  2KL8 A;  2HFV A;  4XDD A;  1M5P C;  3E8O A;  4DV3 J;  3HK2 A;  2NXJ A;  4ZLJ A;  2XI3 A;  3KOA A;  5EN1 A;  2XTJ P;  2I1R A;  1RXO B;  2GZO A;  1WC3 A;  1DUR A;  2VFT A;  3G6V A;  4NOH A;  5A6P A;  5C7P A;  4YFU A;  1JKH B;  3W1Y C;  1U1L A;  1TL7 A;  3IM9 A;  3L95 X;  2WSE C;  1SI9 A;  2N4D A;  3POT A;  4LIR A;  2N7C A;  1N32 J;  3M30 B;  1UET A;  3MAH A;  2J6S A;  3KYL A;  2EBG A;  2LFV A;  3D68 A;  3NGR A;  3PX0 A;  1OMS A;  1UTA A;  5AXL A;  2MLX A;  2ILY A;  4Y2C A;  2FIU A;  3T1Y J;  1E6V A;  2DJW A;  5DG9 A;  2W9C A;  4JV1 A;  1Q8I A;  3LH2 S;  4FNI A;  5EX3 A;  2A6O A;  5D0E A;  1RAA B;  2K5J A;  1U0H A;  4W98 A;  4CIO A;  4DSK A;  4NXM J;  2CVI A;  2V50 A;  4PR6 A;  4JOU A;  4DJB A;  2DXE A;  4HDG A;  2ZOM A;  3I6P A;  3IP0 A;  4A8Q A;  3RW6 A;  2M0G B;  3OXL A;  1Y9O A;  1TUV A;  1GTE A;  4IYQ A;  4ZDN A;  3HT3 A;  2H3A A;  1UPM B;  2ZH7 A;  2WVD A;  3M8R A;  1RA6 A;  2UUA F;  2BM1 A;  4EFA C;  4CYU A;  1YSJ A;  3HHL B;  2IM2 A;  1RWP B;  5I42 A;  5H9E K;  2UU9 J;  4ICL A;  2UUC J;  1RHM B;  1FJC A;  5A6W A;  1RTJ B;  4P73 A;  4JI1 J;  3FDS A;  3MMB B;  3NP5 A;  3VTI A;  2LDY A;  4IG0 B;  1KSP A;  4WIQ A;  5KFP A;  1URN A;  2OPP A;  1R89 A;  2MZS A;  5E5N A;  5AXN A;  4USH A;  4ECS A;  4C9D A;  4KJI A;  2V8H A;  3KK1 A;  1MRO B;  5GAH I;  2HNY B;  4Q0B B;  4O23 A;  3QZ7 A;  3LGN A;  1TKT B;  3I32 A;  4KH0 B;  1SC1 B;  2UUA J;  4WKR A;  4DG1 A;  4RUH A;  2FUG 9;  2OI2 A;  5D4L A;  2YKQ A;  4AXJ A;  5CD4 A;  2FY1 A;  2AGP A;  2V8P A;  1BQM B;  4Z37 A;  3BH6 B;  3HI9 A;  3U1L A;  2RAQ A;  2QMX A;  3IWL A;  4Y2I A;  3DRP A;  4AT1 B;  1D0E A;  4KKO A;  2PD1 A;  3KJF B;  3PW0 A;  3IBF B;  5T41 A;  2HQ3 A;  2QIF A;  3HHK A;  4B02 A;  1KKH A;  3DLG B;  1C1C A;  4ZPC A;  4JI7 F;  5A2Q U;  2J0W A;  3KLI B;  1KFD A;  4G1Q B;  2Y1R I;  2HFU A;  2KXF A;  3BBF A;  4DR6 J;  5KFK A;  3AH6 A;  1SL1 A;  3QID A;  3NY0 A;  2JVO A;  3VW4 A;  4F3M A;  2DNO A;  3NCQ A;  3QAE A;  3LP1 A;  1B0T A;  5IC6 B;  2W25 A;  3KJN B;  3SDE B;  4O3Q A;  3WDO A;  1HYS B;  3M2U B;  2V2Q A;  3SV4 A;  3TR5 A;  1HBU A;  4F04 B;  1NND A;  4A8Y A;  3GII A;  3CCJ S;  3O3L A;  3IR7 B;  2DHH A;  4URG A;  5CD4 H;  2UVW A;  4B9S A;  2DR5 A;  2IMO A;  2ILZ A;  8AT1 B;  1EQ0 A;  3VAK A;  4KFB B;  1U8S A;  5F8I A;  2L48 A;  2P5V A;  2XI2 A;  5B0D A;  3C46 A;  2AV5 A;  2ZJQ Q;  3CNQ P;  2Z2L A;  2M5Y A;  3DU6 A;  2LU1 A;  1KHW A;  1HQU A;  1XQI A;  3QNW B;  4C97 A;  2XO7 A;  3CTR A;  3GG1 A;  2GJF A;  1NK8 A;  2UXD J;  3EVO A;  4GKJ F;  4RWW A;  1LK7 A;  1XMQ F;  3CD7 A;  5CYQ A;  3M8P A;  3MR6 A;  2E7V A;  4I7F A;  3W7B A;  2OPS A;  2J6U A;  4K50 A;  2VPX B;  4H4M A;  3HO1 A;  1C0T B;  1UCN A;  4CT8 A;  3L7P A;  4ED0 A;  4OL8 A;  1CBK A;  2PMH A;  1MU2 A;  2OSR A;  2K3I A;  3KDN A;  5KT4 A;  3KHL A;  5K20 B;  4JYA J;  3W2V B;  1FT8 A;  2XEX A;  3H0P A;  2OD4 A;  1HI8 A;  2AJF E;  3HSD A;  1N6Q A;  4KRW A;  1IM4 A;  3FEY B;  4I68 A;  5F9N A;  5HLF B;  2K9I A;  2VKR A;  1U48 A;  2B7B B;  2QMU B;  2DGQ A;  2HKE A;  3UFC X;  3BJY A;  2DGW A;  2VG7 B;  1U2F A;  1UVL A;  3QJL A;  4OZL A;  1L3S A;  4YEA A;  1HQE A;  1NAQ A;  4ILM A;  1AFJ A;  1TUW A;  1H2U X;  2ZWP A;  4RUB A;  3MUR P;  2W8L A;  5HRO A;  5IT9 U;  3HSZ A;  2C28 A;  3VAF A;  2HRU A;  2Z2M A;  4DL3 A;  3TZZ A;  1KLM A;  4M5L A;  1N52 B;  3KLE B;  1K73 T;  4M5M A;  2CQI A;  4NYP A;  3MI7 X;  2MEW A;  1WDT A;  4K4T A;  2CPI A;  4ZK7 M;  2R7R A;  1RWX B;  2DNK A;  1OS5 A;  2DTJ A;  2GV1 A;  4IG3 B;  1FVS A;  4PYD A;  1N5Y B;  4IDK A;  2FTR A;  3RBZ A;  4PKD B;  4RW8 A;  2ZEJ A;  4C98 A;  4CTA A;  1SJQ A;  1S77 D;  1RWO B;  4LF9 J;  4N76 A;  1HWU A;  2VFR A;  3ICL A;  2YX7 A;  3M6W A;  5F9L A;  2ATC B;  1VBZ A;  2WON B;  4I64 A;  4EO8 A;  3NGD A;  4DF4 A;  4F7V A;  4TN2 A;  3TRG A;  1B28 A;  3GIM A;  4I2P A;  1Y00 A;  1LW0 B;  3MEK A;  1TKX B;  3H2L A;  4ZCM A;  4USW A;  3TOQ A;  3CCU S;  2QLB B;  4J9U E;  4LF9 F;  2Q2K A;  2RVJ A;  1NK0 A;  2A3J A;  5K8P A;  3B4D A;  5C42 A;  1VQ7 S;  3G96 A;  5HQ8 A;  3J7A N;  1U25 A;  3MF5 A;  1Y11 A;  3MM9 A;  4M63 A;  4CLF A;  4WZQ A;  3BBB A;  3M6V A;  3QGG A;  3KUG A;  2J9D A;  4NMX A;  4H4K C;  5HO4 A;  2R7S A;  1RE1 B;  2J9C A;  3QIP A;  2E1A A;  2F3J A;  5I4M A;  4L73 A;  3OV7 A;  4LQ9 A;  2WBR A;  3LOU A;  1UJ6 A;  1XER A;  4UZB A;  1U1Q A;  4PWW A;  1X9W A;  4DPU A;  2IVY A;  2OEJ A;  4WFZ A;  3QQC D;  1WC1 A;  2AF6 A;  2W2O P;  3VAL A;  1YJW S;  2HND A;  1NB7 A;  3OL9 A;  1S12 A;  3RRK A;  1Y7P A;  1QTG A;  3JSB A;  4AE5 A;  5DDR C;  1UL3 A;  2XYG B;  1JLA A;  1HMV B;  2C2K B;  1SH0 A;  2OPR A;  2CNK B;  5DGB A;  2F63 A;  2DNR A;  4DUZ J;  4K0K F;  2DHA A;  2IYG A;  2QA4 S;  4LF7 F;  3R5B A;  3FSX A;  3R27 A;  5K14 B;  4LBP A;  2RDD A;  4IH6 A;  3HSJ A;  2I6W A;  3TAQ A;  2JEG A;  2DGV A;  4CO1 A;  2AJQ A;  4FP9 A;  4DCJ B;  2BQU A;  3KNG A;  4RW6 B;  2A2C A;  2AWZ A;  1JJ2 R;  1SQE A;  3BR8 A;  3N01 A;  4ZVO B;  1S9G A;  3QO9 B;  5K8M A;  1S1V A;  1F5C A;  1WEX A;  3LAN A;  3EYZ A;  4DFP A;  2CJK A;  1RTI A;  3G82 B;  3KDO A;  2RBF A;  1RI7 A;  2B43 A;  2F7V A;  3DRR A;  4MIA A;  4TY9 A;  2ZE2 B;  4B3O A;  3HZG A;  2HVI A;  1EAR A;  4M5G A;  2G13 A;  1S9G B;  3QO9 A;  2J6T A;  2GX8 A;  5KT2 A;  2ZJP Q;  4PWD B;  2XGQ A;  5KT6 A;  4RW6 A;  3D9B A;  2MB0 B;  4R8U A;  3NNC A;  2FHO B;  2V9W A;  2VQF J;  2LLZ A;  4URS A;  2Z30 B;  4WTO B;  4HKQ A;  3J7A 1;  4FVM A;  2FGC A;  1N5T A;  1ZA1 B;  1TL1 B;  2VUG A;  3DRY A;  5L9X A;  2OTJ S;  5A76 A;  1HD1 A;  1VC5 A;  1KS2 A;  2RQM A;  3GIL A;  4UUW A;  4DSI A;  3T6J A;  2CAJ A;  4BWJ A;  3GSD A;  1NH7 A;  2E1P A;  1OJ4 A;  3GE9 A;  3NBP B;  4OZ5 A;  5CHC B;  5EUH A;  1HMV A;  2YKA A;  3ZTS A;  4B9T A;  1Q8K A;  3E2E A;  2WSC C;  4FXV A;  3JS9 A;  1TQL A;  3NS6 A;  3BSC A;  2NQP A;  3H87 C;  3GXQ A;  1GFW B;  3R7N B;  4AD6 A;  3KMQ A;  3Q8P B;  2KN4 A;  2W4P A;  3NGU A;  3NS5 A;  4ZVE A;  2YNG A;  1AZS A;  4L72 B;  4J9P A;  1S6U A;  1T9X A;  6FD1 A;  4U7U K;  3V81 A;  3F44 A;  1FDN A;  3H5X A;  1G4C A;  4NEZ A;  3QBC A;  1JLE A;  4OX7 A;  5A2Q Y;  5IV3 A;  4CNZ A;  2ZNY A;  4UF4 A;  4CZC A;  2PDA A;  1I94 F;  1HBM A;  3DYA B;  3NAH A;  2RUG A;  2CG4 A;  3PHE A;  3PTW A;  4OZ2 A;  1RHQ B;  2XZT B;  3OHA A;  3DRS A;  4NLT A;  4ZPW R;  2I9S A;  5KFN A;  2ZBP A;  5KFE A;  4OYX A;  2E5J A;  2IM1 A;  4HHH A;  4CLK A;  4ECY A;  2M8D B;  1V9O A;  2R8J A;  4ATN A;  3PXG a;  4B08 A;  3RRG A;  2AKW B;  3CJ0 A;  4F26 A;  3G6X A;  1WJ9 A;  2BW2 A;  2HFS A;  1Q4R A;  4DL7 A;  1MW7 A;  2B8Q A;  2BE7 D;  2O67 A;  4YB1 P;  4KGK A;  4CO0 A;  3W5Z A;  5GMD A;  3M1V B;  3H5U A;  5K5M A;  2HAI A;  2QE5 A;  1Z2L A;  4WU3 A;  1NHV A;  1FDD A;  3CDB A;  1X4F A;  3TA0 A;  1CJK B;  1FRJ A;  3T5H A;  2GC8 A;  1UJ4 A;  2VZ9 A;  4WP8 A;  1FJ7 A;  3J7Z T;  2VG5 A;  2B5J A;  2AEJ A;  3G87 A;  5F8H A;  4IUF A;  2NXU A;  1N5Y A;  4FZV A;  2HHU A;  2DXF A;  2I8E A;  4LIW A;  3QT7 A;  1EX8 A;  3FEX B;  2G2O A;  2DGS A;  2DNL A;  3DMJ A;  4G65 A;  4DLG A;  2ZUA A;  2HMI B;  4N47 A;  4JI7 J;  2CNN B;  4OJG A;  3TJA A;  2RS2 A;  3HD2 A;  1KLN A;  2MTL A;  2R8I A;  5HVG A;  3R9L A;  1T03 A;  3M9N B;  3ZZR A;  4J9M A;  2M88 A;  3R8Y A;  1RT4 A;  3TNV A;  2XQC A;  4LMZ A;  2H4W B;  1LWF B;  3KLH A;  3BQ1 A;  4HYK A;  1PC4 A;  2A10 A;  1FA0 A;  4ZJL A;  3US5 A;  2EXU A;  3D5M A;  5EWE A;  1GX6 A; 
#chains in the Genus database with same CATH homology
 2JXI A;  2CPG A;  1P94 A;  3OD2 A;  2RBF A;  1BDT A;  2GPE A;  2JXH A;  3QOQ A;  2BJ1 A;  1ARR A;  3PHT A;  2WVE A;  2K5J A;  2KEL A;  2K9I A;  1BAZ A;  1EA4 A;  2BNW A;  2H1O E;  2JXG A;  3FMT A;  1NLA A;  2BJ9 A;  1QTG A;  2K6L A;  1B28 A;  1Q5Y A;  1MNT A;  2CAD A;  2BSQ E;  1X93 A;  1BDV A;  2CA9 A;  3LGH A;  1IRQ A;  4FXE A;  1U9P A;  2K29 A;  4HV0 A;  3VEA A;  1ARQ A;  3QSI A;  2FGC A;  3BKF A;  2WVD A;  1Q5V A;  2BNZ A;  1MYK A;  4D8J A;  2PC6 A;  2Y3Y A;  4ME7 E;  2WVC A;  1PAR A;  2BJ7 A;  2BJ8 A;  2BA3 A;  2K1O A;  2CAJ A;  3BKT A;  3BKU A;  2WVF A;  2WVB A;  3VEB A;  2CAX A;  3VW4 A;  3FT7 A;  2F1F A;  2HZA A;  2AY0 A;  1MYL A;  2NZC A;  1B01 A;  2HZV A;  3H87 C;  3GXQ A;  2BJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...