2WVTA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 156
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvtA01
1UR0A 1U30A 1PAMA 1KB3A 2WC7A 4A3HA 3BVUA 1DWGM 2VVNA 2VZSA 5A8OA 1V3IA 3MMUA 4LGXA 4HMEA 1BF2A 4PMNA 4J3WA 3AXIA 4AMCA 4GKLA 1VFUA 2E0PA 5I79A 1G94A 1V0MA 3WEOA 1UWTA 1CXEA 2FHBA 3WH7A 5A95A 3BUIA 3ARPA 2G3IA 4ZXLA 1EA9C 2ZOXA 3WL1A 4BQ5A 3IJ8A 1TUXA 4UFHA 1K9DA 4B16A 3VD5A 2O9TA 2GK1A 2WWDA 1XGZA 1CGYA 2XTKA 1W3JA 3GXFA 3VIGA 4MJ4A 3A4AA 2V5DA 4TX6A 4QDMA 1BFNA 5EBAA 3UG4A 4HP5A 2D22A 4UR9A 2NW0A 4B9YA 4AZCA 3WY3A 2BVTA 3BUPA 1UKTA 2XGIA 3FAXA 4WLCA 2WMIB 4PUEA 1PPIA 5TD4A 3ARTA 2ZX5A 1OD0A 3WUFA 5HPOA 4FNUA 4FLOA 2DQXA 4P8WA 5C8BB 1QI0A 3WUBA 3VGHA 3SCPA 4WIWA 2ZXAA 3W6MA 2D0FA 2ALWA 1E9LA 4PEEA 3O2LA 3ALFA 4UOZA 4TVCA 1ISYA 4NXKA 3WD1A 3LXCA 1QPKA 3PZ9A 3CZ8A 1R87A 1DEDA 1ECEA 1M01A 5E6ZA 3BH4A 2WMFA 2JFEX 2ZXDA 2C0HA 2XVPA 2X09A 3CPUA 1UWIA 2EADA 3AMLA 4N0RA 1IV8A 2YL6A 4UFKA 4AZ7A 1CGUA 1E6XM 1BTCA 2YA0A 1QHOA 2WVSA 3LXBA 2VX5A 1GJUA 5FL1A 1B3WA 4P7NA 1JZ7A 4X0NA 2PWGA 3HJEA 1CYGA 4P7QA 2WVUA 3BCDA 1TQUA 1VJZA 3NSXA 3WDIA 3MUIA 1J0KA 1HKMA 1MQPA 2BXZA 3VGDA 3HG4A 1UD4A 1WZLA 3WDRA 1LG2A 1PJ9A 3MSGA 2WZEA 1DTUA 2DIEA 3EJPA 4HOWA 1TVPA 2O9RA 1HVQA 2XN2A 2WW5A 1BYAA 1LWJA 5DEZA 1GQJA 4GI9A 1HKJA 5A2AA 3DX4A 3ZM8A 3OIHA 2BFGA 2W63A 3ZJKA 3BAKA 2QMJA 5A8QA 1GVIA 4U2ZA 1WP6A 5IHSA 2YA1A 2XFRA 1VEMA 5CGMA 2WAGA 3AXHA 1IT0A 3T0BA 2GVYA 2WVTA 2BS9A 3CZLA 4P8UA 4KRUA 2E3ZA 4L4OA 4DM1A 4MB5A 1XH1A 2EAEA 3BVXA 2XG9A 1G1YA 4NZFA 3ECQA 4NRSA 2VCCA 1VEPA 2OSYA 4W7WA 5A1AA 2J7DA 2OYLA 4W7VA 3W37A 4KRTA 3EDKA 5IDIA 1Q6FA 1QHPA 1E6SM 4D6DA 1VBUA 1KBBA 1ESWA 1MW0A 2W5FA 5A94A 3D4ZA 4W89A 4W87A 4EAMA 2BHZA 5LA2A 1UD5A 5CGTA 2ZUVA 3IGUA 1OB0A 3DX3A 4CN1A 1GHRA 3ARRA 5E0FA 4MDOA 4UNIA 3OGSA 3AIEA 1CNVA 3MMWA 4EK7A 1MQQA 2EEXA 1GQKA 5HBFA 3F4VA 1TZ7A 2J75A 4Z2IA 3N11A 1JXJA 1E72M 3VGBA 3VIIA 2ESCA 3NSNA 1XHGA 2A3AA 3BAIA 3VU2A 3TOPA 4OKDA 3BLPX 2D3LA 5CXPA 4ACZA 5I78A 4CGTA 5GNYA 1ZBCA 1FP8A 5LA1A 4E4PA 5IFTA 3GDBA 1V03A 1O7AA 2F7RA 3FNDA 1HJQA 3U5YA 2VVSA 2WHKA 4AD0A 4NZJA 2ZX6A 5DMYA 2D24A 1DWIM 4UQEA 2X2JA 3WNPA 1OM0A 2F8QA 3PZGA 3MI6A 2CYGA 4AZCB 2XN0A 1NWRA 4PBGA 1Y7VA 2GUYA 1BLIA 1J0YA 3IJ9A 3QHNA 4J3XA 4B9ZA 1EHNA 4L4PA 3SIMA 4MNJA 4BF7A 1FHLA 1LG1A 1JZ8A 1MVYA 2VT0A 1PZ2A 3VD9A 2CITA 1QBBA 1OGSA 1ZJBA 2CXGA 4CUCA 2D3NA 1QNQA 3AXXA 4HA4A 3DX2A 4RL3A 3GNOA 4PMYA 2EABA 3WFZA 2DSUA 4AZBA 1V0KA 3T2PA 2G3NA 2DPEA 1B90A 2G3MA 3AMCA 4ZXOA 3RM9A 2NT0A 1R46A 5M03A 4R5EA 5D9OA 3UR8A 3WD3A 1WO2A 5GPRA 3EDFA 4QLJA 4M82A 2ZXBA 3W25A 1KXHA 3VNYA 4U2YA 4AYGA 1JZ5A 4W7UA 3AISA 2E9MA 1M7XA 3ZR6A 4NF7A 2V3FA 3EDEA 1AQHA 4BQ4A 2YFOA 2CKRA 1ISZA 2Q8XA 2EXOA 3S6TA 2DSKA 1S46A 4CCCA 1VIWA 1VB9A 1NWSA 1UR9A 1PX3A 1VEOA 4DUVA 1DP0A 5HNNA 1MFVA 3MV11 1SR0A 1H5VA 3MS8A 1HJXA 3ARXA 3RDKA 5JBFA 5C71A 2JE8A 1CLXA 1MQRA 2F61A 2X8RA 3VX0A 5GNZA 1EO5A 4TUFA 4LQ1A 3U57A 1BVZA 1UD8A 3A23A 4GPNA 1O7DC 3HG2A 1UG6A 2ZX9A 5BXTA 4M80A 3W26A 1N82A 2A3CA 4FK9A 4JCMA 4W8AA 1KR1A 8CGTA 2BHUA 4W5UA 5KZ6A 2XWDA 1NP0A 2X0HA 1V6VA 2Y5EA 1QX1A 2X0YA 2FYVA 3H53A 2PF0A 3WELA 4MPKA 2ZX8A 1UA7A 1B30A 3TA9A 1E4LA 1FH7A 5E6YA 2Y8VA 1JYXA 4PMQA 4ACZB 2XVGA 4J28A 2ZUUA 4MNKA 1Q6EA 4DO4A 4AD2A 3WQ6A 1HJSA 2GJXB 3CC1A 5DFAA 1J01A 4J3TA 1KXQA 4XZBA 4AXNA 2C7FA 3CUFA 2WZIA 2DT0A 3BMVA 4H2CA 3W0KA 5E70A 2VMFA 4ATLA 3CIVA 5BYWA 1XC6A 1QW9A 1JAEA 1W1PA 4ZFMA 4TTGA 1GOOA 5JIWA 2EQDA 7TAAA 2VI0A 4GZEA 2VRJA 3WL0A 2ZUMA 2IXVA 3PZOA 4HPGA 4XB3A 1Q4NX 3SCNA 3WQ5A 2QPSA 1E6NA 1H49A 1MWOA 4BS0A 3L4VA 1VFOA 3PZUA 4TVUA 3L2MA 4NZCA 1R86A 1QNPA 1C8XA 4U5IA 5ABHA 4BA0A 1W2VA 2VX6A 3GYCA 5I3DA 3DHUA 4M1RA 5I5RA 1PIFA 2BHYA 4OBSA 1KXVA 2ZUTA 5M3WA 2ZUNA 1CIUA 3AZRA 2F1BA 1Q6GA 3MUAA 1UR1A 1WNOA 1ODZA 3BCFA 3PTKA 2OLHA 3BC9A 4YN5A 2DSVA 2YLLA 3W4RA 4EKJA 3WUGA 3BUDA 4FNQA 3FW6A 1CXIA 3GBDA 1HP5A 3PTMA 1XV8A 4DO5A 3MU7A 2G4FA 3SCTA 1HKIA 3U7BA 3WBAA 1B2YA 5JBDA 5AC5A 2OWWA 3LPFA 5CPTA 2YKKA 3OLDA 2ZX7A 2E4TA 3VD4A 4D71A 1E4IA 4AEEA 3CBWA 3WD4A 1VENA 4PTWA 3UR7A 4D6FA 4J27A 4IUGA 4B15A 1CZ1A 3WF2A 1GONA 1XYFA 2ZWZA 1V02E 3MV01 3AS0A 4LYPA 1JZ2A 2ZUSA 1KCLA 3RMEA 5A3HA 4H8HA 5GNXA 4CKQA 4AD5A 1E0XA 1P6WA 3SUSA 2A3EA 1EQPA 1JI1A 1M53A 5ABGA 3ZT7A 2GFTA 1KGUA 5IXEA 1K9EA 3ARWA 4WKHA 1UUQA 4HTYA 4MJ2A 3WFLA 3WIJA 2QLYA 2J77A 4CU8A 3VUPA 2J7CA 2G8ZA 1J0JA 1V3MA 1CECA 1JG9A 5E09A 1C92A 3GH5A 3EJTA 1MXGA 3HG3A 3UCQA 2WHMA 1BVNP 2BV9A 4AD4A 4RE4A 4PMZA 2XIBA 4EE9A 5HXMA 2WZHA 4GXPA 1C93A 2YL9A 3PZVA 3GNPA 2FGZA 5DT5A 3RJYA 3TTYA 1EO7A 4DWSC 3CLWA 2J8GA 4AW7A 2WHLA 3EMCA 1EXPA 2GJXA 2C8NA 3GXIA 3WDHA 1E40A 4JL2A 3L4XA 2WMKA 1J0HA 3EBVA 3AHZA 4UQAA 3IK2A 3SCSA 4PMDA 4AZ6A 2VX4A 1IZJA 3RJXA 4UQCA 1DWJM 1VF8A 2JIEA 3ZT5A 1UQYA 3CUJA 3AICA 3HN3A 4CN4A 3CHEA 3CMJA 3BUQA 1F4HA 3POHA 3OLGA 1LL6A 2JIWA 2UY2A 4PMVA 2WBKA 1UASA 3AHXA 5CPSA 3CTTA 1BYCA 3GXDA 3VDBA 3HZ3A 3ARQA 2CCRA 1R85A 3PZIA 4D6CA 2E40A 1SMDA 1W1TA 4UOJA 2FH6A 4CU6A 2J25A 1TA3B 3ZMRA 5ABEA 1OBAA 1JYWA 2VZUA 4UCFA 1W3HA 1PIGA 3GNRA 4NSBA 3MANA 3NUKA 1ISVA 3VSVA 5GQBA 3HG5A 5A8MA 3W28A 5A2CA 5FD0A 2Z1SA 4AIUA 1GW1A 4YHGA 3U7VA 3WNNA 3BLKA 1TG7A 1R47A 3SCUA 4CD6A 4NXSA 4BCEA 2NT1A 1Z32X 3N04A 1JIBA 4KMQA 5I24A 4Q22A 1QWNA 4PN2A 4QAWA 2YL5A 3CHDA 3QOKA 1E43A 2ZE0A 1V3KA 4JKKA 2VQTA 5CG0A 1H41A 5EMYA 2VCBA 2CBJA 4CD7A 2OYKA 3VIOA 3CZEA 2YBUA 3VIPA 3CZKA 4B3LA 2G41A 4OOZA 4PMUA 4KH2A 3WF3A 4ATDA 1D7FA 3N18A 4Z2KA 1R33A 2XVKA 1BPLB 2GJPA 2CHNA 1NOWA 1US2A 3ARYA 2WKLA 3BAJA 1ZBVA 1TFVA 2E9BA 4AEFA 5AC4A 4LPCA 3POCA 1E6RA 1AMYA 4TVDA 1ITXA 2D1ZA 3LRKA 1XCXA 2DT1A 3W82A 3SUUA 3THDA 2W92A 2XSBA 1G5AA 4X9YA 4CD4A 6TAAA 2OSWA 1UA3A 4HZ6A 1OWQA 1HWWA 3WY1A 3NJ3A 4P7LA 4PCTA 2OWCA 1BGGA 4IISA 3N17A 2EPMX 3LXAA 4GQRA 1F4AA 4GO9A 2GDUA 4GZJA 1UR8A 2CBIA 4AZIA 2HVMA 3AHYA 1QVBA 3NCOA 2XJ7A 2BY1A 1KWGA 2YBTA 4PSRA 1E73M 3BGAA 5CPQA 5CLWA 4GZIA 1PX8A 1J0IA 3AHVA 4JIEA 1GOKA 1H1NA 4B3KA 4WSJA 2YIHA 1CTNA 1IZKA 4P8VA 3A6OA 2WLZA 4DWSD 4AZHA 4F9DA 3T2OA 1E6QM 1W32A 4Z2JA 1GOQA 1HXJA 2BNJA 3AYRA 3F5KA 1V3JA 3SCOA 2O9PA 1J12A 1FOBA 1OGBA 1FFRA 5A6KA 3N13A 5AYBA 5AYIA 4UFIA 4PMOA 4DUXA 2J7GA 2UY3A 1H0IA 1QI5A 3OLEA 4BZYA 2DGAA 2Y4SA 1TE1A 4U3AA 3AMKA 1DWFM 3VM5A 4H7VA 4V27A 3UG3A 1PS3A 4CVUA 2VR5A 3UETA 4KWUA 3GM8A 3KLKA 2WC4A 2WB5A 1EDQA 4V28A 3GH4A 3TTQA 1JZ4A 2VJXA 4HOZA 3WH5A 1FP9A 3KZSA 3WH8A 2VCAA 2EJ1A 1ISWA 4IPNB 4UFJA 2XFYA 3AIRA 1WKYA 4S3JA 5CZKA 4BQ3A 4JFTA 2E8YA 1D2KA 3BSGA 1ZL1A 3GXNA 4KGJA 5C70A 3AHTA 2CBUA 2FE0A 4UFMA 2J7BA 1HNYA 2W91A 3OLIA 1G01A 3S2CA 4Z2GA 1JDAA 1VAHA 3GXMA 1U33A 4FNSA 3APGA 4Z2LA 5D4YA 1QNRA 2ZIDA 4CU7A 4QLKA 1GJWA 1KGWA 5E1QA 1H2JA 3ALGA 3MUZ1 1WE5A 2WSPA 3I3DA 1EIBA 1E70M 3BAYA 1ZBKA 2V3DA 3ZJ6A 3VIHA 1E15A 1HP4A 3K8MA 3T0AA 3LMYA 1TQWA 1X6LA 3VM7A 3BSHA 3AIVA 1VFMA 4AMWA 2GSJA 3PBGA 3SURA 3VILA 2YA2A 1I1WA 4ZEPA 2FGLA 4JKLA 1PEZA 4HZ8A 3GXPA 2F18A 2ZUWA 3FY1A 1UKQA 1R8LA 5DT7A 2WK2A 1TMQA 1PZ3A 4HZ7A 2CKSA 2DIJA 1E0VA 1WZAA 3OGRA 4P8XA 1XD1A 3VSUA 4XUYA 3DX1A 3KLLA 2YOCA 3AIBA 3CZJA 2PWEA 1QW8A 2UWFA 4JFUA 3WY2A 3ARUA 1K6AA 3AZSA 3WD0A 4LYQA 5F7UA 3D52A 1JI2A 1QWUA 1CGTA 5IHRA 4AY1A 5A6AA 5CJ5A 2QPUA 1RPKA 1GOWA 3WH9A 5D8WA 3OGVA 3WY4A 2DDXA 3QHMA 3W27A 4OJYA 4PUDA 5BXSA 3HMCA 1HJWA 5EFDA 1O6IA 3LPOA 3CHCA 1HL8A 2EBNA 1E3ZA 2WSKA 3DX0A 2XUCA 5D9MA 3ARZA 2J4GA 1YHTA 2F1AA 4U3CA 3CZGA 2E8ZA 1XRVA 2D20A 3L4ZA 4U5KA 3SCRA 1KXTA 3L4YA 2WMGA 1ZU8A 3CGTA 1TR1A 1HX0A 3AFBA 3NYDA 4K68A 2WKGA 1E56A 3DC0A 4MADA 3ARSA 2J7FA 1UKOA 4LX4A 4OUEA 3LRLA 4P7OA 1K9TA 3RO8A 1HTYA 5A6LA 5HOSA 1JDDA 2DT3A 1EDTA 2XVNA 1LL7A 4H8UA 1BQCA 4HPHA 2J74A 3CHFA 1UH3A 1UZ4A 1ZB5A 1I1XA 1G0CA 1KR0A 4RE2A 1ZS2A 1MW1A 1JAKA 1JXKA 1JF6A 1E0WA 3WN6A 2YDRA 3A3HA 4ATWA 4MAVA 2W61A 2UY5A 3WUEA 2WANA 2DH2A 3A47A 4F79A 1YQ2A 3DYPA 4JHOA 1OT2A 3RPMA 1OCQA 1QI4A 2VR4A 4AIEA 3M6DA 1AQ0A 3GH7A 1WPCA 2X2IA 2AAAA 3NDYA 2J47A 3VOCA 3W24A 3FHQA 1GUVA 2F7PA 4HMDA 3SUVA 3BLBA 2D0HA 2JEPA 4GQQA 1DWAM 5CQ1A 2XYLA 1HT6A 4MB1A 1KQYA 4PTVA 5EB8A 4H8VA 3WKZA 2D0GA 3QGVA 1CGWA 4AYSA 2CIPA 2WMJA 4D1IA 3TONA 3W29A 1UKSA 1LLOA 1GOIA 3B8SA 1NM9A 5A8NA 5AY7A 3BAWA 3T08A 1RD6A 1WDRA 2EACA 3VDHA 3IANA 3J7HA 4CN6A 3CUHA 3UG5A 4UQ9A 1NH6A 4UTFA 2HISA 2VUYA 3CZNA 1Q6DA 3OB8A 1JYVA 4GIAA 2OW7A 4DM2A 1SMAA 3DYMA 1NOFA 3I3BA 3T0DA 1KCKA 4WKFA 1AVAA 1MYRA 1QBAA 1V6YA 3N15A 4HMCA 2ZXQA 2V38A 4W93A 1WZKA 3CH9A 2VURA 3ZIZA 1JD7A 2GJRA 1GZJA 4M29A 3VNZA 4DWSB 2QHAA 1GQLA 5FKYA 5LYRA 1VFFA 1GPFA 2BVYA 3U5UA 4MAZA 1H0GA 1WB0A 3BVVA 1GHSA 4A4AA 2DSWA 4ZE5A 5BCAA 2BY2A 3AMDA 4HU8A 4TXEA 1EOKA 1ODUA 5BRQA 1UZ1A 1W9UA 4MNMA 3ZOAA 3EDDA 2MANA 4ML4A 4WJXA 2F7OA 2J79A 4P7RA 4NX0A 2QF8A 2XM1A 1LF1A 1DHKA 1UKPA 4H04A 1WAWA 4D6HA 2OWXA 2TAAA 5CSUA 1W91A 4AD1A 3MSDA 3EDJA 5FCZA 3PZNA 5E9AA 3L2LA 1EDGA 1BG4A 1B3YA 1SYTA 4M56A 1HIZA 4U33A 1GNXA 4D72A 1QOXA 1CXHA 1TQTA 2BXYA 2XIIA 1D3CA 3O6AA 4PMRA 3THCA 1NP2A 4OOUA 1C8QA 3D50A 1X1NA 1WCGA 3WH6A 1MFUA 1M03A 1MXDA 3OA5A 3WD2A 2PC8A 1CGVA 1M04A 2DSZA 3VGEA 3KL0A 3PZTA 1W9DM 1QHZA 1Q6CA 1HVXA 2X2HA 1GCYA 3F5JA 5E0CA 4X0VA 2E9LA 3WF1A 1JZ6A 5FL0A 4J3UA 1EHAA 5BXPA 3ZJ7A 1KQZA 4UZSA 2V5CA 2WVVA 2JF7A 5D9NA 2CESA 1V6XA 4JL1A 1TVNA 2J8FA 3IJ7A 1QNOA 1TQSA 3QHOA 3VIJA 2PBGA 4URIA 3ZSSA 3FXYA 3WMCA 1L0PA 4UOQA 1HJUA 4NRRA 5CSYA 1KBKA 1AQMA 3AYSA 1R7OA 1W9BM 1C7SA 3CMGA 4UQBA 1HN1A 3K4DA 1CXLA 3KEHA 1BG9A 2BY3A 1CXFA 4AISA 1J10A 3O9NA 5HDRA 4J3SA 3WNKA 3SCWA 3S5ZA 3KE0A 2ZICA 3AZTA 5JUVA 2X05A 2J7EA 5M5DA 3QR3A 3WF4A 3IAQA 3VIMA 4PCSA 2WMIA 4Z2HA 3MKKA 4JAWA 1KTBA 4WKAA 1FFQA 3RIKA 1R7AA 1I75A 1BYDA 2JALA 2WVVB 3DYOA 1W3LA 5I77A 3MO4A 4M8UA 5D8ZA 4FLRA 3F5LA 4CD5A 3VIFA 1L8NA 1BYBA 1W9VA 4GO8A 5JIPA 1US3A 1U2YA 3VKKA 4QFUA 4PYSA 2F2HA 7CGTA 5I6SA 5I0DA 3ZQ9A 3AI0A 2IUZA 1XH2A 2PWFA 5A6MA 4TTUA 1R34A 4PRWA 1V08A 4AIOA 2DH3A 3KWXA 3NIYA 3OBAA 4R27A 3N9KA 2DEPA 3ZO9A 3I3EA 3AJ7A 1B3XA 1J11A 1JYNA 1CDGA 3RM4A 1W3KA 2PI6A 1KTCA 4CCEA 3KL5A 1JNEA 1J0ZA 3PN8A 4QP0A 7A3HA 4XX6A 2XVLA 5A6BD 1WZMA 8A3HA 3LRMA 3VMOA 3UESA 2VRKA 4F66A 4WF7A 4W85A 4D6EA 1UOKA 3AIWA 3A4XA 2YL8A 4KGLA 2UY4A 4WK9A 4E8CA 4M81A 4FLSA 5KEZA 3OZOA 2EO7A 2YLAA 4W88A 1OD8A 2VZTA 1CWYA 3M46A 1V02A 1EOMA 1VJSA 2CBVA 3CZSA 3WENA 3WNMA 1A47A 1V0LA 2OYMA 3TTOA 3BXWA 3EMZA 1RP8A 3H55A 3DHPA 3PTQA 2VRQA 3AOFA 2PB1A 2VOTA 2WCSA 2Y24A 2GDVA 9CGTA 2Y8KA 1JNDA 1HXKA 4QCEA 2X1IA 1BAGA 2WWCA 4OGZA 2EPKX 3WMBA 1E1EA 2XM2A 4GI8A 1B31A 2V3EA 4TX8A 3WNOA 3EMQA 3A24A 1JZ3A 4FNRA 1CPUA 3D4YA 1E55A 4PSPA 1A3HA 1OGGA 2VO5A 3AS2A 4ZENA 3JUGA 1V6WA 3VVGA 2XPKA 2WC3A 2CHOA 3UEQA 3T09A 3VD3A 3WEZA 3AQUA 5M17A 4CVWA 1QI2A 1FH9A 3WF0A 1RH9A 2XGBA 5ECUA 5CLTA 5I23A 3L4UA 4OZOA 4PMXA 2VL4A 3N12A 4GI6A 4NI3A 1LQ0A 1XSKA 2VX7A 1E6ZA 3BAXA 4QLLA 1B0IA 3VINA 1J18A 5I2UA 4C7FA 2EPOA 1KFWA 1JGIA 1HL9A 4WSKA 4CD8A 2IGTA 2W67A 1UD6A 3WNLA 2XWEA 1XD0A 1CEOA 5ABFB 2B31A 2VZVA 3SEPA 1KWKA 2PWHA 3WQ8A 3CUIA 1GQIA 3VIKA 2WXDM 3LPPA 4W8BA 4J7RA 2W66A 4DO6A 5EFFA 1CENA 1EH9A 4DWSA 4W84A 3EJQA 4D6IA 1JL8A 1SZNA 3A5VA 1W9XA 1UWRA 3WSUA 3WBEA 2FHCA 4A3YA 2A3HA 3K8LA 4PTMA 2BY0A 1V3HA 1FH8A 1V6UA 2VNCA 1B3VA 4YHEA 2OW6A 1ISXA 3DDGA 1H3GA 1E5JA 1HF6A 5A6SA 6CGTA 1B3ZA 4ACYA 4HA3A 1VBRA 1E5NA 2WYSA 3WQ4A 1X6NA 4MTVA 5D9PA 1H09A 4D1JA 4LXFA 3LX9A 4E2OA 3NDZA 3OZPA 1CLVA 2CERA 4LYRA 3W6LA 1BSIA 3VX1A 1W1YA 3LPGA 1UD3A 2G3JA 1NQ6A 3K46A 2JF6A 4Y7EA 4HU0A 3WQWA 1LJYA 2J7HA 4YPJA 3NSMA 3VPLA 4IM4A 1JFXA 3K8KA 4JZ5A 3DECA 2J78A 1XYZA 4J3VA 3VMNA 3QOMA 4FMVA 4AMXA 3D5HA 1RP9A 4HOXA 4AD3A 3B9EA 4MB3A 5BWFA 1FA2A 1UD2A 3ARVA 2VQUA 1B9ZA 2XFFA 2WHJA 4C7GA 1EGZA 4PTXA 2XN1A 2AOSA 3G6MA 2JEQA 3W38A 4U31A 5DF0A 3WDQA 5A69A 3A22A 1HJVA 1BGAA 3AIQA 2CPUA 1E6PA 3MMDA 4BQ2A 2WNWA 1W9PA 3FHAA 1JD9A 2EPLX 3RCNA 1CBGA 4UZUA 1XSJA 5A8PA 3G6LA 2VZOA 1W2PA 3WDPP 1NWTA 2YFNA 3FAWA 4M24A 2O9OA 5A6JA 2WCAA 1OIMA 2W4XA 5BROA 1C8YA 2CEQA 1UR4A 3TTSA 1H11A 1E71M 3A21A 3BUBA 5BXRA 3II1A 3SUWA 1TA3A 1GORA 1NOUA 3E1F1 1CGXA 3PHAA 3ZT6A 1VRXA 3FN9A 1C3FA 1OSEA 3BVTA 2CETA 2V3GA 2FHFA 1MW2A 4S3KA 1GVYA 1K9FA 2DT2A 4JKMA 5IFPA 5ABFA 1XSIA 4FNTA 1T0OA 4CCDA 3GXTA 5DO8A 3B9DA 4E8DA 2XSAA 3DDFA 1CXKA 3EJRA 3OG2A 4XZWA 4TOQA 3IAPA 4W8LA 4MDPA 2W62A 4RE3A 3RM8A 4JCLA 3H54A 3BMWA 5A6BA 3RILA 4D6JA 1UHVA 4MB4A 2IXUA 1V0NA 3PZMA 4FF5A 2X2YA 4D6GA 1UR2A 4H41A 2D2OA 1G9HA 2Y2WA 1ZBWA 4FLQA 3AROA 4C7DA 3WDJA 3W81A 4JFVA 1DWHM 3HU7A 1JF5A 2GK1B 1B1YA 3TV8A 1LL4A 1PBGA 1W1VA 4AWEA 2EPNA 3VDCA 5FOOA 1E3XA 3ZJ8A 2QMKA 3SCVA 3TP4A 2RGMA 3ZSTA 4ZE4A 2WMHA 1XCWA 1QNSA 1GOMA 1UWQA 2WBGA 1SFSA 5HPCA 3SCQA 3VMPA 2WM0A 5FIPA 3WEMA 1E1FA 4FNPA 3AS1A 4MNLA 2NSXA 2D73A 3D51A 5LA0A 2WLYA 4JHZA 3WQVA 1UQZA 1V3LA 1BHGA 3CV5A 3GTNA 2ZWYA 3VSTA 4AC1X 1ZJAA 3MUY1 2WPGA 4UQDA 3T2QA 1JFHA 2FH8A 1NARA 1JDCA 3S5YA 1XH0A 2J62A 3VO0A 3AIUA 4N42A 1NWUA 3ZR5A 3EJUA 4W5ZA 3VGFA 1WDSA 1WDQA 2BVDA 1E4MM 3N1AA 1C7TA 1ITCA 2D23A 3GZAA 3VD7A 3B9AA 3A4WA 3M7SA 5JBEA 1C90A 1UH2A 3KL3A 3PZQA 2CNCA 2QV4A 2AMGA 4IPLA 4F8XA 1OINA 1QI3A 3AMGA 2F7QA 1UH4A 4F9JA 3CUGA 3K4AA 4EANA 1PX4A 3EJSA 1E4NA 1UWUA 2WCGA 3SUTA 1TQVA 3L4WA 3M07A 2PBOA 3CO4A 3D3AA 3VGGA 4XV0A 5A2BA 2Z1KA 2PWDA 1C91A 1FHDA 2VTFA 1OIFA 2YDSA 3EYPA 1TCMA 4W86A 4OIFA 4JFSA 3GBEA 4Q7NA 3BVWA 1LWHA 3VTRA 2VC9A 4QCFA 1WDPA 2O92A 1H4PA 4V2XA 1UWSA 4AZGA 2FDMA 1EQCA 3AS3A 2A3BA 3K1DA 1R75A 2OSXA 3WMSA 4OBRA 4UFLA 1OT1A 3W53A 1MW3A 5BRPA 2YDQA 2RGLA 1UYQA 4AZ5A 1J9YA 1HKKA 2XHYA 3VDAA 4JFWA 4GINA 3L4TA 3UERA 1KGXA 4HA1A 6A3HA 2YJQA 4DUWA
chains in the Genus database with same CATH superfamily
4BGLA 4BH8A 1UR0A 4WI7A 4B2DA 2KUTA 3PAOA 1WWAX 4D8AA 1TPDA 4WCJA 3ZVHB 1TWDA 4EN3D 4Y1SA 4ABWA 4CEXC 4WEBL 3CDYA 2DRUA 3QEGL 2PW2A 4WU7A 4HWZB 3BQUD 4Y8AA 5D1ZD 3S4SA 5IB2A 1V3IA 5ANMA 1QTYT 4TUJA 3VYLA 1MLCB 1MNNA 4HKJA 4HMEA 4LGXA 4P0DA 2BZ7A 4IKLA 2EKJA 2HRGA 5H4ZA 4S38A 4M7ZC 3QDMA 1PTGA 4Q0XH 2AZUA 3FQUB 3OGOE 4EIZC 4OUUA 5JH1A 2BCKB 2J44A 2EE0A 3O3EB 1VFUA 1EWEA 5I79A 1ZKAA 5T3ZL 1U41A 2V5MA 1HQRB 3IN0A 3WEOA 2AV7A 3AREB 4DI9A 4QNPF 4EDWH 2Z7ZA 2ICSA 3C6LD 5LG1A 4FADA 4LLWB 3DG6A 7PTDA 3K2UL 4HBCH 2P88A 1RXLA 3S2NA 4MZIA 4FNLL 1S1RA 3RWGB 1Z7JA 2X9ZA 3RQ3A 4MY1A 4U1JA 4G7VL 4GT0A 1A53A 3IJ8A 1TUXA 2BMBA 2XXGA 2PS2A 5ALCH 5EOTA 1N2RB 3EOTH 4CAGA 2VELA 3M0IA 1H61A 3TA6A 2WWNA 4L48A 2AXHA 4PJGF 2X4TB 2GK1A 2BIPA 3NJJA 4LPTA 2HJPA 4PJ8C 4NLAA 3DO7A 5BPPA 1PTZA 3VK5A 1FVDB 1XGZA 1CGYA 2CM6A 1W3JA 1HSAB 1MJJA 1EPXA 1T1WA 2C91A 4XNBA 1BGXH 1IFGA 1N4XH 4GRLD 2EH8L 1Z0NA 4NVTA 4LOEA 1DVJA 4N87A 3C08H 4MJ4A 2ORBH 1BF8A 3MVIA 2VQ1A 3VIGA 1TSHA 5JHDE 5FYLE 5EEVA 4HG4J 1KYOK 3DAQA 3FS9A 4QDMA 1BFNA 2OL3A 5EBAA 1OYAA 3U4EA 5I15L 3KVQA 4HP5A 2D22A 4JHMA 4UR9A 4B9YA 3R79A 5FI8A 4BWUA 3GSNL 3P67A 3NEXA 1PZ5B 5I07A 1NQBA 3RNKB 2CBQA 1I8JA 3H21A 2BX7A 1U93B 3M43A 4IOTA 1FWTA 4IWWA 4I0PD 5BS0B 3DX6A 2EE3A 4EF8A 1G7LA 3EOLA 1GWJA 1UKTA 2DLHA 4UAOB 2XGIA 1DBAL 4F80A 4YNYA 5CD3B 4PJ9B 3T0XA 3TW7A 1N8WA 2NYYC 3ZMNA 2PMZA 2VXVH 3PGFH 1E4XL 1XB8A 3US1A 2DMHA 2PCYA 3ARTA 3SCMC 2IBGA 4BDVA 1W1B1 3WLTA 1YEHH 4YDMA 1AR1C 5TE4L 5AC8A 5IWLC 2A6DB 4ZPVB 3R8RA 4YDLB 2WLNA 4N6RA 2R59A 3D3VA 3UPCA 3DFYA 1U1JA 1T21B 2AGTA 5HPOA 3DVFA 2XINA 4RMSA 1X5XA 4PM1A 1BVWA 8XIAA 2DQXA 1QRKA 5C8BB 2P28B 3F4WA 3IRPX 4YSQA 3VGHA 3WUBA 1XGQB 4E5XA 1PZ0A 1RZJC 3S1VA 4GSRA 3KYAA 4EPEC 1HYSC 3CBJB 3PJUA 1KM6A 2PCPA 2X53A 4JDZA 3TMQA 4PAZA 2GLKA 4ZXLA 3AU6A 4Y5YA 1AD0A 5IBLC 1F5ZA 1ZY9A 4GSDH 3ALFA 2VYOA 2CLVB 4LLDB 4P5RA 4BEUA 4XUGA 1ISYA 2C14A 3KVPA 2OP4L 2ZZ7A 4RQQA 3R89A 4O2EA 3K6SB 1M01A 2DM3A 1ADQA 4KI5D 1Z5LA 3O3BB 1TPH1 2RA1A 3UBXA 5FJJA 3BWAA 5E8PA 5AKTA 3H6JA 3UWQA 2WTOA 1SN2A 4K39A 2C3WA 1AQKH 3PWNB 5CF3A 2YB1A 1OAQL 3TBWA 1KB5L 2CLRB 5AD0B 5EEUA 1EP3A 1NOAA 1SY6L 4MYXA 5D2TA 2E86A 4PODA 4NAEB 1C12B 4KZDL 1BTCA 4BHUA 1XIJA 3NSDA 4XP5L 1QHOA 4QD2E 2UYLB 1JSYA 2CO1A 4ODBD 2J4WH 1JZ7A 4XWGH 1S9VA 4X0NA 5HBBA 4K2SA 1CYGA 5KW9L 3LZNA 5D4HA 4FS9A 4J3OH 3DA0A 3MRRB 2WGXA 3NSFA 1NMAL 3NSXA 3SPCA 4F8PA 5J11B 5K1VA 3KPTA 4M7LT 2MWCA 4JN2B 4S1SL 3RR1A 3MUIA 1NC4D 2AABL 1GTNA 1FWFC 1MQPA 3RVXD 1MMFA 1TU2B 3H2WA 5DRCA 2JB5L 1O0VA 4K6AA 1UD4A 1WZLA 1MCPL 3L6FA 4PFEA 1SBBA 4WW2A 3SSZA 3WDRA 1J8HB 1G67A 3MZ2A 2AJYL 3SDCD 5E2WH 4NFBA 2RKXA 1PJ9A 3GF8A 4QXTB 3MBFA 3T3PE 2WZEA 1DTUA 2A6IA 3Q8EA 1K4DB 3V4VH 2WW5A 5AVZB 1YCSA 3T6VA 4EAYA 5DFWH 1MFAH 4IOIA 5DEZA 4M7JL 2IBBA 5B7MA 1X5JA 3W2MA 1GQJA 5CLZA 1E9YB 2YZRA 2LVCA 3HE7B 4O4YH 4J4KA 1UYWH 3DX4A 5F0LB 5IJKC 3OR7B 3V6FA 2PRMA 3KPSA 3BAKA 3ZJKA 3FO1B 3WXWL 3H2FA 2YWZA 5T1DL 3QDHA 3T65B 1EJOL 1NMCB 3J2PA 1WP6A 3C0QA 1FSKB 3M7OA 3QJZA 4X8JA 3NFNA 1WUEA 2XFRA 1R3IH 5DJYA 4GOSA 3CXHK 2PYEA 5CGMA 2BW5A 1O6VA 4OFQA 1R3RA 2ZZ3A 4YNGA 3LKNB 3TBTB 1AJ0A 5EO9B 4G56A 1N7MH 1YRKA 4E9YA 2OT0A 2OL3H 1H9DA 2W94A 3CZLA 1TJHH 2EDEA 3H26A 1FBIL 1IGTA 2HRPH 2E3ZA 2LABA 2PPCA 2XG9A 2XX1A 3RDTB 3DJ9A 4IOIB 5HJ3B 2OMUA 1OARH 2YD8A 2VCCA 5F1UA 1ETB1 4WXYA 3CVDA 3BUVA 1RUKL 3NCYS 5D9SA 2DKMA 4XC3L 1UP3A 4W7WA 3HEIB 5F9OH 2IKJA 3HKZA 2GJLA 5IG7A 5ABTA 1FWIC 4GOAA 1E6OH 1EHKB 1T2XA 1QFPA 3APMA 1WS7A 5D70L 4M9PA 3T9WA 5FAAA 1G9NH 1OD7A 4IBQA 2ROXA 2PDGA 1V27A 1NCTA 5EZOH 3SYQA 4HUNB 1TCRB 2VABA 4ZUTA 3P3RA 2K6ZA 1KACB 1JNHB 2NY2D 3NJFA 3O2VH 5C0CE 3U6XS 4Z3IA 1E27B 4LCUA 4I89A 1GGYA 1KBBA 1ESWA 2PDLA 2AEIT 2ZCHL 3IJSA 4OCWH 2CGRH 1NGXB 3CSYB 3N43F 5ICXA 1MW0A 2WPBA 1KGJA 4LSBA 1BEYH 1KB9J 3D4ZA 4FHAA 5CSBA 1A7PH 3UBGA 5A2FA 2BHZA 1QAPA 3FCSA 4NPKA 4W89A 4CVZB 2WMPA 3MNWA 3N43B 3MR9A 4JO5A 5CGTA 1MUJA 4AT6A 4JY5L 1IMHC 1QSEE 3QW3A 4LVOB 4X8GA 3QYSA 1QA9A 3HLAB 4NAEA 1GHRA 3P84A 4WY7L 4Q2ZB 4XXDB 1A3RH 2COQA 3ZUNC 1J6OA 1A7OL 1VKXB 1R2RA 1RLDA 5IG7B 1JGEB 4I3GA 5E4EC 3DERA 4NQCA 4X99B 1L7TL 4DBUA 1Z3GH 1REQB 1GGUA 2QSTA 4MGGA 4QHMA 4NQEB 4YDLC 1MQQA 1XG4A 2AXJA 2FWLB 4ZQTA 3P3UA 3RL2B 3H12A 5REQA 2JKLA 4WO0A 2J75A 2Y5SA 1QVOB 4XSLA 2LHAA 4FTVA 2O6EA 3N9GL 4R96B 1JXJA 4NN7B 5IJVA 1E72M 2ZKWA 3VIIA 2OULB 4XXWA 3QUXC 3FQ4A 3B2VL 3WFCH 3JUYA 3T0WA 4LNRB 2VFDA 1X9QA 4A6YH 2A85A 2EC9T 5D2NE 1MCQA 5CJNA 1SEBB 3T4WA 5AL0A 3KHQA 3LV6A 1TYEB 2BSTB 1QSEB 3L7FB 2YPLB 4OKDA 3V5CA 3IUHA 4ACZA 1AFVL 4EE2A 3GG1A 4L61A 5GNYA 1ZBCA 1SUHA 4YGVA 4YCOA 3S5LA 4F1ZA 5DJCA 1I9IH 1JGDA 1R1CA 1GOGA 4NZUL 4TQEH 3FSUA 3MO7A 4I7WA 4JKNA 1H8NA 2N1TE 4OD3H 3GDBA 3GMNA 1ORQA 1V03A 4P2OA 2F7RA 2ICES 3CFJB 3FNDA 3U5YA 2HG5B 5B38B 2YAPA 2VVSA 1Q8AA 2WHKA 1GRWA 4HIPA 4HKBA 5EZJA 2XV6B 4GKSA 3B7UX 3C2EA 2OTUB 3FQ2A 3T1WA 2HV5A 3JZEA 3TZVC 1U3YA 4NO0A 1LRNA 3NCYP 2D24A 1HSBA 2H6RA 4RLIA 1ZE3H 4WV1A 1I1AC 2X2JA 3MA7B 5EZIL 5F7EH 3BEVB 3QUZC 3BKCH 3WG7B 1WH0A 2X28A 1CLZL 3OSVA 4HNVA 4YTQA 1UPMB 4R7VA 2HT2D 3HZKB 4KPHH 5EU5B 5CO1A 2F8QA 4FJZA 3PZGA 4Y2WA 4MGXA 3WUZA 3V5HB 1FP5A 5K9DA 2XN0A 1E42A 1E9QA 4MVAA 4YFLI 1LEGA 4ZMZA 5LXGL 3QZPA 4PBGA 1Y7VA 4HHMA 3ANVA 5ADPL 4WQ6A 3R06A 4NQUA 3A67H 4HCRH 3FTWA 4NRZA 1DJXA 3SPIA 1VCGA 3L1FA 3MLYH 4V2BA 4DHGA 1FRBA 1U8KB 4B9ZA 2GHZA 3U7AA 2E77A 4WWPA 3W1AA 5BQDA 3WK1A 1AGEB 5DQJA 4BF7A 1KC7A 3BZ4B 3WEBA 3S8HA 3QI9B 3WEXB 2Q0ZX 2VT0A 1NKRA 1T04A 3OKEB 3P8IA 2PO6B 4P9MH 1ND0B 3T0ED 2YMOA 4JY9A 1OGSA 5G5DA 5D7SL 4DB7A 4RAHA 2A0NA 2PU1A 4K36A 2WIMA 4ONHA 2DL2A 1QNQA 1DIOA 3KYOB 4LCIH 2XU2A 1DVSA 1TTRA 1XF1A 3KGRA 5CSSA 1G9NL 4J2QA 5BO1L 1BXVA 2YMXH 2QCFA 1BV8A 1YNLH 2B3IA 4ZS7L 3ATBA 4YBQD 3RAJL 4UTAH 4U28A 2G3NA 1TTIA 1XF3A 1I1CA 4QRRE 4NUWA 2G3MA 1CGSL 3UPBA 5C0ND 1R46A 4GC4A 5AN7A 2VM8A 2FX9L 5D9OA 5GPRA 3L5IA 4PJ8D 4IIQB 2W0FA 4K5LA 5IVOA 1ZHNA 3O0FA 4PR5B 3E3HA 3WGVB 2NZ9D 4F33B 3FB8A 4IQEA 5CFHA 1OWWA 3AG2B 1AHKA 3DJZA 3F7KA 3F7RA 3QEQA 4LHUA 3FQUA 4PRDA 5EBLB 4XAKD 3SY0B 4LCCB 2ZCLL 1R3SA 5DJZA 3V4BA 4W7UA 2VHLA 2BOCB 3ZR6A 2CZNA 1PKNA 2Y0FA 3G77A 2OCZA 4O51B 4UDTA 5DMGD 1SU5A 4TLUA 1I0DA 1P2CB 1FVCB 2DBLL 3SOTA 3BARA 2RDWA 3GFXA 4IRSB 4HGWB 4LK4A 3EDEA 1AQHA 1LVEA 1TVDA 2X10A 3N41F 2CKRA 1US0A 1RIUH 2V8LA 2CGRL 3HUJE 1U91A 1XQKA 7PAZA 1Z44A 4F33A 3WLNA 4PRHA 4TQPA 5I02A 2CO7B 5ESVB 2Q8XA 3WS3A 5CJQL 5I9QC 3SECA 3S37L 4L3FA 5E5UB 4CCCA 3CH8A 2Y9RT 4EMZA 1PX3A 2VLKD 3ZWSA 3TIDA 5A3ID 3DOIA 4PJFB 1XX9C 1UEYA 2WCPA 4PYGA 1E4WH 1WBXA 4F57L 3IIPA 2HRHA 1MFVA 1OXYA 1IL1B 3MV11 3TAKA 3RJOA 1HIML 1D5ZB 5IQ9A 1P4UA 4ADIA 1EGVA 1R3LB 1NZRA 4KW2A 3RDKA 1KV7A 3IPBA 3ZL4H 1RVFH 2ASHA 3TDFA 1CLXA 2F61A 2D7QA 5CEYA 5C0DB 4XD6A 2EXWC 3GLCA 2OL3B 5GNZA 2NLJB 1EO5A 2NUPB 4PJ5A 2IQ0A 3U57A 2FZNA 3A23A 1KTKE 2DQDL 2R2EB 2B1AH 2NX5D 2JB5H 4IEFB 4LCWD 3N4FA 5AHIA 4AF0B 4DJED 2DQDH 3HG2A 2ZX9A 4WNQA 2HLFD 2A3CA 2ITDA 2XV0A 5L2JA 2O4QA 5CCZA 1LEGB 2H3NA 3FU0A 1KR1A 8CGTA 2B3RA 2BHUA 3SE6A 2AV1B 2D3VA 3C2YA 4PTUB 5ERWA 4HH8A 5C07D 3GIVA 1O68A 1OX5A 1TJ2A 5DANA 3V35A 3HBGA 5KBNC 1S5MA 2Y5EA 3QO0B 1GMEA 1XCQB 4QRQB 1TSIA 3TT3L 2P80D 3VH8A 1NMBL 1RJQA 1W0YT 4BKSC 1VHCA 1Z8AA 5EN3A 1L9NA 5AVRB 3BJTA 1OHLA 4S23A 3EOTL 4IRSD 2JKPA 2NY6C 2AXFB 1NGWB 2EXYC 2Z35A 1K3ZA 1PQZB 4DQOL 2E27L 1EF2A 2Z27A 2VDRB 3MJGX 4NSKA 1ZRUA 1MIMH 1OTSD 1H8SA 3MUJA 4KROB 2P44B 3H2AA 4JHWL 1WFOA 3K6DA 2CO6A 1XF2A 3VXQB 3G5WA 1OAKL 4H13C 1CK0H 3ZDYB 1NCUA 4IGBD 1UA7A 1HQRA 2WO4A 1UWGH 2OR7A 3GM0A 5C0JB 1B30A 5KVGH 4XD5A 4HAKA 4UR8A 1JJUA 4FZ8L 5E6YA 1KFEA 4PJ7A 3TFKD 4I3RL 3KXFB 2XVGA 4HPYH 5HDBF 4UV4L 4WFGE 1Q6EA 1R3KA 3MCG1 5BRZA 1L9QA 1WDDA 1G4PA 2Q2LA 8RUCA 4R0LA 5F21B 3N0AA 1HJSA 1PY4A 2QNEA 4ZB2A 3MGAA 1HH9A 5DFAA 4KTGA 3DI1A 3M0VA 4PREA 5DD3L 1T99A 2IEPA 4B9GA 2DW6A 1Q1PA 1ZOXA 4MDJB 2QDDA 2WZIA 1BGXL 2TSYA 4OKVA 3CUFA 5G4EA 5D03A 5FJTA 3UYPB 3OBKA 1XB6A 3RVWD 4WQOA 3VFRA 3UJFA 3P11L 3C5SB 2VR2A 1JCKA 4LU0A 4A7GA 3I85A 1HCVA 5HGBA 2BDNH 4NJAH 4O02A 3LBOA 1A4KB 1IKFL 2ZOLA 1MLBA 1LJMA 2K1MA 3QORB 1QW9A 1XC6A 4AL8H 4AEOA 5KVMC 1RZGB 4KKBC 4RUBA 5HGHB 4AMKL 1II4E 2LOEA 1W1PA 4R9HA 3N40F 1B3JA 4XKYB 5B1BB 1U8NB 3S5NA 3HPJA 4X60A 3FDGA 2EQDA 2QV2A 3HBLA 1DVFD 3OF6A 3UBXG 3NFPA 4WUUA 3MBEC 1YNYA 3R06B 3WL0A 2ZUMA 3AC0A 3LZLA 4WWKC 1IRAY 4YFEA 1A21A 4HPGA 2DPKA 3MRFA 3I02B 1AY1H 1M56B 4L9YA 4YSOA 5DQJB 2YXMA 1G5GA 1Q1JL 3GMQA 4MWAC 1ECYA 5DRWA 1U8PB 4OSUH 4FFTA 1MWOA 4MNGE 4Y5XB 4AENA 1SO5A 3KPOA 4QHUA 2AEOA 3PZUA 4Q6XA 4JQAA 1A6UH 2G9HB 4TVUA 2ZUQC 4DZ8B 3NRQA 4J4PC 3GU9A 3VUSA 1ZAGA 2LU4A 3QEUA 3L5JA 3V5HA 3PULA 3TROA 4U5IA 3UOAB 3FT4A 4ZZ9A 3CX5K 1N0XL 1EFXB 2OA9A 5FW6A 4C91A 1QASA 2E68A 4L9XA 3QXUA 2Z25A 2AJ3B 2HBVA 2PDMA 1PIFA 2BHYA 3GMRA 5F1IB 3F4NA 1D9KC 4W81A 3ZE1F 5DYOB 2Q87A 4A2RA 5M3WA 2X87A 5FO9B 1F2JA 3AXMA 1NC4A 4HCGA 4AQEA 4FXFA 5I6LA 3LNDA 1I8MA 3MUAA 5E8OB 5C9WA 5B1JA 1WNOA 2VFFA 4ZUUB 1KCSL 5G2HA 4YN5A 3QUXD 3F7VB 3PCYA 4KMTH 15C8H 5DRNA 5FDWA 4L05A 4MMYB 2VR6A 1ZLSH 4QTHA 3CIXA 3GFUA 5CN1A 2DIAA 4Q32A 3EJCA 3I50L 3LSOA 3DBXA 3D18B 2QCHA 5DJYB 3Q67A 2EUWA 1HP5A 4ZTPH 1F6AA 3KAAA 5D71H 3GS7A 3T65A 1XV8A 1RQBA 3PSVA 2WKJA 1A0CA 3EB3A 1AIFB 1MNUH 1MREH 5CP7A 3EWZA 5E94A 2GSMB 3GZ3A 3QCTL 2PLCA 4GG6A 2NTFA 4DJDC 3C2AL 1PBYA 4IW4C 3N2BA 2XWBA 4PJ8A 2VMDA 3C5ZD 4YE0A 25C8L 5C2XA 2QFRA 4LSRL 1EDHA 1XIEA 32C2A 4IXHA 3LPFA 1OABA 3VFWA 5CPTA 3FJ6A 3E3QE 1SJBA 2ZX7A 3CAKA 2NXZD 2Q3ZA 4HUKB 3P4MB 4N2MA 4H1LB 2JKIS 3QSKB 4TNVK 3CBWA 4IFKB 3G5VB 4CW1B 5GHWL 2X4SA 1VENA 2YPVA 4DK5A 3O41B 4EIVA 1IARB 5DMKA 3IDMA 2X4QA 4PJAB 2ZKXA 2DJSA 4GISA 3VXUE 4MG4A 3KHOA 3CYJA 1TQCB 3KPRB 5C0GB 3WF2A 2E9IA 5FM8A 1FI8C 1BZOA 1ZUAX 4JICA 2DUZA 3TYEA 2DDQH 5M94B 1S5NA 5ALCL 1KRAC 2OX4A 1D5IH 5D38A 3LHPH 1TYRA 1V02E 4XXDA 2BSSB 2MPAH 5FO7B 1RA5A 4JQ1A 2Z7YA 1JZ2A 4JZJC 2WSRA 3HCVB 3NIGF 5MEQA 5EF1A 2PDKA 3PWPD 4NKMB 4GNVA 1INQB 3S37X 3K2UH 1TELA 4JO1H 3LN4A 3FCSB 4CKQA 3EG9B 3BGMA 3QZEA 3W7NA 4AD5A 3LN5A 3RIFF 1XR2A 1K8CA 2JIXA 4G2DA 2J4WL 4X5WB 4YXKL 3AG1B 1ZA6B 4GFTB 4HJJL 1JI1A 4B95C 2ZA1A 1VERA 4REQB 1XAKA 4ZRGA 5KVEH 2PLKA 5C0NC 2NLYA 1MHEB 5J5RA 3SRFA 4NT6A 1KGUA 5C08E 4ZUTB 3KBPA 2ZWLT 2AQWA 4HTYA 1MFMA 3N34A 1MHPH 4MJ2A 4NAQA 3WFLA 4Z7NE 3TZNA 4BQ9A 1LO2L 3ZYOA 1HGWA 3VUPA 1SLVA 2NY6B 1PDKB 4XX1E 4DERA 3MACH 2CGYA 3C6LC 5KVDH 1CECA 4XD3A 1L0YA 1B0RA 1QPRA 1C92A 5E09A 4LSUH 1J1OH 3GH5A 3FH5A 3A6BL 3ESUF 3PGCB 4WO4A 2OG9A 2YR1A 1KCUH 5E0KA 1IGTB 4R3SA 1A4JA 5ELIA 2ATMA 2Z8SA 5DUPL 3BDXA 4XVOA 2WZHA 5EU6B 2KMWA 4HPJA 3H6OA 3ISYA 3LI1A 5DT5A 3MN8A 4MA3A 1AD0B 3UZXA 1E9ZB 1T4WA 4OLXH 4TVPH 4UB9A 3UA3A 2WQ8A 3N44B 4H20H 3G5YA 1G7HB 1T96A 5KZMA 3LTPA 3DIDA 2J8GA 3TLQA 3F2BA 1TFHA 3S88H 4FXGC 3LKNA 4QRPE 5DGQA 5GRJL 3GHBL 2R1KA 4JL2A 3L4XA 3EBVA 1J0HA 1NGYB 4JDVA 4QG6A 1KYDA 2ED9A 3IK2A 3ZHLA 2F58L 1EJ8A 4PS3A 4B41A 1XLDA 1IZJA 3OAUL 1MUCA 1KLFA 4ZDHA 2KKQA 5KYUB 3IM1A 3FQXA 5C0CA 2VDOH 3R7QA 1UYWL 2ZYHA 4EI5D 2FO1A 3RXZA 4HNTA 3AICA 5FDWB 4QRFA 1FHUA 3CHEA 4MS8D 3UGUA 1DVYA 3CMJA 3VFGH 3WBYA 5LXXA 3ILPA 4R9OA 3ABOA 2GITB 2ICEA 2A6DA 4ZPVA 5D09A 2JIWA 3DXAB 2UY2A 2Z7UA 3S96B 3RY6C 4MD0A 2LFGA 3FL7A 2WBKA 3W7GA 3UYCA 4J2XA 1UASA 3U7YL 4M8RA 4A6YB 4ALAC 4PGCB 1J5TA 4RE0A 3VWKD 3WFEL 4DGVL 1DIKA 4JQ3A 5CPSA 2E75C 2FSEB 3O4LA 4KRNA 3VDBA 1FQ0A 3K72B 4XZHA 5K9OB 5CUSH 4D8PA 1GOFA 4UTCA 2BRQA 3CQKA 4RZ4A 5J5DA 4QSHA 2D8KA 2PP7A 1B54A 3QPEA 1DJZA 5TK2A 2G3ZA 5FF7A 2RMNA 1W1TA 3L0GA 2E5EA 4DLFA 1KG0B 4YK4B 5FLUA 4LPUA 1FX6A 3NQ2A 2J25A 1UACH 1TETH 3KPLB 3LB6C 2EH8H 4FQIH 4K23H 4D0DA 3IFPA 4DESA 4E42A 1GVOA 5AQ0A 3KZ8A 5E2UH 5ABEA 3RYSA 5IIEB 3DO7B 1DVUA 4P5KA 3MDWA 4UCFA 1W3HA 5K1JA 4IHCA 3NUKA 5KVFE 5E03A 3MANA 5JOPE 1FV1A 3VSVA 5GQBA 4PHXA 4DTGL 2GK2A 2X0VA 3PWPA 4KZDH 5A8MA 1QOPA 3QQ1A 4DVBB 4P2OC 1WT5A 3Q58A 3NGBC 4G9FD 5FM4A 4GIEA 3DVIA 4YHGA 3AYVA 2P3YA 2YXVA 3ARGA 2BB0A 1TZHA 3VFTB 3C4UA 1A1MA 4ESKA 3QYNA 4GW1B 3OZKA 5GGVL 5FYJL 2OAAA 1TUFA 4E9WA 3KOZA 4YTSA 2R7EB 2NT1A 3NOIA 4LLMB 4TPRH 3STBA 2JB6A 1J2WA 4NBXB 1KJ2H 1T3FA 3BVNB 3TAOA 4KMQA 1FNSH 2I25N 5I82A 2A9ML 5K9QG 1YBQA 4OAWA 4Y2OA 3TTEA 3W1ZA 3T6QC 3GNXA 1W2KT 2XQBL 1I8AA 5TNVA 4Y8DC 2GGHA 2QVNA 1WBYB 1I1YB 2OZNA 2Q09A 2ZE0A 3B97A 4JKKA 3KRSA 2VQTA 4WZHA 5IOBA 3UC0L 3QR0A 3HC2A 5CG0A 1N6QH 1FN4A 4HLZG 4L9LC 5GJMA 1YY9C 3QBUA 3AACA 3QJTB 2NY2B 2YDRA 4CD7A 3MY9A 3B9KB 2OYKA 3DFNA 3HI6L 5G4WA 3VIOA 1GGTA 3FQWB 1S9YA 3PXHA 4HIJA 2J1KA 2FJGA 3M0JA 5DMIL 3AUOA 3RTLA 3FB8B 3H2OA 2G41A 5AOUA 5D2NC 4OFPA 3Q2LA 3UBFA 3WF3A 3GMPB 4NEHB 2PXYD 2ZDSA 4OZIF 1OL0A 4MCYA 2YXWA 3UZQB 1ICTA 1M1XA 1NBYA 3ARYA 3MTWA 1U8HB 4MDRA 4YMPA 3BGJA 1QSFA 1ZBVA 5CSZB 2VDNH 4C5ZA 4AEFA 5AC4A 1UB6A 2PSNA 2V7HB 3AWOA 2X4SB 3POCA 2J6XA 1AMYA 2UWEA 5D7JB 5EOCJ 3KVKA 4Z7WA 4A8LA 2ZE3A 4NQVB 1W5PA 4JN1L 3LRKA 4N9GA 1YYAA 1XCXA 2BZDA 3E8VA 2V2XA 2B0MA 3W7KA 3NAAL 5HGAB 4DKAA 3K74B 3OVGA 3UTSD 2DZTA 2ZTJA 1F42A 4NN5B 1I7ZB 4OGYL 6FABL 1LHZA 4LV9A 1MEXL 1T0MB 3FUNA 4HIIB 1KEGL 4UNVA 2H0PA 4KZ0A 4YS1A 2A83A 2R2EA 1CDJA 3RUGA 5DLLA 1EEXA 3OB0H 3TIEA 3FB7B 2OSWA 5I8OL 4I9MA 1O5PA 1R5VB 1QTWA 3EA2A 4XP6L 5MP6L 3CK5A 5JYLA 4YU1A 3O6LL 4Z7OE 5FGCB 3UTSB 5E08H 4PCTA 3NJ3A 1OFQA 2OWCA 4DELA 1IGML 4UIOA 3I75B 1PWLA 2VIRB 4XVJH 2CWNA 1HCYA 4KKXA 2ABAA 1R24A 2W60A 1EFXD 3NSYA 4XMWA 4X9SA 1YO4A 1PUDA 5D72H 3N4AA 2LVEA 5E8OA 3GD1C 4PWHA 4XZ9A 3N17A 4ZFOL 2IANB 1C29A 4OFYD 2G60H 3QFJE 2QZ5A 3G04B 2YGYA 3S3SA 4UTBL 1NELA 3UWZA 2XG4B 1F4AA 4GO9A 2E67A 5FYKE 2CBIA 2IGFL 2CGZA 4HEPA 1XLGA 4LKXB 1R3VA 3UJRA 5GRXG 2HVMA 4P3CL 3ITYA 2B4CL 4B5WA 2A7NA 3NCOA 2BY1A 2FZ3A 4JFYA 5BVJB 1KWGA 4FZIA 4H1ZA 1WHPA 3WI9A 3DN5A 3MCYA 5D5MA 4UDTB 1N0LA 2OR9H 2YBTA 4MJ6A 3EO1A 1QK0A 1UZ6E 1LEIB 3CWHA 2RHEA 3M45A 4AKQA 1XBZA 5C0AD 3M1ZA 4S3EA 1TWSA 3V55A 4EP8C 2N4IA 3AHVA 2R9RA 3WD5L 4L5ZA 3QH3A 4F7TB 1GOKA 2V4LA 1KJMB 1G69A 3I9AA 5DSCB 4FTVB 3GS4A 1KFGA 3VA2C 3O07A 4UTIA 3RZCD 1L9MA 4H8WL 4KKLC 2FX8L 1LEKA 2FX8H 4O02B 5BOPA 5IHZA 4FD0A 4FEIA 5KTLA 1ZANH 3T2OA 1L3WA 1W32A 2OZ0A 1P5VA 4R4FH 4PBXA 3P4MA 1NBVL 1V3JA 4Z17A 2WLKA 3D7PA 4M3KB 3UYPA 1J12A 3QH3B 5FYKL 4F7TA 1B88A 5I75C 1SSDA 2APWA 2PYEE 1X7TA 2HTLD 2NUYA 3IKCB 2C1HA 3BZ4A 3ILQD 3N13A 2YCLB 1DQIA 5AYBA 1OZTG 5CGBA 3OKMB 1TQCC 2B1HL 2XWJB 3N4EA 3O3RA 1WS8A 5AYIA 5L4IA 1D6EB 1KJMA 1BWMA 2NUXA 1NFDF 5I6KA 1W0WB 4UMAA 3OLEA 4BZYA 5GRVK 3T8MA 1CLYH 3QRFM 4XMZA 2VDHA 5CZRA 2OU4A 4LMQE 1TE1A 4D0CA 1QABA 4FA6A 3FSTA 3AMKA 1VYPX 4NHCL 5DQ9B 2ZQ0A 5LDUA 4PJ7B 3VM5A 4V27A 4MQXC 2ZAGA 3UETA 4OLVH 4KWUA 4BKLA 1N10A 4BWWA 1RZ7H 3HLKA 3GM8A 1ZVSB 3MA7A 2VWEC 5KS9E 2K7PA 4LBUA 1SW3A 3HC3L 1PKQB 3HHSA 4FQXD 3GH4A 2D9CA 5L9DH 1NGWA 2Z35B 2OTUA 3CFBA 2VJXA 1G6RA 4X98B 2HG5A 5B38A 4Q9QH 1FP9A 4KT2A 5KZDA 3WE1A 4ZW3A 3WH8A 4PVBA 1JCYA 3ROOB 5GGRB 3GTXA 3ATFA 3TWCL 1CF8H 5ISZA 4XBGB 1VADB 4K9EH 4MRCA 2XFYA 2OPJA 2H6PA 2QUNA 4Z95H 3L0NA 5IMLB 1ZVSA 3HHMA 4BHUI 4DAGL 1Z48A 2A9BA 5J6SA 3RG1C 4XN9A 2UZIH 4EZLA 3ET9F 5JR1H 2R91A 2BLEA 4DN1A 3EEZA 1EXBA 4ONFH 2DWEA 2V2WA 4LUTB 4QE5A 4J6IA 1RJYA 4K94L 3CVHA 3OZMA 4B4HA 2JI1A 2YHGA 2DZEA 4FRWA 1XZWA 4GG8B 4WJKB 3BGFB 3MYZA 3KPPA 3QUYC 3A4EA 3AHTA 3KPSB 3L1EA 4KHXL 3G1AA 5G2IA 2GHWB 5HYQB 4ZXBD 4PI2A 2VLKB 2DQEH 5A16B 4UFMA 1E8XA 4PP2A 4XR8C 1ONQB 4HS8L 4XNDA 3CAVA 3S2CA 1AY1L 4HV8B 3OVUB 4AYFB 5I66B 2Q8ZA 4YDVB 3WJJA 3ULVD 1D9EA 1NFIB 3O45A 2GGGA 1ZSHA 2VUKA 5DJ6A 5FYKH 1O94A 3BEWA 4BEQA 1X7FA 3IJHB 2QDHA 4QHMB 5F1KC 3II3A 1AO7B 5DUML 3HC4H 3UAJA 2QT6A 1OG0A 3G6LA 4B27A 4MA1C 5I1HL 1MWAL 2O6FA 3CV2A 4H0IA 2J88H 5JPNC 3EYVB 3MMEA 4AITA 1ET7A 3T1GA 3W3BA 4XSMA 2Y1ZA 2QGDA 2V68A 1NCNA 1OP3H 1KY6A 2OS7A 5IV2A 1H2JA 3ALGA 3ME3A 1GHFH 3DLQR 4KX9A 4PJDE 2MCPL 3WAJA 3NCCB 1OAUH 3F01A 4PWIA 2MCPH 5C0AA 3BAYA 3N9RA 1HH6B 4O2CA 1FCCA 4QXGH 1YECH 3TNBA 3VKJA 1NGXA 1JHTB 3ZHNA 2DW7A 4HQVA 3UMNA 4B3VA 1E15A 1PD1A 1YVLA 3QJSB 4TSBH 4GI4A 3ITLA 3QV8A 1B57A 4M3HA 2V2TA 4R7OA 1YPZE 4BH7B 4LESA 3H22A 1EAQA 1MZZA 4JB9L 1ZLUK 1X6LA 1HE8A 2GT9A 4M5YL 3VM7A 4U6VL 1ULVA 3QQ0A 1S7RB 5B38G 4KQ3H 1DLHA 4AMWA 2X1OA 2JB6B 2R4RL 5TDOA 2CO6B 2GSJA 3GW3A 2VDMH 4L3CB 3VILA 1U95B 3BQVA 1E4JA 4FQQB 4FQ2L 4MA7L 5GGTL 2FGLA 3R0UA 4GW1A 4JKLA 4NQCD 1A8JH 3ATEA 5EIVA 3SOBL 1M9SA 3O2DH 4YHIB 2E5DA 1UGKA 3LKSB 1I85C 1R24B 2W60B 4K55A 4N68A 3SKNB 5JIHA 3B7SA 2ZUWA 2YPLD 2DQFA 2GFBA 5HWJA 5EA0H 3PHQA 2PCEA 1WAPA 7XIMA 2FB4H 1PZ3A 1MCCA 1RZ8B 4IL0A 3ARGB 3OJVC 2YD0A 2J9YA 4O1CA 1FYTE 2D2HA 1HKLH 2UXGA 3CFEA 4LPWA 1ML1A 2QS8A 3EBGA 3K0YA 3KVDD 4QYOA 4MA8L 1GC1C 1P7BA 4BSVA 3EOEA 3QKZA 3DFTA 4WNQB 4GO6B 3KJ4C 4WI9A 3B1TA 4I8DA 3BUYB 3CZJA 4YO0B 4ZJ9A 4BFBD 3OKDB 2P26A 4NRZB 4U3SB 3RA7L 3O06A 4GAFB 2BVQB 2HAZA 5MERA 2YBGA 3RL1B 3WY2A 3ARUA 2FGBA 5ITFB 5IHBA 1P7HL 1OOWA 5HJDA 5K39A 3VACA 5JXED 1T40A 3OODA 3ZR4A 2H6UA 4D8PB 4AXKA 5F7UA 3VI3F 1OK4A 1KFBA 1FNEB 3JTBA 4IMLA 1F6YA 5AHNA 5ACMA 1C5BL 4AY1A 1GG1A 1X8FA 5A6AA 1S2CA 3TVMA 4ONVA 5J8OA 2BMKA 1LO4H 3HRZA 1RK5A 1AG1O 4DHLA 5IQLA 2QPUA 2V2XB 4Z7UE 5IT2H 3KLSA 4H25A 1RPKA 5F7DB 3WUWA 4EX4A 5K7JA 2IPFA 5GGRY 3V95A 3FU3A 4Z7WB 3O8XC 4UUIA 4LEEA 1DBML 5D8WA 2FQDA 1EXUB 2B0SL 3WY4A 2DDXA 3GD6A 3FT0A 3VXPA 4BZ1A 2HCVA 4OJYA 5BXSA 2G97A 1HJWA 1IQ8A 4BZ2H 1O6IA 5LN8A 3NCFB 1QSFB 1FORH 1D8CA 3CSPA 3BG9A 1W6LA 4JFDD 4ONFL 4U1MA 3B0PA 1GW0A 2DQJL 2PYED 2FEEI 3MLVL 5KVFH 5D9MA 1UFGA 3IVKB 3S2LA 4GQBA 5TPWH 5IJCC 1DJQA 1A4AA 1OQOA 1RSYA 2MTPA 3ARZA 1T4KB 3EFOB 3GHBH 3RY4A 2ZP0T 4XMKL 3MRRA 3LGDA 4H00A 5EBMB 1KNOA 4MZ1A 2F1AA 3CZGA 2E8ZA 4IRJC 4B9KC 4X7SL 3TYBA 3MLPA 3L4ZA 4O8RA 1N8OE 4TRPL 1DXEA 1EEYA 4WDIB 4U5KA 3SCRA 4W1TA 2O1AA 3WKML 4JFHE 1HQ4B 1KXTA 2FR4B 1AZVA 2EIMB 4TVPL 4X7DC 3RDTD 4DETA 3L9RA 1ZU8A 2WMGA 1FJ1A 3AFBA 1P6AB 3GHRA 2WKGA 3DC0A 4I87A 3U2JA 1WBYA 4LEBA 3DMMC 4JM2A 4MS6A 2F54A 4G7YL 4X7CC 2Z1WA 4LX4A 1KN2L 4N28A 4U1GC 1AL8A 4MMWA 4V1DE 1HTYA 5A6LA 1DSWA 4O58L 4WDWA 2DT3A 5FR3A 4C6FA 4PI0A 2XVNA 4DN3H 4K8RL 3H24A 3QFJD 2EDLA 1RY8A 4IT1A 5J9PA 3SO3B 5E9DA 4G9FA 4UT7L 5DO2D 1BCIA 3D0LB 3GEWB 4EF3A 1UZ4A 2NV2A 1Q90A 4H1LH 5BO1H 1G0CA 2QCEA 1KR0A 4RE2A 3NZGA 3CCHB 1MW1A 5T8IA 2HH0L 4L0YA 2C4FU 2H2SC 4POYA 2FQFA 1AGBA 1IBFA 3NK3A 3DFPA 2H1LM 2OX5A 3NZSA 3CFIC 4QJ3B 1IAMA 4A2GA 2GZXA 4ATWA 1YPIA 2BCKA 4OM1H 4Y7MA 5C09A 1XEDA 1YADA 4KKLD 2V2TB 2UZIL 2W61A 2UY5A 2TMDA 4K7VA 5DLCA 4DXVA 4O0QA 3DOHA 3MXVL 2QFPA 3WUEA 5EO1B 1NAMA 1RJZA 2IGFH 3PVFA 4GKZA 1XGQA 1A3LL 1YQ2A 2IMMA 5IF0B 4JHOA 1RBLA 4GSQA 1OT2A 2CHZA 4CL7A 4QGTA 4C6DA 3ZW3A 1GGCH 3GIZL 4K7PH 3C5XA 4YYCA 1X5HA 5K9QI 4WI3A 5HHVL 4TVPE 4AIEA 4G6JL 3OG6B 4OLUL 2FTYA 3GH7A 2HCZX 5B8CA 2G0KA 5AB2A 3NDYA 2H3BA 2J47A 1ACYL 1J8SA 4Z1BA 3W24A 3XINA 2BSSA 2F15A 1HSBB 1JRHI 1GUVA 1AYOA 2BVUA 1KJ2B 5D4IA 1CB7B 3LRHA 1TTFA 4LGRB 4I90A 4MKVA 4PGCA 3GB6A 3IUDA 2VUOA 1TVLA 1G6VK 4J8QA 5KVDE 5FEWA 5CGYD 2XTJC 1ACXA 5DJ0A 3S96A 3LCFA 4GIOA 2Z7WA 4ABVA 3FQRB 1TXKA 2GB2A 3NVQA 4WUKH 3FYIB 4EQ2A 3MLXL 1TX2A 5CQ1A 3EWDA 1A6PA 2ISFA 4LSRH 1AS7A 2E6QA 1ADDA 2PURA 1OO2A 3ABSA 4ALAL 4PTVA 4XZUB 1YPXA 1D5XA 2J1XA 2W1NA 3VFWB 5C92A 4D1IA 3TONA 3NP4A 2XCMC 3GSOA 5FC9A 4ZMOA 3BLIA 5A8NA 1MHCA 1R5IA 5AY7A 1M41A 1OC6A 4OZHA 3WIHL 1YXDA 1R4XA 4LCCC 1WDRA 4DQWA 3KVJA 1CJYA 1QPQA 4A2HA 3PAJA 5AFDA 2X38A 1E9IA 3FHEA 4M1GH 1RJRA 3J7HA 4JGMA 2ADYA 1NTHA 4WSHA 3LCLA 4I7VA 2W3ZA 2JTDA 1KM5A 4C59B 3EGJA 2EG6A 2NQLA 1EAPB 3CPLA 4X5LA 5I71C 4NQDB 2K9FB 4MA3B 3DXIA 5CLYA 4JRLA 4N22A 3V7AE 1A49A 1IKFH 4GLRH 4MS8C 5J12C 5LJYH 3CZNA 4GVGA 3EUUA 3OB8A 1JYVA 2PF8A 5E6ID 4O10A 4BY3A 5DMIH 1EANA 2NMSA 2WZ6A 4X99A 3IAGC 3CYVA 1YLBB 1NOFA 4XODA 4F58H 3I3BA 3R18A 3T0DA 1KCKA 4AMAA 1V6TA 3HHSB 4GS7B 4NP4L 1LE5B 4GAJL 5JHBA 2YLKA 3FZUC 4DN4H 5IFAH 4XUYA 1Z3GL 1QBAA 1NUNB 2W9LA 3MRGA 4HDIA 5F1IA 2WZPD 1HNFA 2YPKA 4EDXB 1LE9B 1CB4A 3EAUA 3CH9A 1IM3A 3ZIZA 4U4IA 5E99H 3HM7A 4AVHA 2OJZH 2Y1YA 5JZ7C 2GJRA 1U8PA 1GZJA 3EG9A 4M29A 3VNZA 3QJVB 4KKCD 4IX2A 2QHAA 3ARFA 4AV5A 2QUUA 2RALA 4JY8A 1YPFA 4OZFG 4NC0B 3HS8A 3DSNB 5DD0L 3IDNA 2N56A 2BVYA 3LN5B 4OLYL 3U5UA 1H0GA 1URIA 3PP4H 3MVSA 1AD4A 1WB0A 3LDVA 5DMJB 4QXVA 4A4AA 1CQKA 1AYRA 1C12A 5DVMA 3RNQB 4UMSA 4HJTA 4XBEL 3ZKSD 1DANU 5BCAA 1GKRA 1OE3A 3EYVA 5EZOL 3CLEH 4HU8A 3PL6D 1LUCB 2K70A 3MUUA 4LE8A 1E8YA 3GTTA 1EUTA 3II2A 4EQ3A 2G95A 3QMTA 3EDDA 4Y2DD 5HGHA 1WGOA 1B2WL 1DQLH 1G7QA 3IGAB 2PCQA 4YQXH 4DLMA 3AB0C 3L95B 3AQDA 1KMGA 1OEPA 3QV9A 3N42F 4YLBA 5DJ6B 1L5GB 3IDMB 4PJAA 1A1OB 4PJHF 3B0VC 3IK4A 5D7JD 3SGKC 3NOYA 4OJFH 3QSRA 4NX0A 5ECGA 1K7XA 4RMBA 1F1GA 1RUKH 4H1LA 4H88L 2XM1A 3PHSA 3PWJA 4BK8A 1CE1H 1DHKA 3CN0A 1UKPA 2BH0A 4A3QA 4LBEB 1OX4B 2BSLA 3B8UA 1F5WA 3VXNA 5A7BA 1G43A 4TSAH 3SDDA 1HQ4A 1WAWA 1YEJL 4JRXB 2WLLB 2QZQA 4LAQL 1P6CA 2OWXA 4K71C 4HK0A 3C2AH 2QCDA 4OGYH 3PAYA 5MEOB 3RLGA 3UTZA 5CSUA 1NAKH 1T8XA 3CAFA 3EGXB 3ARDA 4KFNA 3FO1A 2AS5M 4HSQA 4M61A 1ODAA 2DY2A 1KN4H 4WNJA 4QPEA 3W39A 4OCYH 5E1GA 3GZKA 5FCZA 4XCYA 4HHLA 3C0LA 1IAIM 2O61B 1EDGA 4EZMA 1CG9B 3QEQD 1AZ2A 3JXAA 1DQQA 3EBAA 1BG4A 3K7UA 4ZUSB 1RAMA 3I84A 1B3YA 1SFTA 2ZD0A 4UC5A 2F6XA 4FQ1H 3U1QA 4B91A 1IT9L 1XBVA 1XIWD 3D9AH 4PUKA 5FO9A 4U33A 5DJ0B 1KCSH 2XG4A 5AHFA 1G6RB 1PSKL 2OM5A 3MNZB 1CBVH 4A8NA 3WNJA 2FFCA 5SWSE 1D3CA 1LGVA 4RNHA 5DVNA 5DHYB 4QO1B 3ZKNC 4L8BA 3BP7B 2YSWA 4PTUA 5ERWB 4PMRA 4OOUA 4GIRA 3QEUB 3IFNH 4NZRL 2FWSA 1KIPB 1WCGA 3H4GA 4QGCA 5AECA 2P24A 4NQED 3TESA 1M03A 4C6NA 3S5LG 1OAZH 3LKQA 2FFIA 1MAJA 4U3HA 4NYLB 2V6HA 2HT3D 4X8CA 2XQ0A 2AJUL 4KROD 1ZLPA 2DBLH 3KL0A 4JGDA 4OZFA 1EERB 4Y2DB 5BQ7B 5ITFA 2X0SA 3M41A 4AZ8B 4PVNA 1W9DM 5JIKA 2OMWA 4K7YA 3SQSA 1KCRH 3EFFB 4Z7VF 1BF5A 2BINA 3F5JA 2W9MA 3AXLA 1UXMA 4LRNH 1UOZA 1EVUA 1YPZB 2J8UB 4G7EB 5EL1A 1FO0B 3U0PA 2WB7A 4AQZA 3KPRD 4LKCA 3PUEA 1D5ZA 5IQ9B 2GJNA 3D5OF 2ZOWA 2P7TB 1GKOA 3KJ6L 1E4WL 2VLLB 1GS6X 3HIZA 3FT3A 3P2TA 2V5KA 3AG3B 2XG5B 3TIDB 4F2ME 4AG0A 2WKOF 3GR4A 2GTZA 5B1AB 4KI5C 3MCMA 2H1PH 2HLEB 4JVWA 4LWWA 4UILH 1XWVA 2EDKA 1MLBB 4XNMB 4X4YB 4NJJA 2A21A 5ESAB 4BZ1L 2B20A 4ICXA 4HK3N 5HJLA 2WJFA 2Q20A 1TQSA 3ZDZF 3PYCA 3QHOA 3VIJA 3WN5A 4JFDE 4PREB 1XYMA 1K5NA 4N7QA 1HINH 4LARL 4LL4A 3DMMD 4WFHE 5HHXL 3WMCA 1L0PA 3SQMA 1O75A 2MJWA 4OKVB 4NJKA 3FT1A 2K45A 3HG1A 2DQTL 2CE6A 1HHHB 1AQMA 1KIUB 2APTA 4LSSH 4WGVB 1W9BM 2GQ9A 3FQWA 2OKTA 3AYSA 4X9GA 3FFSA 5BXFA 1SFDA 1U5HA 3LN3A 5DLML 4UQBA 1HN1A 2C9SA 5SWZE 4GT7A 2BY3A 1CXFA 4K07A 1N19A 1H63A 1W37A 2AITA 1AGDA 1GW6A 2BWIA 4W9JC 2X0UA 2J5WA 2Z7KA 1H5BB 4OJDH 4URKA 3DUGA 1TO4A 3GSQB 5TQ0L 4CADA 4JIRA 4S3FA 4BV1A 2Q1EA 1ZAHA 4B5TA 5AC7A 4PRBB 2A3TA 2ZICA 5DURD 3BH8A 3QEQB 4ZUVB 3RP1A 3PJXA 2WTRB 3ZKXC 5IW3A 3SE9H 3GTIA 4FTVD 3B4NA 5DHXB 5ID0A 5K4XA 1K5NB 4FFYL 3QR3A 4FQCH 4HGMA 2QVFB 3LH2L 1TQBB 4ODTH 1K1DA 3R43A 3SE4C 3FF7A 5EU4A 5CHNA 5G5DB 1YEHL 3MKKA 2YK1L 3TR2A 4Z2HA 4PCNA 3UYOD 4L1LA 2MQ0A 1H0DB 3RIKA 4Q9CA 1R7AA 4WJ5B 4LNVA 5HULA 1X4YA 2JALA 4L4TA 2NQDA 2R1LA 3KRUA 1RK0A 2WVVB 5B7FA 2BJMH 3PIQB 4G5AA 3JWDC 5I77A 3FV9A 3MO4A 3E6FB 1JTPA 1R5WB 4K23L 4M8UA 5DUBB 1KN4L 1U8IB 5GRJH 3VI4F 5CSRA 3SCMB 3VIFA 5K39B 1L8NA 4DYEA 3ZHKA 4OCLC 1UUNA 3RUGB 1ZZMA 1U8OB 4OZGF 5F7KC 3GY1A 4LEFA 2DWEB 2R83A 2V2WB 1U2YA 1RHHA 1WGVA 3MPCA 3VKKA 3MNVA 2MSPA 4KXBA 4XPHL 5CAYB 1N59B 1IGWA 5I6SA 3K4ZA 1IGSA 4L4TB 3GWQA 1RK1B 5DUPH 1H7OA 5E2VL 5AALA 1DO6A 1IGJA 4KX8A 3NCBB 3S35L 2H32B 4H0HB 4MDIB 5C0DA 1QTSA 2WUCL 5CEYB 1G7IA 4JZNB 2EKSB 4AIOA 2HSAA 4POCA 4HIEA 4AWTA 2PPDA 1N5YH 4NHVA 1RK0B 1FHNA 4HJFA 1GAFL 3WGUB 1KIPA 3AJ7A 4Y6GA 5EY5A 4YS4A 3C5ZC 2YYTA 2HE5A 2DEXX 2Y1HA 5EA9A 1W80A 1CDGA 1GKEA 4M6NL 1MF2H 3DG7A 5DO2C 3PBYA 3UT0A 3GU2A 1R3JA 5I8EB 3RB7A 1S3KH 1U95A 3CK0H 3CH0A 5I00A 4Q97A 2IWFA 1E9PB 2RD0A 3D25A 2HWZH 1Q6QA 3BJLA 2LU3A 2QIIA 4FOUA 5LHDA 2YD2A 1VGKB 1CDIA 1J0ZA 3O3EA 3AWEA 3ARDB 3BH9B 3BQUB 5EUOB 1ML0A 3BW2A 4OJEH 5DCEA 3FO9A 2YXFA 4IMKA 2J3SA 4QP0A 3FUJA 4JMNA 4OCWL 1A8ZA 1XLEA 3VABA 1BP3B 5EUOF 3INPA 2XVLA 3W9ZA 2P10A 1WZMA 4LASH 3SDDB 2B1OA 1ZPTA 2QSQA 4GKNB 3LRMA 1WOAA 2EHHA 5ACLA 4LHUD 4RDWA 3UESA 5IM7A 1SLWA 2FECL 4WF7A 4O16A 5EU3A 5MEOA 1BVKA 4D6EA 1DIDA 1JWSA 4J9JA 5I16B 4KGLA 4APXB 2BERA 5J13B 5KBMA 3SE8H 2BDQA 2ESVB 2QJJA 3OZLA 3D85B 4G1EB 4FLSA 4A66A 4H9MA 2I17A 5D1XB 1AOZA 4B0MM 4Z1DA 2Y7QA 4OCXL 2DKSA 4JTFA 4ODHH 3KCLA 4JFOA 4XC3H 2QW5A 4WR3A 3QQ3B 1OD8A 2B7QA 2HS8A 2XWTA 4XMVA 3VXOB 1V02A 1A7OH 2NWSA 5SX4H 3NQCA 4ZMPA 1BXXA 1G4RA 2BVOB 3KCWA 2D7MA 1YDOA 1MUJB 4HEPG 4OCNC 4IHBA 4HV8A 4OD1H 4AYFA 3QZAA 3BXWA 3TTOA 4E4UA 1HOCB 3EMZA 1RP8A 4OF6A 5TK4A 3PTQA 1XFCA 4MAVA 1KELH 4Q2ZA 2VLKA 2WN2A 5DJXB 5A16A 1J8KA 2CXEA 2PB1A 3RCMA 1KC5H 3IDGB 3SKJL 2WCSA 2H8ZA 4H0LC 5B3JF 3UAJD 3UAAA 2HN7A 4CKVX 5GS0D 4XBSA 3Q8CA 5IBTH 3X3FH 4K3ZA 2OFJA 3P9MB 1CK0L 1JNDA 3L17A 1I3UA 4NRXA 1BJMA 4UAHA 2G37A 2L7QA 3P6LA 5DCCA 1NSNL 3QP3A 2WKOA 1IM3B 1X5KA 3K0WA 1N0LB 2RCSH 3FU8A 1E5AA 3HBQA 2OMWB 4AWJC 3WMBA 2IBZY 1PZCA 5LHFA 3NIDF 1VIZA 4GI8A 4ZO7A 2Q86B 2H8PB 2YN5A 3MYOA 4I9AA 2QJDA 2VKXA 3ARDD 4OF3A 2QR6A 2K78A 3ZTNL 1YDVA 5ISZB 4ZQKA 3BP6B 2CA4A 4F8OA 4H9VA 6PCYA 2FMOA 2BNQB 1XO8A 4F3FB 1WA2X 3SDDD 2AQRA 4FNRA 1CPUA 4AOFA 4RX4A 5ICUA 3H9YA 4M62L 2DWDB 2CJUL 4YIWA 3QXWA 3VWKA 1QO3B 2G30A 4AVIA 4F1SA 4R26L 3NQIA 1VFTA 1XCFA 1NFAA 3KLHC 4ZW8A 3T6ZA 3IGHX 3QORD 3QCUL 4HC1H 2AJZB 5E4AA 3T09A 4L9LB 3RVWC 4NPYA 3PF2A 3S98A 2ZRUA 3QH2A 1OQXA 1Z2KA 4G9FE 5EF0A 3ETSA 4OLZL 3KCPA 4UR7A 4E9VA 1FH9A 3V6ZB 2FSDA 4EI5A 5KW9H 2SODB 3P30H 4N25A 1RCYA 1KTDB 2EDOA 2D2CC 5D1QE 3SDYH 1FG2A 1AFVH 3EKGA 3L4UA 3L2NA 3PANA 4UWQB 5BZXA 43C9A 6XIAA 1GMIA 4OZOA 2EYTB 3QJOA 5DZOA 2BIQA 1F8IA 4DP9X 2GUOA 2HT4D 3N12A 4GXWA 3SQLA 4BCYA 3HJZA 3GB7B 4L9LA 5F6IC 5C0IA 4LBEA 1OX4A 4V33A 1LQ0A 1NDVA 4J1OA 1DFXA 2EYSB 3FO2B 3L3GA 4PJDF 5EV7A 3D3VD 4JR9H 1FWWA 4QE1A 3UXAA 1QO3A 1YKWA 3KWSA 4JX6A 4GAYA 1KPVA 1NC4B 3M88A 5C0EB 1KFWA 1JGIA 2F8IA 1OHZA 4WSKA 1Q72H 3I7QA 4JTAA 3SSGA 5H37G 3WNLA 4P2VA 5MEND 2AQTA 2B1AL 3CMOL 2P8MB 2O26U 2HVJA 2Z64C 2EDTA 4UIMA 4NO0D 1FUYA 3WKYA 2B31A 2VP8A 2VZVA 3BD5A 1NFDA 1EC9A 4XPBL 1KWKA 3TYGH 1H51A 3WQ8A 3UGXA 3WLHA 4POZC 1PMYA 1QRND 1AKPA 2WXDM 2Y25A 4GXVH 3O9WB 4J7RA 4DO6A 2I5YL 4XISA 1SFJA 2HP4A 5D7IE 1Q13A 1N55A 3CL7A 4WVXA 4YEEA 4XCNB 4JZ5A 2JK2A 1N64L 4W84A 1HKFA 1WIPA 4K5NA 4NRXB 5CCJA 2NDFA 3DTXB 5IEHB 4IX0A 3A5VA 2EXTA 3ZY7A 3N14A 1G6CA 5K9JL 4PLJC 5IHUH 1FCVA 1A66A 1PLGH 1BDYA 1I9RL 3HMXL 3LS4H 4GRLA 3WSUA 2WXIA 5HHOB 4MJMA 3KLAB 1QAWA 3K8LA 1AANA 4K3DH 4DQOH 2R69L 1IE4A 2EYRA 5F72S 1MF2L 5LN4A 2G5UA 5HY9A 1YBQB 1FH8A 3LTYA 1MY7A 3P62A 3HMXA 4GQ0A 4YEFA 5JQ6H 5D7SH 1WVZA 4YXHL 2NY5H 4XKYA 2WJEA 1ID2A 5G2WA 3DDGA 2BVOA 3L2IA 1H3GA 4XNYL 7FABH 3UA4A 2HUEA 1MDTA 2E74C 2R29L