2WVTA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
438
structure length
438
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 156
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvtA01
4D6GA 1CGUA 2E0PA 4AIEA 3SCSA 2DSKA 2QPUA 3N11A 2FGLA 4M80A 1Q6EA 2BY1A 5HPCA 2CXGA 4AY1A 2WVUA 7TAAA 5HBFA 5A2AA 4ML4A 2GJXB 5HXMA 2WVVB 1E4MM 2XVKA 2UY4A 4NRSA 3IANA 4PMVA 4UNIA 4NF7A 3MV11 1G9HA 3MU7A 4GQQA 4NI3A 2YLAA 1WDRA 4IPLA 3VILA 1JXKA 1F4HA 4UZSA 2DSUA 3ALGA 1I1XA 4U3AA 3RJXA 1E6PA 1R85A 5DEZA 4P8WA 2VZVA 3QHOA 2WK2A 3GXNA 3IGUA 2GDVA 4AW7A 2IXUA 2XHYA 5A8QA 1UKSA 2WXDM 4YPJA 3ZSSA 2EEXA 3CV5A 3CLWA 2XUCA 3UETA 3VSTA 1HJSA 2G8ZA 2ALWA 3W6LA 1L0PA 1PZ3A 1VFUA 1GOKA 1GUVA 1JXJA 3VKKA 5A6AA 4ZENA 4EK7A 3VO0A 1CWYA 2WLZA 2D73A 3H53A 1XH0A 3B9EA 2GK1A 3UG3A 1W32A 2XFRA 1CBGA 5BWFA 4PMYA 1NQ6A 2YKKA 3ZR6A 2O9OA 4Z2JA 3ARZA 2GFTA 1CGVA 1E9LA 3SCPA 2F18A 3N1AA 3H55A 5D8WA 2OSWA 1DWGM 3QGVA 4JCMA 1DHKA 2WMFA 3PZQA 5CXPA 3ZQ9A 3OBAA 1ZBCA 1UHVA 1LL6A 3DX0A 1V6XA 4WKFA 4MB4A 1RP9A 1ISZA 1GOIA 4C7FA 4GI9A 3BUIA 3BAXA 2YDSA 3DYMA 3EDFA 1R47A 4YN5A 2XGBA 5A6BD 3WN6A 1CXHA 4AZ5A 5C70A 4AZBA 2PWHA 3EJUA 3BUPA 4UQBA 3ZT5A 1R86A 2VX5A 1KFWA 3WF1A 3VM5A 4AIOA 3VIFA 5DF0A 1PIGA 1MXGA 1TQWA 4FNPA 5F7UA 5CGTA 1B3XA 1QI2A 1D7FA 1PJ9A 1W1PA 1VJZA 1XD0A 5JBFA 1R34A 2O9TA 2VCCA 1A3HA 2JF6A 1V3HA 4W85A 3CMJA 1W2PA 1NM9A 3AS3A 1VEPA 3CUGA 1JDDA 3PTQA 3L4VA 1HF6A 2J75A 3WEZA 1UWSA 3RO8A 3DECA 3SUSA 1JYXA 4M24A 4XV0A 3GYCA 4W8LA 5C8BB 3CBWA 3GXIA 1CENA 2F2HA 2D3LA 8A3HA 3SUWA 1Y7VA 2CBUA 4F9JA 5FL1A 2W91A 2A3CA 2C7FA 4X0NA 4ZE4A 1HNYA 1XCXA 3VGFA 3SCNA 3ZR5A 5CSUA 1GJUA 1W9DM 4AEFA 5BXPA 2J77A 1J01A 2WC4A 1WDSA 2A3BA 4FNQA 1NWSA 4GIAA 2D2OA 3HN3A 4HMDA 5A8PA 1W9BM 5BXSA 5A2BA 1V3LA 4U5IA 3WD0A 5CPQA 3W4RA 1QBBA 2WWDA 3WKZA 3VTRA 1EO5A 4EANA 1UR0A 3BVXA 1W91A 3LPGA 5M5DA 3ARVA 3D4YA 3WENA 3OB8A 1I1WA 2QMKA 1PS3A 2E9BA 3GDBA 2PWEA 3BVUA 1GOMA 4FNSA 3AXHA 3AHVA 6TAAA 1MQQA 4W86A 4KRTA 3RILA 1OWQA 4UZUA 3NDZA 1RPKA 3AMGA 2YA1A 1V02A 2ZWZA 1FHDA 1YHTA 4WKHA 3WH7A 4FLRA 3ZT7A 4HMEA 4QLLA 1HJUA 4MNKA 1GOOA 2V5CA 1BGAA 2WANA 2X2YA 1UR2A 2VVNA 1WE5A 3GZAA 4PMNA 3W26A 3MSDA 3WH6A 4X9YA 1BSIA 2OWWA 2VUYA 1VAHA 3GNOA 1V0NA 1YQ2A 4ATLA 2DSVA 1T0OA 3CUFA 2GJPA 4TXEA 2ZWYA 3PZOA 3DX4A 1W1YA 4UFHA 2OYMA 1IZJA 3VDAA 4TVCA 4MAZA 4W89A 2WVSA 2CBVA 3LXBA 5BROA 1QHOA 4JKKA 5AYBA 1WB0A 2X2HA 1CGWA 2VZOA 2NT0A 3DX2A 4QDMA 1DTUA 1K9FA 2RGMA 1QI0A 2DPEA 5DMYA 3SEPA 3NIYA 4Y7EA 5EB8A 3EDDA 2VCAA 3HG3A 3RIKA 3N9KA 2VC9A 3CIVA 1XSIA 1R46A 9CGTA 3O6AA 2NW0A 3RDKA 3VIOA 4ACZB 2ZX9A 1GPFA 1N82A 1KR0A 5A8NA 2WZEA 1PPIA 2WZIA 2GJRA 3F5LA 1PX3A 3KWXA 1NOFA 1WO2A 1J10A 3HZ3A 1HVQA 4JCLA 2PBOA 4P8XA 1J0IA 2J7CA 2BFGA 1BPLB 1CIUA 4BZYA 4BQ4A 2VT0A 1MW2A 3VD5A 5IFTA 3GTNA 1QNQA 4H8HA 3BSGA 3NSNA 3KL3A 3ZT6A 1ZU8A 2G3IA 1UH3A 5I2UA 1EO7A 1E6SM 4UR9A 3AZRA 1GOQA 1ZBWA 4RE4A 4KRUA 1ZL1A 2DSZA 3SIMA 2BY2A 5A6MA 1DEDA 4OBRA 1C7TA 5I77A 1Q6GA 4J3TA 2DT0A 2CBIA 1JF6A 3WMCA 1EQCA 1KTCA 4ZXOA 3CZLA 4V27A 1R7OA 2B31A 3K4DA 2VZSA 1G01A 3CGTA 5I6SA 4HA3A 3A4XA 1V6UA 3ARPA 2YBUA 1ZJBA 1QPKA 3DHUA 3KE0A 3UG5A 2XVNA 4OJYA 4GQRA 4H2CA 1BLIA 5FCZA 1XYZA 2EPOA 1JAEA 3MKKA 3OZPA 1ZJAA 2ZXQA 3PN8A 3MUY1 1CZ1A 1GQJA 6CGTA 2XVPA 3ZIZA 3BMWA 4MAVA 2V3GA 1UKQA 2O92A 4U33A 2XSAA 1WZLA 5A95A 3A3HA 3AMKA 1OGBA 3U5YA 2WMIA 2PF0A 3BAKA 2BY3A 2VZUA 3SCRA 2FGZA 5I5RA 4PMDA 4GI8A 1TA3A 2EPKX 4OGZA 2CERA 4UQDA 2ZX6A 3AHXA 5HDRA 3EMCA 4MDPA 3GXDA 2EADA 1CNVA 2CNCA 3WQ6A 1UKOA 5LA2A 1W9PA 1XH2A 2F1AA 2W92A 1CGXA 4PMUA 4JIEA 3EDKA 1ZBKA 4PTMA 1E73M 1GQIA 2V3FA 1OT2A 2D0FA 1GOWA 1OBAA 4DO6A 1RH9A 2VO5A 3VMOA 4E4PA 5CQ1A 3BLPX 4CN1A 1MW0A 3AI0A 2E3ZA 3FXYA 3WNMA 3SCQA 1M04A 3A24A 5DFAA 3EDJA 2YOCA 1VBUA 3IK2A 1JZ4A 1TR1A 3T09A 3A4AA 4NX0A 1UOKA 3MUZ1 4Z2IA 2XN2A 3DX3A 1V3IA 3AQUA 1TQSA 4URIA 1C8XA 2QMJA 4WKAA 3A22A 3IJ7A 3BVWA 5KZ6A 1JYNA 5D9PA 3W25A 1C90A 1W3HA 2D20A 1PIFA 3NYDA 4AISA 2JALA 3THCA 1OCQA 1CGTA 1BF2A 4QCFA 5ABEA 2VURA 1Q6DA 4HA4A 3L4WA 4UFKA 3THDA 2QLYA 1HL9A 3MUAA 1E70M 3HU7A 1PAMA 3VDCA 1UR4A 2EO7A 4WJXA 4OOZA 3EJPA 3N17A 3VDHA 3BAJA 2O9PA 1HP4A 4TVDA 3B9AA 4MTVA 3WDRA 3GXFA 1GHSA 3MMUA 1TQUA 1Z32X 3BGAA 4AZGA 1UWRA 1LF1A 1KTBA 1JZ7A 1BYAA 2BXZA 4MB1A 3VIKA 2PI6A 4CN6A 3CH9A 4AZIA 4PCSA 1GJWA 3RPMA 3VD9A 3RM4A 1VB9A 2FYVA 3VIPA 3W82A 3N12A 1H09A 2UY2A 4F9DA 2D3NA 4J3VA 3RCNA 3WNLA 2V3EA 3B8SA 1NP2A 3II1A 4NZFA 4HA1A 2J7BA 3K1DA 3CZGA 3WNNA 2J4GA 3KL5A 3VGEA 4HPGA 2EABA 3F4VA 4PMQA 3VGGA 4P8VA 1TZ7A 3CHFA 3UG4A 1GVIA 5EMYA 1EH9A 2E9LA 3WSUA 1LG1A 1UKTA 4PEEA 2F8QA 3RM9A 3SUUA 2XYLA 4D1IA 2UWFA 3WH8A 4FLQA 4CVUA 4DWSB 3HJEA 1UZ1A 3WD1A 5CLWA 3AOFA 4BS0A 1U33A 5JIWA 3SCUA 2DDXA 2XIBA 1D2KA 5D4YA 4PMRA 4CU6A 2VR4A 2VR5A 1SFSA 4Q7NA 4P7NA 1OB0A 1KXVA 1NH6A 1NOWA 2JFEX 3ZJKA 1EOMA 3NSMA 1XD1A 4J7RA 5AYIA 3AIUA 1PBGA 3A5VA 1QW8A 3BAYA 1W9UA 1F4AA 4CKQA 4CD4A 2UY3A 4D6FA 3EJRA 4MNJA 4CD6A 3FAWA 1V6YA 1JG9A 1E4NA 3PBGA 2FHCA 1KGUA 2E4TA 3WFLA 3AZSA 4UFLA 5FIPA 3LPPA 3ARYA 3OG2A 2WC3A 3QHNA 5A8MA 3U7VA 5AC5A 3VU2A 5I23A 1E5JA 1UQYA 3WD3A 4AWEA 1E3ZA 4LYRA 4CCDA 1JFXA 1VRXA 4P7LA 3GH4A 1J0KA 2X1IA 4NZCA 3WQ8A 3GBEA 1EDQA 3AHZA 3W37A 4C7DA 3AJ7A 4D6HA 2IXVA 1BVNP 1EHAA 5CPSA 1JGIA 1BYCA 5HPOA 4DUWA 2X8RA 2E40A 1ECEA 1GQLA 4NXSA 2RGLA 4TX8A 3WEOA 1V0LA 2CKRA 3ARUA 4GZIA 2ZXBA 4JFUA 2PC8A 3WUEA 3OLGA 1B1YA 4W8AA 3WMBA 1E72M 3SCVA 1W1VA 4MNMA 2DT3A 4FLOA 4PMZA 3GH5A 2VOTA 1DWJM 4U3CA 1J12A 4FLSA 1BTCA 1E6NA 4BQ3A 2EAEA 1JDAA 4UFIA 1TVPA 4DM2A 3D4ZA 3OLDA 2YLLA 4CGTA 3CPUA 1LQ0A 4JL2A 2ZICA 1PX8A 4NRRA 3ALFA 5JUVA 5I0DA 1W2VA 1OGSA 1E43A 1C92A 3WNKA 2Y24A 4QP0A 1EDTA 1EHNA 5CG0A 3VX1A 1UR8A 1UH4A 3BXWA 2ZUTA 1B3WA 2WZHA 2FHFA 4ACZA 1HXKA 1UUQA 1WCGA 1O7AA 3D3AA 3KLLA 4KGJA 4B3KA 3HMCA 2E9MA 5E6ZA 4RL3A 5AC4A 2ZUNA 3UCQA 1RP8A 4JFTA 1P6WA 1XRVA 3EJTA 4GI6A 2HISA 7A3HA 4OBSA 1JI1A 2Y2WA 3APGA 1C91A 3KEHA 2QHAA 1TCMA 1DWFM 4Z2KA 3CZSA 2E8ZA 1XSKA 2XVGA 3K8LA 4V2XA 3MO4A 4CCEA 1H4PA 1UWQA 1VENA 2C0HA 3MMWA 4CD7A 2Z1KA 1VBRA 4F8XA 1FOBA 2WPGA 5EFFA 4MDOA 4J3SA 4V28A 3JUGA 5FD0A 4U2YA 1A47A 1JF5A 3CC1A 1J0JA 1GQKA 1XYFA 1LL4A 2DQXA 3GNPA 3AIVA 1R75A 2D0HA 4DO4A 4AD2A 5ABGA 3WMSA 1TFVA 3ARXA 3UR7A 3OZOA 1JZ5A 3W53A 4HOZA 1GNXA 1M53A 1H11A 3AIQA 3WF0A 5GQBA 1GW1A 4UFJA 1ZS2A 5D9OA 2J8GA 2QPSA 3POHA 4LGXA 1CXFA 1K6AA 2J7EA 1ZBVA 2OWXA 4J3XA 3WH5A 3M7SA 4RE3A 3AIEA 1H1NA 3IJ8A 3I3EA 4QLJA 1H5VA 5DT5A 4QFUA 1KQYA 4H41A 3MUIA 1JNDA 3D52A 1HVXA 3MMDA 1V0MA 3OGRA 3L2MA 2ZX5A 4Z2GA 3U5UA 4XB3A 5CPTA 4L4PA 3PZUA 4ATDA 3VD3A 2JEQA 1HJWA 2UY5A 1E56A 1B0IA 1TQVA 4JFWA 1EXPA 1E6XM 1V0KA 3VOCA 1DWAM 4W5ZA 2F61A 3MI6A 4AEEA 4P8UA 4MNLA 3ZJ8A 2D22A 4K68A 3WY2A 3T08A 4TTGA 4KGLA 4PTXA 1W9XA 6A3HA 1MW3A 2J62A 2WMGA 4TTUA 4WIWA 4MB3A 3SUVA 1EGZA 2WLYA 3AYSA 5HNNA 3N18A 1M01A 3M46A 3NDYA 2Z1SA 1UD3A 2G3NA 1H0IA 1IV8A 1FH9A 2EPLX 3ARRA 3CZNA 4PMXA 3K8KA 2WSPA 1HTYA 1G94A 5D9NA 3ZM8A 1TQTA 3CUJA 3WFZA 4M8UA 1G1YA 1Q4NX 4QAWA 4J28A 3AHTA 3W29A 1JL8A 3L4TA 4UFMA 4D72A 4PSRA 4B15A 1VFOA 4AMWA 4AD1A 4JKLA 1WDPA 1B9ZA 3BSHA 3L4YA 5GPRA 1UYQA 3DC0A 4IUGA 3EJQA 4RE2A 2ZE0A 3EYPA 2WYSA 2DH2A 3AS0A 2CITA 5A6SA 4WF7A 3AIRA 3WF3A 2VL4A 1W3JA 4TVUA 4HOXA 1KWKA 3HG2A 1WKYA 4HZ6A 3AFBA 1QX1A 4FNRA 1J0HA 4M81A 4CUCA 3MANA 4D6EA 3GXTA 1WDQA 3MS8A 2QF8A 1O6IA 2XG9A 3AICA 2OWCA 1WZMA 1E1EA 3CZEA 1UA3A 3G6LA 1ZB5A 4JFSA 3N15A 1B90A 4ZE5A 2YA0A 4FMVA 4LXFA 4R27A 3LRKA 2X2IA 3S6TA 3WNOA 4PN2A 1K9EA 3W24A 2EQDA 4AXNA 4PYSA 3L4UA 2OYKA 4JL1A 3K8MA 3WH9A 1M7XA 1DWHM 5A8OA 2XJ7A 4UQ9A 1UASA 2F7PA 3F5JA 1ISYA 1ISWA 4AYSA 5DT7A 4B16A 4HOWA 3IAQA 4GPNA 3A6OA 4UOQA 1BFNA 1B2YA 5GNYA 5A1AA 1US3A 3D51A 1UA7A 2DT1A 2WBKA 1CDGA 3WUFA 4MJ2A 2A3HA 5E09A 2GUYA 3IAPA 3VIHA 1GORA 4MPKA 1FH7A 4AZ7A 2XGIA 1GONA 4NZJA 3DYPA 4Z2LA 5ABFB 3VMNA 3CMGA 3TONA 3ECQA 2VX6A 2JF7A 3U57A 1EOKA 2GJXA 2WVVA 2ZXDA 3DX1A 1E4LA 1BVZA 2X2JA 2J7FA 3F5KA 2AOSA 3SCTA 1OGGA 1WNOA 4UQAA 3BLBA 2DEPA 1XSJA 1TG7A 1QVBA 3PTMA 2CKSA 4TOQA 3OA5A 5FOOA 4D6DA 4E8DA 1JI2A 5I79A 5BXTA 1AVAA 1W9VA 2BV9A 3PZMA 5A3HA 2V3DA 5GNXA 1MXDA 1R87A 3S2CA 2Y8KA 5ABHA 1VEMA 2YDQA 4AMXA 4W5UA 3SURA 5A6KA 2VJXA 1H3GA 3AXXA 5BRPA 2BNJA 4DWSC 8CGTA 3BH4A 2F7OA 5I3DA 2JE8A 3VD7A 4F79A 1FFQA 2WHLA 1W1TA 3MSGA 1E6ZA 2JIWA 1V02E 3UESA 3AIWA 3DYOA 3W28A 3WUGA 2ZUSA 2WW5A 1CTNA 1HKJA 1UQZA 3CO4A 1E1FA 1NWTA 4ZEPA 4QCEA 1NWUA 3AHYA 1KBKA 2YJQA 1GZJA 3TTSA 2G4FA 5JBEA 2XWEA 2J47A 4AD4A 3VDBA 2OSYA 1QNRA 1HN1A 2JIEA 1X6LA 2FH6A 1MW1A 1H41A 4M1RA 1BGGA 5FL0A 1NARA 1LL7A 4CN4A 2WHMA 1E0VA 2FDMA 1WP6A 4AMCA 3OGVA 2BVDA 3ZOAA 3ZJ7A 4X0VA 3WIJA 4A4AA 1AQHA 5A69A 1HKIA 1WPCA 2J8FA 2VRQA 3UR8A 3W6MA 2BXYA 5CLTA 1LWJA 3BCFA 1J11A 2VMFA 3ZSTA 1RD6A 3MV01 2WBGA 1BQCA 2W67A 5AY7A 2DGAA 3L4XA 3EJSA 3GBDA 5C71A 1PZ2A 1VJSA 5IHRA 3BUQA 1HJXA 3CHDA 2VVSA 2YIHA 4OZOA 2W4XA 2PB1A 2G3MA 4D6JA 1CECA 1OINA 2CIPA 4B9ZA 1TE1A 2CPUA 3AISA 4BQ2A 4IM4A 1XHGA 1V08A 2ZUUA 4F66A 1W3KA 1AQMA 2WMHA 2VNCA 1GHRA 2W66A 2OSXA 1UD6A 2FHBA 3UERA 4D6CA 3CTTA 1MFVA 4GO9A 3ZO9A 2D1ZA 3WL1A 5LA0A 2WCGA 3T0BA 2Y4SA 3VPLA 5CZKA 4XZBA 1HJQA 4B9YA 1OIFA 4AZCB 1GVYA 4LYPA 2J78A 3NSXA 1OT1A 2OW6A 3DDGA 3T2OA 1E5NA 4H04A 1TA3B 2XN1A 4CD8A 1MQRA 1OD8A 3WY1A 3CZJA 4DM1A 3RJYA 1U30A 2WWCA 3BAWA 2ZX7A 5I78A 3CZ8A 4W8BA 4AD5A 4H8UA 3VIMA 4PUDA 1BYDA 2PWGA 5CSYA 1J0YA 1KGWA 1VFMA 2NT1A 4GKLA 4AC1X 3PTKA 1E3XA 2CBJA 3LRMA 1X6NA 3VM7A 3AMCA 5I24A 2GVYA 1UZ4A 3FNDA 2DIJA 2EXOA 1B3ZA 1CYGA 4E8CA 1TVNA 1TMQA 2QV4A 2J7DA 3WUBA 5A6LA 1H49A 3QOMA 3AROA 1JZ2A 3WDHA 2YL9A 3BCDA 4PTWA 4C7GA 2EBNA 1HP5A 3VGBA 4HMCA 1G5AA 1K9DA 4MB5A 2EPMX 2PBGA 2WVTA 2VQUA 4S3KA 2ZUVA 4CU7A 2Q8XA 3GXPA 3AMDA 3WBEA 4DWSD 3AXIA 1QOXA 3FN9A 3ARSA 1E40A 1KCLA 3TTQA 2CHNA 1G0CA 2HVMA 2VZTA 3NCOA 2CESA 4LYQA 2VRJA 1R33A 3S5ZA 4W7WA 2WCAA 3KL0A 1WZKA 2JEPA 1LLOA 3AMLA 2D24A 1DWIM 3W38A 4PBGA 3GH7A 3K4AA 3TV8A 1HT6A 2CYGA 1VEOA 1QW9A 3OIHA 3B9DA 3BLKA 3FHQA 1C3FA 3VGDA 5KEZA 2DSWA 3POCA 4PRWA 2ESCA 1EA9C 1E6QM 3OGSA 3ZJ6A 2ZUMA 3NUKA 1HIZA 1JZ8A 1UG6A 4WSKA 2J25A 1X1NA 1B3YA 1BG9A 1O7DC 2G41A 3A47A 2WHJA 2VX4A 1HJVA 2J74A 3PHAA 2ZOXA 3VUPA 1JZ3A 1CLXA 2XM1A 2O9RA 4GINA 5BYWA 3LXCA 3GNRA 3WF2A 1DP0A 4W7UA 2A3AA 1QHPA 3ZMRA 1UD4A 3VD4A 3VX0A 3AS2A 4ATWA 2VQTA 1NWRA 1XC6A 3J7HA 1JDCA 5A2CA 5ECUA 2BHUA 1UWIA 3PZIA 3VSVA 3HG5A 1EIBA 1QI3A 3VSUA 4CD5A 4KMQA 3GXMA 1JD7A 3DHPA 5D9MA 2VI0A 3VMPA 2XPKA 2F7RA 4W87A 3A21A 4EE9A 1CLVA 3TOPA 3PZNA 4BQ5A 3WL0A 3RM8A 2DT2A 1EQPA 4KH2A 2GDUA 2A3EA 3WD2A 2NSXA 3LX9A 1XGZA 2ZX8A 1MVYA 4JAWA 1OM0A 1BHGA 2YDRA 1C8YA 2W63A 3WQ5A 5DO8A 3WDJA 1OD0A 4J3WA 1UKPA 4DO5A 3UEQA 1M03A 2DIEA 2C8NA 1KQZA 3EMZA 1EDGA 1E55A 1E71M 4CVWA 4HP5A 4IPNB 3SUTA 4D71A 4L4OA 3BMVA 4PSPA 1MQPA 2XSBA 2XIIA 1B31A 1OIMA 1UD8A 1ITXA 1CEOA 1HXJA 1CGYA 1WAWA 3ARWA 4FK9A 5GNZA 1VF8A 4WSJA 4D1JA 4P7QA 3TTYA 4AD3A 1JYVA 2XVLA 4A3HA 3WDPP 4YHGA 1GCYA 2X05A 1CXIA 4GXPA 1PEZA 1W3LA 5ABFA 1FA2A 4M56A 4HU8A 2OLHA 1V6VA 3O9NA 5M17A 4A3YA 1TUXA 1FFRA 3FW6A 1QWNA 3WQ4A 2GK1B 4FNTA 2VX7A 1UR1A 3E1F1 3D50A 4E2OA 2XM2A 1ODUA 3VIJA 1J18A 3OLEA 3M6DA 3N04A 3LRLA 3CHEA 4TUFA 1CXLA 3QOKA 2VCBA 5FKYA 1KB3A 5M03A 2E8YA 1NOUA 1UWTA 4DUXA 1JIBA 4LQ1A 4UQCA 2X0HA 2YL6A 1BYBA 3WF4A 5LA1A 2IUZA 5E1QA 1S46A 2YL8A 4UOJA 5BCAA 2VTFA 1JNEA 1QNSA 3WBAA 1PX4A 1KWGA 4PUEA 4W88A 4OUEA 3TA9A 4BA0A 1E0XA 2BS9A 3T0DA 5E70A 3WDIA 3EMQA 1UWUA 1ESWA 3AIBA 2ZXAA 1KXTA 3IJ9A 3LXAA 3FY1A 3PZGA 3N13A 2MANA 2WMJA 1R7AA 1QI4A 2OYLA 2TAAA 3WELA 4AYGA 4WK9A 4J27A 5TD4A 1IT0A 4JZ5A 2J7GA 2EACA 2CCRA 4UTFA 2X0YA 4N42A 3PZ9A 4OIFA 3W0KA 4YHEA 1KXQA 1SMDA 1MYRA 2WMKA 4PCTA 1V3KA 4PTVA 3LMYA 4H8VA 2WNWA 3EDEA 5JIPA 4W84A 1QHZA 1HWWA 1WZAA 3CUHA 2W61A 2BVTA 2EJ1A 1BG4A 2OW7A 4QLKA 1ISVA 3W27A 1JD9A 3WY3A 3D5HA 4BF7A 5BRQA 3I3DA 4UOZA 1V6WA 4GO8A 3M07A 3WD4A 3G6MA 1AQ0A 1CXKA 1QNOA 2CETA 3BAIA 2X09A 3LPFA 1VFFA 4AD0A 2BY0A 3LPOA 4CCCA 2GSJA 4B3LA 3A23A 2W5FA 1HX0A 3BC9A 4FF5A 2BVYA 5A6JA 3AS1A 1H0GA 1XV8A 4HU0A 4DWSA 3VVGA 1E15A 5E9AA 1SMAA 3TP4A 4KWUA 4MJ4A 4FNUA 1FHLA 1HKKA 3FHAA 3W81A 2XTKA 3WY4A 4P7OA 3U7BA 1FH8A 1FP9A 3KZSA 4AZHA 3FAXA 4TX6A 3WQWA 2AMGA 3WNPA 3ARQA 1L8NA 4MADA 4S3JA 4AIUA 3VIIA 3WDQA 5IFPA 1UD5A 5CJ5A 5IXEA 3I3BA 2CHOA 2BHYA 4R5EA 1ITCA 2V5DA 2ZIDA 4NXKA 5BXRA 3SCOA 2WHKA 1FP8A 3A4WA 4GZJA 4M82A 3WQVA 4AZCA 1E0WA 1K9TA 1B3VA 1V3MA 4GZEA 4IISA 2ZUWA 1JZ6A 5E0CA 2YBTA 2FE0A 1US2A 5D8ZA 3OLIA 5IHSA 1U2YA 2F7QA 1SYTA 1BAGA 1QWUA 1OSEA 1MWOA 3T2QA 1ODZA 4ZXLA 1IZKA 2V38A 2WM0A 1JAKA 1J9YA 1V03A 2J7HA 3VGHA 5M3WA 4NSBA 4XUYA 1SZNA 1MFUA 3EBVA 5A6BA 2W62A 5EBAA 3L2LA 1LJYA 3QHMA 4LX4A 3T2PA 4P7RA 3VINA 4HZ7A 5E6YA 1KGXA 4CU8A 2FH8A 4H7VA 4DUVA 1LWHA 4UCFA 4HTYA 1D3CA 1E6RA 5IDIA 1XH1A 3VNZA 1CPUA 2WAGA 1KR1A 1Q6FA 4UQEA 3TTOA 2D0GA 2G3JA 2DH3A 5EFDA 4M29A 3K46A 4J3UA 2WB5A 4ZFMA 1JYWA 2Y8VA 2WKLA 3HG4A 5JBDA 1XCWA 4JFVA 1R8LA 1KCKA 3PZVA 1HL8A 1J0ZA 4U5KA 2XFYA 2WKGA 1H2JA 2WCSA 4EKJA 2D23A 5LYRA 3BUDA 3QR3A 4HPHA 2YFNA 3CHCA 2BHZA 1ISXA 2Y5EA 5E0FA 5CGMA 1JFHA 4W93A 4LPCA 3PZTA 3AZTA 1E4IA 1NP0A 1HKMA 1KBBA 3BVVA 4OKDA 2YL5A 3S5YA 2XWDA 2IGTA 4PMOA 2VRKA 4XX6A 3T0AA 1KXHA 2YA2A 2XN0A 1C93A 4HZ8A 3BUBA 2CEQA 1SR0A 4WLCA 1QNPA 3RMEA 2YFOA 1UH2A 5A94A 1QI5A 4W7VA 4Q22A 2PWFA 3AYRA 4BCEA 4ACYA 3KLKA 3NJ3A 3CUIA 1UR9A 4JHZA 1I75A 3SCWA 3VIGA 2WC7A 4U2ZA 1UD2A 1VIWA 4JKMA 1V3JA 4XZWA 4JHOA 4Z2HA 1QBAA 3O2LA 2J79A 1C8QA 4D6IA 3WEMA 2WSKA 3ARTA 4EAMA 2XFFA 2AAAA 1Q6CA 1B30A 3H54A 3DDFA 2EPNA 2F1BA 7CGTA 4N0RA 3BVTA 4U31A 1C7SA 1LG2A 1CXEA 2PWDA 3L4ZA 2WMIB 3GM8A 4OOUA 4AZ6A 1AMYA 3CZKA 3VNYA 5HOSA
chains in the Genus database with same CATH superfamily
3GW0A 4D6GA 1INEL 2HVJA 4MSSA 3CIXA 5T5FL 2QPUA 2MMXA 1PNDA 1X44A 3M0YA 4D9LL 3FBQA 5E6UB 2HXAA 4GXVH 3ZKNC 2IXQA 4Y8EA 3GINA 4K94L 3HE6D 4IS6A 4F3HA 3MRHB 1G9HA 1O5RA 4R33A 1M6OB 2Y0SA 4WY7H 1SLUA 3B40A 2YMTA 1R85A 2XDHA 3WIAA 2VZVA 3QHOA 3AG2B 2GDVA 3L5XL 4X5QA 5ESAB 4XD4A 2XUCA 3RX3A 3T7VA 3F83A 1CWYA 3BKJH 2KPWA 1LK3H 4G6JH 1W0VB 2GK1A 4C6DA 2INEA 3MODL 1NQ6A 1B4LA 1E9LA 1OWRM 5EF0A 12E8L 3H55A 3SDXF 2OSWA 2WXPA 3QGVA 3TWCH 2TSAA 5CEYA 1V6XA 2BNUA 3S1VA 1RP9A 3HB3D 5G5DA 1TETH 3UJSA 2P88A 3U9PL 4DP0X 3LQAH 1KPVB 5D7EA 2NLJB 3KBJA 1QO3B 1TFPA 2QCMA 3WF1A 2JXMA 2OFQA 2Q7YB 1MXGA 4ABQA 3EOBA 5BQ7B 1VJZA 2P47B 2VCCA 1A3HA 2RKXA 3TSBA 1U3HD 3CMJA 3CDGA 3NQAA 4XPHL 5F7DB 3ZUNC 3GRWA 3FX4A 3L7RA 1W54A 4GXWA 4FHBD 3GPSA 1FHNA 4GLRI 2DQCL 3LNMA 5H4ZA 5J6GA 4JNZA 2R9HD 1G4RA 4JDYA 1DBAH 1XISA 1XF2A 3HPXA 3FFDB 5L9DL 3HN3A 5GRVK 4ZFCA 4OIBA 1DXIA 5LCVA 4AYDC 3GTTA 1ZVHA 3ZE1F 1SXSA 4PIBA 4PRID 3UAEA 3Q01A 3D6NA 5D2YA 5M5DA 3K0YA 4XP1H 3OKKA 2FB2A 1DN0B 3W7HA 3HFYA 1Q9WA 1FNGB 3P3UA 5HNRA 3R5EA 1ML0A 3M8OL 5JW3H 4UC5A 1Y1DA 5ID0A 2PYFA 4AC4A 4XP6L 2UXTA 4LL1A 1AH1A 3AUOA 4XP4L 4PGBA 4NWUH 3P0XA 2V5CA 1BGAA 3D18B 2WANA 4F15B 1HHJB 3T6VA 3RPTA 4LHUB 4X9YA 4YK4B 1RQEA 4DGVH 4C65A 1XCQA 1MFEL 1TTCA 3NL6A 4XPBL 1P4UA 1GL4B 2CLPA 1U8MA 3V0HA 5EOTB 1XJBA 5J6HB 5D5MF 4KCUA 4Q8UA 3JWNC 1WB0A 2NT0A 4GYKA 2OR8A 3SSGA 2RGMA 3SEPA 5CEZL 2OZ4A 4OLXH 1Q94B 1XQ4A 4N2NA 3IGHX 2AABH 5FCUH 1KR0A 4JQVA 1TJXA 3BSMA 1J10A 2VSKB 2VUOA 3HZ3A 1HVQA 2NUPA 4ACPA 3NQFA 4QKXB 1BPLB 2EDMA 3M0MA 5TDNA 4MZ8A 5JQHC 4JHVA 1QNQA 4JTUA 5EMMA 1TDQA 4F2ME 1J1PL 1MLBB 3LD8B 5D93C 1L0QA 3LKNB 3EWCA 3VD0A 4JFPB 4MXWH 1JPKA 2ZUXA 2DQFB 3P61A 3W1MA 3EPOA 1RVFH 1G01A 4XZUA 9XIAA 5J5RA 3CVDA 1V6UA 2F5BL 1XYZA 3MXWH 4DVBA 1JS4A 4P2OB 2APXA 1GPOH 3GZ3A 1DQMH 3UZWA 5SWSB 4WHCA 2O92A 5A95A 2AEWA 4PU2A 3WMPA 4CMHB 5C07B 3GUTB 5I5RA 3S6DA 1VGKA 2ADGA 3ZXAC 3SY6A 1NBYA 2X44D 4QD2E 2H0EA 2X4TA 3UGVA 1OZMA 1IKOP 1R2RA 2G30A 1GOWA 4XHJD 2FBRA 4DK3A 1GH7A 1DN2A 4JB9L 2E3ZA 2NVDA 5DHDA 3DX9B 3EDJA 3T2NH 4FG6D 1U8OB 4QHMB 2VZ1A 2DV0A 4AK1A 5B8CC 4OFQA 4NP7A 2AV7B 2JIXA 3F58H 1NCBL 3RGTA 4OH2A 3IJ7A 4HG4J 1H7RA 5AZEH 2YN5A 1UB3A 1S8DB 4KCVA 2VURA 1UWEL 1Q6DA 1O6SB 1VACA 3IV8A 1HL9A 4RH4A 1MRQA 3SBRA 1A7NH 2XZCL 1ZT1B 4PJEF 4JO3L 3S5LA 2HT4C 4Y19B 4MX7A 4WHYG 4AL8L 4TRPH 5ECGA 2Q6WA 1G6RL 1OTTC 2VELA 1IX2A 4PJAA 5I1DA 2OZ8A 4ZUUA 4DJDA 2Z8RA 4XTDA 3WMLA 3VRIB 4LMQI 3G5ZB 4G1EA 2J4GA 1XXFC 2K70A 1YMMB 1NIBA 3B2PA 1R4XA 4RGOH 3EX2A 1UKTA 4PEEA 1WHOA 1P0KA 3VRJA 3OJDB 3VXSA 3MU3A 4NP4H 4U6YB 4A8LA 3TFKC 1GYUA 2XV2A 4PRAB 5AW5B 4H40A 3LB0A 2IKGA 2H47C 2G5RA 2ZOWA 4TQTA 2A5UA 3QW4B 4ZFFB 1W9UA 2ADFL 3IETB 4G7EB 4JDEB 3EJRA 4ZAKB 5F4XA 1MFAL 1AIFA 1KCVH 4YQXL 4N7QA 4WW2F 4X5WA 2UX6A 1FWEC 2G3XA 3GKWH 4O2EA 3RWDB 5D72H 1AQKL 4RQQB 6XIAA 1FNFA 4O57A 5IEKB 1GKEA 4MCZA 4LYRA 4DNHA 3AM8A 4HAKA 3ZHNA 3HAEH 3Q6FA 2IXVA 4QTFA 3X12A 2Z2BA 3UP8A 3SYQA 3WKQA 1DUZB 3PPCA 1NQKA 1KN4L 1HSBA 5DHVH 1U3YA 4UV4H 3LZNA 2XPYA 4DYKA 4GMSL 1FV1B 1IKNA 4YNYA 5T1LB 4EJ1C 1MFBL 3S4SA 2IPUG 2XZ7A 2H9GB 5DJDB 4WGKA 5KVMC 4AG4L 3UYIA 1SFHA 2O7SA 5HJ3A 4ZSUA 1G43A 4IBTA 5MEOB 3PAOA 4I7WA 1L9SA 1U8IA 2DLFH 4TSCL 1B0GB 5GS0D 1IIHA 1W3NA 1Z5LA 4GSRA 2PCPB 1RP8A 2WKOA 4JFTA 3GZOA 3WXVH 1PFCA 1EEZA 4KO9A 1FAIL 1FFNB 4P57A 2VMCA 1QFOA 4GY1A 3OTRA 4CCEA 5LIYX 2OCCB 3Q7JA 4BYHA 3LB6C 4EO5A 4V1DE 4OD2A 4HKJA 2UY7B 3C60A 5DD6A 1EEUA 1A47A 4XCEA 5ENWA 2DQXA 4KY1H 4AVOA 3HUJE 3EOSA 3W7CA 3E2RA 4YO0B 1L6PA 1MNNA 3M41A 1XL6A 4QYAA 5HATA 3LKOA 1CXFA 4UM8B 1NF7A 4J3XA 1KB9K 1R0AL 3KYOA 3QRGH 3CDZA 5MEPA 4OV4A 4FFVC 4R4FL 2UWEE 2VDGA 1HVXA 2RH0A 1NGPL 3ZDZF 2PLTA 3TZFA 2F74A 3SGGA 2HT3C 4KK9D 2C26A 1Q9LA 3VOCA 1T40A 1F07A 2DZSA 3IS1X 4UTBA 1PUDA 2MHAB 3UTSB 4GRWE 3HS0C 2VP8A 4K68A 2JKJA 2LGNA 3IMSA 4Q8BA 1A66A 4WY0F 4TTUA 3C2FA 4HGWA 4ZOBA 5I1JH 1ZAHA 1I0BA 3N2JA 3CZNA 3LNGA 5EEXA 1S38A 4GKZA 1XR9A 4F8LA 3BP4A 3MGTA 5K39B 3T3MF 4NRXA 1HHKA 2A9CA 3BPWA 1D9EA 1KB5H 2V9RA 4AIZA 2MPVA 1E65A 5DWUH 4N0UA 4HFUL 2P5ED 3EJQA 1AD0A 1THFD 3F7VA 4MMZB 1LO2H 4WF7A 3K2MC 3NCXA 4MWAD 2NY4C 4I87A 1R19A 1JK9A 3HGOA 3TW6A 5C9ZA 5GGRA 1P5UC 5KVFL 1ND0B 2QEZA 3AICA 5J3HC 1XBZA 1WT5C 1NIFA 3DEQA 4R27A 3V4BA 5IG7A 4RCXA 2HSAA 4KROD 3H2FA 1NFBA 1S39A 3I7SA 2CBTA 3W9EA 5ETUA 3MMTA 4UQ9A 3WG7B 1ROCA 4DP1X 3V0UA 1BQLH 3ZS4A 5F2MA 2HS6A 2VD8A 2YMXL 1EYEA 2VW4A 4S3DA 5EU3A 3HM7A 4AZ7A 2Q20A 1ZCOA 5BZAA 4OLZH 4Z2LA 4HNUA 1K02A 3BE1L 2ED8A 2DI7A 3KYNA 2GJ6A 2MKLC 3DX1A 3D85A 3HE6C 3HAEA 2C3VB 4IJ3B 2DEPA 4J3ZA 5I3FA 3STEA 2YGOA 2KZ1B 4NYLB 4HJUA 4MLSA 1FH2A 4YHML 1LP9A 1W9VA 1JRHI 3TBWA 3N2BA 5G55A 4KNQA 2LU3A 4AMXA 4W5UA 3AXXA 4NHUB 1M56B 4XISA 4X4YB 3DX5A 3TEXA 5CPLA 3C6EA 4PRNA 5DZPA 3VD7A 3KPQA 5F4WA 2QULA 5CPMA 3UESA 4BGLA 3ZL1A 4FABH 3TAOA 1VYRA 1JHKH 4J3OC 4M4RB 3QXDA 2HKHL 2O6CA 3M0XA 2HH0H 1NARA 4BZ2L 3MRGB 4CN4A 2FDMA 3LXUX 3IDGB 3WIJA 4A4AA 2O5NA 3HB3C 3TO4D 4E36A 4F57L 3F65A 4AQZA 1LEIA 3QI9A 4OZHA 2W0KA 2VVSA 2NW2B 5DLMH 4E8GA 2CPUA 1U3HC 4ZO7A 5D8JL 4GG6A 2WMHA 1J2BA 1YECH 3NN8B 3VJ6A 3SE3C 4FXKB 3V35A 1U92B 1DBMH 3MCLL 1C8PA 1AJZA 2R9HC 1OT1A 2YXMA 4C4KT 2K6WA 4X9IA 4H04A 3PP3H 1OD8A 4YHKH 3CUXA 4DF2A 3RJYA 1ZTXE 2PDWA 1S1PA 4YFLF 3P0VL 1L5GA 2X4UA 3BO8A 1F1AA 2FMNA 3LCXA 1X6NA 3PDDA 3VM7A 5L7XH 4DLFA 4HCLA 3RWJB 2QGBA 3X3FH 4BFGA 3TNNA 4X50A 1IVLA 4RR4A 1HG3A 3BH8A 1U8NB 1AC0A 4AAJA 7PTDA 4MB5A 3ZTCC 1SSDA 2ZONA 3FB5B 4KJQD 1OGTB 2C1OB 3O8XD 3CC5A 4B2DA 3V1HA 4LLVA 1K8ZA 2C13A 3SDAB 4X5RA 1P9MA 3F7LA 1KB5A 2OXGA 2EE0A 4KTDL 4O18A 4LOEA 1XGRA 3KCPA 3EUUA 4L8CB 3AB0C 1DEEA 1WXZA 3G5VA 4H7CA 1F3JA 3FU8A 3OMAB 4F9PA 1B3IA 1E9OB 1O7DC 4AYID 2ZOXA 6ALDA 5HVFB 3UYRL 3P9MA 1I9RH 3AS2A 2LU5A 2BOBB 4K9EH 3V52H 5CAYB 4IQEA 3W22A 4YEEA 1Q6LA 2A79A 4YLQT 1SXNA 3VSUA 3BW9A 5EC1A 3L4CA 1J86A 3U4BH 4W87A 1MZYA 1I8IA 2NY6B 1ZGLP 1X5MA 3QXAB 1UXLA 1T7XA 1ZHAA 1MAJA 1YN7A 4GH1A 2A38A 1F00I 1FL6B 4I0PB 4ESKA 3WLHA 3B2DC 2GSIB 1ULVA 1M1XB 3D0LB 3SCMA 4BQCA 1M03A 3G08A 2YK1L 1EDGA 4L4TA 3MFFA 5LNVA 3A12A 2EXTA 4L4OA 3PGCB 4PSPA 3TIDB 2XSBA 1S7UB 1RMFH 4ZMQA 3QUZD 3CFBA 4A6YB 4P4RA 4ALDA 1HXJA 5FJRA 4LHUG 1W16A 3MO1B 4P7QA 1KIRB 1PSCA 5JYLA 5DD5L 4B5WA 4PJCB 1VHPA 3UR2A 4PD4K 1S78D 1DDHB 4ZUVA 4O2FB 4JFFE 2VX7A 1ZHLB 4JPWH 4XHJC 4IOSA 3UPBA 1TPXC 5KZDA 3M6DA 1KJMA 3KXFB 4BINA 5FGBA 3U7WL 4FG6C 5FKYA 2WO3B 4R7JA 3QPZA 5LO7A 3TMLA 1IT9H 1VPOL 4KRLB 2HJFB 3V8OA 1DYSA 1BD2B 1QR7A 3AABA 2DYPD 4HSHA 2TRSA 4JFQB 3P67A 1CFVL 3VQMA 4OUEA 3TA9A 2WWMC 4PJIB 5ESQB 1RQHA 2VFEA 5F0PB 3GMNA 3BPLC 4U0RB 4PVMA 3CX5K 1QI4A 4AYGA 1UPMB 2EACA 2CNZA 5G1TA 2EE9A 2CW6A 3I6GB 4JY6A 1E0TA 1XAUA 3ES7A 4XRCB 3NJIA 2MWCA 2PS2A 3RWFB 1KLZA 2UZYB 4D8AA 4IZGA 1K7EA 5J13C 1FLRL 3BZEB 3PBYA 2PZNA 3BAIA 4HSAC 3LPFA 2BY0A 3R10A 3QJAA 4Y1AB 2H32B 4JNXA 3HRZB 2YXVA 4K1GA 3D0VB 1EPFA 3VVGA 5IBLD 4MHHG 1FNAA 2BX7A 1BBJB 2J8UB 4HJIA 3JU2A 4JAMB 2E09A 1VJIA 2H6OA 2P8BA 1T5XB 4XPAL 3BZJA 3S5SA 4NJIA 4R5EA 2X10A 3S42A 3IB4A 3PS7A 3ABKB 2HT2D 2WHKA 2ETWA 1B3VA 1PS9A 2VDKB 1KC7A 1E4XI 1N5AB 4MKSA 1KDJA 2VQ1B 2Y5TA 1EUTA 1BAGA 4E42B 4JJ5A 1OSEA 1OLLA 2YPIA 1UC6A 4NSBA 1VGAA 3AADB 5G2WA 3G5XA 4G83A 1PZCA 4A7GF 3QHMA 4LX4A 2EKSA 4ZFZA 3KHQA 1G7VA 1BFVH 4WV1B 1KACB 4HZ7A 4A8IA 2WXJA 3H2PA 3NZ8B 1QVOB 4PJGB 1OKEA 5FSDC 4ZQRA 3ROOB 2H1LM 4F27A 1FY6A 4JUTA 3SDCD 5CJBA 2XH4A 2ORBL 2D0GA 2XBZA 4O19A 4JS3A 3EYSL 2DL9A 2XWTA 3ZRCC 3SRFA 4OLWL 1E5CA 2O5XL 4QTIH 3ARFB 2DICA 2I5YL 2WCSA 3IPFA 2VXUL 1UMYA 3DXAA 1X96A 5SX5H 5AFDA 2W07A 3SKNA 3KS0J 1BZ9B 5C0FA 4HJWA 4PJGE 3PZTA 3AZTA 3BDYL 2Y1ZA 2XIQA 4OKDA 3RA7L 5G1MA 1EGMA 1UXWA 3QG6A 3IARA 3T0AA 5XIAA 3DHMA 4URTB 2OXHB 1OM9A 2PR4H 1KM5A 2PC4A 1MZZA 2PWFA 4XD5A 4ACYA 5GS0C 4HUXB 3MDUA 1VIWA 3QHTC 5E8EA 3TR2A 4XZWA 4Z2HA 3TYEA 4NGHH 1X9UA 5DZLA 4EAMA 1SO6A 5KAQG 3WJXA 2V2TA 4G71B 2HRHA 3BVTA 4ZPVA 3CPRA 5BW7A 1Z9OA 1PZAA 2VIRA 1CTMA 2IF7A 4C90A 3RWCA 4K5NA 3WKMH 3F01A 3VXMB 5ILTL 4R0LC 1KC5L 2BY1A 5HPCA 1U58B 3QULA 4LEXH 4TOYL 3NIFF 3GSOB 3MLYH 2A9BA 5IB1A 1IM9D 4JUSA 1OAXH 1S2CA 3GO1L 2VLKB 1FIEA 3ULUF 9PCYA 4RZBA 3VILA 3DAQA 4PL2A 2Y2YA 4URKA 3L5LA 3R19A 2IXUA 5TF0A 3VXME 2VERA 4PY7B 1U93B 2QQKL 1SJHB 2ALWA 4IHBA 4KK9C 4C1NA 3VKKA 1GUVA 2Y2TA 4IBUA 4ONVA 4FYTA 4RISH 4ADUA 2ITDB 2EIJB 3OC5A 3QORA 3LA4A 4P9ML 4PMJA 2P8LB 2OJZL 2YKKA 2VISA 1MWAL 1VCVA 4Q7DA 2ZZ2A 3DDMA 5HDQL 1JF1A 2QVTA 4JCMA 2D7PA 5DVOA 4F33A 3CFTA 4J2MA 1P43A 3UYPB 4GBUA 1JK8A 3PAYA 3BUPA 4ZD3H 1HCFX 3ZT5A 5JXEA 5CWSB 3MV7E 3IRDA 3VXUE 3BN3B 3U30C 3WIFB 4QRQA 5SWZA 4DW2H 1QA9B 4JIQA 1JRCA 4MWAC 1A5LC 4U7SA 2J75A 3FUHA 5CBAA 5LAXB 2G5UA 3RDTA 1X38A 2OPJA 4X0NA 4FLHA 3F12B 1XR8A 3EBIA 3EA1A 5BXPA 5IR1A 1CURA 1OZQA 3LZQA 2XG4A 5KUMA 4KROC 5HR7A 2B2XL 4FZ8L 4FPSA 2IQ9H 4PJ5A 2BDQA 3L54A 2PW1B 3P9WB 2OO0A 3O2DL 3VWJA 3DURB 4WO4A 2WWDA 1YPFA 3MGOA 4LAQH 1EO5A 2BX5A 3BX7C 2F6KA 4OVUA 2J12B 5E1AA 2O5ZL 3EJCA 1PS3A 1V8EA 2IDQA 4GRWH 5L4JA 4GLEA 2OX5A 4WKHA 3HR5B 4EZKA 1TFHA 3CJJA 2QVKA 3OVGA 1TTGA 2X2YA 3N85L 1W1A1 4PMNA 3W26A 3QKEA 1F73A 2E6PA 5FK9B 1A6WH 4S39A 5JHDD 3NZRA 1I9IL 1W3IA 4QMEA 4QRSA 4US5A 2WVSA 5IMOA 5JNYB 5DRCA 3UXIA 3OKEB 3ROLB 3ISRA 1HE8A 4P23B 5ICXB 1AZBA 2I7SA 1QRQA 4DP5X 3MVIA 2WTOA 1H5BC 5IB5A 3ZLFA 3GMQA 3QUMH 1R46A 4N2EA 2UYLA 2AEQL 3SFKA 4S0SD 2GJRA 4N2BA 4DI8A 4HUKB 1YKWA 2WZPD 3GQYA 1E9IA 4WWOA 1T6BX 4JCLA 3DKHA 4H25A 4GUCA 1EGVA 3NPZB 1MRDL 3GK8H 3TO4C 1E6SM 3CQFA 1ZL1A 3AXLB 4GVIA 4LCRA 3O6LL 4J3TA 5FGSA 1W37A 3FMGH 3WMCA 1EQCA 1P4BH 1W72H 4PJAF 4GLRH 3MLRH 2OI9B 2E86A 4LEOB 2YWZA 4LCCC 3SQOH 2GGEA 4GRLD 1WAAA 3MJWA 4Z18A 3UG8A 1IXOA 2G9HA 3PQYA 4JY8A 2RJGA 5I5JA 3QJQB 1TZIA 3S48A 3VNMA 4H13C 5I00A 4OLUL 2WIIB 4ZW5A 2FGWL 4QM1A 2CNCA 4TL5A 1XH2A 3WCZA 3LKSB 4RIRA 2F1AA 2W92A 4YYCA 3T0EA 2GQ9A 1JCMP 3OXRA 2V3FA 4PRBA 1X5JA 2MTAA 3R79A 1B4JL 3GTIA 1YC7A 2PXYB 3PJSA 5EKYA 3LQGA 1PY4A 3BDKA 1IGCL 1BEXA 4JVWA 5EOQL 3P5ZA 3G9VA 1OFAA 4IX0A 7PCYA 1CZ8L 2EEAA 4YHOH 3U6WA 1JZ4A 5GVJA 4N26A 2VDOB 1TQBC 3A4AA 3MUZ1 1TQSA 2QVNA 3SYAA 3B8YA 3QEQD 2E28A 2JQAA 4KJQC 4KRPC 5IB2A 3O8XC 2D20A 1PIFA 1YPXA 4O1EA 3W2DL 3IIPA 5KG9B 3BD4A 2FJGA 4AWJC 3BZ4A 3ZZ1A 1DJGA 4RAUA 3D05A 3MUAA 1E70M 4HJSA 5I8EA 4RA0C 1LDSA 4IPJA 3ZTJG 3WFHB 3CB8A 1LF1A 4M1BA 4MB1A 1OX6A 2FMOA 4ZFOB 3O9WA 2L0DA 4GEJA 2YXWA 3EIFA 4D94A 1AD9A 4E9QA 3T6CA 3ZVHA 3KW8A 5JPMB 2P0OA 3HI5L 2B7NA 3P60A 1YEHH 3VGEA 3FB6A 4U4MA 4O0ZA 2UZXA 2C7UB 1I0DA 3WH8A 5DBUA 1F56A 5CLWA 1KJ3L 4WDIA 3MRCA 2DAVA 5G4MA 3WO3B 3V0WH 4Y1SA 5EY5A 1ZTXH 2MNJB 4YLWA 3KPLB 3ONBA 2ESVB 3PV6A 2CBOA 3P4OB 4N6QA 4LVGA 4YDNA 1A1MA 4ES9A 4Q9BA 2QQNL 4MNQB 1ZTVA 2D9CA 1LBFA 2GOUA 3O6ML 3QUZC 1EFQA 5GJTH 2EDHA 3P8IA 3OKLB 4LEFA 4HOMA 2WN3A 5C0BD 3F6JA 4OBTA 3O81A 1S78C 1QASA 3P4LA 4LV4A 3C0SA 2G4JA 3EOYG 3SBFA 1QOQA 3GIVA 4XGZB 3O3UN 4ADIA 4YBQD 5I73B 4KX7A 3QUMA 4X7EC 1B6UA 5BMFH 3A9BA 4O02H 5T1DL 1PVHA 2W88A 4W70A 4KXCA 1XGUB 4TVSa 2RQ8A 5AHNA 4UFIA 1SJMA 4PRHD 5E0QA 4E9RA 1AMKA 5I0DA 4ORIA 4PJFE 1VRSA 4P9HH 5ERWB 1SJDA 4N2IA 2HBXA 2FHFA 3S98A 3LN9A 1UUQA 3HPZA 3TWBA 2HFGH 4DZIA 1W72A 1KSRA 3IXAA 4X7TB 3TESA 3UCQA 4OBSA 3EWBX 4LGRB 3LBOA 3H7BA 2ABBA 2P3YA 2A6IA 5ADPH 4OY9A 1QSEE 2X88A 2QR6A 1TCMA 4YIQB 1ORQA 5IF0A 3SPIA 2CCWA 1HGWA 4V2XA 3GFXA 2B9BA 3NMEA 3MMWA 4ZI8A 1FOBA 4F8XA 4MM1A 3TFKD 1NBQA 3VG0L 4D9PA 4PLNC 2JKSA 4NNCA 3AIVA 3OPZH 3GQFA 5DS2A 5ITFA 3BLLA 2HYMA 1QQDA 3OV6A 1QABA 3F7KA 5IBLC 1QFWL 3WF0A 1GW1A 2MCPL 3L3IA 3FF8A 2OWXA 1OGAB 3N1PC 5E8PA 2H3DA 3QCTH 1TZGL 4H41A 4OF6A 4Z2GA 4TUJA 1ENUA 1JGLL 2LVEA 1WWWX 3QFGA 1A4LA 5DXYA 1O5PA 4ONGL 2UY5A 4RMWA 3RX4A 4QCIB 3QO0B 1DWAM 2GY5A 3E2VA 5IFHH 1AXTH 3MUCA 3BWZA 3SRHA 4YSPA 1MDLA 4MB3A 3KPPA 2NX5D 4LF3A 2C1PB 4XC3L 4QPEA 4XHQA 3VFPB 4Y5XB 1F4YH 4HNCA 3SDCC 2H45A 2F8IA 3L45A 5J5EA 4JDVB 2UBPC 2A73A 1G1YA 5BVPH 4QAWA 2W0PA 4CDHA 4HSCX 4UFMA 2FQIA 2FSEA 1B9ZA 1RY7B 5GPRA 3TU6A 4PWGA 2VITB 2UY6B 4JLRB 3AS0A 3C6LB 2YRLA 3QJUB 3G1FA 3AIRA 1TLKA 4BFIA 2WSYA 5DD3L 1JQVA 3QDAA 3G2GA 1Z5HA 3FB7A 1BXVA 4ORGA 1DVUA 3CK5A 2BNQD 4JFSA 5FLUA 3MT1A 2JKIS 5CN3A 5BRZA 1DBJH 2GYSA 1YO4A 4PN2A 5FYKH 4PV1C 4TLKA 3L4UA 2YD0A 4JPQA 3ULVL 1DBTA 1DO6A 4ZXBB 5ICZA 1A49A 1RV6X 4A29A 4B16A 3RL1B 2NY2D 2D03H 1PLAA 1ZPLA 2APVA 4AQEB 1M7IA 2E7MA 2Q8AL 1YUHB 4Q8PA 1HQRB 4JRYB 4GG6F 3TYFB 1YJDH 5IIEB 1IBHA 4OZ4A 3FEQA 1L9PA 3U9WA 3ZXWA 1RUQH 3I6EA 1WFNA 3IFPB 4UB0H 3RNDA 3QNZA 3MRNB 1BFOB 1HH6A 2OZNA 4RWYL 1X1OA 2QYGA 3AUJA 3NPWA 4ODTL 3CZUB 3LIZH 1EWEA 1KRMA 4I9JA 1KD0A 1FJ1A 4EVNA 2ISVA 3PP3K 3N1FC 2FEJA 2WW8A 3APYA 4B92A 1MXDA 1BWKA 4N24A 4WUIA 2QDGA 2HFEA 4QXUL 3HTWA 1F4XL 4OU1A 4DWSC 3BH4A 1FGVL 5KYYB 1E6ZA 3L3KA 4AKQA 2JKXA 3QR2A 1E9QB 2H3BA 3IDNB 2A9AA 1GC1H 3CYVA 4LLUA 4QXVA 4S3AA 3V7AG 3LEYL 3FJNA 4I13B 4Y89A 3SJ3A 4QLWA 3KJ4B 5M1TA 2DD8H 2OTDA 1K3ZA 2NY3B 2OMTB 5HJGA 5IHUH 3KS0H 3GB7A 1NFGA 4OLVL 2X4PB 5CCZA 4XN1A 1GGTA 4XVJL 4F0HA 2G3MA 4KKZA 1QT1A 2P3EA 2ICEA 2ATAA 5I2IA 3RVVD 3D0CA 5C2CA 2PRLA 3WJSA 1X5HA 1RZKC 4I2XB 1FIGH 2O1AA 1AQMA 4N2GA 1GHRA 3EH1A 1G9NH 5GSVA 4NZ3A 3T0BA 1JXGA 3VPLA 2IANB 3FO9B 3QRHA 2Y5JA 4AZCB 5T1MB 2EVFA 2YO3A 1RIVL 4DAGL 3NSXA 5C3LD 3KEDA 3STLB 3D4GA 3MJ7B 2B1HL 1ADQL 4YJ5A 1J9TA 3VIMA 3P4NA 1SDDB 2BP3A 5CSYA 1ZP3A 1WTGT 2B77A 1MIMH 5GJPA 5B7FA 4B9FA 3UTTA 5L8KB 3MYJB 3WUBA 2IANE 2QHRL 3RRXA 3L95B 1EWDA 4QKTA 1PYWA 3KDPB 1JRHH 3BGMA 3QDMB 1UM6H 5LXXA 4Y9GA 2IMMA 1G6CA 1GYVA 3W3BA 5SX4H 3BGJA 2H41A 4JFXB 4B6ZA 3V36A 2OMWB 3AMLA 1AHWC 3CB3A 3KWWB 3TN0A 4Z1BA 2CYGA 4J3OD 3OIHA 4MQSB 1CO1A 4GBXD 1WBYA 3FQUA 2NSQA 3GJFA 2ESCA 2I07B 4HA0A 4HJGA 4HS8H 1UWXK 4NQXA 4QEHA 1T22A 3KDNA 1TV7A 2DDQH 4E38A 1IEVA 3TEZA 1JZ3A 5AVTB 2XM1A 2OZ3A 4GW4A 2R2BA 2WBWB 2O6EA 3NA9H 1WDDA 3GNRA 3BCJA 4PBEA 1XC6A 4U1JA 3TW7A 4JFDB 3K71B 4RV3A 5ACMA 3VSVA 3H2OA 3NFPB 1TJHH 2YBRB 3N0AA 4R97B 2XPKA 3NZHH 1IGFH 4U1SB 2J88H 3QQDA 4ZMAT 5K4XA 1VQTA 1MDTA 4RDBA 4FS0A 3VXOA 2PRMA 2E9JA 1BHGA 4ELDA 1L6FA 4MQ7B 4GRLC 4NQQA 1XBXA 2IV9A 4J3WA 1BP3B 3KDMB 1KFEA 3N06B 1QW7A 4JFDE 3V4VL 3TCSA 5DFTA 4W9IC 4R84A 2VC2H 4I18B 5EBWB 2F0CA 4GIPD 3APDA 4IL0A 1U95A 5A40E 3JUYA 3SGZA 1T7LA 3BUVA 2YGQA 5DTFB 2I32A 2Z7GA 3TTYA 4JTQA 4AD3A 4MCYB 3HHRB 1X7SA 1DL3A 3HGRA 3B3IA 3C5ZA 3TUUA 3UMTA 4W9TA 4FQJL 1UM5L 2PF8A 4AZUA 2X4NB 1K77A 4UTWA 3REVB 1BAFL 3CFJA 4AGQA 4KTGA 1TV2A 4MXVF 1KIQB 3M44A 3TPUA 2ENPA 1C9WA 1A3LL 3O6FA 2WINA 3FO2B 4GK8A 2RR3A 4E4UA 3WF4A 1XF5A 2DZEA 1JUFB 4H6KA 2F8OA 4NBYB 1GIGL 3MBEA 3TH6A 3GMMB 1GZPA 1CD1A 3LXAA 4APQB 3PM6A 3CFCH 1OP5H 2XV0A 1PZDA 2OGYA 4OIFA 2P50A 2BSSA 1KXQA 2CRYA 3T3PF 2CSPA 2A6JB 2HLAA 1F45A 4Z7OF 4GQ0A 3LCYA 2QSTA 4MMWA 3DX6B 1XKJA 4OZFH 2BSDA 1Q72L 2EIBA 3STGA 4ZB5A 5ABTA 4X0KB 1EHLL 4B50A 4HG4K 4NEHB 3OHMB 5SX5K 3KPOA 4CMMA 4WQOA 3MACH 3GSVA 2X09A 3RZCD 3GIZL 4DKAA 2OO6A 3KRUA 3IWPA 2VLMD 4CBPA 1C9DA 4FNUA 1KEGH 4L48A 5TE7L 1PW3A 4WI7A 5IVXA 4S3JA 3R8QA 1VCBC 1PQZB 3KCWA 1D5XA 5CLYA 4BFJA 4N2LA 1KUMA 3ML9A 5E8OB 2ZUWA 2BOCA 4FQXA 2FFIA 2KLSA 3V4UH 1ODZA 4LT7A 2QSCH 3UWEA 4HZMA 1F05A 4YGVB 1HI6B 1ZEAH 1RULH 3ZE2F 5LZLA 2X41A 4Q6YA 3T6WA 1JV5B 2Y22A 1BEUA 4HNVA 2AXGA 5EO1B 2CXKA 3GS7A 2EYTB 5SWSE 3L21A 4F7CA 1K8IB 5C6WH 4R9HA 1X5LA 1Q6FA 5C07E 1X9LA 1OE1A 4DYJA 4PJ9B 5D05A 2WKLA 25C8L 3DKLA 3QPKA 4DB7A 4Y4KA 4P48A 3FKKA 2WWMD 4YBQC 3QQ0A 4HCRH 1WOBA 1TITA 4LUYA 1JNLL 3P4MB 4YGAB 1JFHA 1S3TC 4FYRA 3WTYA 2DZUA 1JHTB 2VDQB 1Q8MA 1KBVA 7ENLA 3QIUA 4NO0A 4L3EB 4BFFA 1HKLH 1D5MA 3ZVIA 4R6UA 1CBVL 2YKLH 2YSSA 2J88A 4W7VA 5L6YH 5FFGA 1YG9A 3AYRA 3V9CA 3FQXA 3MX0A 4WDXA 1GGIL 4A3RA 3ARTA 4YWSA 1U91A 2VABB 4Y19E 4KMTH 3M7FB 1ZK5A 1KULA 4OOUA 1NQBA 4XZNX 4WHYH 3C5XA 1FH5H 1Z7JA 1PWMA 3N11A 4HIQA 1YTKA 1GW9A 3OB0H 3F4NA 4C47A 3PDOA 5C0EB 5E8NA 1NMCC 4IJCA 3RVXC 1YMME 4U7MA 3PNWA 3MRRA 3UNDA 3VFWA 4LNCA 4D9QD 2YEVB 4NLAA 3KAOA 5D71H 4AM0B 1QJWA 1J9QA 1MCOH 4GUPB 2GJLA 1ZLWK 3ZRSA 5GGVH 3MUUA 2D2JA 2WSDA 1DCLA 1HJSA 1GOKA 1GRWA 1JXJA 4KXAA 3EGXA 5T3XD 3SE9H 5HA7A 1W56A 3TO2A 1R0MA 3F7YA 1D9KA 3UBPC 2WGNB 3VKDA 2WQVA 2QKIC 3QUKA 3M5VA 4G8IB 5D8WA 4MA7L 4XN8A 1F7BA 2YAPA 4P46C 1UHVA 1ETJA 1G4SA 2K6ZA 3QEGL 5L4MA 4Q8TA 4DBUA 1U36A 4F20A 1DJZA 1ZGLM 4W9DC 3DO3A 5K9OA 2XJKA 4OZFA 2PWHA 1LEGA 3F05A 1E2WA 4NT6A 3E2SA 4X99B 1FWCC 1XDLA 2GYIA 2Y63A 3VGAB 2HNEA 1DUYA 2DBJA 3V16A 2FKPA 5I6XC 3CUGA 4DBSA 3PTQA 5GGTH 2YCLA 5FM5O 4R7WA 5EORH 3WLOA 4M24A 3ZLGA 3IMUA 5C6MA 1KKOA 1QHQA 1COBA 1GGYA 4F9JA 3WL9A 3AG4B 3ABSA 2G5BB 2DQ6A 4X4XB 1MSSA 2R7EB 3HJ0A 2W94A 1HDMA 5IW3A 1DJWA 1WVZA 3SKUD 5I17B 1S4IA 4YFDB 5DJXB 3SO3C 4ZUSA 5A8PA 3VCNA 2DMKA 1ETB1 2M8XA 2ISSA 1UWYA 4MDJB 2NY2C 5FEZA 5I0YA 2IQAA 4M61B 2L7EA 3ARVA 2H0PA 2JTYA 4GAFB 5HGBB 3IU4L 5D7IF 1WAAF 3BQUC 1DQUA 3LSCA 2Y5QA 2H3KA 2Z31A 2NXZB 4OFCA 1WIOA 1C16B 2K78A 1RPKA 5EU6D 6PCYA 1YHTA 2ZWZA 2OKOA 4P61A 3W11D 4NKQB 5C0CD 3LVEA 3ZR4A 1QSZA 1P6BA 3WO4B 4FEZA 4DZ8A 1SVZA 5I15L 1YDVA 1AGCB 43C9A 3W9DB 5DQDH 5GJSL 4Q56A 1YYMH 1T41A 1XGDA 3WHE1 5DCEA 1FLTX 3H7RA 4HJTA 4F0LA 1X5AA 1IEXA 3O4LB 3OF6D 5AYBA 4Q9QH 2VZOA 4HXBH 5CAHA 3VKAA 1E9YB 1NFDF 1BDYA 3F2CA 3S8FB 1XZWA 4WNSA 2VC9A 3LTYA 1ETZB 2ZX9A 3QCUH 1XLBA 4OZIA 1IIKA 3UTSE 3UD6A 4RAVB 3S3GA 4DQAA 1YEEH 3P11L 2CBPA 1RJLB 1HL2A 3QR0A 5I1KH 4IIFA 4LASH 3M0ZA 4Z7IA 3MC0A 1I7ZA 4L18A 4M62L 1DQLH 4JN2A 4PS3A 3HNTH 4C4BA 3NAAL 4ZYKA 4KWOA 4BSWA 3BZFA 1VHCA 5HP5A 1N68A 3F4DA 5DRWB 4XNXH 3RVVC 4MUZA 2F5AL 4JRXB 3DVNA 3EZ4A 3GMPA 1JAEA 1AKJD 3LHWA 1ZJAA 3N5AA 1RFDH 3IM1A 2YUZA 4ZTOL 1GQJA 5I82A 4YHPB 1KV5A 4HNTA 3RU8X 3LN3A 1UQSA 1AZUA 5CR1A 4E6MA 2ZCKL 4U33A 1WZLA 5FXCH 3AMKA 4Q4SA 4HC1H 2VZUA 5EPDA 1XBDA 5JPNC 1I2NA 3AHXA 3EMCA 2IGFH 2C1HA 3T55A 3WQ6A 4P5KB 3L3HB 4DP6X 3RY5A 1EUNA 3VMOA 5D1XA 3O7UA 4QG8A 4LS1A 2XXCB 5D1ZD 4F37K 3L5WA 3WU1A 1M04A 5EMUA 3FLUA 4DKFH 1W1ZA 3I75A 3ARBD 1BXCA 4JTAA 5FKPA 1VBUA 1OAUL 2EDEA 2J13A 2OEKA 3IJYB 5DHVA 4ELMB 4Z2IA 1QUPA 4LBEA 3NIGF 3A22A 1YDYA 5KBKA 2J1YA 4ACTA 5HMDA 4WU5A 3TNMA 3FOLA 1MFDL 4AGMA 4NCC1 3X14B 4G1KA 1PAMA 2A9MH 5DMKB 5F1SA 4ZZ9A 3A5FA 3U6RA 4BH7B 3ZTNH 3L68A 4GBXC 2A83A 2DJUA 3UFIA 2V2WA 2PI6A 4WI2A 5GGTA 1KGCD 1FN4B 4ZMWA 5LDSA 4NO3A 3CZGA 5IEHB 3UZEA 1AFSA 3SN0A 2EABA 1IC4L 2AL2A 1BKHA 2C9VA 2DIKA 4FQ2H 1J1XH 2HWGA 4K8HA 5MEQB 2X16A 1RZJC 4YZFE 1XQKA 15C8L 3NSYA 3T4AA 3V6BR 5DT1H 1PKLA 1NOWA 5GHWL 3MXVL 2V2XA 3DLQR 4WNQB 4GCXA 2QUMA 1PBGA 4AJYV 4PJ8B 3SD2A 2I5GA 4Y5VC 5HYQB 2UY3A 4NPYA 1A7PL 5IHZA 1MHCB 3GMLB 2J5WA 1WSST 4DEUA 2QUUA 2Z0UA 4Z7QF 3P62A 1HHGB 2EDOA 4XX1G 4MMXC 4CBZA 3S36L 2CXEA 4GOAA 2O6DA 3PDGA 3V0VA 4TNWK 5JHBA 4P7LA 3PP4H 3GH4A 1EDQA 4OCXH 3RDJA 2XWJA 4HT1H 1EHAA 1BYCA 1QNIA 4AVIA 3W86A 4KRPD 5KJ7E 5IWLA 5ITBH 4RE0A 5IMMA 3BOLA 2PC8A 3OLGA 3IJSB 3KPRD 1IGWA 1E72M 3QG7H 1W1VA 4MNMA 4FAMA 2FVLA 1WBZA 2VOTA 1DWJM 4YX2L 4H6RA 1JDAA 1TVPA 5C9JB 1PX8A 3B04A 4R88A 4QP0A 3WSQH 1DLFL 2EVJA 4ACZA 2YR1A 1CDHA 3UXDA 5HANA 3TVMA 5I8CA 5AVYB 2XN9B 3NQCA 4AXWA 4GI6A 4CNPA 3IWUA 4J12A 3FH8A 5BO1L 1ET5A 3GVGA 3FCSB 2F54B 5C9WA 1H4PA 5TQ0L 2C0HA 4UUJB 4A2FA 1VBRA 1BVKB 4E0RB 3ZRFC 4PCNA 2CLIA 5F0MB 3RZCC 4LMQE 4Q52A 4U2YA 3GJFK 2YARA 1I31A 4HC1A 2HROA 4Y4HA 4GJTB 1Q63A 2I9LA 4NO2B 3W53A 2PCEA 1LJMA 2Y7MA 5I3KA 5HYJA 4MG4A 2DTML 4AZ8B 4UFJA 1ZS2A 1KJ2B 3EGDB 5D9OA 3CH1A 2J1KA 4F37F 4LCUB 5JHLL 2OM5A 3C2SA 4GYBA 3FO0L 4OCRL 2PP1A 1LQAA 3TQPA 4HJJH 1KQYA 5CEXA 1X98A 1BGXL 2WQUA 4UM9B 3PHOA 3PZUA 3UJ2A 5IJCC 1K85A 4A7SA 2IG2L 4QS5A 4YHYB 4P8UA 1IEIA 5FX3A 1OADA 4OV9A 3TSMA 2IPGA 4XO6A 3E0FA 4DP2X 4YDIH 4JY5L 5PTDA 1A9BA 1NBVH 3CDCA 3RGVA 1G94A 3AQDA 5BQDA 4RWHA 4CC1A 3Q9PA 4PJCE 2K4AA 4IU2B 3ZWSA 2D7TH 3TCLA 2EDLA 1MY7A 2GT9B 3MR9B 1VFOA 4WTWA 3L3GA 2NY5L 5B38A 2XNAB 3I9GL 3UTQB 4M6MH 4GW5A 3BP5A 4O53A 4JPVL 3BQ5A 3GSWA 4HFWA 3M47A 4L29A 3KXFE 1JWUA 1W3JA 2AJYH 5E51A 2P53A 1JP5A 2NNAB 4DZBB 2BOFX 2JVUA 1PYFA 3PFMA 1WZMA 1BD2E 1VKXA 3NRQA 4ZNCD 5DS1A 5L2KB 1FBIH 1IM3D 5F9WB 3EAKA 2EXSA 4PJIE 4F58L 2D4DA 4X42A 1L9NA 1TV4A 2N59A 3KOYA 2NXYD 3NL2A 2R0ZL 4MAYA 4OSUH 1VPXA 5GNYA 3I9PA 5EHFA 4F7MA 5DVPA 2DT1A 4X7CC 3WUFA 1F02I 1WUEA 4F7PA 5DUPL 4M7KH 1B4TA 2QCHA 4NZJA 5E2TH 4TNWF 4IIDA 4N0YL 3TJEH 2V8MA 4W4QA 3BPCB 4OFYD 3ECQA 3BSZL 2JF7A 1IVTA 2A99A 1X7QB 3CVIH 3UZXA 3MLSL 4Y1AE 1JCVA 2J8UE 4QJ3B 4FXGB 4PLJC 3X17A 3UFYA 3FONA 4X4KA 1VEMA 3HNSH 3EBGA 5EU4A 3B8UA 1LWRA 1V5JA 1LO4H 5EA9A 1RSCA 3MSGA 4GIRA 5I1HL 1S5HA 3F2BA 2AV1A 2X87A 1C08A 4G80B 1JPSL 1BAWA 4TNVK 1EZLA 1NCDL 2A7RA 4RNRB 1NF0A 1CT8B 3LRSA 1LT7A 2VLJD 4CEXC 1Z89A 1S7QA 1JGDA 3HNVH 1HNGA 3VI4B 3RWHA 1LO0H 3MHUA 2R8SH 1A4KB 2ZRXA 1WD9A 3CQ0A 3C87A 3MCOA 3UR8A 2OQJA 3GZQA 3WV0A 4NZUL 3GSRA 3BCFA 5LNGA 2ZOLB 4XBEH 2BGNE 2NLJA 4KXZI 1M9SA 4Y9PA 3VTMA 4DPQA 3AJXA 3EJSA 5AVSB 3CHDA 4OI8A 5AB1A 2DEXX 1NMAL 4WGHA 4K2UL 1N8ZB 4NO5A 4XKMA 4BQ2A 1R1CA 4ICNA 1ADOA 4WTQA 4Y2DA 5KSUB 4JM0A 1RPQA 4F66A 4G70B 3S1UA 2QIIA 1J5HA 3WL1A 3TMQA 3CIQA 3VOFA 1CFTB 3DDGA 4FN0A 1XTMA 4XAFA 4HUCA 2P42B 3FFDA 3OR7B 4PTTB 4LSPH 3V7AE 3I85A 3UL4A 2ZX7A 4A2HA 2GTWA 5FUOL 1MHEB 1AHKA 4GQZA 2DM7A 4LH8A 4JN8A 4LY8A 1XL9A 2X9XA 4NAFB 1KENL 2FZ9A 1YEIL 2R15A 4DTGL 1BV8A 3BLIA 1MH5B 3UABA 1Y6NR 5CGBA 3GGWB 2YL9A 2BW5A 1PDYA 2DORA 5AN7A 4M6NL 3QMTA 3W11C 3SRDA 2BBFA 1TJIH 3WFCL 4DWSD 5BNXD 3QWRA 1PYMA 2VZTA 2E68A 4R2GB 2VRJA 2JEPA 4D2JA 2VLKE 3MV8D 1ZPTA 2HJLB 2ENJA 2ADYA 3ESMA 3WOVA 1QW9A 1Q8JA 5FF0A 5CUSL 5KEZA 4RDQF 4KOCA 4F2MA 1PZ0A 3VXQA 1XF4A 2TYSA 1OVDA 2C0AA 1Q94A 1HOCB 2WHJA 3EPNA 1I4FB 4LVDA 3QV8A 5F7LB 2VDRL 1JPTL 1UD4A 1BMGA 3PJWA 3IUIA 2UV8G 4YDLC 2R4SL 5ECUA 3HQPA 4NZ5A 4B4HA 5HBBA 4H26B 3GXMA 1JD7A 2VI0A 4JBSA 3NQMA 2CO7A 4N02A 5LNWA 3DCPA 1TYEB 7ODCA 1MCSA 1OP5K 2GQ3A 3FQTB 3NZPA 2ZT9C 1V6TA 4AX6A 3C5QA 4TLTA 2A4AA 5LIWX 4WHTB 3VFUB 3H4WA 4DJFA 5IJBC 3DZ1A 1QMUA 4O58L 1GZHC 2D3JA 4Q6JA 3BMVA 4XNUL 1H6FA 4OCWL 1T7VA 1ZGDA 2VYOA 1MEXH 5D70L 4YMPA 1H3XA 3W2JA 4M3JA 3C08L 1NIAA 3PJTA 3APMA 1NWOA 3ZIYA 4JFED 5ABFA 1W3LA 4M1DL 3F8UB 4M56A 1BBDL 1V6VA 4FFWC 1U4EA 4X8GA 5HY9A 2ZWSA 2FR4B 1JTOA 3NEVA 5CILH 4KBXA 4TNVF 3MQTA 5D1ZC 1ZANH 4KWSA 1TPB1 2L7QA 3DX9A 3WHE0 3ARBC 4AHOA 2VCBA 2OMVB 1UWTA 4F48A 4EX4A 1HXMB 4N9BA 3B2MA 1PKQB 1U4FA 5GGQH 1NMBH 4IQHA 4HUUB 4ZPTB 1R30A 4PUEA 4P3DB 2OEMA 3N4EA 3ZHFA 1RIHL 1OZUA 4ZTEA 3BGFC 4JDTH 1ACYH 1G7JA 3O45B 5J9PA 4YHEA 4TVPE 3ALPA 1ZS8B 3MOAH 3MJ6A 2EJ1A 3C2VA 3X3GL 1ISVA 2GUUA 2OCJA 3OJMB 4ODHL 3WD4A 1YYAA 3G5ZA 4NP9A 3NP3A 5HWJA 3CXHJ 4LCWD 3UJFA 2VXQL 1VFSA 2GSJA 4JKNA 5E00B 5JMRA 3WYRA 2WP3O 4JFHE 2PLJA 1QNZL 3S2JA 2X4OB 4L9DA 4U6YA 1E15A 1SMAA 3HPJB 3KVMA 3FHAA 3JS3A 1CLZH 4N1EA 3KZSA 5HDBB 4EXQA 4MADA 4U1IB 1X4ZA 3I3BA 2BHYA 4GAYB 1S2UA 3W1ZA 3RY6A 2B0MA 2AJ3A 1XM3A 3WQVA 5I07A 2XWBA 5HNTA 4ZFFA 3NVTA 3BRGC 1RZ7H 3IETA 3A64A 3QK0A 4K3EH 2W8CA 1XCTB 3APFA 1SF5A 4JYEA 3VB9A 3ZL4L 3EG9B 1T1WA 2YAFA 3HURA 3MRMB 3IDJA 1MN4A 5B3SB 5EUOB 1D3CA 5IDIA 5IW6A 2YAQA 2QVMA 4C57C 4LBAA 5IJVB 1QTPA 4B5NA 2CKNA 3W7LA 4A37A 2XFYA 4U5KA 5GGUA 3Q6GL 3N1GC 1ID2A 4JE4B 5HYSG 1T83C 3LM7A 1S9XA 1FL3B 2BSCA 1RZFL 1C5DB 4G56A 5DJDA 3BLFA 3SADA 4GQ9L 1IQWH 2JJVA 5B1JA 3NDYE 3OX8B 4LAUA 2VRKA 4V1DA 2OL3B 2P76A 2P5PA 2AXJA 3RY4A 2GI7A 3HUJA 1OZTG 1QPRA 4DF0A 4HBQA 1I75A 4KJPD 2IO5A 1I8UA 2NUTA 2PYED 1TPDA 1B5TA 5HUPA 1AR2A 3H54A 7CGTA 1FPTH 2UWEA 4YXKH 1ZRUA 1YA5A 4NZ8A 1UB5B 4Z42C 1CGUA 1M6UA 2CMRH 3ZTJH 1FP5A 2WKOF 1UOLA 2DSKA 2BCKB 2QS8A 2DUZA 5CZRA 4CQAA 4AFYA 1YMYA 2CXGA 5I9QB 4AY1A 4LT9A 5LGJA 2FTPA 3IPEA 5IFJB 4NRSA 1L9QA 1FWIC 3QBTB 3AXMA 1H7OA 4F9LC 4GKSB 2A0NA 1DE4B 3WNIA 2PO6D 2WBJB 4G2AA 1A65A 1A6UL 3HVDA 3TZVA 4LL4A 2OJPA 3U4EA 2X1TA 3SI9A 5I1EL 3GSNL 2J6XA 3JSSA 1UIPA 2ESVE 3NFUA 2WD0A 3ALXA 1XH0A 1MFCH 1THAA 2AI0H 1O1ZA 4MNQE 3QAZB 1H3WM 3LSBA 2CRIA 3Q1EA 4GB9A 4L64A 3JUZA 3VABA 2ZZ6A 5CZVH 1GOIA 4PGDB 4E9SA 5K39A 3EWXA 5IVZB 2BPBA 4QE4A 1KA9F 2P8MB 3NCYS 4YSOA 2X3CA 2BVPA 2Y7QA 1JN6B 4HK0B 4PJXB 4HCHA 1MI5D 4JPKH 2Z1VA 3GSXA 3IDXL 1LNUA 1JDDA 3KTXA 1WJ3A 3L48A 3MLXH 2G2PA 4ZUTA 3GTXA 3UP6A 1I7TB 4ODVH 4H9MA 1BOGA 3SUWA 1Y7VA 5E93A 4LU5L 1U8QB 3S37H 4XSMA 4MJ5A 1H8OA 2A3BA 2WLLA 3UPAA 4C54A 4IGBA 4LSQH 3C5JA 3DJ9A 3W4RA 2NXYC 1IXPA 3RVXD 2NV1A 3QJFA 4U6XB 3REQB 1ZV2A 4NSKB 4LVOC 4RDVA 3GHBL 1F58H 1CK0L 1JXFA 2FYMA 3JVFC 3TU9A 3F84A 2EUZA 4HWEH 3RILA 4MA8H 3D25A 2YA1A 4B96A 3LHPL 3DESA 1KGJA 4A6YH 3IFOB 3NJXA 3EX4A 1S5NA 4H83A 2H6PB 4LB4A 3IN2A 1LO3L 1OGAE 4NDMA 2ZWYA 4M5YL 1INDH 4QRRD 1SEQL 3NACH 4P46D 1EP2A 4RXFA 1CGWA 1YQVL 3GBNH 5FAGA 1J93A 1Q7MA 1QI0A 3S9DB 3EWDA 5T5NG 1LP9F 1BZDA 4KPHL 2XTJD 3MRFB 2CO3A 4RX4A 2K9UA 2A7PA 1PX3A 1NOFA 4B9KC 1ZY9A 1WO2A 4HGKC 3NRPA 3FO1B 5I16A 1J0IA 1HK6A 4HNLA 1BYPA 3BP7A 5A7BA 2NX9A 4BZYA 1A0QL 5IFTA 3KJ6L 1RR2A 1P0NA 2QAPA 3NSNA 5REQB 3U46A 4J4PA 1VYPX 5GS0L 4HKXB 3HOJA 1NC2B 4AQ1C 2DSZA 2R9RA 4UILL 4BQ8A 1GXEA 3JZYA 5G1YA 3GHEL 3K5XA 3MRBB 4WEMB 2FECL 1D5IH 1MWAB 3OMIB 2HPOA 3UOAB 2AAVA 3AC0A 2GPTA 1YEGH 1FGNH 4O50A 4YSDA 2YX0A 4LSBA 4H8NA 2AZUA 4HETA 1JOIA 3PN8A 3VQ2C 3E5BA 4OZHF 3O16A 1UKQA 2QZRA 3UC2A 1A53A 3U5YA 1REIA 3GNML 4OQTH 1WHPA 2FGZA 4HGMA 3BQUD 5HDRA 1A2YA 5I8KH 1ZGLB 1TZ9A 4A39A 4A63A 3C8KA 3EDKA 3JV6B 1E73M 5BS0B 1CDCA 4M43L 1RH9A 4Z7NB 5E2UL 3OGCA 4MSWB 1IAKB 5K9DA 1HIMH 2BIPA 1NAMB 1SEBB 1RUKL 5T1KD 2AS5M 3VNIA 2VDKH 3FQRA 4WTZA 3ZX1A 4PODA 2PMQA 1AD1A 4Z77B 4HJ1A 3AZUA 3W0WB 4O02A 4JRYE 3FK3A 1T1YB 1DE6A 4Z1CA 2I57A 3O3EA 3TA3A 3PWJB 4UT6H 3THCA 1OCQA 2V17H 5BS0E 2Q7NA 2WMPA 3THDA 1YY8A 3VWKB 1R38A 3BFWA 5IMKA 3V0AC 4UINL 3UX9B 3GJEA 3BOVA 1MREL 4FG4A 4TN9A 3EWYA 3V79C 3GR4A 1RJRA 1PNCA 4Q4EA 3NQ6A 1S5WA 4K8RD 4JDBA 3CH9A 4TNFA 4PB9L 1RLCL 3CN1A 4V2CB 4OTKA 3L9CA 3MJ9H 4NBXB 5CLXA 3W74A 2XX1A 4IMCA 5LBGA 1Z41A 4LVHB 4Z3FA 3FNKA 2PUZA 2YC1A 4ES4A 2IWFA 2VW7A 4XB8A 2BOBA 1R3WA 1MCWM 4FLQA 4CVUA 1KEML 3NEOA 1X7FA 4MQTB 3OAUL 3WBDA 1AS8A 1NH6A 3NSMA 4J7RA 4NNPH 3KX6A 1TVBA 3IXTA 3CAKA 2LTQB 1H15B 1T0NA 1FL6A 1MJUL 2QJNA 4YR6B 4JFFA 1HO1A 2GG1A 3KBWA 2EIDA 1PTAA 3D0LA 4U6TA 3OXSB 4IBSA 3IUDA 3XISA 2ZRYA 4I2XE 2EIMB 1S7UA 3DPBB 5AW2B 5D03A 1KGUA 1Y18A 4AYMC 1PCKA 3PSVA 4MJZA 3FCUB 2QVFB 2FLMA 1E8XA 4R90H 1FWGC 1K4DA 4OFVA 5I23A 4F1SA 1QBML 3KCLA 3DOIA 4NQSB 1T20A 1MCPH 4JKPL 1E28B 2X8RA 4ZVJA 2E40A 3J8F7 4B60A 5C3IA 2ZXBA 4G8AC 3KCOA 1ZT4B 2LAGB 5F8QC 3GH5A 4ALAC 3EA2A 4JPGA 1T89C 3ECWA 5K9XA 2HJFA 4IXXA 3WMQA 4ENZA 1LDPL 2VO8A 3CPUA 1A8JH 3OKMA 3CFKB 1T7ZA 1W2VA 3WUWB 3N42B 4KI5E 3DARA 4XIMA 1UR8A 3NJNA 1KY6A 4NS0A 2RCSL 4XX5A 2P1FA 1AO7B 3QDME 1T99A 3W7RA 4XX1E 3U2OA 4B3KA 4G42A 4O1DA 3LHAA 5E6ZA 4RL3A 4U1GC 3BEWB 1XRVA 1P6WA 4FL4B 5GRJL 3UA4A 3ES6B 5DQ9B 3SJVD 2KMWA 1XSKA 3BZEA 4JO8A 4LARH 2ZDSA 2ZKWA 2HRWA 1EA0A 4XXWA 2P4AB 2C9QA 4XPGH 3WMSA