2WVFA

Structural and mechanistic insights into helicobacter pylori nikr function
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
SIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAEDNPNDESKIAVLVVIYDGGQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Helicobacter Pylori Nikr Activation.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords PUTATIVE NICKEL-RESPONSIVE REGULATOR
total genus 35
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2wvfA01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2wvfA02
1EA4A 1BDTA 2BNZA 4ME7E 1X93A 2JXIA 2KELA 1MYKA 2K9IA 2JXHA 1B28A 1NLAA 2K5JA 1B01A 2BJ8A 1U9PA 1Q5VA 4HV0A 3GXQA 2PC6A 2GPEA 2CPGA 3QOQA 3QSIA 2CADA 3VW4A 2BJ7A 2FGCA 2BA3A 2JXGA 1PARA 3BKTA 2RBFA 1ARQA 3OD2A 1MYLA 3VEAA 3H87C 3BKUA 2F1FA 2CAXA 3FT7A 2BSQE 2CA9A 2H1OE 1Q5YA 2BJ3A 3VEBA 1P94A 2WVFA 2NZCA 2K29A 2WVBA 2CAJA 3LGHA 2BJ9A 1IRQA 1BAZA 2WVDA 1MNTA 2HZVA 3BKFA 2WVEA 1QTGA 2BJ1A 2K6LA 4FXEA 4D8JA 1BDVA 2K1OA 2Y3YA 2AY0A 2BNWA 3FMTA 2HZAA 2WVCA 1ARRA 3PHTA
chains in the Genus database with same CATH superfamily
2GGPA 3UO0A 3UD4P 4OI1A 2W2OP 1UVIA 3PXGa 2NLWA 4ECRA 5FJ4A 1UW4A 1RTJA 5L9NA 1N33F 1SH2A 2A0FB 3PFEA 2JX2A 3ZZOA 3GFZA 4DFMA 4N8OA 3GP9A 1XTZA 1E6VA 5KT5A 2DHSA 4EZ9A 1UFKA 3RU0A 1UMJA 3GQCA 2W4PA 3QZ7A 1CSJA 4QWCA 1HNVB 4QIEA 1LWCB 3CO0P 3H42A 1LV5A 2FVCA 1HBUB 1WEZA 1PG5B 4X4UA 2OPSA 1YJTA 2C22A 4C8NA 2PFDA 3WIVA 5A76A 5DGBA 2MQOA 1ZAWA 3DLKB 1F9FA 4NLGA 1NZ8A 4LREA 3TYTA 1T94A 2HG4A 5F9NA 2V4RA 3RJMB 2V67A 3I4PA 5K5MA 2OD6A 3IO1A 3NG8A 3ISND 4HTJA 1IUJA 3I31A 3KMQA 3R2DJ 1WHWA 4GO5X 4EFAC 4QBUA 1HWUA 2J9DA 1C0UA 1M90T 3AY0A 3ITHB 4U8YA 3KLGA 1LXNA 2AJFE 2FHMA 2IC3A 3K57A 2E5GA 1N5VA 4M5NA 3JSBA 3PYEA 4ZPVR 1F5CA 1KP6A 2J0WA 4DPWA 2W25A 1MYLA 3FKBA 1ELOA 1LNQA 3RBDA 5KFVA 4IFVA 4RLEA 5KFZA 4DV1J 2VQEF 5LXYA 3UI3A 4JI1J 1OMSA 4L6V3 4NMLA 5I42B 3TA1A 3CD7A 1WC6A 3CTRA 4RKUC 1PYTA 5B0BA 5C24B 2XEXA 3FFIA 4F3QA 2XGPA 3QSYB 4C8LA 3NL0A 1F2GA 1FEHA 1UVLA 3M8YA 4QJVA 2O1PA 2MKIA 1R6YA 2YPZA 1S59A 3GG1A 1ARRA 3KK2B 3PYGA 4IH5A 3ZZTA 4OI3A 2ZUGA 1FRHA 4ZJLA 4DZDA 1NM2A 1YJVA 2QMUB 1FO1A 1C0UB 3TRGA 1G2EA 4M5KA 3W7BA 1HKAA 3KUGA 4P7TA 2HHUA 4E8UA 5KG7A 2RF2B 3RBEA 5HBMA 3I4HX 2FVPA 4HT7A 4UOGA 2OFGX 1UWBA 1LWFB 4YY3F 4DR2J 1FFSB 4DQQA 2OPRB 3PRBA 4ECVA 1JLFA 1VQNS 1DQAA 2WVBA 2VF3A 3MD1A 4AYBD 2ZZNA 2BM0A 1NDCA 1VLYA 2XULA 2ZH2A 5KAKA 1XNRJ 3X1LB 3MMBB 4K5SA 4IFYA 3RAXA 2J8AA 3K7RA 2EKNA 4NOHA 1GX5A 2YWGA 2AP6A 2H3AA 1QY7A 1XNQF 3I0SB 1LKZA 4WFNQ 2HVZA 4LRAA 5MAOA 5SUHA 5J1NA 3UW1A 2BYCA 1Q95G 1AXQA 3DLGB 4UW2A 1S49A 1U0HB 1RTDB 2FHKA 3ZO7A 5L1JA 3FRZA 4FPRA 2NXUA 3H2VE 4LF9F 1RWOB 5DQGA 3ZZ0A 2FLOA 4K4YA 4F4ZA 1XR7A 2O01C 2MDAA 3SBMA 3V6JA 1JK9B 5AE2A 1WACA 3TZWA 2GGPB 4NXMJ 2IC3B 4DFKA 3AOCA 1T9VA 4FYXB 2XCPA 2DRBA 2FY1A 3NNEA 2AN7A 1AW0A 2D3O1 1URNA 3A8IA 4DWIA 3QRRA 4P73A 4TQSA 1VC6A 1B0VA 3RR8A 1UVMA 2I9SA 1N32J 2F65A 2CNOB 3ILOA 2CPDA 4URGA 5DO2A 2Z2LA 3KLFB 4J9NA 3R6GB 4USMA 1I1GA 2WBRA 1FNOA 2BE7D 3MM7B 3ENVA 2VKZG 4QIGA 2RRNA 4KHPF 5E5NA 2BR0A 4RU2A 1WOOA 2LXFA 2PO4A 4KKOB 4NLYA 2DGOA 1P27B 5AJ3F 3NGKA 1FJCA 5BR8F 1YBAA 2HKEA 4MAKA 3LPEA 2Z0GA 3ELHA 1HIYA 4ZK7M 3Q24A 2GIRA 4A8MP 1WKLA 3GSIA 1NDPA 1M5OC 3AD9C 1S9GB 1AUSL 1ROFA 3BPSP 3LP2A 5F9LA 3TJ9A 4A8SA 2IM0A 2KM8C 2W9BB 1RWKB 3AXKA 3UN3A 4O3SA 4FF2A 3OL8A 2WVFA 4OHYA 4ED8A 4IR9A 2ZNZA 2BE2A 2W8LA 4DEZA 3M9MB 5I4MA 3P49B 1W2IA 2EFGA 4ZN3A 2KT2A 3OXFA 1NBEB 2NUHA 2ZUAA 4FPIA 4IFYB 4IFVB 4RW9A 1G1XA 2JXIA 2RVJA 2V9WA 1EQMA 4NASA 2MPUA 4NLXA 2VC0A 2AJQA 1TL4A 3O1LA 3MCMA 2QIFA 1PBUA 4ZN1A 3M05A 4DSKA 4DV4F 3QGPA 1L3TA 4X65F 2NUUG 2O66A 2VBWA 4ZJOA 5DQHA 3CJTA 3BSNA 5H1SV 5DGAA 3OLAA 2VB6A 4WCEQ 2ZVSA 4KPYA 2E44A 1ZBTA 3TI0A 2J6SA 2XO7A 4AAIA 4DF4A 4B02A 4J9MA 1FKAF 4PCQA 4LF5F 1RAHB 2JZ5A 1R0BG 4EYHB 5AE3A 2I38A 5THWA 1X8DA 2X3GA 3JAMY 3ILLA 1MROB 3RRHA 1HNXF 3CC7S 2A2DA 5IOLA 4X66F 3ZZUA 2VUGA 4ZVEA 3IS9A 2C2ZB 5D78A 1NK4A 3BEGB 1QLNA 3NY0A 2KXFA 2NCKL 2K2PA 2AX1A 3MECB 2OFHX 3MM6A 2JXHA 4DV2F 1IKWB 1F0XA 3MMBA 2U1AA 1SJQA 2JVRA 3EGVA 1RHMB 3BQ0A 4WZMA 2XMAA 5F8JA 4OZJA 4RNHA 2WW4A 4EO8A 3ZZYA 3G4SS 3AB2B 4WFYA 4PQUA 1F9EB 3VGVA 3NOCA 3NBPA 2HRYA 5EWGA 3A1YG 3ONQA 4ANCA 4G6VB 3CD5A 5J1EB 4J9RA 3PW2A 3DNCA 2R2SA 1PILA 2CZ9A 1RT7A 3P8BB 2V8HA 1SQGA 3DRPB 4MT1A 4UOCA 2LU2A 3CCJS 1CS4A 2B51A 4KFBA 5ETVA 1RWMB 4I67A 1SL0A 2E5LF 1JLBB 2UXDJ 3PHEA 5M2UA 3A8KA 2OUGA 5KG2A 1LWCA 3QT7A 3S1TA 4NLPA 2ZH5A 2B5JA 4Y28C 3PYDA 4LF2A 3GIMA 3CC4S 4E98A 3MAAA 2XLIA 2CADA 1X5OA 2ADCA 5KFEA 4ECWA 2FLNA 4H54A 3BO2A 2ZWOA 5DDPC 2AGPA 3FUYA 2RMLA 3K5PA 2N4DA 2FY8A 2AZ1A 2QLJB 1MN7A 4V1Ak 2RKIA 3DU5A 3N5FA 4OX9F 2LEAA 2CAXA 1O51A 3KHHA 1RA7A 2BSQE 4GVBB 2W7PA 2HHTA 2F40A 3EVMA 3J7YI 1X4EA 1YJNS 5KFAA 2XHWA 3ILJA 4FXDA 5KFIA 4I64A 1IRQA 2FJXA 2BW2A 1X0FA 3HJFA 3EVOA 5DLFA 1JKHA 5MLCV 5GMKa 5KFKA 3Q8VA 1Y4ZB 2V34A 1MROA 2W9BA 4JI4F 2JC1A 1BE4A 2V50A 4EYIB 2B4VA 3HK2A 1F5BA 4CTAA 4F50A 3K0JA 3MCSA 1RZMA 3FQKA 3MR5A 2KHDA 4DL3A 2ZD1A 4IG3B 1TKXA 2YQ3A 4DCPB 5KFPA 2DNOA 1RYSA 1KR4A 5HP1B 4ECQA 3CMES 3CIMA 4IRCA 3ZZPA 4NX9A 2MHEA 4J9OA 4DSLA 2RBFA 1N5QA 2HW3A 2JSXA 3BN7A 4DX8H 2C42A 3ICLA 4DL2A 4JI2F 4MKYA 4N5SA 1K9MT 3QBCA 4DUTA 5K8NA 3D2WA 5AJ3J 1EKSA 1WDDA 3W64A 4B3RJ 4AQYF 3W2VB 3LF0A 2EXUA 3OTBA 4RW6B 4DV3J 4ZVGA 2JEJA 4F4XA 2FZKB 3CB4A 2YWFA 3LP0B 4P2FA 1L3VA 1FWLA 1SIWA 2OPQB 1UJ5A 1N5TA 3GYNA 1K1QA 2EFQA 3HF5A 2R7SA 4O0NA 5A8WB 4ZLLA 5GADU 2HBYB 2R4FA 3DRSB 3ZFVA 4PEOA 5ETPA 5KT3A 4L75A 3CCVS 3R27A 1SKWA 2ZH4A 2UUBF 4NXNJ 4IKAA 3W65A 3SV3A 2LU1A 3DM2B 2BJ7A 2AV5A 4J9LA 2ALZA 4UY85 4X84A 1FNMA 2R7QA 2M4MA 2J9DE 3SSSA 1U45A 1KQFB 4MIWA 3JYTB 1U1PA 1AZSB 2IHR1 2VFUA 2EBGA 4BBYA 2C3YA 2DGXA 1P94A 3B82A 2KXHA 5LMUF 3HVWA 4RO0A 3N9UC 4NPOA 1Q1KA 2W2NP 1WUUA 4J9UE 4TY9A 3JQMA 2K6LA 1N8RT 3HKWA 1TVRB 1V3SA 1C1BA 2XSJA 4FP9A 2P6SA 3FSYA 1IBLF 2BOPA 2YNIB 2KFZA 2YQ1A 3UQSA 4WP3A 1QVFR 2UVRA 1RWXB 1T05B 1MYKA 1IR2A 3LQVA 1RBOB 1RT3B 1TQLA 1F2HA 3RB3A 3DLLQ 2ZFHA 4LF6F 1EP4A 1X4DA 3MR3A 3SV4A 3QOQA 3X3UA 3QSIA 2LECA 1RKJA 4TY8A 3VWSA 3G96A 1K44A 4MFBB 4B3OB 3ZZRA 1SXLA 4C8OA 3M2UB 4RX6A 4WE1A 1IQTA 2MZTA 2O67A 4KY3A 3UN2A 2DBBA 3RW6A 7FD1A 4WYWA 1JLAB 2VU5A 1T02A 2E1RA 3AD7C 2QC3A 3MPDA 1RYRA 1N34J 4ZKAA 2QEXS 3DC2A 1HI8A 4PAAA 4J5OA 1QTGA 4QPTA 1B7FA 2BA9A 3SMZA 4D3GA 4QYRA 2AZ3A 3LP0A 4PXDA 5L9XA 4ZLNA 1JWWA 5KOXA 2R2RA 3RW7A 4KB7A 2MQPA 3CPWR 2HHHJ 4XO0A 4OX9J 1FHTA 4PQUB 1KLMB 2H4WB 2K1RA 3CVKA 2VOOA 2GZOA 1XBWA 3H90A 2UVWA 3O44A 5IWAF 4L76A 2LXIA 2ROGA 2CQ3A 3PJXA 3HHDA 4P52A 1Y5IB 3T1AA 2DPJA 3EMTA 1HR0J 4ZIWA 2XTJP 1IBMF 1TAQA 1WF1A 1VK3A 3CIZA 2R2TA 1TR0A 2V94A 2AMCB 2KZMA 5U47A 2NS1B 4OZ1A 2HNYB 4C8KA 3VR1A 4XAKA 3LW5C 1PIEA 4ZDNA 2VQFJ 2HFZA 3HD2A 1P1LA 5ETOA 1FDAA 4NYPA 1FWPA 2GMJA 3FC9A 2ABYA 1HW8A 1HWJA 1R27B 1VDHA 3LOUA 4K8RA 1WD6A 4CLWA 2HQGA 3GG0A 2HMIA 4OHVA 4OL8A 1H0HB 4HH1A 3D0HE 2CG4A 3DOKB 4I2QA 1M5KC 3FEXB 1UZHA 3H5XA 4DR6F 3C15A 1T9TA 2C3OA 1P9QC 2HWHA 2UUWA 1EJ7L 4CLPA 2B56A 4ALZA 3CJ3A 4CYUA 5CD4A 2Q79A 5J2PB 4LBIA 5L1LA 2E66A 2QTWA 3DI6B 5IT9U 2CG8A 3R97A 2DNPA 4DSFA 2UXBF 2QA1A 2GIFA 1U6ZA 2IFXA 2YKNA 5DS7A 1N33J 1IKYA 1DJ0A 1VRTB 1XR6A 1JMTA 2ACYA 2CQ0A 2EFNA 4MK7A 4ZOSA 1WTBA 4FBTA 4LR9A 1TKXB 4C8MA 3RAMA 3IWNC 3AOBA 4Y2KA 1W26A 5IT9Y 1IWAA 1REVA 1MMDA 3AOAA 5HSPA 3OFGA 2V2ZA 1HQEB 3CCSS 2EFVA 3OPKA 3PFOA 4RU9A 1ZTTA 4J91A 1LW2B 4USIA 5D4OA 2KRBA 2YNFB 4OYAA 1HL6A 4RW4B 2L41A 4DV3F 1FEEA 2JJ4D 3KLIB 4JV2A 4PRFA 1HI0P 3DLEA 4BLGA 1HA1A 4QOTA 4CYUB 2W1BA 2OGUA 2FVQA 4G1QB 2CRLA 4IO1A 3CCRS 4MJWA 4CO1A 2EPIA 1JNRB 4QIWD 3IRWP 3HJVA 3UCZP 1QUVA 1NK6A 2GNKA 3RRKA 1S0MA 2W7AA 2A10A 1IM6A 1NK8A 3THPA 4ECYA 3ILIA 3IP0A 2BRLA 2DO4A 1UTAA 2MLYA 2VDIA 3UNGC 3ZNJ1 5G0RB 1VMBA 2QJ3A 4HI1A 3G6ES 2GV1A 1WG5A 2DGQA 1MWYA 4LR8A 5KT4A 2COLA 4KGMA 4PG8A 2RKIB 1OQ3A 1LW0B 4JBCA 4JI5J 1A7GE 2C2MB 2AX0A 4MYTA 3BO4A 2DY1A 4ES3A 4ZHRA 4DR2F 3LH2S 3BH7B 2GS8A 4KO0A 3FMWA 3IXQA 1VBYA 4OI2A 1HPZA 3L4BC 1T03A 4BDPA 4ED3A 3PDNA 1A0OB 2CDRB 1JKHB 3ISZA 3PO4A 3C3LA 1TKDA 3GV7B 4H4KC 4N76A 1H7XA 4LQ9A 4NRUA 5F0UA 5KG6A 3DRRA 3QYYA 2KU7A 3BM7A 5K14A 2IMOA 2Q43A 4PYAA 5DDOC 4NLVA 1U24A 1R0AA 2E1AA 2LQJA 3IM8A 3M4XA 3MZIA 4QQBA 5CCMA 4LF9J 4H4MA 2HHVA 3DRXA 1LWEA 3KG4A 4QWAA 1LXJA 1N5YB 3BPDA 3HKZD 2YNGA 4N56A 2F5GA 4K4XA 4U7CA 4FS2A 4LVOP 4NYZA 5HMZA 1RK8A 4DXLA 4GRSA 3MM9B 1RI7A 2VG6A 4DX7A 4B3MF 1DLOB 2EEYA 1HI1A 2Z2MA 4QIVA 2ZNYA 1X4FA 3JTOA 2YPYA 3AB4B 3UDCA 2GJFA 1RT1A 2ERRA 3DOLB 2CQ2A 2XS2A 2Z2ZA 4M5DA 3CJQA 1TP7A 1D3WA 2KKHA 2RH3A 1PYSB 2D41A 2MXYA 3KTQA 5CXTA 3G82B 3PYFA 3FT7A 3LAKA 1B0TA 3J80Y 2GHPA 2VH7A 1FKOA 2GW8A 1FWKA 3PJWA 3UWTA 4JI6J 5HN0A 1UVKA 2BJ9A 3EE3A 1QAJA 4RUCA 1ZAVA 2J7KA 2FDNA 1D8ZA 2IBOA 2Z56B 3CDBA 3EUNA 3MPUB 4KHRA 3PVXA 1FESA 1V5VA 4P9SA 3QLHB 3SCLE 2ZBCA 1S9FA 2AQ4A 3TX8A 3KLEB 1L3SA 4Y00A 1HQUB 1HYSA 3PEJA 1IKYB 1HWIA 1VRTA 3I32A 4USKA 1E6YA 4KYZA 1S76D 4B9SA 1HLWA 2VQFF 3EGZA 5LSRA 3Q2SC 1U9PA 1QE1A 3AXMA 4IG0B 4NLRA 5KFWA 4X62F 3OUYA 4ERDA 3NWRA 2VG5A 3MR2A 2BV3A 2CPHA 4Y2IA 1D09B 3M32A 2R8KA 1N0VC 3K5OA 1VLOA 4M63A 4JI4J 1FI4A 1HQEA 2H65B 1R8AA 4QWDA 3OR2A 5KFCA 1KVJA 2Q3PA 4NMXA 3HHLA 3OFHA 5T41A 3T6JA 3E2EA 3UDVA 3RUBL 2QT7A 3TJAA 1FRXA 2K8GA 2DGTA 2ZHBA 1EP4B 4AUKA 2IJRA 3TJ8A 2AYMA 1JLGA 2XCAA 2FHJD 1T9XA 1JQGA 1RAGB 3FBBA 3I0RB 4CO0A 1NH8A 1CJKA 1P8GA 3GZ7A 4OYZA 2G2OA 4YN3B 4A47A 1VQKS 2VD3A 4ME7E 2BKPA 2HRTA 2W9CA 1UL3A 1FRIA 1VRQC 2YNGB 4O3QA 3UNYA 2MKYA 1JLAA 4UTGA 4JI1F 3LGMA 1ACMB 2DJWA 1F1BB 3PCOB 3R5DA 2KTQA 2VV5A 1PYOB 3BGOP 4QZVB 2CPXA 3VALA 2QE5A 1Y11A 1IBKF 4DR4F 2FD2A 1LK7A 3DXBA 3T19A 5D0HA 2AWZA 6AT1B 5GAEU 1FJEB 2J9EA 3MR6A 1ARQA 2V5HG 3I9ZA 4B9TA 4KV8B 5KFNA 1H2UX 1R31A 4TN2A 3ULHA 5ETRA 3CCTA 4DN0A 2G2YA 2OO4A 2GJIA 4ZITA 4IOAQ 3DDNA 1NPPA 5KG1A 4NCAA 2J0SD 2HQ3A 3TWZA 4WKRA 3GR1A 3A13A 4LT6A 1CEZA 2DH7A 2I8EA 1S1WA 2A1BA 1S1TA 3D7SB 3W5ZA 3DRRB 5BJRA 3BO3A 5J2MA 1LK5A 1RT6A 2LQ9A 5H9FK 3QT8A 3CJ2A 4FXVA 3SSRA 3OHAA 2W9AA 4M5IA 3HPOA 2L9DA 4RWXA 1XIQA 2JNJA 4JI3F 3QWUA 1U0HA 2YTCA 3AD8C 4Q2MA 3CJKA 3I5BA 2D3UA 3PACA 3TVYA 3W63A 4Z2XA 5HLFA 3SQGB 2R7TA 3CNQP 4OYPA 3D54A 3DLBA 1UJ6A 2DIUA 3HHLD 1GNKA 3MDFA 5CYQB 4TVAB 3J81Y 4F2SA 3SQOP 1UEVA 4PR6A 2KRRA 4ZA1A 1HHTP 2BANA 1J27A 2XLJA 5B0AA 3TZYA 3D1OA 1TKZB 3AQPA 3EPGA 4DCJB 3QFHA 1RKIA 3J7A1 2ZDOA 2V2VA 2V2QA 4I6YA 4OV1A 5A8RB 3P4UB 5E33A 3ZNUA 1GMVA 4FF3A 4NLUA 3HHNB 2ZBPA 3U02A 1YI2S 4DUZF 2YKQA 2UUAJ 4WFXA 4ZP6A 1CVJA 3TEGA 2RHSB 2XY6A 1HMVA 4A8FA 1RABB 2ZVIA 4GC7A 1V9OA 4H4MB 2AEJA 1HYSB 1FD2A 3AJDA 1NU4A 3IWXA 1LWXA 4R0EA 4NA3A 1FFWB 4DS4A 1U1OA 5LMNF 4GKKF 1GH8A 2VG5B 3MMAA 3SSQA 3UVJA 1CQMA 1H6KX 5CZXA 2IRUA 4KC5A 5D4PA 2NREA 3PTWA 3V4MA 2I2YA 4NEYA 1WC1A 1KN6A 3M8ZA 3OBIA 3FMBA 3G8TA 1ZM3A 3J7YU 3R1LA 2X51A 1HNVA 2XYHB 2ZE2B 3MMCB 2CKWA 4TLQA 4DJBA 3KLHA 4DR1J 4O3PA 1X93A 1S0NA 1K0VA 3QJJA 5J2QB 5LL6d 4KTQA 3NS7B 2XS7A 3B4DA 1NSQA 2AYGA 4ES1A 2YKOA 2MQQA 4AD6A 2DKOB 3IN5A 5B0GA 3SYZA 3H59A 3RB0A 3OL7A 4Y0FA 4YR2A 2HAFA 1LFPA 3SXLA 2KJVA 3MUVP 5D4NA 4AL6A 3QNWB 5KFTA 3M9OB 1BGXT 4DX6A 2X3DA 1JB0C 1T95A 3OTDA 3R7BB 3BGFA 1VHFA 1EARA 4CT8A 1KHVA 1U1RA 1TFWA 1HD0A 2C2DA 5KFMA 5IZHA 2ZKTA 1BDVA 2Q2KA 4ID5B 5HJXA 1VBZA 4LQ3A 4B17A 1H98A 3Q86A 1WC0A 1HARA 1TUWA 2DHAA 3DCAA 5D0EA 4YR0A 2VFSA 2XM3A 1S6QB 2YNHA 2I6WA 1TZ0A 2CPJA 2CQ4A 3N0VA 2F9DA 3VVTA 3JB9k 2FJWA 2CPZA 2W8KA 2LYVA 1DY3A 3IR7B 1RCXB 3NS5A 5E7OB 4FVMA 3W8PA 4C7QA 5DETA 1N4LA 2B43A 2HURA 2VPZB 3MM5A 2Y1IA 4LF8F 3MUMP 2B9XA 2XNRA 4YB6A 5IV4A 2NZ4A 4CLYA 1DARA 3EWGA 5HO4A 4QYZK 2I1RA 3QT5A 5IM0A 3VEAA 2HGMA 3TUIC 2OPPA 1NK0A 1N36J 1AUDA 5GMEA 3V2UC 3MWBA 4HVZA 4Q45A 3W8GA 2MQNA 1KQSR 3SCKE 3G2XA 2AW0A 2M88A 5HMXA 4L3KA 2LDYA 3L7PA 1AFIA 3CDEA 1FF2A 1DTTB 4NLSA 3D9BA 2LEPA 4WFAQ 3DHWC 3CCMS 3D6TB 4DR5J 3S01A 2CNLB 3CULA 1HBOA 4ED0A 4H4KA 1JJ4A 4YEAA 5ETTA 4LF5J 3OT9A 3H25A 1RADB 3OLBA 3FZBA 4MK9A 3K5LA 1VQYA 2BE2B 3GFXA 1YDLA 3HVRA 1YLXA 1SL2A 1RUSA 3MAAB 1I6JA 2F4VF 3KJFB 4BWJA 1CULA 4EI2A 3TAMB 4BS2A 2C2NA 3IGVA 3QIPB 3T5HA 1FXLA 1RXOB 2GJ2A 4G3IA 2HGLA 4P2SA 2DB1A 3HZEA 3Q8YA 2UXDF 1FERA 4PQAA 4DV2J 4F2RA 2MSTA 2V2KA 1ZA1B 2ALYB 2YWWA 4RW6A 3RYLA 1S6PB 5KFRA 2HFVA 2CPEA 3W9IA 4LF6J 4FYDA 3L09A 2WOMA 2HS4A 4U67Q 1SJFA 1NJXA 2FZCB 4HACB 2WVDA 3GJSB 2DRDA 2OEKA 4A8YA 2WVEA 4Q7AA 2MQ8A 1VQ5S 4GKJJ 2H4YB 1O5JA 2QMXA 3A3OB 1VFJA 2MHNA 3K89A 3QATA 2ZM6J 2BNZA 1KOOA 1WI8A 1QM9A 2QSFA 5DG7A 1NLAA 1LWFA 3LALA 3MXHP 5KFHA 1N6QA 2WONA 1HBUA 1JNZB 3B4MA 5KOWA 1RU1A 4LBHA 3VAHA 2W2PP 3QIPA 3CCLS 2BA3A 4LRCA 1JIHA 4ZCLA 5GAGU 2BOAA 2IBKA 2KT5A 1S79A 3QO9B 5C2CA 4G1IA 3HFZB 4HTIA 3AJ2A 3JS9A 1XR5A 2HS0A 4I4BA 4IOCQ 1HBMA 2HK3A 3OTEA 3ISNC 4HL9A 5F8IA 5KFJA 3HULA 3GIIA 3F44A 3C6UA 3PEHA 2EFOA 2RIJA 2CQHA 4MH8A 4Q2LA 4DL0C 5HL7Q 2W4DA 3IBFB 2QL5B 5KFBA 1I94F 4WWSA 4DPYA 1DTTA 1ZAXA 4LFAJ 1NUEA 2WSEC 2ZH3A 1RT3A 4YDXA 4JI2J 2DNLA 1BQMA 1X5PA 3D0IE 5HATA 4DN9A 4EUVA 2B3TB 1X9MA 4IRKA 2PDAA 3O8WA 1K73T 2FHOB 3KG1A 2CPGA 4F67A 1OO0B 4CO4A 2ILYA 1CC8A 3W5XA 4C3KA 2VKRA 5D6GA 4DR1F 4DQRA 4PWDA 2J76E 4IYQA 3TAPA 2QG9B 3DLJA 3E3XA 4P7VA 5IQQA 3KNAA 2OD4A 4B3TF 2VIHA 2FJBB 1OYEA 2NZCA 2X1GA 2MZ1A 1GMWD 2JH3A 2NYIA 1IQZA 2I5JB 3I0SA 2HZVA 2FGOA 2JFDA 2P9EA 3KDNA 5IT0A 2ZJQQ 2R7VA 1X0PA 2M8HA 3VAGA 5FDLA 3P96A 2UXBJ 2QLBB 4Z7YA 3LP2B 2IYGA 1H7WA 4FF1A 2ZEJA 2P8IA 3ET6A 4WBFA 3GFHA 2DXDA 2OPRA 3GV8B 4JUZA 1RP5A 3BYPA 5JVHQ 4C4WA 1SCJB 1Q8IA 2IVFB 4PWUA 5KFGA 4M5GA 1U1QA 4J90A 3MOJB 3IS9B 3M6VA 5EWFA 4C11B 2EKYA 2RQCA 1D8YA 1Q7LB 2XNQA 3H87C 3IFEA 3PKYA 1S1UB 4LSLA 1Y5NB 2EC0A 5CAAA 5DQIA 4OYWA 4TQRA 4MMOA 4DS5A 4WU3A 2UP1A 2VPWB 2XLKA 2FB0A 4I56A 2DIVA 1FE4A 3FK4A 2YWEA 5E0OA 3VCDA 4DV7J 1U6FA 1RBLA 2CQCA 2H3EB 3IR7A 1RAOA 1SC4B 1U26A 1ZPVA 3D28A 3LUYA 4CRJA 3B54A 4R5PA 1A6LA 1R0CB 3M1VA 3VQTA 4NWBA 1TFYA 1NRKA 4N8NA 1VBKA 2KN4A 4FYWB 5HQ8A 8RUCA 5HVHA 4RNNA 2KVQE 4O3NA 1REGX 2XG8A 3TP2A 5GAEI 1FFGB 2HFUA 2DD8S 4WIIA 4AXJA 5D3GA 2ROPA 4OJ1A 1MU2A 3OR1B 2QA4G 2SXLA 2CJXB 2UU9J 1F5AA 2JLFA 2RRBA 3GU0A 5CYMB 1H73A 2CVIA 1SJRA 3DOMA 3HP6A 1TK8A 2UUTA 4V19J 3OVBA 2MY7A 1HNWJ 5A8WA 1P6TA 4KRWA 3PIPQ 1KLNA 4CP5A 2HHHF 3HCXA 2H1OE 4P72A 3NGUA 5CABA 4ELVA 1U2CA 4DG1A 3OV7A 1NKCA 4OJ3A 5GAHI 2FHJA 1QUPA 3HT0A 4LIRA 5BXIA 3K5MA 1JX4A 2DR8A 2OPSB 1R89A 2ZKUA 3PRVA 1BAZA 3FJ2A 3UN5A 1NK9A 2CJQA 1HD1A 1TKTA 1FRJA 1WSVA 4KKOA 3T1YJ 2UUCF 5HQMA 1TL5A 1G4CA 4WYLA 3HMJG 3FVYA 1RA6A 3C2PA 2RS2A 2WOMB 4DLEA 3RGIA 4LFBF 1NXIA 2VDHA 1LEOA 2J6UA 4DQPA 3VAKA 3C8YA 3CC2S 1I94J 4NRTA 3NRBA 2LEBA 5L46A 3B8HA 4LMZA 4QU7A 3BF4A 2FQQB 5D8HB 1EX8A 1S5ZA 2YKNB 2ACMA 1PAUB 5IWAJ 1B64A 2MSSA 3M2VB 4DFJA 5T7LA 1HW9A 4R0JA 4PYDA 1O8BA 4Y65A 5IT4A 2HIYA 4I0WA 4C97A 1FXDA 5F3ZA 1CLFA 3TO8A 3CMQA 3TUZC 3LPYA 2ZH9A 4WE1B 3OSNA 4RW9B 2LP4A 1EKRA 4OX6A 3DLGA 2DNRA 1HBMB 1YX2A 2D69A 4P6QA 3VTIA 2I5JA 4LRFA 3G8QA 3T6BA 2OPQA 5CH7B 1S9EB 4U95A 4RW8A 1U25A 3DLHA 4UY8T 2MKHA 2BVZA 4IQMA 2BQUA 2IY5B 3NXZA 2H5JB 4ZVQB 2AIRB 4P75A 4CI0B 3SFGA 2BJ3A 1SPBP 3RB6A 1HNZF 2ZZMA 5BYQA 3H5UA 3PNIA 2HK2A 3DM2A 3I96A 5KTQA 4DFPA 1U2FA 2PI5A 4IRDA 3DGPA 4CLUA 1IR1A 1T3OA 3FSIA 1IBKJ 5G0RA 2C3PA 2NSCA 1NKEA 1FA0A 4DR3F 1W25A 4FDFA 2XMVA 2HZAA 3L9ZA 2AGOA 4PWDB 3KYLA 2IMWP 3RRGA 4JI8J 1K0TA 1CJVB 3BBCA 3GIJA 3KWMA 1FK9A 4ENOA 2BJ8A 4ICLB 4M8LA 5KG3A 3FZ2A 1AB8A 4WP9A 3HM9A 4ED2A 2X7IA 1LQ9A 4YHHJ 5KFOA 3A12A 3D6MB 3HVTB 1S9GA 2C2KB 1Q82T 5C7PA 1JLEB 2NPFA 5IS2A 3U1NA 2R7RA 2C3MA 2DO0A 3THTA 2VBYA 1X4HA 5B09A 1WNEA 3CCZA 3CD0A 4JI0J 3MI7X 4K0KF 4JV5J 2CQDA 2QSWA 2WONB 1VJQA 4ZVHA 4CWBA 5KFFA 4UZBA 3Q8SB 2P6TA 4B9MA 3KLEA 2ZC3A 1Q16A 1JLCB 4HT5A 1XMQJ 1X4BA 3C16A 4JP8A 1X4GA 4PXBA 3D66A 2WB1D 2BNWA 3QQCD 4ED6A 2P5VA 1FJ7A 4Y2CA 2BKNA 2B9YA 3VAMA 1VQ7S 1AZSA 1GFWB 2B7BB 3JTPA 5HP1A 3KKFA 3U1LA 3GLJA 2GAHC 1KONA 1HBNA 3U27A 1UFLA 2FGCA 1WJ9A 2PA8D 1XN9A 4MKVA 4C8YA 4URQU 5FLXU 4USHA 1M5SA 1UVJA 4GKJF 1F3FA 2IRYA 3CE8A 3P6YC 4JI7F 4Q0BA 1TK5A 2NSBA 1IN0A 1NH7A 2E5LJ 4KJIA 1SQFA 2HYIB 1ZOTA 2CXEA 2DT9A 3M30B 2ZOFA 2HEKA 3R7SB 2EK1A 3TR5A 4F3OA 2F4VJ 2VBXA 3QGIA 3NCQA 1X5SA 5KG4A 1MWZA 3BZQA 3C16B 4AXIA 4X4OA 5JVGQ 1F60B 1WC4A 2D3ZA 1E6VB 4OZLA 4ZCMA 5F0WA 3NGSA 2RT3A 1T9UA 4N47A 3PM9A 4MIBA 1WEYA 2CZVC 4ZCIA 3OVAA 3K17A 1Q0NA 4RR5A 4ZS6A 1NEEA 1RTIA 1SJ3P 2KELA 4CO5A 4R8UB 2JEGA 1B28A 4HHUA 2JLGA 2D1CA 3K5NA 5GAHU 3D5MA 4I1TA 4KH0B 3IC1A 4ZPWR 5LJ3Y 1CBKA 2OMOA 4OLOA 5H9FJ 3BV8A 4DOZA 3LP1B 2XMWA 4U9RA 2F8EX 2Z2YB 3IG1B 2IVYA 1VRUA 2POKA 4NCGA 1IM4A 3LGNA 4JV0A 3RG6A 2DGUA 2GVDA 5CCLA 3ENQA 4ZHRB 3QJLA 6FD1A 2K1RB 2M2BA 4WK3A 3BSOA 1K8AT 1KTVA 2RRAA 4F3MA 4DR6J 4Y2AA 1VGYA 5SZTA 3BN4A 1MNTA 3MGJA 4C98A 3NOGA 4X65J 2CNKB 1XNQJ 4CO2A 3RB4A 4E0DA 2K3IA 5EN1A 1UKUA 2AY0A 4DL5A 2C28A 2GX8A 3HX9A 3FNNA 2LA6A 2VPXB 2XZWA 3K8WA 2OAUA 3H20A 1HNIB 4YMEA 3NMAA 5LOQA 1T11A 4RNOA 3M7VA 4UZCA 4K4UA 3V81A 1IKWA 4PWWA 2N3OA 1GT8A 1PJ5A 1Q79A 1SC6A 1WG1A 4L72B 2ADBA 1FKPA 2MKJA 4CH1A 1GAOA 1U1NA 4LFAF 3BKUA 1S7IA 5I3UB 4C9DA 2OLWA 4KV8A 4NZ6A 3P5TL 2G13A 1TELA 2VPYB 4ZPAA 3V6DA 5RUBA 1N48A 1J5EJ 1X9WA 2E5HA 1CPZA 2K29A 1JJ2R 5C42A 2GC8A 3AA8A 2PFFB 2VC1A 2CQIA 5ETSA 3GILA 1VQMS 2BJ1A 2HBRB 1VQPS 3DHXA 4DR7F 1D9FA 5JMNA 1KLMA 1SB6A 2IM3A 4OLPA 3FMTA 3G71S 1VISA 2K1OA 4CTAB 2OP5A 1QAYA 5B0FA 3VAFA 1VBXA 4K50A 1FRLA 1R43A 4U7UK 1RWVB 2LCWA 1S77D 2MLZA 4ZVPB 1T05A 4ETXA 3IA0A 4B3SF 4JI0F 4U96A 2KT3A 3OW2R 2LQ5A 3HFKA 1KRPA 2UXCJ 2PSZA 1IKXA 2J7WA 3DFEA 4EGLA 4C0HA 5B7WA 3PKMA 4A48A 1MLAA 2GFFA 4OJHA 3NNAA 4DR7J 3WHIA 1HQUA 4OI4A 1M0SA 1NKBA 1IBLJ 4J9PA 1KKHA 4ED1A 2ZBRA 4DV4J 3DMJA 1CJVA 1HHSA 2A18A 3HHLC 3OUYB 2UXCF 1R8BA 3M8WA 3FEZA 2HMIB 2PEBA 3KHRA 2WB4A 2KHCA 2JFKA 2K7JA 3H2LA 1M5PC 3QFWA 3HVTA 4EEYA 1KWMA 5F41A 2PMZD 1OSDA 1N88A 2LLZA 4WJBA 4RBUA 1R0AB 1XJWB 3Q22A 3QJPA 5AXKA 1EIYB 2YH1A 3GB0A 1SH3A 2YXLA 2RUSA 3BR9A 1NJZA 1TV6A 1CG2A 1Y3JA 4X4TA 3WC2A 3VAJA 2A6MA 2F8HA 2IJFA 2QFIA 3MPVA 4MK8A 2OI2A 4EBDA 2DNQA 2JL9A 4TYBA 3QPIA 5GADI 4W92B 3NLCA 3EDRB 1KHWA 2KG1A 2UVVA 4ZLPA 2EC2A 1SUQA 3UDLA 1RTHA 2MGZB 4DL7A 2AEMA 3B6BA 4JI3J 2KZZA 1FDNA 1VQ9S 1JXLA 4F04B 2HNDB 1IR0A 3ADAC 3BSAA 2V69A 5K9FA 4K4TA 3H0PA 1S6QA 2YNHB 4CH7A 5EGYA 1QD1A 3PG9A 4DZ6A 4XDDA 4USVA 2O3DA 4K4WA 1YJUA 2AU0A 3CDAA 3D0GE 2WRMA 2KYXA 3OSPA 4HV0A 1SL1A 1W2BR 5M2PA 4HI2A 2BBEA 5L1KA 5IM0B 1HHQA 4MFBA 4B3OA 4URSA 3KJVB 2AF6A 2DHHA 1IKXB 4TU7A 1RT6B 4QIFA 5JUMA 3UR0A 3PV8A 1OY6A 2RU9A 3GWCA 2BQRA 3T1YF 1H72C 2W24A 2B0GA 2BW7A 1ICEB 2APOA 3OTOJ 1NMEB 3PZPA 3V81B 2Z30B 2R3VA 3D3BJ 2F9JA 3CEDA 3BB5A 2WAQD 4O4GB 3THVA 4IUFA 1WC5A 2YBVA 5I3QA 2R8GA 3KHGA 1F3VA 3MAQA 4X4NA 1EZZB 1S0VA 3CXCR 2F63A 3C66A 4KGZB 3IG1A 1WOPA 4FXWA 4DI6A 3CGIA 5DZ6A 1X31C 5C5JA 5C42B 1TAUA 4CM2A 1SV5B 1XERA 2DISA 4ZVRB 1HPZB 3OTOF 3TARA 1J5EF 2KI2A 1JLGB 3CJ4A 2V4JA 4O3OA 2MQLA 3ENAA 2ZBIA 3H4BA 4ECTA 5E3PA 2FZGB 1TV6B 2D3OR 1UCNA 4L74A 3H40A 5EX0A 1RT5B 1RU2A 4ZVSB 1M1KT 2HFNA 2HQCA 1AA1B 1VHIA 3C14B 2HVEA 3Q8UA 4LUBA 4USWA 3UE2A 1R8CA 2ZDPA 3MM6B 2VICA 1PSDA 3I82A 2IDLA 1J2VA 4WP8A 2HGNA 3Q8PB 4QPXA 3GCXP 4F4WA 2RD5C 2F8MA 4IG0A 3O2IA 4YFUA 3PW5A 4HEA9 3Q0AA 2DVIA 3CJRA 4DR4J 1RJJA 2Z4PA 4FNHA 2HNDA 4X4VA 4EMDA 4ZP8A 1WELA 4ZP7A 1RAAB 1M1HA 4NZ7A 3I9V9 3R5CA 1MWQA 1S1XB 4NZ0A 2E7WA 5CQGA 1PKUA 2VBZA 2IPOB 2VJVA 2BE9B 3CCWA 4M95A 2CUYA 3T1HF 4BC7A 4QWEA 2J0XA 3R5BA 2Z8QA 3TW0A 2BMBA 4CLLA 1S6UA 3DI6A 4FYYB 3F73A 5BYSA 2RDIA 5HMYA 1U7LA 4CT9A 3KDOA 1XQIA 5KT7A 1Y9OA 5GMDA 3NKYA 1U48A 3MMJA 4ILLA 4PPDA 1S6PA 2QYGA 3VGTA 3CJKB 2F4FA 4K5RA 4FS1A 4OZ3A 4OIXA 1WHYA 1CJUB 4NEZA 2G4BA 1Q8LA 5E41A 5B0EA 3TZZA 2KFYA 1FE0A 3BDEA 2F7VA 5KFSA 2KM8B 3KK1B 2HAIA 3AJ1A 4USJC 7FDRA 3EVWA 3IAM9 2G1HA 4O44B 3HDSA 3HD1A 3W2WB 2GIQA 4ES2A 4YQWA 3F56A 2IIHA 2V9KA 2OH2A 1VI7A 1QE1B 2IAJB 3GONA 2G0CA 2CDQA 4P2XA 4IH6A 4OYXA 1LOUA 4I6WA 4K0KJ 1GXLA 4XPEA 1KD1T 1NZAA 2H5IB 1C1CB 2P2CB 1XNRF 3SIPB 3T5KA 4G1QA 2DY9A 2YKAA 4OZ2A 4QW9A 1P9YA 3QLHA 1BY9A 1Z4UA 1O0PA 3EZUA 2R7WA 2XBPA 5K8OA 5DDQC 3RBXA 3ZTOA 2DYAA 5D4LA 3KK3B 4LSNA 2OHDA 2ZM6F 3TOQA 1IXKA 3JSMA 4QCLA 4DLGA 1WORA 2GMHA 4C48A 4PKDB 4B3MJ 1S12A 1QDUB 3LGHA 1VYAA 1S1VA 4UQGA 5L8RC 2GO9A 1VIXA 1Q8KA 2RUGA 1S57A 4HDGA 4MKBA 4DU8A 5A0YA 4DUZJ 4KAIA 4TU8A 3QAEA 4LFBJ 2W9CB 1LW0A 3H2UB 3IGNA 3ZC4A 4BHQA 1VC0A 3CJ0A 5F8GA 1G6BA 3V6DB 4B9NA 4NL5A 2ZOGA 3H5YA 2GMLA 3MEGB 3M8PB 4KO0B 2RS8A 2CYYA 3GJTB 2WCXA 4YDDB 1WDTA 3NGDA 2D7SA 3NGTA 3D6HB 4H4OA 1FVQA 1OYDA 2N4CA 4RW4A 1YG0A 2XC9A 2BRKA 1NDKA 1TL3A 2PGCA 4NI2B 4CO3A 3WX4A 5J1PA 3RR7A 5HROA 1ZM2A 2M70A 1N52B 2Q66A 4PZVA 4LRBA 2M7SA 4MJKA 5H9EJ 5K14B 2W2MP 2OKQA 3DRSA 1CC7A 4IOBA 2U2FA 4NLWA 4UF4A 4WK1A 2ASJA 3AA9A 1C4CA 3E01A 3M2RA 1N56A 2AD9A 4LFCF 1FT8A 3G6VA 2JVOA 4ZPBA 4RNMA 2MZRA 1TUVA 5J2MB 5HMWA 2QGFB 2XMTA 4ANEA 4C3LA 4DV6F 5D15A 3PY8A 4W90B 1Y7PA 2HRUA 4JV1A 2IM2A 3C14A 1AROP 1S48A 1U02A 3IMQJ 4CNYA 2DR7A 4FN5A 2ZZTA 3S7RA 4AFFA 2DR6A 1Y0HA 1XMOF 1Z2LA 3G86A 2K9IA 1GEHA 3N4WA 1HNZJ 2RB7A 4OX8A 2ATCB 5F8NA 1SVDA 1KNZA 4CIOA 1RT1B 1BQXA 2HS3A 3NCPA 2NXJA 4OHZA 3NGRA 5IC4B 4OHWA 2V8DA 3W1YC 1W7WA 1SH0A 2JXGA 2ATLA 2DCLA 5DLGA 4C11A 1I3OB 4TLRA 5CYQA 4DV0F 1F9HA 5LT5A 3W9HA 2XY5A 4IH7A 2GQ2A 3VZHA 4DCOB 2ZHOA 5A6WA 4LF4F 4O4RA 2Y1LB 4UUXA 4DSJA 2KO1A 5LSLA 5AXMA 3O3LA 3W62A 4X62J 3JSYA 5DDRC 2X1AA 3WC0A 1VQ8S 4NYOA 1BWEA 3MFHA 4ECXA 2YVSA 3NP5A 2FC8A 3MPWA 3W66A 4YS2A 3GIKA 1T9YA 5KFDA 1N36F 1N5YA 2PN6A 2K7KA 3L7OA 1E6YB 2MYFA 3ZTSA 4CM0A 1WTFA 4CLZA 4ZLJA 4DV1F 3R1HA 1H2VZ 4QW8A 1P1TA 2LQ8A 2R8IA 4DL4A 4ED7A 3C6UB 3N28A 3O6QA 2NQPA 4DV7F 1MU2B 2GHVC 4ZPDA 4OYIA 2V6AA 4PG7A 5C25B 3SQGA 1VS3A 1UPPA 2HWTA 3D4JA 1MG7A 3J81j 2XS5A 2WHOA 3GSDA 3NWGA 4IDKA 2DEIA 3VGUA 2EFPA 1X4AA 4PUOB 1FX4A 4ZIVA 3W9JA 2E1CA 4A46A 3J7AN 1NB2A 5ETLA 2FTRA 4DPUA 2WSCC 3J7ZT 2OEJA 4NLTA 1CQNA 2MQMA 4N77A 1UEKA 4OZ5A 3E01B 3M2RB 4KGKA 4I6AA 1TKZA 3KOAA 2DRAA 2MJNA 3MTKA 4KR0B 5IQ6A 3KJNB 5K8MA 4DU7A 4Y3CA 2WVCA 1EA4A 1OJ4A 1RAFB 3UR3C 1IKVB 1OS5A 1DQ8A 2HIQA 3MEEB 5T14A 3L3CA 4JI7J 1TKTB 2QLFB 5A8KB 2C2EA 4R25A 1RCOB 3QMQA 1BC6A 2FJEB 5KFXA 2EW9A 1ZH5A 4Z7CA 6FDRA 4J9QA 5C25A 4J9VA 3DDIA 5IXUA 1SIWB 3EGNA 2QO3A 2CJBA 3KK1A 2CPFA 4A8KA 3PJ9A 4ER8A 4ED4A 2DR5A 5HI7A 4X4PA 1AFJA 3EJMA 2V0NA 2CQPA 2IAJA 4PG4A 2D74B 1VQ4S 2YKPA 1NJYA 4H4OB 3R5AA 5T7LB 4KE5A 5IFMA 4DPXA 1YKWA 2OJ3A 4QWBA 3MM8B 3HSJA 3UPFA 3OXGA 2FYXA 3LANA 3G8SA 1QSYA 1VQLS 2EG1A 2W01A 3QRPA 1K47A 3KG0A 2AJ1A 3OFEA 2DNKA 4IQXA 3HSGA 4DQSA 3IR6B 5J2QA 2E9ZA 1UVNA 4PG6A 3BSCA 2XZTB 4OI6A 4OHXA 5EWEA 3R3TA 1G3OA 4DX5A 1BQNB 2XO6A 3K58A 4BC9A 3LJPA 2XZDB 2GCFA 1S9EA 5L38A 3AQOA 3BYRA 4RW8B 1ITPA 2HNZA 4C0BA 3EZOA 3VV2B 2QV6A 1ZZFA 4K4SA 2AJ0A 4KGVB 1S1XA 2C1EB 5B0CA 2OSRA 1G7CB 3K8VA 1MW7A 2DITA 3IAS9 3H98A 3OR1A 4OX7A 3BGRA 1YBTA 2IYIA 4XTTA 3WQPA 5C24A 3UDEA 4C3MA 4DV5F 1QSLA 2KKEA 1KSPA 1BDTA 3QO9A 5LMNJ 1FCAA 1S1TB 1S99A 3GR0A 1GXUA 1NSAA 2XMJA 3E51A 3MUTP 3NAIA 1VK8A 1F6TA 4ECZA 2HHQA 1N32F 2XI3A 4EBEA 3UD5A 1BQNA 3IWLA 3W60A 1CJUA 3TQEA 3OXLA 4KSEB 2RNEA 2B8QA 3GPAA 2VHGA 2JDJA 1X60A 2L08A 3FGVA 3K2YA 5HLFB 4Y2MA 4E2FB 3OJUA 4DR3J 3KUHA 4EBCA 3DXSX 2RHQB 1N0UA 2YX7A 3M30A 3PR4A 2X1BA 5HANA 1RB0A 5HBMB 4CNZA 4C2MA 3EPIA 2YY3A 2IRXA 4BCAA 1VJWA 1KDNA 1WF0A 4DPTA 1GTHA 3TUJC 2R9LA 1HFEL 2LKZA 4FKYA 2GQCA 3MF5A 1Q16B 3US5A 1IJEB 4M5HA 3UFCX 4WKYA 3CCUS 4ZMMA 2XYGB 1RTIB 3SFUA 2DHGA 3CJ8A 3Q89A 4DMZA 1YJ9S 4LF4J 1HBOB 1KVKA 4A8WA 1S72S 1GMWA 2EBEA 2VL1A 2GAGC 3GYGA 3H4DA 3FFIB 2WBMA 3CT9A 2PC6A 4USTA 5E3AA 5CD4H 3A8JA 4UOFA 4L73A 4B9VA 4B9LA 2G0IA 1M5VC 1LWEB 4JYAF 3GFYA 3BKTA 4FNIA 1VIOA 4K7QA 1OG7A 4ZVUB 4X66J 1IKVA 3D6FB 3H7HB 3MEEA 3CF5Q 1MSWD 2QA4S 5FDLB 1UEUA 5KT2A 1GXTA 4Q0BB 2PD1A 1NO8A 1V3ZA 3SEOA 2RDDA 2VG6B 3T41A 1IWGA 5D3GB 1Q86T 3G9CA 2JEIA 3HVAA 3JTNA 1SC1B 4RBVA 4Q8FA 1DURA 1RT7B 5LJ5Y 4L3NA 2VFVA 4K4VA 4Z37A 2RF2A 1J5OB 1NJIT 2KL8A 1TTHB 2VFRA 1UJ4A 1FTCA 2DXFA 2RJZA 3BGRB 3GE9A 1KTQA 4HR2A 4WFZA 4KFBB 4CDIA 2LMIA 2N82B 1UWAA 4IR1A 2PA3A 2ZD1B 4IG3A 3IBCB 3POTB 3ENWA 5B08A 4YY3J 3NS6A 2PMWA 1T3NA 2I0XA 3AH6A 2DPIA 3QRQA 2CIMA 2V63A 3IR5B 3IRXA 2EK6A 7AT1B 1L3UA 5L39A 1WC3A 4DR5F 3MD3A 3HFVA 4XPCA 2NR0A 3TQ1A 2UVUA 3CW2C 2MKSA 1RDRA 4ITSA 1B4SA 4LF1A 3ZTRA 3CDWA 3BQ1A 1C0TB 1UZDA 5IC6B 3GCWP 1Q8BA 4I68A 3QGGA 1LW2A 2E1MC 1SJ1A 2BJDA 2IA0A 1WEXA 1NJWA 1Q7YT 1WOSA 2MZSA 1TU0B 3EX7B 2BDPA 2K3KA 1LFWA 1FTRA 2VG7B 4P2MA 4FXEA 1QAXA 3CMAS 4F4YA 4J7CA 2OIHA 2NYHA 3NNCA 3OJSA 2UV8A 2XI2A 3DOMB 4OZNA 1WHXA 1IBMJ 3TVKA 2Y9HA 3M2VA 3MHYA 2KOEA 3N01A 2H9ZA 3LA0A 1R7IA 2KJWA 2DGWA 4W4MA 4FYVB 3V4IA 5DG9A 4G1PA 5DM6Q 2MB0B 2MTLA 2GVZB 2WW8A 3MM7A 1PBAA 2M5YA 1IJFB 1R8PA 2CJAA 2Q6BA 2QA2A 2HQFA 3P45B 3WIUA 3TUPA 2BABA 2LVWA 3QAUA 2L48A 4DV5J 3G87A 3RTVA 1Q5YA 2DHXA 4EK2A 2A2CA 2VFTA 2W4CA 3DN9A 4MKAA 1VCTA 3A3NB 4CLSA 4N7TA 2UUAF 2C2OB 2BX6A 2XSJB 2E9TA 1KBRA 3M8SA 4ILMA 4WTOB 2DNYA 2HHPA 1RHKB 3R7NB 1BWVA 4NXMF 1H3DA 2A3JA 4KPCA 1DTQA 3WBZA 3B78A 2CQBA 2XYPB 4M5MA 1ZM9A 1RT4B 2HPUA 3DGVA 4MIAA 4PABA 1PAEX 1KEKA 4NLOA 3HI9A 2KH9A 3BR8A 3C46A 1TUGB 4QR0A 2AYBA 2CVEA 5DG8A 2FC9A 2HHWA 3R5JB 4CLTA 4LFCJ 4B3RF 4FBUA 1H2TZ 2YKMA 3CJSA 3FBEA 5JJBA 3C6TA 5KT6A 1SKSA 3TAQA 4A4JA 4DHVA 4ZVFA 4AL5A 1RACB 3V6KA 5CHCB 3D68A 2UUBJ 4DUYF 3JXOA 3OD2A 2G2ZA 3HHEA 4RWWA 3LWMA 1JLBA 1KFSA 4NLQA 3QIDA 1DBDA 1FX2A 1CJTA 1I5OB 3TNVA 4WFBQ 1EHWA 1FDBA 1JXEA 1TL7B 4RL1A 4DBQA 1A9NB 5LM7E 4LBPA 2Y1JA 3AODA 5GVQA 2EVZA 4F0MA 2CWXA 2XMMA 3M1VB 4HACA 2Y3YA 1RT4A 4GMKA 4WU2A 4UT4A 3G82A 3VZIA 3T3FA 4ZCKA 2E7XA 4NCBA 5DM7Q 3M8RA 3KXDA 1VQOS 3MOZA 4P71A 2BANB 1U1KA 5HVGA 2HLTA 1QTMA 3HLUA 3PRDA 5KG0A 2CJYB 2ZITA 3WX8A 4ECUA 1YITS 4LRVA 2ASYA 4O3RA 3BDPA 2M0GB 4OMFG 1EETA 5DRKA 4JI8F 4YB5A 5HQLA 5FD1A 3V6HA 1N54B 3JQJA 3KJQB 5HJYA 2W7OA 2AEFA 1PGZA 1KC8T 2CFXA 5A2QY 4B3SJ 4F02A 2L3MA 2B4UA 1YK9A 3Q23A 3IRXB 4P74A 3GTYX 3BREA 2B8PA 2FJAB 2FPHX 3GMGA 2RAQA 4A8QA 2ASLA 1S97A 4NA2A 4ZVTB 3M32B 4F26A 4EZ6A 3EICA 4Q8EA 2VODA 1IBCB 2L9WA 1C0TA 3T5LA 1YTYA 4OYMA 1UW9A 2OMLA 2CQ1A 2RQKA 4TXSA 3RZAA 2DEJA 3NAHA 4LR7A 3EYZA 2R8HA 5K8PA 3HO1A 1BQMB 2P9GA 4M5LA 4X64F 1Q4RA 2UZAA 3M6UA 4DF8A 4RNFA 1RTJB 2HQDA 2D9OA 1FD8A 1ZS6A 2BEFA 2DXEA 3DRPA 4LSZB 1VOMA 2CPIA 3P3DA 3OVSA 1N34F 3UCGA 4GVLA 2GA7A 1JLCA 3NMRA 1EETB 3FDSA 2Y1RI 3MMCA 1RBAA 5E3CA 2GQQA 1UFWA 1JLQA 3J80U 2VA3A 2M9KA 4ANDA 2AJ2A 3V4IB 4XK8C 1NNDA 4O0IA 4ECSA 1M5HA 3DGPB 3KUEA 3MECA 5ETNA 2CAJA 1QJHA 4F36A 5HROB 4I7FB 4ZPCA 5F3TA 4Y34A 2A2BA 2QMWA 3BKFA 3HT3A 3HXMA 2QN6B 1RWUA 2H48B 2RSQA 3MPYA 4UUWA 2RQ4A 3GJRB 3IM9A 1VR6A 4GVBA 1R8HA 1U49A 1HR0F 4M94A 1X9SA 4B3TJ 3DOKA 4WPAA 4A8XA 1VQ6S 2CWKA 3D3CJ 2DGSA 3L7UA 1QAIA 1MNEA 2KXNB 5LSOA 2HBQB 2N7YA 2GPEA 2B4PA 2V4JB 4WTYA 1DFDA 1B0PA 2H54B 2RE1A 2ZH6A 4ID5A 4AE5A 3I5AA 2VG7A 3EXYA 1WG4A 4OZ0A 2HWIA 3PO5A 1YWXA 3PX6A 4K2XA 1JLQB 3PW7A 2YNIA 2YWHA 5EUHA 4DSIA 2VA2A 2CA9A 3TA0A 1JLFB 2IJNA 3I56S 1XMOJ 2DNMA 3CUNA 1WKJA 2YKMB 2H5EA 1TK0A 4I7FA 1NSKL 1YQHA 2QLWA 5IV3A 4QYZJ 2YX1A 4LJMA 2HQIA 4EO6A 3CCES 4PPZA 3ETOA 2VJUA 1URRA 2DNHA 2ZWPA 2KVIA 4R5PB 4P10A 1BHNA 2VASA 1TVRA 1UP1A 3TEHB 5GAGI 1I51B 1TL7A 2MGZA 2Q1LA 1WKKA 1S4FA 2YQ0A 2ADLA 1PC5A 2RDJA 1WSRA 4CQ1A 4S0MA 2HVHA 1J5OA 3V5RA 4JOUA 4M5JA 4TY8B 2K06A 3FSXA 1NSPA 1JLEA 2A6OA 3A8EA 2G9OA 4LVNP 4F4KA 3CSKA 4ZPTR 4U8VA 3W3SA 2EI5A 3KFWX 2YX4A 5BR8J 2HSEB 2YWKA 1JJCB 2JBVA 4QR1A 4DG1B 2B9WA 2P9CA 5DJBA 3SZ2A 5M2RA 3TAMA 1UA1A 1RT2A 3R5GA 3C6TB 1YRTA 1KOHA 4ILRA 3T9NA 2FLLA 3BBBA 1RAJA 1OY9A 4O23A 2C3UA 4TU9A 3W2WA 4F8RA 3CD6S 1YRUA 1O6XA 3MEGA 1OQ6A 5J2NB 5J1EA 2K5JA 1Y00A 1XWLA 3LP1A 1NPKA 3GIRA 1KFDA 2GHWA 2LDIA 4F0HA 1RISA 3W2VA 2JLEA 4NI2A 1SIZA 5D0GA 1C1BB 3FCWA 5J2PA 1XMQF 2OTJS 1DZ5A 4J9KA 2RQMA 1U0SA 3N79A 2ZE2A 2E5IA 5F8MA 3KLHB 2VONA 2AYEA 3PW4A 2M8DB 4JI5F 1YJRA 4X4QA 4LIWA 3JSMB 2FJVA 4OQJA 3NNHA 3T1HJ 3JSRA 5AXLA 3Q8QB 4HYKA 1S10A 2WTFA 3TX0A 2QRRA 4FF4A 1QTNB 2JHEA 2M52A 4W98A 1GX6A 1Q81T 3RAQA 3Q83A 1VRUB 2HFOA 3OFFA 4NCGB 1V3RA 2AHOB 5DZ7A 5J2NA 1NHUA 1S7HA 4D3HA 4UQTA 5CA5A 3NO7A 9RUBA 5I3PA 2ROEA 4KIAA 2E7VA 3OL6A 5KFQA 3N5BA 4IO9Q 2AKWB 3OHBA 3ZTPA 2BM1A 3FQLA 2DNZA 1QSSA 2PEHA 3W5YA 3MCNA 5ETKA 1NK5A 5KFLA 3PX0A 4M1KA 4B08A 2IVMA 5CYJA 1Q53A 2GVDB 2NPIA 3BGUA 3AFGA 3CWJA 5ETMA 4ED5A 4PG5A 3KLIA 3LO3A 3MM5B 3Q8RB 4DDFA 3K59A 3KNGA 1CJKB 2UU9F 2J6TA 2ZJPQ 4WZQA 8AT1B 3DDKA 1RE1B 4J37A 1ZZNA 2J0QD 1OPZA 3KMSA 4JYAJ 1WWHA 4YR3A 5I3UA 3G6YA 3PX4A 1REVB 1RLDA 1Z1ZA 1EQ0A 1ZM4A 4OJGA 1XC9A 2QX0A 5HK4A 2D9PA 2QZ8A 4Q5VA 3R8YA 2KG0A 4X2BA 4QR2A 1RWPB 4I2PB 4ZVOB 1NAQA 2XQCA 1T7PA 3LAMA 4ICLA 1PC4A 1B7YB 4DV6J 4YB7A 5G4DA 1ZTWA 2R7XA 2IM1A 2PE8A 3FBFA 1OPIA 4HKQA 3DMJB 3S6EA 3TANA 1OSCA 3L95X 2WSFC 2CJ9A 3C19A 4HH0A 1S6OA 2V8VA 3HHLB 4KQZA 1XK8A 4N41A 2R8JA 2CPYA 4Q43A 2R7UA 5A2QU 1SKUB 2DK2A 1T03B 1V6HA 5AT1B 1ZPWX 2G0JA 1NLKL 2NXCA 4WXWA 3ZZZA 1SQEA 1YHQS 1UAWA 4USUA 4F7VA 2E5JA 2X1FA 1S1UA 3QWPA 4JB8B 4LSLB 4EU0A 1QVGR 4GKKJ 1MMNA 3QGHA 1XEZA 2KB2A 4JI6F 1S0OA 5E3QA 5D77A 3MURP 4ZP9A 3J81U 2DGVA 2XMUA 1RWWB 3ZXWA 3AT1B 5K20B 2FLPA 3F0NA 1HBNB 3EDQB 3FBCA 3SCJE 4CH0S 3T5JA 3TA2A 2F3JA 1N5SA 1UETA 2OEMA 2O5DA 1KQGB 2Q6CA 2XSFA 4LRDA 2JC0A 2HVIA 1FKOB 2DNNA 1NPRA 1GK8A 2HBZB 1U4BA 1BMQB 1DLOA 1VC5A 3HZGA 3CO9A 2BACA 3N6MA 4ETZA 3DLEB 3ETMA 3M8QA 3D1QA 1YJWS 2BUNA 3EM1A 4M5DB 1H74A 1Y3KA 1R3NA 1Q78A 1S1WB 3H5SA 4DL6A 1U1LA 1ZYQA 1SKRA 5AXNA 1X7VA 3M2UA 1YRXA 3PHTA 3BH6B 3FEYB 3TZXA 2J5AA 2PT0A 3FCVA 4NLDA 3R9LA 1CS4B 1BLUA 2JOQA 3VF0B 4X4SA 1HNIA 4ELUA 1YSJA 2MKKA 4AQYJ 4QU6A 3EZ5A 2JEFA 2IA6A 1GMUA 1DAXA 1DHMA 1V5IB 2KDOA 4WXOA 2B5JB 3KJVA 2MMYA 1HWKA 4MTPA 1HNXJ 1NK7A 3M9NB 1U47A 2B9EA 3DYAB 4C8ZA 2W2QP 2HHSA 4GC6A 5B0DA 2NXNA 1IVZA 2V68A 3IBWA 1RTHB 1XMBA 3KHLA 1RHQB 1BXNA 2DNGA 4K59A 4NXNF 1U8WA 4YHHF 2QL9B 2RU3A 4X64J 4FKXA 2ZBQA 3FRYA 4DQIA 1OIAA 3UD3P 2VOPA 4DPOA 1WF2A 1RAIB 3M6XA 1B3TA 4B9UA 2KFNA 2CNNB 2Z57B 4LSNB 2H1YA 3WZ0A 4KT0C 4LF7J 3FCHA 2M3DA 2R7OA 5C2GA 2MKCA 2XMKA 1M1GA 1BUXA 3U7JA 4C0OC 4U7UD 2ZJRQ 2AGQA 4RUHA 1YZ7A 4CCHA 2XWXA 2B4OA 2J9CA 3BGLA 4G65A 3MEDB 4HDHA 3QZ8A 4YB1P 3KLVA 2PIIA 4ATNA 3RBZA 5KFUA 2BKOA 3AHPA 1RAEB 4O44A 1FKPB 1DRZA 1SI9A 1FVSA 3ET6B 2JRSA 3R6LB 3VEBA 1SV5A 4DSEA 3OR2B 1FJGJ 1APSA 2BXJA 4HLBA 2Y0SD 3W61A 1SBRA 4OI0A 4RUBA 2BQ3A 1TL3B 3JAMU 3ZTQA 1GQEA 2AT1B 2ZH7A 1HNWF 3EGWB 1X4CA 2MZJA 3PW0A 2V4QA 1NCLA 2XWYA 1YZ6A 2Y8WA 3MCOA 3P5BP 2VZ9A 4RW7B 1X5TA 2FUG9 1FJGF 4AT1B 1D9DA 4KBIA 2RILA 1D9AA 4ZJQA 3PIOQ 3OL9A 4A8OA 3VW4A 1YGYA 1EB0A 2G1DA 2WK4A 2CJKA 1PARA 1RT2B 4U6PA 5KG5A 1U2RA 2LA4A 5BYRA 3VAIA 2XGQA 1HQ2A 1RHJB 2DH8A 3PR5B 4GO7X 2UUCJ 1L5UA 1SJ4P 3LTOA 1DQ9A 3JYTA 3MM9A 1FXRA 3N6NA 3OTCA 2ZHAA 4KH1B 1PCAA 3F41A 3M8PA 2E1PA 1KS2A 1UA0A 1JXVA 3O5TB 2OTLS 3QT6A 5CYMA 2HVDA 3DOLA 2EG2A 1RGVA 4DV0J 1PJ6A 4DUYJ 3I55S 2MZQA 2E29A 3MAHA 1RSCA 1U09A 1U6BA 1OHNA 1K1SA 2DH9A 4K4ZA 4Q44A 1TL1B 4UOHA 5D0RA 4F25A 4TKTA 3SDEB 3GXQA 3WDOA 2V8PA 2Y8YA 2PMHA 3GV5B 2MY8A 4Y6IA 4V19X 2FJDB 2CZ4A 3I0RA 4NA1A 2Z58B 4BWMA 2LXUA 2C2RA 4XDCA 2ILZA 4F0KA 1MN9A 2B6AB 2WZ1A 4ID8A 4XIUA 1OWXA 1OY8A 4PXCA 5A6PA 5EHHA 1KQKA 2OPPB 4X4RA 1ULRA 3MFIA 2OSQA 4C6AA 5EX3A 2QFJA 1TMMA 2LQBA 1SUQB 3BS9A 3ITHA 4OYBA 1RWNB 2MLXA 5A0YB 5CZVA 1YIJS 1FRMA 4O4GA 1C1CA 1YBUA 3J7Z5 3R2CJ 4LF8J 2JWNA 2HLUA 3SCIE 1ZA2B 3A4TA 4IDKB 1RLCL 4WF9Q 1SC3B 1VQSA 2HZCA 2MEWA 3KK3A 3M6WA 1TL1A 3CJ5A 2B7CB 3E8OA 3MTJA 1T0TV 3POTA 5ETQA 4FVCA 1NHKL 4PXEA 1YVFA 5A8RA 3C15B 5E2QA 2ZH8A 1S1VB 4YOEA 3SI8A 1KVIA 4OFZA 3D67A 2YH0A 5F8HA 3VGSA 2N7CA 2L9NA 1RT5A 1CULB 1YJ7A 2DCUB 3G6XA 2QLXA 1T9WA 2ZC4A 2XB2D 3I6PA 4NE9C 2F1FA 3NEKA 2ZOMA 3DRYA 5A8KA 2N3LA 4OV6A 4R8UA 2ZH1A 2HFSA 2FIUA 1T8EA 1EAYC 4I2PA 2UV8G 1NHVA 1RHUB 2HNYA 1Y10A 1DTQB 3MMAB 3UVJB 1U1MA 2QYCA 4KHMA 4MYUA 4RJVA 3U1MA 5EDWA 1JJHA 1D1UA 5FIIA 2AJ4A 4ELTA 1B70B 1UWBB 3N6LA 4HHHA 5F8LA 1TMJA 3S8SA 2VQEJ 5AE1A 2XY7A 3DYAA 1H38A 5KFYA 5LMUJ 1B01A 8ATCB 4JV5F 4PUOA 3G5OA 3GJQB 4I2QB 3BJYA 4F4AA 2Y0BB 3GYXB 4AL7A 4OYOA 4YUDA 4I69A 9ATCB 1N6QB 3BBFA 4RZRA 5I42A 2BZ2A 3D1HA 1HWLA 4RPFA 4K2JA 1PJ7A 2GVZA 5E3RA 1RHRB 5LXRA 1CJTB 4LF7F 2H51B 1ZETA 2FVSA 4CLKA 4TNOA 4RW7A 3KK2A 1WHVA 1Y5LB 3MR7A 1GTEA 2LFVA 1FK9B 4TYAA 2ASDA 5H9EK 2E9RX 2MJUA 3TVZA 4EWTA 2PI4A 3DKDA 3VHQA 4FZVA 1NB7A 3HHKA 1AT1B 2HNZB 1NDLA 5HVFA 5ITHA 3MEKA 2R42A 1RTZA 3MEDA 3NCRA 4HHJA 1U8SA 2BJEA 3H8YA 4J9SA 1FDDA 2CQGA 2NXEA 1FNXH 2DTJA 3EXCX 1RTDA 1MMLA 1D0EA 2FVRA 3AAWB 3OQ2A 2EWHA 1C4AA 3KLGB 5FLXY 1Q5VA 2XHCA 3KLFA 3HSDA 3M8QB 3T9ZA 3JQKA 1WI6A 3VQSA 3A3PB 2YNFA 5HAOA 4RBTA 2QL7B 2GO8A 3I87A 1PO6A 2OELA 3MM8A 2V8GA 3CDUA 2J8SA 1FRKA 1Z2ZA 3LWLA 5L1IA 2HHXA 5JXSA 1AYEA 3VVUA 4WIQA 3Q2TC 1L3KA 4KHPJ 3SDEA 5ADZA 1BD6A 1B99A 1UPMB 3I5CA 2IDEA 4YP3A 4RUAA 3UCUP 2KYZA 4CLFA 4KGXB 1RQ0A 3CCQS 2DR9A 3DU6A 4D8JA 2B6AA 1C2PA 2R2UA 2J7UA 1HMVB 4CZCA 1R6VA 3HSZA 3BQ2A 3DLKA 3NBPB 1S4EA
chains in the Genus database with same CATH topology
1EA4A 1BDTA 2BNZA 4ME7E 1X93A 2JXIA 2KELA 1MYKA 2K9IA 2JXHA 1B28A 1NLAA 2K5JA 1B01A 2BJ8A 1U9PA 1Q5VA 4HV0A 3GXQA 2PC6A 2GPEA 2CPGA 3QOQA 3QSIA 2CADA 3VW4A 2BJ7A 2FGCA 2BA3A 2JXGA 1PARA 3BKTA 2RBFA 1ARQA 3OD2A 1MYLA 3VEAA 3H87C 3BKUA 2F1FA 2CAXA 3FT7A 2BSQE 2CA9A 2H1OE 1Q5YA 2BJ3A 3VEBA 1P94A 2WVFA 2NZCA 2K29A 2WVBA 2CAJA 3LGHA 2BJ9A 1IRQA 1BAZA 2WVDA 1MNTA 2HZVA 3BKFA 2WVEA 1QTGA 2BJ1A 2K6LA 4FXEA 4D8JA 1BDVA 2K1OA 2Y3YA 2AY0A 2BNWA 3FMTA 2HZAA 2WVCA 1ARRA 3PHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA4 A;  1BDT A;  2BNZ A;  4ME7 E;  1X93 A;  2JXI A;  2KEL A;  1MYK A;  2K9I A;  2JXH A;  1B28 A;  1NLA A;  2K5J A;  1B01 A;  2BJ8 A;  1U9P A;  1Q5V A;  4HV0 A;  3GXQ A;  2PC6 A;  2GPE A;  2CPG A;  3QOQ A;  3QSI A;  2CAD A;  3VW4 A;  2BJ7 A;  2FGC A;  2BA3 A;  2JXG A;  1PAR A;  3BKT A;  2RBF A;  1ARQ A;  3OD2 A;  1MYL A;  3VEA A;  3H87 C;  3BKU A;  2F1F A;  2CAX A;  3FT7 A;  2BSQ E;  2CA9 A;  2H1O E;  1Q5Y A;  2BJ3 A;  3VEB A;  1P94 A;  2WVF A;  2NZC A;  2K29 A;  2WVB A;  2CAJ A;  3LGH A;  2BJ9 A;  1IRQ A;  1BAZ A;  2WVD A;  1MNT A;  2HZV A;  3BKF A;  2WVE A;  1QTG A;  2BJ1 A;  2K6L A;  4FXE A;  4D8J A;  1BDV A;  2K1O A;  2Y3Y A;  2AY0 A;  2BNW A;  3FMT A;  2HZA A;  2WVC A;  1ARR A;  3PHT A; 
#chains in the Genus database with same CATH topology
 2GGP A;  3UO0 A;  3UD4 P;  4OI1 A;  2W2O P;  1UVI A;  3PXG a;  2NLW A;  4ECR A;  5FJ4 A;  1UW4 A;  1RTJ A;  5L9N A;  1N33 F;  1SH2 A;  2A0F B;  3PFE A;  2JX2 A;  3ZZO A;  3GFZ A;  4DFM A;  4N8O A;  3GP9 A;  1XTZ A;  1E6V A;  5KT5 A;  2DHS A;  4EZ9 A;  1UFK A;  3RU0 A;  1UMJ A;  3GQC A;  2W4P A;  3QZ7 A;  1CSJ A;  4QWC A;  1HNV B;  4QIE A;  1LWC B;  3CO0 P;  3H42 A;  1LV5 A;  2FVC A;  1HBU B;  1WEZ A;  1PG5 B;  4X4U A;  2OPS A;  1YJT A;  2C22 A;  4C8N A;  2PFD A;  3WIV A;  5A76 A;  5DGB A;  2MQO A;  1ZAW A;  3DLK B;  1F9F A;  4NLG A;  1NZ8 A;  4LRE A;  3TYT A;  1T94 A;  2HG4 A;  5F9N A;  2V4R A;  3RJM B;  2V67 A;  3I4P A;  5K5M A;  2OD6 A;  3IO1 A;  3NG8 A;  3ISN D;  4HTJ A;  1IUJ A;  3I31 A;  3KMQ A;  3R2D J;  1WHW A;  4GO5 X;  4EFA C;  4QBU A;  1HWU A;  2J9D A;  1C0U A;  1M90 T;  3AY0 A;  3ITH B;  4U8Y A;  3KLG A;  1LXN A;  2AJF E;  2FHM A;  2IC3 A;  3K57 A;  2E5G A;  1N5V A;  4M5N A;  3JSB A;  3PYE A;  4ZPV R;  1F5C A;  1KP6 A;  2J0W A;  4DPW A;  2W25 A;  1MYL A;  3FKB A;  1ELO A;  1LNQ A;  3RBD A;  5KFV A;  4IFV A;  4RLE A;  5KFZ A;  4DV1 J;  2VQE F;  5LXY A;  3UI3 A;  4JI1 J;  1OMS A;  4L6V 3;  4NML A;  5I42 B;  3TA1 A;  3CD7 A;  1WC6 A;  3CTR A;  4RKU C;  1PYT A;  5B0B A;  5C24 B;  2XEX A;  3FFI A;  4F3Q A;  2XGP A;  3QSY B;  4C8L A;  3NL0 A;  1F2G A;  1FEH A;  1UVL A;  3M8Y A;  4QJV A;  2O1P A;  2MKI A;  1R6Y A;  2YPZ A;  1S59 A;  3GG1 A;  1ARR A;  3KK2 B;  3PYG A;  4IH5 A;  3ZZT A;  4OI3 A;  2ZUG A;  1FRH A;  4ZJL A;  4DZD A;  1NM2 A;  1YJV A;  2QMU B;  1FO1 A;  1C0U B;  3TRG A;  1G2E A;  4M5K A;  3W7B A;  1HKA A;  3KUG A;  4P7T A;  2HHU A;  4E8U A;  5KG7 A;  2RF2 B;  3RBE A;  5HBM A;  3I4H X;  2FVP A;  4HT7 A;  4UOG A;  2OFG X;  1UWB A;  1LWF B;  4YY3 F;  4DR2 J;  1FFS B;  4DQQ A;  2OPR B;  3PRB A;  4ECV A;  1JLF A;  1VQN S;  1DQA A;  2WVB A;  2VF3 A;  3MD1 A;  4AYB D;  2ZZN A;  2BM0 A;  1NDC A;  1VLY A;  2XUL A;  2ZH2 A;  5KAK A;  1XNR J;  3X1L B;  3MMB B;  4K5S A;  4IFY A;  3RAX A;  2J8A A;  3K7R A;  2EKN A;  4NOH A;  1GX5 A;  2YWG A;  2AP6 A;  2H3A A;  1QY7 A;  1XNQ F;  3I0S B;  1LKZ A;  4WFN Q;  2HVZ A;  4LRA A;  5MAO A;  5SUH A;  5J1N A;  3UW1 A;  2BYC A;  1Q95 G;  1AXQ A;  3DLG B;  4UW2 A;  1S49 A;  1U0H B;  1RTD B;  2FHK A;  3ZO7 A;  5L1J A;  3FRZ A;  4FPR A;  2NXU A;  3H2V E;  4LF9 F;  1RWO B;  5DQG A;  3ZZ0 A;  2FLO A;  4K4Y A;  4F4Z A;  1XR7 A;  2O01 C;  2MDA A;  3SBM A;  3V6J A;  1JK9 B;  5AE2 A;  1WAC A;  3TZW A;  2GGP B;  4NXM J;  2IC3 B;  4DFK A;  3AOC A;  1T9V A;  4FYX B;  2XCP A;  2DRB A;  2FY1 A;  3NNE A;  2AN7 A;  1AW0 A;  2D3O 1;  1URN A;  3A8I A;  4DWI A;  3QRR A;  4P73 A;  4TQS A;  1VC6 A;  1B0V A;  3RR8 A;  1UVM A;  2I9S A;  1N32 J;  2F65 A;  2CNO B;  3ILO A;  2CPD A;  4URG A;  5DO2 A;  2Z2L A;  3KLF B;  4J9N A;  3R6G B;  4USM A;  1I1G A;  2WBR A;  1FNO A;  2BE7 D;  3MM7 B;  3ENV A;  2VKZ G;  4QIG A;  2RRN A;  4KHP F;  5E5N A;  2BR0 A;  4RU2 A;  1WOO A;  2LXF A;  2PO4 A;  4KKO B;  4NLY A;  2DGO A;  1P27 B;  5AJ3 F;  3NGK A;  1FJC A;  5BR8 F;  1YBA A;  2HKE A;  4MAK A;  3LPE A;  2Z0G A;  3ELH A;  1HIY A;  4ZK7 M;  3Q24 A;  2GIR A;  4A8M P;  1WKL A;  3GSI A;  1NDP A;  1M5O C;  3AD9 C;  1S9G B;  1AUS L;  1ROF A;  3BPS P;  3LP2 A;  5F9L A;  3TJ9 A;  4A8S A;  2IM0 A;  2KM8 C;  2W9B B;  1RWK B;  3AXK A;  3UN3 A;  4O3S A;  4FF2 A;  3OL8 A;  2WVF A;  4OHY A;  4ED8 A;  4IR9 A;  2ZNZ A;  2BE2 A;  2W8L A;  4DEZ A;  3M9M B;  5I4M A;  3P49 B;  1W2I A;  2EFG A;  4ZN3 A;  2KT2 A;  3OXF A;  1NBE B;  2NUH A;  2ZUA A;  4FPI A;  4IFY B;  4IFV B;  4RW9 A;  1G1X A;  2JXI A;  2RVJ A;  2V9W A;  1EQM A;  4NAS A;  2MPU A;  4NLX A;  2VC0 A;  2AJQ A;  1TL4 A;  3O1L A;  3MCM A;  2QIF A;  1PBU A;  4ZN1 A;  3M05 A;  4DSK A;  4DV4 F;  3QGP A;  1L3T A;  4X65 F;  2NUU G;  2O66 A;  2VBW A;  4ZJO A;  5DQH A;  3CJT A;  3BSN A;  5H1S V;  5DGA A;  3OLA A;  2VB6 A;  4WCE Q;  2ZVS A;  4KPY A;  2E44 A;  1ZBT A;  3TI0 A;  2J6S A;  2XO7 A;  4AAI A;  4DF4 A;  4B02 A;  4J9M A;  1FKA F;  4PCQ A;  4LF5 F;  1RAH B;  2JZ5 A;  1R0B G;  4EYH B;  5AE3 A;  2I38 A;  5THW A;  1X8D A;  2X3G A;  3JAM Y;  3ILL A;  1MRO B;  3RRH A;  1HNX F;  3CC7 S;  2A2D A;  5IOL A;  4X66 F;  3ZZU A;  2VUG A;  4ZVE A;  3IS9 A;  2C2Z B;  5D78 A;  1NK4 A;  3BEG B;  1QLN A;  3NY0 A;  2KXF A;  2NCK L;  2K2P A;  2AX1 A;  3MEC B;  2OFH X;  3MM6 A;  2JXH A;  4DV2 F;  1IKW B;  1F0X A;  3MMB A;  2U1A A;  1SJQ A;  2JVR A;  3EGV A;  1RHM B;  3BQ0 A;  4WZM A;  2XMA A;  5F8J A;  4OZJ A;  4RNH A;  2WW4 A;  4EO8 A;  3ZZY A;  3G4S S;  3AB2 B;  4WFY A;  4PQU A;  1F9E B;  3VGV A;  3NOC A;  3NBP A;  2HRY A;  5EWG A;  3A1Y G;  3ONQ A;  4ANC A;  4G6V B;  3CD5 A;  5J1E B;  4J9R A;  3PW2 A;  3DNC A;  2R2S A;  1PIL A;  2CZ9 A;  1RT7 A;  3P8B B;  2V8H A;  1SQG A;  3DRP B;  4MT1 A;  4UOC A;  2LU2 A;  3CCJ S;  1CS4 A;  2B51 A;  4KFB A;  5ETV A;  1RWM B;  4I67 A;  1SL0 A;  2E5L F;  1JLB B;  2UXD J;  3PHE A;  5M2U A;  3A8K A;  2OUG A;  5KG2 A;  1LWC A;  3QT7 A;  3S1T A;  4NLP A;  2ZH5 A;  2B5J A;  4Y28 C;  3PYD A;  4LF2 A;  3GIM A;  3CC4 S;  4E98 A;  3MAA A;  2XLI A;  2CAD A;  1X5O A;  2ADC A;  5KFE A;  4ECW A;  2FLN A;  4H54 A;  3BO2 A;  2ZWO A;  5DDP C;  2AGP A;  3FUY A;  2RML A;  3K5P A;  2N4D A;  2FY8 A;  2AZ1 A;  2QLJ B;  1MN7 A;  4V1A k;  2RKI A;  3DU5 A;  3N5F A;  4OX9 F;  2LEA A;  2CAX A;  1O51 A;  3KHH A;  1RA7 A;  2BSQ E;  4GVB B;  2W7P A;  2HHT A;  2F40 A;  3EVM A;  3J7Y I;  1X4E A;  1YJN S;  5KFA A;  2XHW A;  3ILJ A;  4FXD A;  5KFI A;  4I64 A;  1IRQ A;  2FJX A;  2BW2 A;  1X0F A;  3HJF A;  3EVO A;  5DLF A;  1JKH A;  5MLC V;  5GMK a;  5KFK A;  3Q8V A;  1Y4Z B;  2V34 A;  1MRO A;  2W9B A;  4JI4 F;  2JC1 A;  1BE4 A;  2V50 A;  4EYI B;  2B4V A;  3HK2 A;  1F5B A;  4CTA A;  4F50 A;  3K0J A;  3MCS A;  1RZM A;  3FQK A;  3MR5 A;  2KHD A;  4DL3 A;  2ZD1 A;  4IG3 B;  1TKX A;  2YQ3 A;  4DCP B;  5KFP A;  2DNO A;  1RYS A;  1KR4 A;  5HP1 B;  4ECQ A;  3CME S;  3CIM A;  4IRC A;  3ZZP A;  4NX9 A;  2MHE A;  4J9O A;  4DSL A;  2RBF A;  1N5Q A;  2HW3 A;  2JSX A;  3BN7 A;  4DX8 H;  2C42 A;  3ICL A;  4DL2 A;  4JI2 F;  4MKY A;  4N5S A;  1K9M T;  3QBC A;  4DUT A;  5K8N A;  3D2W A;  5AJ3 J;  1EKS A;  1WDD A;  3W64 A;  4B3R J;  4AQY F;  3W2V B;  3LF0 A;  2EXU A;  3OTB A;  4RW6 B;  4DV3 J;  4ZVG A;  2JEJ A;  4F4X A;  2FZK B;  3CB4 A;  2YWF A;  3LP0 B;  4P2F A;  1L3V A;  1FWL A;  1SIW A;  2OPQ B;  1UJ5 A;  1N5T A;  3GYN A;  1K1Q A;  2EFQ A;  3HF5 A;  2R7S A;  4O0N A;  5A8W B;  4ZLL A;  5GAD U;  2HBY B;  2R4F A;  3DRS B;  3ZFV A;  4PEO A;  5ETP A;  5KT3 A;  4L75 A;  3CCV S;  3R27 A;  1SKW A;  2ZH4 A;  2UUB F;  4NXN J;  4IKA A;  3W65 A;  3SV3 A;  2LU1 A;  3DM2 B;  2BJ7 A;  2AV5 A;  4J9L A;  2ALZ A;  4UY8 5;  4X84 A;  1FNM A;  2R7Q A;  2M4M A;  2J9D E;  3SSS A;  1U45 A;  1KQF B;  4MIW A;  3JYT B;  1U1P A;  1AZS B;  2IHR 1;  2VFU A;  2EBG A;  4BBY A;  2C3Y A;  2DGX A;  1P94 A;  3B82 A;  2KXH A;  5LMU F;  3HVW A;  4RO0 A;  3N9U C;  4NPO A;  1Q1K A;  2W2N P;  1WUU A;  4J9U E;  4TY9 A;  3JQM A;  2K6L A;  1N8R T;  3HKW A;  1TVR B;  1V3S A;  1C1B A;  2XSJ A;  4FP9 A;  2P6S A;  3FSY A;  1IBL F;  2BOP A;  2YNI B;  2KFZ A;  2YQ1 A;  3UQS A;  4WP3 A;  1QVF R;  2UVR A;  1RWX B;  1T05 B;  1MYK A;  1IR2 A;  3LQV A;  1RBO B;  1RT3 B;  1TQL A;  1F2H A;  3RB3 A;  3DLL Q;  2ZFH A;  4LF6 F;  1EP4 A;  1X4D A;  3MR3 A;  3SV4 A;  3QOQ A;  3X3U A;  3QSI A;  2LEC A;  1RKJ A;  4TY8 A;  3VWS A;  3G96 A;  1K44 A;  4MFB B;  4B3O B;  3ZZR A;  1SXL A;  4C8O A;  3M2U B;  4RX6 A;  4WE1 A;  1IQT A;  2MZT A;  2O67 A;  4KY3 A;  3UN2 A;  2DBB A;  3RW6 A;  7FD1 A;  4WYW A;  1JLA B;  2VU5 A;  1T02 A;  2E1R A;  3AD7 C;  2QC3 A;  3MPD A;  1RYR A;  1N34 J;  4ZKA A;  2QEX S;  3DC2 A;  1HI8 A;  4PAA A;  4J5O A;  1QTG A;  4QPT A;  1B7F A;  2BA9 A;  3SMZ A;  4D3G A;  4QYR A;  2AZ3 A;  3LP0 A;  4PXD A;  5L9X A;  4ZLN A;  1JWW A;  5KOX A;  2R2R A;  3RW7 A;  4KB7 A;  2MQP A;  3CPW R;  2HHH J;  4XO0 A;  4OX9 J;  1FHT A;  4PQU B;  1KLM B;  2H4W B;  2K1R A;  3CVK A;  2VOO A;  2GZO A;  1XBW A;  3H90 A;  2UVW A;  3O44 A;  5IWA F;  4L76 A;  2LXI A;  2ROG A;  2CQ3 A;  3PJX A;  3HHD A;  4P52 A;  1Y5I B;  3T1A A;  2DPJ A;  3EMT A;  1HR0 J;  4ZIW A;  2XTJ P;  1IBM F;  1TAQ A;  1WF1 A;  1VK3 A;  3CIZ A;  2R2T A;  1TR0 A;  2V94 A;  2AMC B;  2KZM A;  5U47 A;  2NS1 B;  4OZ1 A;  2HNY B;  4C8K A;  3VR1 A;  4XAK A;  3LW5 C;  1PIE A;  4ZDN A;  2VQF J;  2HFZ A;  3HD2 A;  1P1L A;  5ETO A;  1FDA A;  4NYP A;  1FWP A;  2GMJ A;  3FC9 A;  2ABY A;  1HW8 A;  1HWJ A;  1R27 B;  1VDH A;  3LOU A;  4K8R A;  1WD6 A;  4CLW A;  2HQG A;  3GG0 A;  2HMI A;  4OHV A;  4OL8 A;  1H0H B;  4HH1 A;  3D0H E;  2CG4 A;  3DOK B;  4I2Q A;  1M5K C;  3FEX B;  1UZH A;  3H5X A;  4DR6 F;  3C15 A;  1T9T A;  2C3O A;  1P9Q C;  2HWH A;  2UUW A;  1EJ7 L;  4CLP A;  2B56 A;  4ALZ A;  3CJ3 A;  4CYU A;  5CD4 A;  2Q79 A;  5J2P B;  4LBI A;  5L1L A;  2E66 A;  2QTW A;  3DI6 B;  5IT9 U;  2CG8 A;  3R97 A;  2DNP A;  4DSF A;  2UXB F;  2QA1 A;  2GIF A;  1U6Z A;  2IFX A;  2YKN A;  5DS7 A;  1N33 J;  1IKY A;  1DJ0 A;  1VRT B;  1XR6 A;  1JMT A;  2ACY A;  2CQ0 A;  2EFN A;  4MK7 A;  4ZOS A;  1WTB A;  4FBT A;  4LR9 A;  1TKX B;  4C8M A;  3RAM A;  3IWN C;  3AOB A;  4Y2K A;  1W26 A;  5IT9 Y;  1IWA A;  1REV A;  1MMD A;  3AOA A;  5HSP A;  3OFG A;  2V2Z A;  1HQE B;  3CCS S;  2EFV A;  3OPK A;  3PFO A;  4RU9 A;  1ZTT A;  4J91 A;  1LW2 B;  4USI A;  5D4O A;  2KRB A;  2YNF B;  4OYA A;  1HL6 A;  4RW4 B;  2L41 A;  4DV3 F;  1FEE A;  2JJ4 D;  3KLI B;  4JV2 A;  4PRF A;  1HI0 P;  3DLE A;  4BLG A;  1HA1 A;  4QOT A;  4CYU B;  2W1B A;  2OGU A;  2FVQ A;  4G1Q B;  2CRL A;  4IO1 A;  3CCR S;  4MJW A;  4CO1 A;  2EPI A;  1JNR B;  4QIW D;  3IRW P;  3HJV A;  3UCZ P;  1QUV A;  1NK6 A;  2GNK A;  3RRK A;  1S0M A;  2W7A A;  2A10 A;  1IM6 A;  1NK8 A;  3THP A;  4ECY A;  3ILI A;  3IP0 A;  2BRL A;  2DO4 A;  1UTA A;  2MLY A;  2VDI A;  3UNG C;  3ZNJ 1;  5G0R B;  1VMB A;  2QJ3 A;  4HI1 A;  3G6E S;  2GV1 A;  1WG5 A;  2DGQ A;  1MWY A;  4LR8 A;  5KT4 A;  2COL A;  4KGM A;  4PG8 A;  2RKI B;  1OQ3 A;  1LW0 B;  4JBC A;  4JI5 J;  1A7G E;  2C2M B;  2AX0 A;  4MYT A;  3BO4 A;  2DY1 A;  4ES3 A;  4ZHR A;  4DR2 F;  3LH2 S;  3BH7 B;  2GS8 A;  4KO0 A;  3FMW A;  3IXQ A;  1VBY A;  4OI2 A;  1HPZ A;  3L4B C;  1T03 A;  4BDP A;  4ED3 A;  3PDN A;  1A0O B;  2CDR B;  1JKH B;  3ISZ A;  3PO4 A;  3C3L A;  1TKD A;  3GV7 B;  4H4K C;  4N76 A;  1H7X A;  4LQ9 A;  4NRU A;  5F0U A;  5KG6 A;  3DRR A;  3QYY A;  2KU7 A;  3BM7 A;  5K14 A;  2IMO A;  2Q43 A;  4PYA A;  5DDO C;  4NLV A;  1U24 A;  1R0A A;  2E1A A;  2LQJ A;  3IM8 A;  3M4X A;  3MZI A;  4QQB A;  5CCM A;  4LF9 J;  4H4M A;  2HHV A;  3DRX A;  1LWE A;  3KG4 A;  4QWA A;  1LXJ A;  1N5Y B;  3BPD A;  3HKZ D;  2YNG A;  4N56 A;  2F5G A;  4K4X A;  4U7C A;  4FS2 A;  4LVO P;  4NYZ A;  5HMZ A;  1RK8 A;  4DXL A;  4GRS A;  3MM9 B;  1RI7 A;  2VG6 A;  4DX7 A;  4B3M F;  1DLO B;  2EEY A;  1HI1 A;  2Z2M A;  4QIV A;  2ZNY A;  1X4F A;  3JTO A;  2YPY A;  3AB4 B;  3UDC A;  2GJF A;  1RT1 A;  2ERR A;  3DOL B;  2CQ2 A;  2XS2 A;  2Z2Z A;  4M5D A;  3CJQ A;  1TP7 A;  1D3W A;  2KKH A;  2RH3 A;  1PYS B;  2D41 A;  2MXY A;  3KTQ A;  5CXT A;  3G82 B;  3PYF A;  3FT7 A;  3LAK A;  1B0T A;  3J80 Y;  2GHP A;  2VH7 A;  1FKO A;  2GW8 A;  1FWK A;  3PJW A;  3UWT A;  4JI6 J;  5HN0 A;  1UVK A;  2BJ9 A;  3EE3 A;  1QAJ A;  4RUC A;  1ZAV A;  2J7K A;  2FDN A;  1D8Z A;  2IBO A;  2Z56 B;  3CDB A;  3EUN A;  3MPU B;  4KHR A;  3PVX A;  1FES A;  1V5V A;  4P9S A;  3QLH B;  3SCL E;  2ZBC A;  1S9F A;  2AQ4 A;  3TX8 A;  3KLE B;  1L3S A;  4Y00 A;  1HQU B;  1HYS A;  3PEJ A;  1IKY B;  1HWI A;  1VRT A;  3I32 A;  4USK A;  1E6Y A;  4KYZ A;  1S76 D;  4B9S A;  1HLW A;  2VQF F;  3EGZ A;  5LSR A;  3Q2S C;  1U9P A;  1QE1 A;  3AXM A;  4IG0 B;  4NLR A;  5KFW A;  4X62 F;  3OUY A;  4ERD A;  3NWR A;  2VG5 A;  3MR2 A;  2BV3 A;  2CPH A;  4Y2I A;  1D09 B;  3M32 A;  2R8K A;  1N0V C;  3K5O A;  1VLO A;  4M63 A;  4JI4 J;  1FI4 A;  1HQE A;  2H65 B;  1R8A A;  4QWD A;  3OR2 A;  5KFC A;  1KVJ A;  2Q3P A;  4NMX A;  3HHL A;  3OFH A;  5T41 A;  3T6J A;  3E2E A;  3UDV A;  3RUB L;  2QT7 A;  3TJA A;  1FRX A;  2K8G A;  2DGT A;  2ZHB A;  1EP4 B;  4AUK A;  2IJR A;  3TJ8 A;  2AYM A;  1JLG A;  2XCA A;  2FHJ D;  1T9X A;  1JQG A;  1RAG B;  3FBB A;  3I0R B;  4CO0 A;  1NH8 A;  1CJK A;  1P8G A;  3GZ7 A;  4OYZ A;  2G2O A;  4YN3 B;  4A47 A;  1VQK S;  2VD3 A;  4ME7 E;  2BKP A;  2HRT A;  2W9C A;  1UL3 A;  1FRI A;  1VRQ C;  2YNG B;  4O3Q A;  3UNY A;  2MKY A;  1JLA A;  4UTG A;  4JI1 F;  3LGM A;  1ACM B;  2DJW A;  1F1B B;  3PCO B;  3R5D A;  2KTQ A;  2VV5 A;  1PYO B;  3BGO P;  4QZV B;  2CPX A;  3VAL A;  2QE5 A;  1Y11 A;  1IBK F;  4DR4 F;  2FD2 A;  1LK7 A;  3DXB A;  3T19 A;  5D0H A;  2AWZ A;  6AT1 B;  5GAE U;  1FJE B;  2J9E A;  3MR6 A;  1ARQ A;  2V5H G;  3I9Z A;  4B9T A;  4KV8 B;  5KFN A;  1H2U X;  1R31 A;  4TN2 A;  3ULH A;  5ETR A;  3CCT A;  4DN0 A;  2G2Y A;  2OO4 A;  2GJI A;  4ZIT A;  4IOA Q;  3DDN A;  1NPP A;  5KG1 A;  4NCA A;  2J0S D;  2HQ3 A;  3TWZ A;  4WKR A;  3GR1 A;  3A13 A;  4LT6 A;  1CEZ A;  2DH7 A;  2I8E A;  1S1W A;  2A1B A;  1S1T A;  3D7S B;  3W5Z A;  3DRR B;  5BJR A;  3BO3 A;  5J2M A;  1LK5 A;  1RT6 A;  2LQ9 A;  5H9F K;  3QT8 A;  3CJ2 A;  4FXV A;  3SSR A;  3OHA A;  2W9A A;  4M5I A;  3HPO A;  2L9D A;  4RWX A;  1XIQ A;  2JNJ A;  4JI3 F;  3QWU A;  1U0H A;  2YTC A;  3AD8 C;  4Q2M A;  3CJK A;  3I5B A;  2D3U A;  3PAC A;  3TVY A;  3W63 A;  4Z2X A;  5HLF A;  3SQG B;  2R7T A;  3CNQ P;  4OYP A;  3D54 A;  3DLB A;  1UJ6 A;  2DIU A;  3HHL D;  1GNK A;  3MDF A;  5CYQ B;  4TVA B;  3J81 Y;  4F2S A;  3SQO P;  1UEV A;  4PR6 A;  2KRR A;  4ZA1 A;  1HHT P;  2BAN A;  1J27 A;  2XLJ A;  5B0A A;  3TZY A;  3D1O A;  1TKZ B;  3AQP A;  3EPG A;  4DCJ B;  3QFH A;  1RKI A;  3J7A 1;  2ZDO A;  2V2V A;  2V2Q A;  4I6Y A;  4OV1 A;  5A8R B;  3P4U B;  5E33 A;  3ZNU A;  1GMV A;  4FF3 A;  4NLU A;  3HHN B;  2ZBP A;  3U02 A;  1YI2 S;  4DUZ F;  2YKQ A;  2UUA J;  4WFX A;  4ZP6 A;  1CVJ A;  3TEG A;  2RHS B;  2XY6 A;  1HMV A;  4A8F A;  1RAB B;  2ZVI A;  4GC7 A;  1V9O A;  4H4M B;  2AEJ A;  1HYS B;  1FD2 A;  3AJD A;  1NU4 A;  3IWX A;  1LWX A;  4R0E A;  4NA3 A;  1FFW B;  4DS4 A;  1U1O A;  5LMN F;  4GKK F;  1GH8 A;  2VG5 B;  3MMA A;  3SSQ A;  3UVJ A;  1CQM A;  1H6K X;  5CZX A;  2IRU A;  4KC5 A;  5D4P A;  2NRE A;  3PTW A;  3V4M A;  2I2Y A;  4NEY A;  1WC1 A;  1KN6 A;  3M8Z A;  3OBI A;  3FMB A;  3G8T A;  1ZM3 A;  3J7Y U;  3R1L A;  2X51 A;  1HNV A;  2XYH B;  2ZE2 B;  3MMC B;  2CKW A;  4TLQ A;  4DJB A;  3KLH A;  4DR1 J;  4O3P A;  1X93 A;  1S0N A;  1K0V A;  3QJJ A;  5J2Q B;  5LL6 d;  4KTQ A;  3NS7 B;  2XS7 A;  3B4D A;  1NSQ A;  2AYG A;  4ES1 A;  2YKO A;  2MQQ A;  4AD6 A;  2DKO B;  3IN5 A;  5B0G A;  3SYZ A;  3H59 A;  3RB0 A;  3OL7 A;  4Y0F A;  4YR2 A;  2HAF A;  1LFP A;  3SXL A;  2KJV A;  3MUV P;  5D4N A;  4AL6 A;  3QNW B;  5KFT A;  3M9O B;  1BGX T;  4DX6 A;  2X3D A;  1JB0 C;  1T95 A;  3OTD A;  3R7B B;  3BGF A;  1VHF A;  1EAR A;  4CT8 A;  1KHV A;  1U1R A;  1TFW A;  1HD0 A;  2C2D A;  5KFM A;  5IZH A;  2ZKT A;  1BDV A;  2Q2K A;  4ID5 B;  5HJX A;  1VBZ A;  4LQ3 A;  4B17 A;  1H98 A;  3Q86 A;  1WC0 A;  1HAR A;  1TUW A;  2DHA A;  3DCA A;  5D0E A;  4YR0 A;  2VFS A;  2XM3 A;  1S6Q B;  2YNH A;  2I6W A;  1TZ0 A;  2CPJ A;  2CQ4 A;  3N0V A;  2F9D A;  3VVT A;  3JB9 k;  2FJW A;  2CPZ A;  2W8K A;  2LYV A;  1DY3 A;  3IR7 B;  1RCX B;  3NS5 A;  5E7O B;  4FVM A;  3W8P A;  4C7Q A;  5DET A;  1N4L A;  2B43 A;  2HUR A;  2VPZ B;  3MM5 A;  2Y1I A;  4LF8 F;  3MUM P;  2B9X A;  2XNR A;  4YB6 A;  5IV4 A;  2NZ4 A;  4CLY A;  1DAR A;  3EWG A;  5HO4 A;  4QYZ K;  2I1R A;  3QT5 A;  5IM0 A;  3VEA A;  2HGM A;  3TUI C;  2OPP A;  1NK0 A;  1N36 J;  1AUD A;  5GME A;  3V2U C;  3MWB A;  4HVZ A;  4Q45 A;  3W8G A;  2MQN A;  1KQS R;  3SCK E;  3G2X A;  2AW0 A;  2M88 A;  5HMX A;  4L3K A;  2LDY A;  3L7P A;  1AFI A;  3CDE A;  1FF2 A;  1DTT B;  4NLS A;  3D9B A;  2LEP A;  4WFA Q;  3DHW C;  3CCM S;  3D6T B;  4DR5 J;  3S01 A;  2CNL B;  3CUL A;  1HBO A;  4ED0 A;  4H4K A;  1JJ4 A;  4YEA A;  5ETT A;  4LF5 J;  3OT9 A;  3H25 A;  1RAD B;  3OLB A;  3FZB A;  4MK9 A;  3K5L A;  1VQY A;  2BE2 B;  3GFX A;  1YDL A;  3HVR A;  1YLX A;  1SL2 A;  1RUS A;  3MAA B;  1I6J A;  2F4V F;  3KJF B;  4BWJ A;  1CUL A;  4EI2 A;  3TAM B;  4BS2 A;  2C2N A;  3IGV A;  3QIP B;  3T5H A;  1FXL A;  1RXO B;  2GJ2 A;  4G3I A;  2HGL A;  4P2S A;  2DB1 A;  3HZE A;  3Q8Y A;  2UXD F;  1FER A;  4PQA A;  4DV2 J;  4F2R A;  2MST A;  2V2K A;  1ZA1 B;  2ALY B;  2YWW A;  4RW6 A;  3RYL A;  1S6P B;  5KFR A;  2HFV A;  2CPE A;  3W9I A;  4LF6 J;  4FYD A;  3L09 A;  2WOM A;  2HS4 A;  4U67 Q;  1SJF A;  1NJX A;  2FZC B;  4HAC B;  2WVD A;  3GJS B;  2DRD A;  2OEK A;  4A8Y A;  2WVE A;  4Q7A A;  2MQ8 A;  1VQ5 S;  4GKJ J;  2H4Y B;  1O5J A;  2QMX A;  3A3O B;  1VFJ A;  2MHN A;  3K89 A;  3QAT A;  2ZM6 J;  2BNZ A;  1KOO A;  1WI8 A;  1QM9 A;  2QSF A;  5DG7 A;  1NLA A;  1LWF A;  3LAL A;  3MXH P;  5KFH A;  1N6Q A;  2WON A;  1HBU A;  1JNZ B;  3B4M A;  5KOW A;  1RU1 A;  4LBH A;  3VAH A;  2W2P P;  3QIP A;  3CCL S;  2BA3 A;  4LRC A;  1JIH A;  4ZCL A;  5GAG U;  2BOA A;  2IBK A;  2KT5 A;  1S79 A;  3QO9 B;  5C2C A;  4G1I A;  3HFZ B;  4HTI A;  3AJ2 A;  3JS9 A;  1XR5 A;  2HS0 A;  4I4B A;  4IOC Q;  1HBM A;  2HK3 A;  3OTE A;  3ISN C;  4HL9 A;  5F8I A;  5KFJ A;  3HUL A;  3GII A;  3F44 A;  3C6U A;  3PEH A;  2EFO A;  2RIJ A;  2CQH A;  4MH8 A;  4Q2L A;  4DL0 C;  5HL7 Q;  2W4D A;  3IBF B;  2QL5 B;  5KFB A;  1I94 F;  4WWS A;  4DPY A;  1DTT A;  1ZAX A;  4LFA J;  1NUE A;  2WSE C;  2ZH3 A;  1RT3 A;  4YDX A;  4JI2 J;  2DNL A;  1BQM A;  1X5P A;  3D0I E;  5HAT A;  4DN9 A;  4EUV A;  2B3T B;  1X9M A;  4IRK A;  2PDA A;  3O8W A;  1K73 T;  2FHO B;  3KG1 A;  2CPG A;  4F67 A;  1OO0 B;  4CO4 A;  2ILY A;  1CC8 A;  3W5X A;  4C3K A;  2VKR A;  5D6G A;  4DR1 F;  4DQR A;  4PWD A;  2J76 E;  4IYQ A;  3TAP A;  2QG9 B;  3DLJ A;  3E3X A;  4P7V A;  5IQQ A;  3KNA A;  2OD4 A;  4B3T F;  2VIH A;  2FJB B;  1OYE A;  2NZC A;  2X1G A;  2MZ1 A;  1GMW D;  2JH3 A;  2NYI A;  1IQZ A;  2I5J B;  3I0S A;  2HZV A;  2FGO A;  2JFD A;  2P9E A;  3KDN A;  5IT0 A;  2ZJQ Q;  2R7V A;  1X0P A;  2M8H A;  3VAG A;  5FDL A;  3P96 A;  2UXB J;  2QLB B;  4Z7Y A;  3LP2 B;  2IYG A;  1H7W A;  4FF1 A;  2ZEJ A;  2P8I A;  3ET6 A;  4WBF A;  3GFH A;  2DXD A;  2OPR A;  3GV8 B;  4JUZ A;  1RP5 A;  3BYP A;  5JVH Q;  4C4W A;  1SCJ B;  1Q8I A;  2IVF B;  4PWU A;  5KFG A;  4M5G A;  1U1Q A;  4J90 A;  3MOJ B;  3IS9 B;  3M6V A;  5EWF A;  4C11 B;  2EKY A;  2RQC A;  1D8Y A;  1Q7L B;  2XNQ A;  3H87 C;  3IFE A;  3PKY A;  1S1U B;  4LSL A;  1Y5N B;  2EC0 A;  5CAA A;  5DQI A;  4OYW A;  4TQR A;  4MMO A;  4DS5 A;  4WU3 A;  2UP1 A;  2VPW B;  2XLK A;  2FB0 A;  4I56 A;  2DIV A;  1FE4 A;  3FK4 A;  2YWE A;  5E0O A;  3VCD A;  4DV7 J;  1U6F A;  1RBL A;  2CQC A;  2H3E B;  3IR7 A;  1RAO A;  1SC4 B;  1U26 A;  1ZPV A;  3D28 A;  3LUY A;  4CRJ A;  3B54 A;  4R5P A;  1A6L A;  1R0C B;  3M1V A;  3VQT A;  4NWB A;  1TFY A;  1NRK A;  4N8N A;  1VBK A;  2KN4 A;  4FYW B;  5HQ8 A;  8RUC A;  5HVH A;  4RNN A;  2KVQ E;  4O3N A;  1REG X;  2XG8 A;  3TP2 A;  5GAE I;  1FFG B;  2HFU A;  2DD8 S;  4WII A;  4AXJ A;  5D3G A;  2ROP A;  4OJ1 A;  1MU2 A;  3OR1 B;  2QA4 G;  2SXL A;  2CJX B;  2UU9 J;  1F5A A;  2JLF A;  2RRB A;  3GU0 A;  5CYM B;  1H73 A;  2CVI A;  1SJR A;  3DOM A;  3HP6 A;  1TK8 A;  2UUT A;  4V19 J;  3OVB A;  2MY7 A;  1HNW J;  5A8W A;  1P6T A;  4KRW A;  3PIP Q;  1KLN A;  4CP5 A;  2HHH F;  3HCX A;  2H1O E;  4P72 A;  3NGU A;  5CAB A;  4ELV A;  1U2C A;  4DG1 A;  3OV7 A;  1NKC A;  4OJ3 A;  5GAH I;  2FHJ A;  1QUP A;  3HT0 A;  4LIR A;  5BXI A;  3K5M A;  1JX4 A;  2DR8 A;  2OPS B;  1R89 A;  2ZKU A;  3PRV A;  1BAZ A;  3FJ2 A;  3UN5 A;  1NK9 A;  2CJQ A;  1HD1 A;  1TKT A;  1FRJ A;  1WSV A;  4KKO A;  3T1Y J;  2UUC F;  5HQM A;  1TL5 A;  1G4C A;  4WYL A;  3HMJ G;  3FVY A;  1RA6 A;  3C2P A;  2RS2 A;  2WOM B;  4DLE A;  3RGI A;  4LFB F;  1NXI A;  2VDH A;  1LEO A;  2J6U A;  4DQP A;  3VAK A;  3C8Y A;  3CC2 S;  1I94 J;  4NRT A;  3NRB A;  2LEB A;  5L46 A;  3B8H A;  4LMZ A;  4QU7 A;  3BF4 A;  2FQQ B;  5D8H B;  1EX8 A;  1S5Z A;  2YKN B;  2ACM A;  1PAU B;  5IWA J;  1B64 A;  2MSS A;  3M2V B;  4DFJ A;  5T7L A;  1HW9 A;  4R0J A;  4PYD A;  1O8B A;  4Y65 A;  5IT4 A;  2HIY A;  4I0W A;  4C97 A;  1FXD A;  5F3Z A;  1CLF A;  3TO8 A;  3CMQ A;  3TUZ C;  3LPY A;  2ZH9 A;  4WE1 B;  3OSN A;  4RW9 B;  2LP4 A;  1EKR A;  4OX6 A;  3DLG A;  2DNR A;  1HBM B;  1YX2 A;  2D69 A;  4P6Q A;  3VTI A;  2I5J A;  4LRF A;  3G8Q A;  3T6B A;  2OPQ A;  5CH7 B;  1S9E B;  4U95 A;  4RW8 A;  1U25 A;  3DLH A;  4UY8 T;  2MKH A;  2BVZ A;  4IQM A;  2BQU A;  2IY5 B;  3NXZ A;  2H5J B;  4ZVQ B;  2AIR B;  4P75 A;  4CI0 B;  3SFG A;  2BJ3 A;  1SPB P;  3RB6 A;  1HNZ F;  2ZZM A;  5BYQ A;  3H5U A;  3PNI A;  2HK2 A;  3DM2 A;  3I96 A;  5KTQ A;  4DFP A;  1U2F A;  2PI5 A;  4IRD A;  3DGP A;  4CLU A;  1IR1 A;  1T3O A;  3FSI A;  1IBK J;  5G0R A;  2C3P A;  2NSC A;  1NKE A;  1FA0 A;  4DR3 F;  1W25 A;  4FDF A;  2XMV A;  2HZA A;  3L9Z A;  2AGO A;  4PWD B;  3KYL A;  2IMW P;  3RRG A;  4JI8 J;  1K0T A;  1CJV B;  3BBC A;  3GIJ A;  3KWM A;  1FK9 A;  4ENO A;  2BJ8 A;  4ICL B;  4M8L A;  5KG3 A;  3FZ2 A;  1AB8 A;  4WP9 A;  3HM9 A;  4ED2 A;  2X7I A;  1LQ9 A;  4YHH J;  5KFO A;  3A12 A;  3D6M B;  3HVT B;  1S9G A;  2C2K B;  1Q82 T;  5C7P A;  1JLE B;  2NPF A;  5IS2 A;  3U1N A;  2R7R A;  2C3M A;  2DO0 A;  3THT A;  2VBY A;  1X4H A;  5B09 A;  1WNE A;  3CCZ A;  3CD0 A;  4JI0 J;  3MI7 X;  4K0K F;  4JV5 J;  2CQD A;  2QSW A;  2WON B;  1VJQ A;  4ZVH A;  4CWB A;  5KFF A;  4UZB A;  3Q8S B;  2P6T A;  4B9M A;  3KLE A;  2ZC3 A;  1Q16 A;  1JLC B;  4HT5 A;  1XMQ J;  1X4B A;  3C16 A;  4JP8 A;  1X4G A;  4PXB A;  3D66 A;  2WB1 D;  2BNW A;  3QQC D;  4ED6 A;  2P5V A;  1FJ7 A;  4Y2C A;  2BKN A;  2B9Y A;  3VAM A;  1VQ7 S;  1AZS A;  1GFW B;  2B7B B;  3JTP A;  5HP1 A;  3KKF A;  3U1L A;  3GLJ A;  2GAH C;  1KON A;  1HBN A;  3U27 A;  1UFL A;  2FGC A;  1WJ9 A;  2PA8 D;  1XN9 A;  4MKV A;  4C8Y A;  4URQ U;  5FLX U;  4USH A;  1M5S A;  1UVJ A;  4GKJ F;  1F3F A;  2IRY A;  3CE8 A;  3P6Y C;  4JI7 F;  4Q0B A;  1TK5 A;  2NSB A;  1IN0 A;  1NH7 A;  2E5L J;  4KJI A;  1SQF A;  2HYI B;  1ZOT A;  2CXE A;  2DT9 A;  3M30 B;  2ZOF A;  2HEK A;  3R7S B;  2EK1 A;  3TR5 A;  4F3O A;  2F4V J;  2VBX A;  3QGI A;  3NCQ A;  1X5S A;  5KG4 A;  1MWZ A;  3BZQ A;  3C16 B;  4AXI A;  4X4O A;  5JVG Q;  1F60 B;  1WC4 A;  2D3Z A;  1E6V B;  4OZL A;  4ZCM A;  5F0W A;  3NGS A;  2RT3 A;  1T9U A;  4N47 A;  3PM9 A;  4MIB A;  1WEY A;  2CZV C;  4ZCI A;  3OVA A;  3K17 A;  1Q0N A;  4RR5 A;  4ZS6 A;  1NEE A;  1RTI A;  1SJ3 P;  2KEL A;  4CO5 A;  4R8U B;  2JEG A;  1B28 A;  4HHU A;  2JLG A;  2D1C A;  3K5N A;  5GAH U;  3D5M A;  4I1T A;  4KH0 B;  3IC1 A;  4ZPW R;  5LJ3 Y;  1CBK A;  2OMO A;  4OLO A;  5H9F J;  3BV8 A;  4DOZ A;  3LP1 B;  2XMW A;  4U9R A;  2F8E X;  2Z2Y B;  3IG1 B;  2IVY A;  1VRU A;  2POK A;  4NCG A;  1IM4 A;  3LGN A;  4JV0 A;  3RG6 A;  2DGU A;  2GVD A;  5CCL A;  3ENQ A;  4ZHR B;  3QJL A;  6FD1 A;  2K1R B;  2M2B A;  4WK3 A;  3BSO A;  1K8A T;  1KTV A;  2RRA A;  4F3M A;  4DR6 J;  4Y2A A;  1VGY A;  5SZT A;  3BN4 A;  1MNT A;  3MGJ A;  4C98 A;  3NOG A;  4X65 J;  2CNK B;  1XNQ J;  4CO2 A;  3RB4 A;  4E0D A;  2K3I A;  5EN1 A;  1UKU A;  2AY0 A;  4DL5 A;  2C28 A;  2GX8 A;  3HX9 A;  3FNN A;  2LA6 A;  2VPX B;  2XZW A;  3K8W A;  2OAU A;  3H20 A;  1HNI B;  4YME A;  3NMA A;  5LOQ A;  1T11 A;  4RNO A;  3M7V A;  4UZC A;  4K4U A;  3V81 A;  1IKW A;  4PWW A;  2N3O A;  1GT8 A;  1PJ5 A;  1Q79 A;  1SC6 A;  1WG1 A;  4L72 B;  2ADB A;  1FKP A;  2MKJ A;  4CH1 A;  1GAO A;  1U1N A;  4LFA F;  3BKU A;  1S7I A;  5I3U B;  4C9D A;  2OLW A;  4KV8 A;  4NZ6 A;  3P5T L;  2G13 A;  1TEL A;  2VPY B;  4ZPA A;  3V6D A;  5RUB A;  1N48 A;  1J5E J;  1X9W A;  2E5H A;  1CPZ A;  2K29 A;  1JJ2 R;  5C42 A;  2GC8 A;  3AA8 A;  2PFF B;  2VC1 A;  2CQI A;  5ETS A;  3GIL A;  1VQM S;  2BJ1 A;  2HBR B;  1VQP S;  3DHX A;  4DR7 F;  1D9F A;  5JMN A;  1KLM A;  1SB6 A;  2IM3 A;  4OLP A;  3FMT A;  3G71 S;  1VIS A;  2K1O A;  4CTA B;  2OP5 A;  1QAY A;  5B0F A;  3VAF A;  1VBX A;  4K50 A;  1FRL A;  1R43 A;  4U7U K;  1RWV B;  2LCW A;  1S77 D;  2MLZ A;  4ZVP B;  1T05 A;  4ETX A;  3IA0 A;  4B3S F;  4JI0 F;  4U96 A;  2KT3 A;  3OW2 R;  2LQ5 A;  3HFK A;  1KRP A;  2UXC J;  2PSZ A;  1IKX A;  2J7W A;  3DFE A;  4EGL A;  4C0H A;  5B7W A;  3PKM A;  4A48 A;  1MLA A;  2GFF A;  4OJH A;  3NNA A;  4DR7 J;  3WHI A;  1HQU A;  4OI4 A;  1M0S A;  1NKB A;  1IBL J;  4J9P A;  1KKH A;  4ED1 A;  2ZBR A;  4DV4 J;  3DMJ A;  1CJV A;  1HHS A;  2A18 A;  3HHL C;  3OUY B;  2UXC F;  1R8B A;  3M8W A;  3FEZ A;  2HMI B;  2PEB A;  3KHR A;  2WB4 A;  2KHC A;  2JFK A;  2K7J A;  3H2L A;  1M5P C;  3QFW A;  3HVT A;  4EEY A;  1KWM A;  5F41 A;  2PMZ D;  1OSD A;  1N88 A;  2LLZ A;  4WJB A;  4RBU A;  1R0A B;  1XJW B;  3Q22 A;  3QJP A;  5AXK A;  1EIY B;  2YH1 A;  3GB0 A;  1SH3 A;  2YXL A;  2RUS A;  3BR9 A;  1NJZ A;  1TV6 A;  1CG2 A;  1Y3J A;  4X4T A;  3WC2 A;  3VAJ A;  2A6M A;  2F8H A;  2IJF A;  2QFI A;  3MPV A;  4MK8 A;  2OI2 A;  4EBD A;  2DNQ A;  2JL9 A;  4TYB A;  3QPI A;  5GAD I;  4W92 B;  3NLC A;  3EDR B;  1KHW A;  2KG1 A;  2UVV A;  4ZLP A;  2EC2 A;  1SUQ A;  3UDL A;  1RTH A;  2MGZ B;  4DL7 A;  2AEM A;  3B6B A;  4JI3 J;  2KZZ A;  1FDN A;  1VQ9 S;  1JXL A;  4F04 B;  2HND B;  1IR0 A;  3ADA C;  3BSA A;  2V69 A;  5K9F A;  4K4T A;  3H0P A;  1S6Q A;  2YNH B;  4CH7 A;  5EGY A;  1QD1 A;  3PG9 A;  4DZ6 A;  4XDD A;  4USV A;  2O3D A;  4K4W A;  1YJU A;  2AU0 A;  3CDA A;  3D0G E;  2WRM A;  2KYX A;  3OSP A;  4HV0 A;  1SL1 A;  1W2B R;  5M2P A;  4HI2 A;  2BBE A;  5L1K A;  5IM0 B;  1HHQ A;  4MFB A;  4B3O A;  4URS A;  3KJV B;  2AF6 A;  2DHH A;  1IKX B;  4TU7 A;  1RT6 B;  4QIF A;  5JUM A;  3UR0 A;  3PV8 A;  1OY6 A;  2RU9 A;  3GWC A;  2BQR A;  3T1Y F;  1H72 C;  2W24 A;  2B0G A;  2BW7 A;  1ICE B;  2APO A;  3OTO J;  1NME B;  3PZP A;  3V81 B;  2Z30 B;  2R3V A;  3D3B J;  2F9J A;  3CED A;  3BB5 A;  2WAQ D;  4O4G B;  3THV A;  4IUF A;  1WC5 A;  2YBV A;  5I3Q A;  2R8G A;  3KHG A;  1F3V A;  3MAQ A;  4X4N A;  1EZZ B;  1S0V A;  3CXC R;  2F63 A;  3C66 A;  4KGZ B;  3IG1 A;  1WOP A;  4FXW A;  4DI6 A;  3CGI A;  5DZ6 A;  1X31 C;  5C5J A;  5C42 B;  1TAU A;  4CM2 A;  1SV5 B;  1XER A;  2DIS A;  4ZVR B;  1HPZ B;  3OTO F;  3TAR A;  1J5E F;  2KI2 A;  1JLG B;  3CJ4 A;  2V4J A;  4O3O A;  2MQL A;  3ENA A;  2ZBI A;  3H4B A;  4ECT A;  5E3P A;  2FZG B;  1TV6 B;  2D3O R;  1UCN A;  4L74 A;  3H40 A;  5EX0 A;  1RT5 B;  1RU2 A;  4ZVS B;  1M1K T;  2HFN A;  2HQC A;  1AA1 B;  1VHI A;  3C14 B;  2HVE A;  3Q8U A;  4LUB A;  4USW A;  3UE2 A;  1R8C A;  2ZDP A;  3MM6 B;  2VIC A;  1PSD A;  3I82 A;  2IDL A;  1J2V A;  4WP8 A;  2HGN A;  3Q8P B;  4QPX A;  3GCX P;  4F4W A;  2RD5 C;  2F8M A;  4IG0 A;  3O2I A;  4YFU A;  3PW5 A;  4HEA 9;  3Q0A A;  2DVI A;  3CJR A;  4DR4 J;  1RJJ A;  2Z4P A;  4FNH A;  2HND A;  4X4V A;  4EMD A;  4ZP8 A;  1WEL A;  4ZP7 A;  1RAA B;  1M1H A;  4NZ7 A;  3I9V 9;  3R5C A;  1MWQ A;  1S1X B;  4NZ0 A;  2E7W A;  5CQG A;  1PKU A;  2VBZ A;  2IPO B;  2VJV A;  2BE9 B;  3CCW A;  4M95 A;  2CUY A;  3T1H F;  4BC7 A;  4QWE A;  2J0X A;  3R5B A;  2Z8Q A;  3TW0 A;  2BMB A;  4CLL A;  1S6U A;  3DI6 A;  4FYY B;  3F73 A;  5BYS A;  2RDI A;  5HMY A;  1U7L A;  4CT9 A;  3KDO A;  1XQI A;  5KT7 A;  1Y9O A;  5GMD A;  3NKY A;  1U48 A;  3MMJ A;  4ILL A;  4PPD A;  1S6P A;  2QYG A;  3VGT A;  3CJK B;  2F4F A;  4K5R A;  4FS1 A;  4OZ3 A;  4OIX A;  1WHY A;  1CJU B;  4NEZ A;  2G4B A;  1Q8L A;  5E41 A;  5B0E A;  3TZZ A;  2KFY A;  1FE0 A;  3BDE A;  2F7V A;  5KFS A;  2KM8 B;  3KK1 B;  2HAI A;  3AJ1 A;  4USJ C;  7FDR A;  3EVW A;  3IAM 9;  2G1H A;  4O44 B;  3HDS A;  3HD1 A;  3W2W B;  2GIQ A;  4ES2 A;  4YQW A;  3F56 A;  2IIH A;  2V9K A;  2OH2 A;  1VI7 A;  1QE1 B;  2IAJ B;  3GON A;  2G0C A;  2CDQ A;  4P2X A;  4IH6 A;  4OYX A;  1LOU A;  4I6W A;  4K0K J;  1GXL A;  4XPE A;  1KD1 T;  1NZA A;  2H5I B;  1C1C B;  2P2C B;  1XNR F;  3SIP B;  3T5K A;  4G1Q A;  2DY9 A;  2YKA A;  4OZ2 A;  4QW9 A;  1P9Y A;  3QLH A;  1BY9 A;  1Z4U A;  1O0P A;  3EZU A;  2R7W A;  2XBP A;  5K8O A;  5DDQ C;  3RBX A;  3ZTO A;  2DYA A;  5D4L A;  3KK3 B;  4LSN A;  2OHD A;  2ZM6 F;  3TOQ A;  1IXK A;  3JSM A;  4QCL A;  4DLG A;  1WOR A;  2GMH A;  4C48 A;  4PKD B;  4B3M J;  1S12 A;  1QDU B;  3LGH A;  1VYA A;  1S1V A;  4UQG A;  5L8R C;  2GO9 A;  1VIX A;  1Q8K A;  2RUG A;  1S57 A;  4HDG A;  4MKB A;  4DU8 A;  5A0Y A;  4DUZ J;  4KAI A;  4TU8 A;  3QAE A;  4LFB J;  2W9C B;  1LW0 A;  3H2U B;  3IGN A;  3ZC4 A;  4BHQ A;  1VC0 A;  3CJ0 A;  5F8G A;  1G6B A;  3V6D B;  4B9N A;  4NL5 A;  2ZOG A;  3H5Y A;  2GML A;  3MEG B;  3M8P B;  4KO0 B;  2RS8 A;  2CYY A;  3GJT B;  2WCX A;  4YDD B;  1WDT A;  3NGD A;  2D7S A;  3NGT A;  3D6H B;  4H4O A;  1FVQ A;  1OYD A;  2N4C A;  4RW4 A;  1YG0 A;  2XC9 A;  2BRK A;  1NDK A;  1TL3 A;  2PGC A;  4NI2 B;  4CO3 A;  3WX4 A;  5J1P A;  3RR7 A;  5HRO A;  1ZM2 A;  2M70 A;  1N52 B;  2Q66 A;  4PZV A;  4LRB A;  2M7S A;  4MJK A;  5H9E J;  5K14 B;  2W2M P;  2OKQ A;  3DRS A;  1CC7 A;  4IOB A;  2U2F A;  4NLW A;  4UF4 A;  4WK1 A;  2ASJ A;  3AA9 A;  1C4C A;  3E01 A;  3M2R A;  1N56 A;  2AD9 A;  4LFC F;  1FT8 A;  3G6V A;  2JVO A;  4ZPB A;  4RNM A;  2MZR A;  1TUV A;  5J2M B;  5HMW A;  2QGF B;  2XMT A;  4ANE A;  4C3L A;  4DV6 F;  5D15 A;  3PY8 A;  4W90 B;  1Y7P A;  2HRU A;  4JV1 A;  2IM2 A;  3C14 A;  1ARO P;  1S48 A;  1U02 A;  3IMQ J;  4CNY A;  2DR7 A;  4FN5 A;  2ZZT A;  3S7R A;  4AFF A;  2DR6 A;  1Y0H A;  1XMO F;  1Z2L A;  3G86 A;  2K9I A;  1GEH A;  3N4W A;  1HNZ J;  2RB7 A;  4OX8 A;  2ATC B;  5F8N A;  1SVD A;  1KNZ A;  4CIO A;  1RT1 B;  1BQX A;  2HS3 A;  3NCP A;  2NXJ A;  4OHZ A;  3NGR A;  5IC4 B;  4OHW A;  2V8D A;  3W1Y C;  1W7W A;  1SH0 A;  2JXG A;  2ATL A;  2DCL A;  5DLG A;  4C11 A;  1I3O B;  4TLR A;  5CYQ A;  4DV0 F;  1F9H A;  5LT5 A;  3W9H A;  2XY5 A;  4IH7 A;  2GQ2 A;  3VZH A;  4DCO B;  2ZHO A;  5A6W A;  4LF4 F;  4O4R A;  2Y1L B;  4UUX A;  4DSJ A;  2KO1 A;  5LSL A;  5AXM A;  3O3L A;  3W62 A;  4X62 J;  3JSY A;  5DDR C;  2X1A A;  3WC0 A;  1VQ8 S;  4NYO A;  1BWE A;  3MFH A;  4ECX A;  2YVS A;  3NP5 A;  2FC8 A;  3MPW A;  3W66 A;  4YS2 A;  3GIK A;  1T9Y A;  5KFD A;  1N36 F;  1N5Y A;  2PN6 A;  2K7K A;  3L7O A;  1E6Y B;  2MYF A;  3ZTS A;  4CM0 A;  1WTF A;  4CLZ A;  4ZLJ A;  4DV1 F;  3R1H A;  1H2V Z;  4QW8 A;  1P1T A;  2LQ8 A;  2R8I A;  4DL4 A;  4ED7 A;  3C6U B;  3N28 A;  3O6Q A;  2NQP A;  4DV7 F;  1MU2 B;  2GHV C;  4ZPD A;  4OYI A;  2V6A A;  4PG7 A;  5C25 B;  3SQG A;  1VS3 A;  1UPP A;  2HWT A;  3D4J A;  1MG7 A;  3J81 j;  2XS5 A;  2WHO A;  3GSD A;  3NWG A;  4IDK A;  2DEI A;  3VGU A;  2EFP A;  1X4A A;  4PUO B;  1FX4 A;  4ZIV A;  3W9J A;  2E1C A;  4A46 A;  3J7A N;  1NB2 A;  5ETL A;  2FTR A;  4DPU A;  2WSC C;  3J7Z T;  2OEJ A;  4NLT A;  1CQN A;  2MQM A;  4N77 A;  1UEK A;  4OZ5 A;  3E01 B;  3M2R B;  4KGK A;  4I6A A;  1TKZ A;  3KOA A;  2DRA A;  2MJN A;  3MTK A;  4KR0 B;  5IQ6 A;  3KJN B;  5K8M A;  4DU7 A;  4Y3C A;  2WVC A;  1EA4 A;  1OJ4 A;  1RAF B;  3UR3 C;  1IKV B;  1OS5 A;  1DQ8 A;  2HIQ A;  3MEE B;  5T14 A;  3L3C A;  4JI7 J;  1TKT B;  2QLF B;  5A8K B;  2C2E A;  4R25 A;  1RCO B;  3QMQ A;  1BC6 A;  2FJE B;  5KFX A;  2EW9 A;  1ZH5 A;  4Z7C A;  6FDR A;  4J9Q A;  5C25 A;  4J9V A;  3DDI A;  5IXU A;  1SIW B;  3EGN A;  2QO3 A;  2CJB A;  3KK1 A;  2CPF A;  4A8K A;  3PJ9 A;  4ER8 A;  4ED4 A;  2DR5 A;  5HI7 A;  4X4P A;  1AFJ A;  3EJM A;  2V0N A;  2CQP A;  2IAJ A;  4PG4 A;  2D74 B;  1VQ4 S;  2YKP A;  1NJY A;  4H4O B;  3R5A A;  5T7L B;  4KE5 A;  5IFM A;  4DPX A;  1YKW A;  2OJ3 A;  4QWB A;  3MM8 B;  3HSJ A;  3UPF A;  3OXG A;  2FYX A;  3LAN A;  3G8S A;  1QSY A;  1VQL S;  2EG1 A;  2W01 A;  3QRP A;  1K47 A;  3KG0 A;  2AJ1 A;  3OFE A;  2DNK A;  4IQX A;  3HSG A;  4DQS A;  3IR6 B;  5J2Q A;  2E9Z A;  1UVN A;  4PG6 A;  3BSC A;  2XZT B;  4OI6 A;  4OHX A;  5EWE A;  3R3T A;  1G3O A;  4DX5 A;  1BQN B;  2XO6 A;  3K58 A;  4BC9 A;  3LJP A;  2XZD B;  2GCF A;  1S9E A;  5L38 A;  3AQO A;  3BYR A;  4RW8 B;  1ITP A;  2HNZ A;  4C0B A;  3EZO A;  3VV2 B;  2QV6 A;  1ZZF A;  4K4S A;  2AJ0 A;  4KGV B;  1S1X A;  2C1E B;  5B0C A;  2OSR A;  1G7C B;  3K8V A;  1MW7 A;  2DIT A;  3IAS 9;  3H98 A;  3OR1 A;  4OX7 A;  3BGR A;  1YBT A;  2IYI A;  4XTT A;  3WQP A;  5C24 A;  3UDE A;  4C3M A;  4DV5 F;  1QSL A;  2KKE A;  1KSP A;  1BDT A;  3QO9 A;  5LMN J;  1FCA A;  1S1T B;  1S99 A;  3GR0 A;  1GXU A;  1NSA A;  2XMJ A;  3E51 A;  3MUT P;  3NAI A;  1VK8 A;  1F6T A;  4ECZ A;  2HHQ A;  1N32 F;  2XI3 A;  4EBE A;  3UD5 A;  1BQN A;  3IWL A;  3W60 A;  1CJU A;  3TQE A;  3OXL A;  4KSE B;  2RNE A;  2B8Q A;  3GPA A;  2VHG A;  2JDJ A;  1X60 A;  2L08 A;  3FGV A;  3K2Y A;  5HLF B;  4Y2M A;  4E2F B;  3OJU A;  4DR3 J;  3KUH A;  4EBC A;  3DXS X;  2RHQ B;  1N0U A;  2YX7 A;  3M30 A;  3PR4 A;  2X1B A;  5HAN A;  1RB0 A;  5HBM B;  4CNZ A;  4C2M A;  3EPI A;  2YY3 A;  2IRX A;  4BCA A;  1VJW A;  1KDN A;  1WF0 A;  4DPT A;  1GTH A;  3TUJ C;  2R9L A;  1HFE L;  2LKZ A;  4FKY A;  2GQC A;  3MF5 A;  1Q16 B;  3US5 A;  1IJE B;  4M5H A;  3UFC X;  4WKY A;  3CCU S;  4ZMM A;  2XYG B;  1RTI B;  3SFU A;  2DHG A;  3CJ8 A;  3Q89 A;  4DMZ A;  1YJ9 S;  4LF4 J;  1HBO B;  1KVK A;  4A8W A;  1S72 S;  1GMW A;  2EBE A;  2VL1 A;  2GAG C;  3GYG A;  3H4D A;  3FFI B;  2WBM A;  3CT9 A;  2PC6 A;  4UST A;  5E3A A;  5CD4 H;  3A8J A;  4UOF A;  4L73 A;  4B9V A;  4B9L A;  2G0I A;  1M5V C;  1LWE B;  4JYA F;  3GFY A;  3BKT A;  4FNI A;  1VIO A;  4K7Q A;  1OG7 A;  4ZVU B;  4X66 J;  1IKV A;  3D6F B;  3H7H B;  3MEE A;  3CF5 Q;  1MSW D;  2QA4 S;  5FDL B;  1UEU A;  5KT2 A;  1GXT A;  4Q0B B;  2PD1 A;  1NO8 A;  1V3Z A;  3SEO A;  2RDD A;  2VG6 B;  3T41 A;  1IWG A;  5D3G B;  1Q86 T;  3G9C A;  2JEI A;  3HVA A;  3JTN A;  1SC1 B;  4RBV A;  4Q8F A;  1DUR A;  1RT7 B;  5LJ5 Y;  4L3N A;  2VFV A;  4K4V A;  4Z37 A;  2RF2 A;  1J5O B;  1NJI T;  2KL8 A;  1TTH B;  2VFR A;  1UJ4 A;  1FTC A;  2DXF A;  2RJZ A;  3BGR B;  3GE9 A;  1KTQ A;  4HR2 A;  4WFZ A;  4KFB B;  4CDI A;  2LMI A;  2N82 B;  1UWA A;  4IR1 A;  2PA3 A;  2ZD1 B;  4IG3 A;  3IBC B;  3POT B;  3ENW A;  5B08 A;  4YY3 J;  3NS6 A;  2PMW A;  1T3N A;  2I0X A;  3AH6 A;  2DPI A;  3QRQ A;  2CIM A;  2V63 A;  3IR5 B;  3IRX A;  2EK6 A;  7AT1 B;  1L3U A;  5L39 A;  1WC3 A;  4DR5 F;  3MD3 A;  3HFV A;  4XPC A;  2NR0 A;  3TQ1 A;  2UVU A;  3CW2 C;  2MKS A;  1RDR A;  4ITS A;  1B4S A;  4LF1 A;  3ZTR A;  3CDW A;  3BQ1 A;  1C0T B;  1UZD A;  5IC6 B;  3GCW P;  1Q8B A;  4I68 A;  3QGG A;  1LW2 A;  2E1M C;  1SJ1 A;  2BJD A;  2IA0 A;  1WEX A;  1NJW A;  1Q7Y T;  1WOS A;  2MZS A;  1TU0 B;  3EX7 B;  2BDP A;  2K3K A;  1LFW A;  1FTR A;  2VG7 B;  4P2M A;  4FXE A;  1QAX A;  3CMA S;  4F4Y A;  4J7C A;  2OIH A;  2NYH A;  3NNC A;  3OJS A;  2UV8 A;  2XI2 A;  3DOM B;  4OZN A;  1WHX A;  1IBM J;  3TVK A;  2Y9H A;  3M2V A;  3MHY A;  2KOE A;  3N01 A;  2H9Z A;  3LA0 A;  1R7I A;  2KJW A;  2DGW A;  4W4M A;  4FYV B;  3V4I A;  5DG9 A;  4G1P A;  5DM6 Q;  2MB0 B;  2MTL A;  2GVZ B;  2WW8 A;  3MM7 A;  1PBA A;  2M5Y A;  1IJF B;  1R8P A;  2CJA A;  2Q6B A;  2QA2 A;  2HQF A;  3P45 B;  3WIU A;  3TUP A;  2BAB A;  2LVW A;  3QAU A;  2L48 A;  4DV5 J;  3G87 A;  3RTV A;  1Q5Y A;  2DHX A;  4EK2 A;  2A2C A;  2VFT A;  2W4C A;  3DN9 A;  4MKA A;  1VCT A;  3A3N B;  4CLS A;  4N7T A;  2UUA F;  2C2O B;  2BX6 A;  2XSJ B;  2E9T A;  1KBR A;  3M8S A;  4ILM A;  4WTO B;  2DNY A;  2HHP A;  1RHK B;  3R7N B;  1BWV A;  4NXM F;  1H3D A;  2A3J A;  4KPC A;  1DTQ A;  3WBZ A;  3B78 A;  2CQB A;  2XYP B;  4M5M A;  1ZM9 A;  1RT4 B;  2HPU A;  3DGV A;  4MIA A;  4PAB A;  1PAE X;  1KEK A;  4NLO A;  3HI9 A;  2KH9 A;  3BR8 A;  3C46 A;  1TUG B;  4QR0 A;  2AYB A;  2CVE A;  5DG8 A;  2FC9 A;  2HHW A;  3R5J B;  4CLT A;  4LFC J;  4B3R F;  4FBU A;  1H2T Z;  2YKM A;  3CJS A;  3FBE A;  5JJB A;  3C6T A;  5KT6 A;  1SKS A;  3TAQ A;  4A4J A;  4DHV A;  4ZVF A;  4AL5 A;  1RAC B;  3V6K A;  5CHC B;  3D68 A;  2UUB J;  4DUY F;  3JXO A;  3OD2 A;  2G2Z A;  3HHE A;  4RWW A;  3LWM A;  1JLB A;  1KFS A;  4NLQ A;  3QID A;  1DBD A;  1FX2 A;  1CJT A;  1I5O B;  3TNV A;  4WFB Q;  1EHW A;  1FDB A;  1JXE A;  1TL7 B;  4RL1 A;  4DBQ A;  1A9N B;  5LM7 E;  4LBP A;  2Y1J A;  3AOD A;  5GVQ A;  2EVZ A;  4F0M A;  2CWX A;  2XMM A;  3M1V B;  4HAC A;  2Y3Y A;  1RT4 A;  4GMK A;  4WU2 A;  4UT4 A;  3G82 A;  3VZI A;  3T3F A;  4ZCK A;  2E7X A;  4NCB A;  5DM7 Q;  3M8R A;  3KXD A;  1VQO S;  3MOZ A;  4P71 A;  2BAN B;  1U1K A;  5HVG A;  2HLT A;  1QTM A;  3HLU A;  3PRD A;  5KG0 A;  2CJY B;  2ZIT A;  3WX8 A;  4ECU A;  1YIT S;  4LRV A;  2ASY A;  4O3R A;  3BDP A;  2M0G B;  4OMF G;  1EET A;  5DRK A;  4JI8 F;  4YB5 A;  5HQL A;  5FD1 A;  3V6H A;  1N54 B;  3JQJ A;  3KJQ B;  5HJY A;  2W7O A;  2AEF A;  1PGZ A;  1KC8 T;  2CFX A;  5A2Q Y;  4B3S J;  4F02 A;  2L3M A;  2B4U A;  1YK9 A;  3Q23 A;  3IRX B;  4P74 A;  3GTY X;  3BRE A;  2B8P A;  2FJA B;  2FPH X;  3GMG A;  2RAQ A;  4A8Q A;  2ASL A;  1S97 A;  4NA2 A;  4ZVT B;  3M32 B;  4F26 A;  4EZ6 A;  3EIC A;  4Q8E A;  2VOD A;  1IBC B;  2L9W A;  1C0T A;  3T5L A;  1YTY A;  4OYM A;  1UW9 A;  2OML A;  2CQ1 A;  2RQK A;  4TXS A;  3RZA A;  2DEJ A;  3NAH A;  4LR7 A;  3EYZ A;  2R8H A;  5K8P A;  3HO1 A;  1BQM B;  2P9G A;  4M5L A;  4X64 F;  1Q4R A;  2UZA A;  3M6U A;  4DF8 A;  4RNF A;  1RTJ B;  2HQD A;  2D9O A;  1FD8 A;  1ZS6 A;  2BEF A;  2DXE A;  3DRP A;  4LSZ B;  1VOM A;  2CPI A;  3P3D A;  3OVS A;  1N34 F;  3UCG A;  4GVL A;  2GA7 A;  1JLC A;  3NMR A;  1EET B;  3FDS A;  2Y1R I;  3MMC A;  1RBA A;  5E3C A;  2GQQ A;  1UFW A;  1JLQ A;  3J80 U;  2VA3 A;  2M9K A;  4AND A;  2AJ2 A;  3V4I B;  4XK8 C;  1NND A;  4O0I A;  4ECS A;  1M5H A;  3DGP B;  3KUE A;  3MEC A;  5ETN A;  2CAJ A;  1QJH A;  4F36 A;  5HRO B;  4I7F B;  4ZPC A;  5F3T A;  4Y34 A;  2A2B A;  2QMW A;  3BKF A;  3HT3 A;  3HXM A;  2QN6 B;  1RWU A;  2H48 B;  2RSQ A;  3MPY A;  4UUW A;  2RQ4 A;  3GJR B;  3IM9 A;  1VR6 A;  4GVB A;  1R8H A;  1U49 A;  1HR0 F;  4M94 A;  1X9S A;  4B3T J;  3DOK A;  4WPA A;  4A8X A;  1VQ6 S;  2CWK A;  3D3C J;  2DGS A;  3L7U A;  1QAI A;  1MNE A;  2KXN B;  5LSO A;  2HBQ B;  2N7Y A;  2GPE A;  2B4P A;  2V4J B;  4WTY A;  1DFD A;  1B0P A;  2H54 B;  2RE1 A;  2ZH6 A;  4ID5 A;  4AE5 A;  3I5A A;  2VG7 A;  3EXY A;  1WG4 A;  4OZ0 A;  2HWI A;  3PO5 A;  1YWX A;  3PX6 A;  4K2X A;  1JLQ B;  3PW7 A;  2YNI A;  2YWH A;  5EUH A;  4DSI A;  2VA2 A;  2CA9 A;  3TA0 A;  1JLF B;  2IJN A;  3I56 S;  1XMO J;  2DNM A;  3CUN A;  1WKJ A;  2YKM B;  2H5E A;  1TK0 A;  4I7F A;  1NSK L;  1YQH A;  2QLW A;  5IV3 A;  4QYZ J;  2YX1 A;  4LJM A;  2HQI A;  4EO6 A;  3CCE S;  4PPZ A;  3ETO A;  2VJU A;  1URR A;  2DNH A;  2ZWP A;  2KVI A;  4R5P B;  4P10 A;  1BHN A;  2VAS A;  1TVR A;  1UP1 A;  3TEH B;  5GAG I;  1I51 B;  1TL7 A;  2MGZ A;  2Q1L A;  1WKK A;  1S4F A;  2YQ0 A;  2ADL A;  1PC5 A;  2RDJ A;  1WSR A;  4CQ1 A;  4S0M A;  2HVH A;  1J5O A;  3V5R A;  4JOU A;  4M5J A;  4TY8 B;  2K06 A;  3FSX A;  1NSP A;  1JLE A;  2A6O A;  3A8E A;  2G9O A;  4LVN P;  4F4K A;  3CSK A;  4ZPT R;  4U8V A;  3W3S A;  2EI5 A;  3KFW X;  2YX4 A;  5BR8 J;  2HSE B;  2YWK A;  1JJC B;  2JBV A;  4QR1 A;  4DG1 B;  2B9W A;  2P9C A;  5DJB A;  3SZ2 A;  5M2R A;  3TAM A;  1UA1 A;  1RT2 A;  3R5G A;  3C6T B;  1YRT A;  1KOH A;  4ILR A;  3T9N A;  2FLL A;  3BBB A;  1RAJ A;  1OY9 A;  4O23 A;  2C3U A;  4TU9 A;  3W2W A;  4F8R A;  3CD6 S;  1YRU A;  1O6X A;  3MEG A;  1OQ6 A;  5J2N B;  5J1E A;  2K5J A;  1Y00 A;  1XWL A;  3LP1 A;  1NPK A;  3GIR A;  1KFD A;  2GHW A;  2LDI A;  4F0H A;  1RIS A;  3W2V A;  2JLE A;  4NI2 A;  1SIZ A;  5D0G A;  1C1B B;  3FCW A;  5J2P A;  1XMQ F;  2OTJ S;  1DZ5 A;  4J9K A;  2RQM A;  1U0S A;  3N79 A;  2ZE2 A;  2E5I A;  5F8M A;  3KLH B;  2VON A;  2AYE A;  3PW4 A;  2M8D B;  4JI5 F;  1YJR A;  4X4Q A;  4LIW A;  3JSM B;  2FJV A;  4OQJ A;  3NNH A;  3T1H J;  3JSR A;  5AXL A;  3Q8Q B;  4HYK A;  1S10 A;  2WTF A;  3TX0 A;  2QRR A;  4FF4 A;  1QTN B;  2JHE A;  2M52 A;  4W98 A;  1GX6 A;  1Q81 T;  3RAQ A;  3Q83 A;  1VRU B;  2HFO A;  3OFF A;  4NCG B;  1V3R A;  2AHO B;  5DZ7 A;  5J2N A;  1NHU A;  1S7H A;  4D3H A;  4UQT A;  5CA5 A;  3NO7 A;  9RUB A;  5I3P A;  2ROE A;  4KIA A;  2E7V A;  3OL6 A;  5KFQ A;  3N5B A;  4IO9 Q;  2AKW B;  3OHB A;  3ZTP A;  2BM1 A;  3FQL A;  2DNZ A;  1QSS A;  2PEH A;  3W5Y A;  3MCN A;  5ETK A;  1NK5 A;  5KFL A;  3PX0 A;  4M1K A;  4B08 A;  2IVM A;  5CYJ A;  1Q53 A;  2GVD B;  2NPI A;  3BGU A;  3AFG A;  3CWJ A;  5ETM A;  4ED5 A;  4PG5 A;  3KLI A;  3LO3 A;  3MM5 B;  3Q8R B;  4DDF A;  3K59 A;  3KNG A;  1CJK B;  2UU9 F;  2J6T A;  2ZJP Q;  4WZQ A;  8AT1 B;  3DDK A;  1RE1 B;  4J37 A;  1ZZN A;  2J0Q D;  1OPZ A;  3KMS A;  4JYA J;  1WWH A;  4YR3 A;  5I3U A;  3G6Y A;  3PX4 A;  1REV B;  1RLD A;  1Z1Z A;  1EQ0 A;  1ZM4 A;  4OJG A;  1XC9 A;  2QX0 A;  5HK4 A;  2D9P A;  2QZ8 A;  4Q5V A;  3R8Y A;  2KG0 A;  4X2B A;  4QR2 A;  1RWP B;  4I2P B;  4ZVO B;  1NAQ A;  2XQC A;  1T7P A;  3LAM A;  4ICL A;  1PC4 A;  1B7Y B;  4DV6 J;  4YB7 A;  5G4D A;  1ZTW A;  2R7X A;  2IM1 A;  2PE8 A;  3FBF A;  1OPI A;  4HKQ A;  3DMJ B;  3S6E A;  3TAN A;  1OSC A;  3L95 X;  2WSF C;  2CJ9 A;  3C19 A;  4HH0 A;  1S6O A;  2V8V A;  3HHL B;  4KQZ A;  1XK8 A;  4N41 A;  2R8J A;  2CPY A;  4Q43 A;  2R7U A;  5A2Q U;  1SKU B;  2DK2 A;  1T03 B;  1V6H A;  5AT1 B;  1ZPW X;  2G0J A;  1NLK L;  2NXC A;  4WXW A;  3ZZZ A;  1SQE A;  1YHQ S;  1UAW A;  4USU A;  4F7V A;  2E5J A;  2X1F A;  1S1U A;  3QWP A;  4JB8 B;  4LSL B;  4EU0 A;  1QVG R;  4GKK J;  1MMN A;  3QGH A;  1XEZ A;  2KB2 A;  4JI6 F;  1S0O A;  5E3Q A;  5D77 A;  3MUR P;  4ZP9 A;  3J81 U;  2DGV A;  2XMU A;  1RWW B;  3ZXW A;  3AT1 B;  5K20 B;  2FLP A;  3F0N A;  1HBN B;  3EDQ B;  3FBC A;  3SCJ E;  4CH0 S;  3T5J A;  3TA2 A;  2F3J A;  1N5S A;  1UET A;  2OEM A;  2O5D A;  1KQG B;  2Q6C A;  2XSF A;  4LRD A;  2JC0 A;  2HVI A;  1FKO B;  2DNN A;  1NPR A;  1GK8 A;  2HBZ B;  1U4B A;  1BMQ B;  1DLO A;  1VC5 A;  3HZG A;  3CO9 A;  2BAC A;  3N6M A;  4ETZ A;  3DLE B;  3ETM A;  3M8Q A;  3D1Q A;  1YJW S;  2BUN A;  3EM1 A;  4M5D B;  1H74 A;  1Y3K A;  1R3N A;  1Q78 A;  1S1W B;  3H5S A;  4DL6 A;  1U1L A;  1ZYQ A;  1SKR A;  5AXN A;  1X7V A;  3M2U A;  1YRX A;  3PHT A;  3BH6 B;  3FEY B;  3TZX A;  2J5A A;  2PT0 A;  3FCV A;  4NLD A;  3R9L A;  1CS4 B;  1BLU A;  2JOQ A;  3VF0 B;  4X4S A;  1HNI A;  4ELU A;  1YSJ A;  2MKK A;  4AQY J;  4QU6 A;  3EZ5 A;  2JEF A;  2IA6 A;  1GMU A;  1DAX A;  1DHM A;  1V5I B;  2KDO A;  4WXO A;  2B5J B;  3KJV A;  2MMY A;  1HWK A;  4MTP A;  1HNX J;  1NK7 A;  3M9N B;  1U47 A;  2B9E A;  3DYA B;  4C8Z A;  2W2Q P;  2HHS A;  4GC6 A;  5B0D A;  2NXN A;  1IVZ A;  2V68 A;  3IBW A;  1RTH B;  1XMB A;  3KHL A;  1RHQ B;  1BXN A;  2DNG A;  4K59 A;  4NXN F;  1U8W A;  4YHH F;  2QL9 B;  2RU3 A;  4X64 J;  4FKX A;  2ZBQ A;  3FRY A;  4DQI A;  1OIA A;  3UD3 P;  2VOP A;  4DPO A;  1WF2 A;  1RAI B;  3M6X A;  1B3T A;  4B9U A;  2KFN A;  2CNN B;  2Z57 B;  4LSN B;  2H1Y A;  3WZ0 A;  4KT0 C;  4LF7 J;  3FCH A;  2M3D A;  2R7O A;  5C2G A;  2MKC A;  2XMK A;  1M1G A;  1BUX A;  3U7J A;  4C0O C;  4U7U D;  2ZJR Q;  2AGQ A;  4RUH A;  1YZ7 A;  4CCH A;  2XWX A;  2B4O A;  2J9C A;  3BGL A;  4G65 A;  3MED B;  4HDH A;  3QZ8 A;  4YB1 P;  3KLV A;  2PII A;  4ATN A;  3RBZ A;  5KFU A;  2BKO A;  3AHP A;  1RAE B;  4O44 A;  1FKP B;  1DRZ A;  1SI9 A;  1FVS A;  3ET6 B;  2JRS A;  3R6L B;  3VEB A;  1SV5 A;  4DSE A;  3OR2 B;  1FJG J;  1APS A;  2BXJ A;  4HLB A;  2Y0S D;  3W61 A;  1SBR A;  4OI0 A;  4RUB A;  2BQ3 A;  1TL3 B;  3JAM U;  3ZTQ A;  1GQE A;  2AT1 B;  2ZH7 A;  1HNW F;  3EGW B;  1X4C A;  2MZJ A;  3PW0 A;  2V4Q A;  1NCL A;  2XWY A;  1YZ6 A;  2Y8W A;  3MCO A;  3P5B P;  2VZ9 A;  4RW7 B;  1X5T A;  2FUG 9;  1FJG F;  4AT1 B;  1D9D A;  4KBI A;  2RIL A;  1D9A A;  4ZJQ A;  3PIO Q;  3OL9 A;  4A8O A;  3VW4 A;  1YGY A;  1EB0 A;  2G1D A;  2WK4 A;  2CJK A;  1PAR A;  1RT2 B;  4U6P A;  5KG5 A;  1U2R A;  2LA4 A;  5BYR A;  3VAI A;  2XGQ A;  1HQ2 A;  1RHJ B;  2DH8 A;  3PR5 B;  4GO7 X;  2UUC J;  1L5U A;  1SJ4 P;  3LTO A;  1DQ9 A;  3JYT A;  3MM9 A;  1FXR A;  3N6N A;  3OTC A;  2ZHA A;  4KH1 B;  1PCA A;  3F41 A;  3M8P A;  2E1P A;  1KS2 A;  1UA0 A;  1JXV A;  3O5T B;  2OTL S;  3QT6 A;  5CYM A;  2HVD A;  3DOL A;  2EG2 A;  1RGV A;  4DV0 J;  1PJ6 A;  4DUY J;  3I55 S;  2MZQ A;  2E29 A;  3MAH A;  1RSC A;  1U09 A;  1U6B A;  1OHN A;  1K1S A;  2DH9 A;  4K4Z A;  4Q44 A;  1TL1 B;  4UOH A;  5D0R A;  4F25 A;  4TKT A;  3SDE B;  3GXQ A;  3WDO A;  2V8P A;  2Y8Y A;  2PMH A;  3GV5 B;  2MY8 A;  4Y6I A;  4V19 X;  2FJD B;  2CZ4 A;  3I0R A;  4NA1 A;  2Z58 B;  4BWM A;  2LXU A;  2C2R A;  4XDC A;  2ILZ A;  4F0K A;  1MN9 A;  2B6A B;  2WZ1 A;  4ID8 A;  4XIU A;  1OWX A;  1OY8 A;  4PXC A;  5A6P A;  5EHH A;  1KQK A;  2OPP B;  4X4R A;  1ULR A;  3MFI A;  2OSQ A;  4C6A A;  5EX3 A;  2QFJ A;  1TMM A;  2LQB A;  1SUQ B;  3BS9 A;  3ITH A;  4OYB A;  1RWN B;  2MLX A;  5A0Y B;  5CZV A;  1YIJ S;  1FRM A;  4O4G A;  1C1C A;  1YBU A;  3J7Z 5;  3R2C J;  4LF8 J;  2JWN A;  2HLU A;  3SCI E;  1ZA2 B;  3A4T A;  4IDK B;  1RLC L;  4WF9 Q;  1SC3 B;  1VQS A;  2HZC A;  2MEW A;  3KK3 A;  3M6W A;  1TL1 A;  3CJ5 A;  2B7C B;  3E8O A;  3MTJ A;  1T0T V;  3POT A;  5ETQ A;  4FVC A;  1NHK L;  4PXE A;  1YVF A;  5A8R A;  3C15 B;  5E2Q A;  2ZH8 A;  1S1V B;  4YOE A;  3SI8 A;  1KVI A;  4OFZ A;  3D67 A;  2YH0 A;  5F8H A;  3VGS A;  2N7C A;  2L9N A;  1RT5 A;  1CUL B;  1YJ7 A;  2DCU B;  3G6X A;  2QLX A;  1T9W A;  2ZC4 A;  2XB2 D;  3I6P A;  4NE9 C;  2F1F A;  3NEK A;  2ZOM A;  3DRY A;  5A8K A;  2N3L A;  4OV6 A;  4R8U A;  2ZH1 A;  2HFS A;  2FIU A;  1T8E A;  1EAY C;  4I2P A;  2UV8 G;  1NHV A;  1RHU B;  2HNY A;  1Y10 A;  1DTQ B;  3MMA B;  3UVJ B;  1U1M A;  2QYC A;  4KHM A;  4MYU A;  4RJV A;  3U1M A;  5EDW A;  1JJH A;  1D1U A;  5FII A;  2AJ4 A;  4ELT A;  1B70 B;  1UWB B;  3N6L A;  4HHH A;  5F8L A;  1TMJ A;  3S8S A;  2VQE J;  5AE1 A;  2XY7 A;  3DYA A;  1H38 A;  5KFY A;  5LMU J;  1B01 A;  8ATC B;  4JV5 F;  4PUO A;  3G5O A;  3GJQ B;  4I2Q B;  3BJY A;  4F4A A;  2Y0B B;  3GYX B;  4AL7 A;  4OYO A;  4YUD A;  4I69 A;  9ATC B;  1N6Q B;  3BBF A;  4RZR A;  5I42 A;  2BZ2 A;  3D1H A;  1HWL A;  4RPF A;  4K2J A;  1PJ7 A;  2GVZ A;  5E3R A;  1RHR B;  5LXR A;  1CJT B;  4LF7 F;  2H51 B;  1ZET A;  2FVS A;  4CLK A;  4TNO A;  4RW7 A;  3KK2 A;  1WHV A;  1Y5L B;  3MR7 A;  1GTE A;  2LFV A;  1FK9 B;  4TYA A;  2ASD A;  5H9E K;  2E9R X;  2MJU A;  3TVZ A;  4EWT A;  2PI4 A;  3DKD A;  3VHQ A;  4FZV A;  1NB7 A;  3HHK A;  1AT1 B;  2HNZ B;  1NDL A;  5HVF A;  5ITH A;  3MEK A;  2R42 A;  1RTZ A;  3MED A;  3NCR A;  4HHJ A;  1U8S A;  2BJE A;  3H8Y A;  4J9S A;  1FDD A;  2CQG A;  2NXE A;  1FNX H;  2DTJ A;  3EXC X;  1RTD A;  1MML A;  1D0E A;  2FVR A;  3AAW B;  3OQ2 A;  2EWH A;  1C4A A;  3KLG B;  5FLX Y;  1Q5V A;  2XHC A;  3KLF A;  3HSD A;  3M8Q B;  3T9Z A;  3JQK A;  1WI6 A;  3VQS A;  3A3P B;  2YNF A;  5HAO A;  4RBT A;  2QL7 B;  2GO8 A;  3I87 A;  1PO6 A;  2OEL A;  3MM8 A;  2V8G A;  3CDU A;  2J8S A;  1FRK A;  1Z2Z A;  3LWL A;  5L1I A;  2HHX A;  5JXS A;  1AYE A;  3VVU A;  4WIQ A;  3Q2T C;  1L3K A;  4KHP J;  3SDE A;  5ADZ A;  1BD6 A;  1B99 A;  1UPM B;  3I5C A;  2IDE A;  4YP3 A;  4RUA A;  3UCU P;  2KYZ A;  4CLF A;  4KGX B;  1RQ0 A;  3CCQ S;  2DR9 A;  3DU6 A;  4D8J A;  2B6A A;  1C2P A;  2R2U A;  2J7U A;  1HMV B;  4CZC A;  1R6V A;  3HSZ A;  3BQ2 A;  3DLK A;  3NBP B;  1S4E A; 
#chains in the Genus database with same CATH homology
 1EA4 A;  1BDT A;  2BNZ A;  4ME7 E;  1X93 A;  2JXI A;  2KEL A;  1MYK A;  2K9I A;  2JXH A;  1B28 A;  1NLA A;  2K5J A;  1B01 A;  2BJ8 A;  1U9P A;  1Q5V A;  4HV0 A;  3GXQ A;  2PC6 A;  2GPE A;  2CPG A;  3QOQ A;  3QSI A;  2CAD A;  3VW4 A;  2BJ7 A;  2FGC A;  2BA3 A;  2JXG A;  1PAR A;  3BKT A;  2RBF A;  1ARQ A;  3OD2 A;  1MYL A;  3VEA A;  3H87 C;  3BKU A;  2F1F A;  2CAX A;  3FT7 A;  2BSQ E;  2CA9 A;  2H1O E;  1Q5Y A;  2BJ3 A;  3VEB A;  1P94 A;  2WVF A;  2NZC A;  2K29 A;  2WVB A;  2CAJ A;  3LGH A;  2BJ9 A;  1IRQ A;  1BAZ A;  2WVD A;  1MNT A;  2HZV A;  3BKF A;  2WVE A;  1QTG A;  2BJ1 A;  2K6L A;  4FXE A;  4D8J A;  1BDV A;  2K1O A;  2Y3Y A;  2AY0 A;  2BNW A;  3FMT A;  2HZA A;  2WVC A;  1ARR A;  3PHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...