2WVTA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 156
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvtA01
4B9ZA 3MSDA 1JXJA 1RP9A 3CZKA 1YHTA 3L4UA 2BVTA 1HP4A 2F7QA 5A8QA 3WNLA 1E72M 1R7OA 4BA0A 2UY5A 1W3JA 2CERA 1UD2A 3G6LA 3TTOA 1FP8A 4WK9A 4PMYA 4HA3A 4D71A 2F7OA 4F9DA 3W6LA 1U33A 4ATWA 2CBUA 1MVYA 3BVVA 4PCSA 3B9DA 2JF7A 3AFBA 2VX6A 3EJRA 3KLLA 3AJ7A 1WO2A 3PZQA 3AIVA 4IPNB 3NJ3A 3S2CA 3D52A 2Q8XA 3W37A 1DWFM 2PWGA 1WKYA 3AS0A 1V02E 4Z2GA 3CBWA 1CECA 2IXUA 3NCOA 4MJ2A 5D8WA 4DUWA 4FLSA 1RD6A 4W8AA 4FLQA 2XIIA 3S6TA 6CGTA 1W9PA 3RMEA 1CXKA 1NH6A 3CUIA 3MMDA 1HXKA 1B3VA 1C92A 2WMHA 5D8ZA 1Q6CA 3UG3A 3BVWA 2BVYA 1TCMA 3MS8A 4UFIA 3AHTA 3PBGA 3VGGA 3VX1A 3RO8A 3EJQA 2ZE0A 1GONA 4B3LA 4MDOA 1WZKA 4D6DA 3IJ7A 4LPCA 4PYSA 3ZM8A 4UQAA 1MFVA 4D6GA 4DM1A 3CIVA 1KXTA 1JZ2A 5BXPA 5CJ5A 1E70M 1X6LA 4UZUA 4R27A 2CXGA 4LXFA 4QFUA 4JKKA 1UD6A 2CETA 2PWEA 4HPHA 2RGLA 1KCKA 4MNMA 3BAWA 5I0DA 1V3LA 1J0JA 3M6DA 3GXNA 5ECUA 1QHPA 2J7FA 1PZ2A 4AEEA 1XSKA 3MUY1 3VDBA 3KL0A 1CBGA 1OM0A 5HXMA 3OZOA 3LXCA 4HZ8A 1WDPA 4WSKA 1XD0A 4OUEA 3WH6A 4BQ4A 2X2IA 3ARWA 2CBJA 1RPKA 1XRVA 3VD5A 3WD4A 4CN1A 5LA1A 3CZJA 1VBRA 3L4YA 3ARUA 3AMGA 1TMQA 4P7QA 1H49A 4Z2KA 4P7OA 4D6HA 4CU8A 1BGGA 3GXFA 2EQDA 3VSUA 3WDPP 3AS3A 1B1YA 3IANA 3WNOA 2VURA 1EH9A 1G0CA 3DYMA 3I3BA 4GI8A 1DEDA 1QOXA 2WSPA 3PZUA 1H5VA 2VX7A 2OSXA 3O9NA 3OLDA 2VI0A 1UD3A 1E6NA 4W89A 1RH9A 4KRUA 2GJPA 3VGDA 3WFLA 2AMGA 1CXEA 1VB9A 3BSHA 3ARYA 1FH9A 2RGMA 4U3CA 3L4ZA 1EXPA 3TP4A 1KB3A 3W28A 2ZUTA 1GJWA 1GQJA 2ALWA 2ZXAA 4MPKA 3VMOA 3TA9A 5BYWA 3WF3A 1E15A 1V3IA 1C91A 2ZIDA 2E40A 3UG5A 2XFFA 1BG9A 2W5FA 4P8VA 2W61A 4PTWA 1W3KA 1K9DA 3CUHA 1KGUA 6TAAA 1JYNA 4BF7A 3D5HA 3W25A 2XGIA 5FKYA 3ZJ6A 3RILA 3FN9A 5ABFA 4Q22A 1WDRA 2O9TA 1CGVA 2WHMA 1C8QA 5AY7A 2GJXB 1JZ4A 2CESA 4MTVA 5M17A 3AYRA 2C7FA 1OCQA 1V6UA 1TR1A 1MXGA 5CGMA 1C8YA 1WB0A 2YLLA 2A3BA 2WC4A 2J7BA 2EPKX 3MUAA 1R7AA 4B15A 5DFAA 3CZNA 3OLEA 3IK2A 2F1BA 4AXNA 1JD9A 3L4XA 3OBAA 3IAQA 2VX4A 3T08A 1F4HA 1JYVA 2VQTA 4NZFA 2OWWA 2WMIB 3F4VA 5A6KA 2E0PA 2X2YA 4AZ5A 4MB1A 3W4RA 4CGTA 2WKGA 3K1DA 2YFOA 2WKLA 3AXHA 4ZE4A 4AZIA 4J3WA 1M03A 1KQZA 4DWSA 1K9TA 3A21A 2Y5EA 1YQ2A 1MQRA 4NXSA 1D2KA 4F8XA 4CCDA 4E2OA 1W2PA 4KRTA 1B31A 1ISXA 1FHDA 1LL6A 2XSBA 2FH6A 4JZ5A 1BGAA 3K8LA 3BSGA 3WBEA 1EO7A 2V3EA 3HMCA 1H3GA 3CUFA 2WC7A 3A4WA 3KWXA 1J11A 2QV4A 2OWXA 3W82A 5D9PA 5EMYA 3MKKA 1FA2A 4TXEA 3CH9A 4M80A 1CPUA 1F4AA 4CVWA 1UKTA 1MQQA 1J0YA 3RJXA 2Y24A 3WUEA 1H0GA 2ZUSA 1V6XA 5BXTA 3SCWA 3AZTA 1E6QM 4ZXOA 1V0NA 4AYGA 2TAAA 2Z1KA 3UEQA 2DT1A 2BY0A 2FGLA 3NSXA 3NSNA 2DGAA 1CZ1A 5DMYA 4QCEA 2WVSA 5IFPA 4ML4A 1JD7A 1JI1A 1H1NA 4U2ZA 4WLCA 3FY1A 1PIGA 3VGHA 1PAMA 2WPGA 4FNQA 3U5UA 4WJXA 4HMDA 4PTVA 2D1ZA 1NP0A 4TTUA 1J01A 5A8PA 3TV8A 1VF8A 3SCOA 3A4XA 3WENA 4YHGA 5CPSA 2YA1A 4PTMA 3QHMA 1EQCA 2E3ZA 3T0DA 2ZUWA 4EANA 4W7UA 3BLPX 1E6PA 5BWFA 2XVPA 2FDMA 3UERA 2DQXA 3HG2A 4CD4A 2D24A 2C8NA 5TD4A 4JFUA 3LXBA 1KGXA 2VZSA 5CXPA 1BHGA 3MV11 2AOSA 4QCFA 3TONA 1M53A 1QW8A 3SUWA 5DEZA 3CGTA 1JDDA 3WH8A 3CMJA 2ZX9A 2X8RA 5CLTA 4W93A 3SUTA 5HDRA 3WBAA 1KWGA 1GQKA 2J77A 1HJQA 1TQUA 2A3CA 2YL9A 3MMUA 4EKJA 1JYWA 4UFMA 1VFFA 1Z32X 3DX3A 1NOWA 1H4PA 3QOMA 4D6FA 3ZQ9A 5CZKA 3AYSA 3BAKA 4AEFA 5FCZA 3SUSA 1E9LA 5I23A 1LG2A 2VL4A 5BCAA 4MB5A 1EHNA 1R87A 2A3HA 3GNPA 1GOIA 1PZ3A 1CGYA 2Y8KA 1WZLA 4NXKA 2GJXA 2ESCA 4F9JA 4OBSA 4MNKA 4HPGA 1E3ZA 3CO4A 3IJ9A 3DECA 3RCNA 1HL9A 1CGXA 3VDCA 1QI3A 3QHOA 2WM0A 3D3AA 1KGWA 3WNPA 2F18A 4PUDA 5IDIA 2XYLA 1HT6A 4Z2LA 2V5CA 4PCTA 4AZCB 5M3WA 5I6SA 1TA3B 3D4ZA 1PPIA 1B30A 2XVNA 5A6MA 5D9NA 3SEPA 4YPJA 4BZYA 3N9KA 1R75A 1V6WA 3A5VA 1HVQA 1BLIA 2YDSA 2D2OA 4CU7A 1NWRA 1AVAA 3K8KA 4KWUA 4KMQA 4WKAA 2XPKA 2F1AA 4A3YA 3ARXA 2VVNA 2FGZA 2BNJA 4FLRA 4AZBA 2FHBA 2O9RA 5IXEA 1BAGA 4J7RA 5A2BA 3FXYA 2D22A 4GZEA 2WHLA 4M82A 1UHVA 2CNCA 1FFQA 4W84A 1US2A 4X0VA 2YKKA 4JCLA 3MU7A 4UQBA 1CXHA 3DX4A 8CGTA 5A8MA 1JL8A 1NP2A 2OSYA 3WY1A 2VNCA 4WKHA 3L4VA 8A3HA 1AQ0A 3VIFA 2X09A 1CENA 3AIQA 2EADA 3IJ8A 1XCWA 2MANA 5D4YA 3T2OA 6A3HA 2WVVB 1R85A 1RP8A 2VMFA 1V0LA 3DX2A 4PMDA 4TVDA 1MXDA 4QLKA 1J0HA 3WD1A 4ATLA 1UR9A 2OYMA 5E0FA 2YA2A 5CLWA 1JNEA 2IGTA 3BMVA 3WDQA 1H2JA 1JGIA 4KGLA 1S46A 1CNVA 3OG2A 3N1AA 1PX4A 1DTUA 1K9EA 3T0BA 5LA2A 3WL1A 5DO8A 2VR5A 5AYBA 3VPLA 1EDTA 1DWAM 3BXWA 2O9OA 4V27A 3BH4A 3SCQA 3ZT6A 4ZENA 4J3XA 1UYQA 2BY3A 3T09A 4CN4A 2W91A 5DT5A 4JL1A 1M01A 1WPCA 4AY1A 2A3EA 1UA7A 3AHXA 3LMYA 4OOZA 3II1A 5BXSA 4HA1A 5CQ1A 4MAZA 3ZSSA 1B0IA 5A6BA 1VENA 1E1FA 4AZGA 3IAPA 3VIPA 1J10A 3AIUA 4P7NA 3VD4A 2WMGA 4N42A 1ZS2A 1E0VA 4UQ9A 4H8VA 1XH0A 3VUPA 3POCA 1GCYA 4UFKA 3W0KA 4AW7A 4BQ2A 3KE0A 1TUXA 3WF2A 2WK2A 3W6MA 4PMNA 1EIBA 1FFRA 3WF0A 4U31A 3PZIA 3DHPA 1EQPA 3SUVA 4E4PA 1SYTA 3D51A 4BQ5A 4QP0A 1MW1A 5BXRA 3BMWA 5E6ZA 2EABA 2F2HA 1Q6DA 1XH2A 1UR0A 3VILA 3WH9A 3ECQA 4ACZA 3PHAA 1ISYA 2XFYA 2GUYA 3I3EA 1UH2A 1GOOA 1PS3A 3CHFA 3MUZ1 4A3HA 2VRQA 3DC0A 5FD0A 4IM4A 1O7DC 4JKMA 4Y7EA 1E56A 4BQ3A 1GQLA 4E8CA 3GBDA 4JHZA 1KTBA 3UESA 1TFVA 1ESWA 1UUQA 3NDYA 1MW3A 1QHZA 2WCSA 1UR2A 2G3JA 2QPSA 2XSAA 3MMWA 1UH3A 1XYFA 1EHAA 3LPOA 1J9YA 3CZ8A 2PWDA 3WMSA 1ZBCA 2DEPA 4UR9A 1UH4A 1W91A 3O2LA 2DH3A 1E6XM 4MAVA 4AIOA 4AZCA 3LPPA 4BCEA 4JFTA 5A6SA 4PMUA 3N17A 2IXVA 3AIWA 3GZAA 3AOFA 3ZIZA 4QLJA 3OLIA 4AD5A 4GPNA 3MSGA 4XZBA 1C8XA 3TTQA 1NWTA 3T2QA 3AS1A 3CHEA 5A3HA 3WY2A 2XIBA 5A8OA 5KEZA 1CGTA 1R33A 3K46A 2WMFA 3W26A 3FHAA 1E3XA 4M56A 1OBAA 1IZJA 2CIPA 3NSMA 2BHUA 3G6MA 1PJ9A 4J27A 1V02A 1R46A 4PSPA 2E9LA 4LYRA 1QX1A 3AZRA 3BUIA 3VNZA 2DT2A 3VINA 1KTCA 1QVBA 2XM2A 5JIWA 1QI5A 2DIJA 4JFWA 2WVVA 1LWJA 1GW1A 1HJSA 1W3HA 2WWCA 4DO5A 2WLZA 5BROA 1TG7A 1PX8A 2Y2WA 3VDHA 2WW5A 1JYXA 2YLAA 5EFFA 4CUCA 5A69A 3UR7A 4FNRA 4U2YA 3CPUA 5HPCA 4ATDA 3CZEA 1MQPA 1HJUA 4TVUA 1V0KA 2ZX8A 4MNLA 1HX0A 3AXIA 3GDBA 1UZ4A 3WQ6A 3VGBA 2WYSA 1QW9A 2V3GA 2WVUA 4OJYA 2XTKA 1I75A 3CUGA 1JZ6A 1XH1A 3RM4A 2G4FA 4D6IA 5E09A 3ARZA 1KWKA 2CITA 2VCBA 4C7GA 3LX9A 3A47A 2ZX6A 2XN1A 4XUYA 4UNIA 1NQ6A 2CKSA 4Q7NA 4J3SA 1VIWA 1CIUA 4UOJA 4A4AA 2O9PA 1ITCA 2D23A 4GINA 2JFEX 3LRLA 2VQUA 1FH8A 3THCA 1ZL1A 3U7VA 2XHYA 2WCAA 1R86A 4OOUA 2G3IA 3PTQA 3FNDA 3M7SA 2QF8A 3SCUA 3ZJ8A 3VM7A 1VBUA 3K4AA 1X6NA 1CDGA 2W63A 2JALA 1XC6A 3PZOA 3VIJA 4Z2HA 1EDGA 2WMJA 1LWHA 1US3A 2XVLA 1UKQA 3WDJA 3W81A 1UWQA 2HISA 3PZMA 3OGSA 3ZR5A 3THDA 1ITXA 1VJZA 1XV8A 2GK1B 4NSBA 1UR1A 4W7WA 3WFZA 2WMKA 2NT1A 1MFUA 1BFNA 3AI0A 1JF5A 2ZXQA 2CYGA 3UR8A 2YIHA 4AD1A 1GNXA 2XUCA 5LA0A 1VEOA 4ACZB 3F5LA 4LYQA 4U3AA 1CXIA 3AMCA 1NOUA 3HG3A 1E1EA 1PIFA 3PZVA 4CVUA 1U30A 5CG0A 4RE4A 1JG9A 2FYVA 2WBKA 3VTRA 3U57A 5IHSA 4UTFA 4NRRA 5HNNA 2J79A 3VX0A 1W9UA 5FIPA 1W32A 4M1RA 2GFTA 4GKLA 2XN2A 4ZXLA 1MWOA 9CGTA 2WC3A 3TTYA 2OW7A 3DHUA 2NT0A 4HOWA 2UWFA 4NZCA 1XGZA 4OKDA 4GZJA 5JBEA 4EAMA 4NI3A 1NM9A 3WELA 3A3HA 4W8BA 4AZ6A 4FMVA 4TTGA 3BAJA 4XZWA 1IV8A 1ZBWA 1QNRA 4N0RA 2VX5A 1I1XA 1GUVA 3ZJ7A 2J7EA 4RE3A 2OWCA 2ZX7A 2UY3A 3W53A 3N11A 1ZB5A 4H7VA 5I3DA 1KXQA 5CPQA 1B2YA 1LL7A 2DT0A 4UQCA 2VTFA 3BCDA 1M04A 3MUIA 3AHZA 3N12A 1J18A 5JBDA 4XX6A 4DWSC 2BY2A 1E4IA 4AZHA 3CMGA 1SMAA 5AC5A 2F7PA 5JUVA 1E71M 4DM2A 1GVIA 1FHLA 1Q6FA 4GIAA 4HA4A 4ZFMA 4H8UA 3AIRA 1LJYA 3U5YA 4S3JA 2ZXBA 3WNNA 1B90A 2WZIA 5GNZA 1HTYA 3AISA 1GJUA 3QR3A 4D1IA 4MB3A 3GH4A 1D7FA 4D6EA 3HZ3A 2WXDM 3PN8A 4JCMA 5E0CA 4ZEPA 1SR0A 3GXDA 3E1F1 4MJ4A 2C0HA 1EOKA 2WANA 2ZWYA 4RE2A 4V28A 3EJPA 3WQVA 1WDQA 3UCQA 3SCPA 3WUFA 1E73M 2UY4A 1GHRA 4DWSB 1K9FA 2YDQA 1HNYA 4HU8A 3VIOA 2CHNA 4R5EA 3CC1A 3VKKA 1QNQA 3O6AA 3KL3A 2F7RA 2X0HA 4J3UA 1BG4A 1QNSA 5I77A 1TZ7A 1CEOA 2QMJA 3OGVA 3EDKA 4PMVA 2BXZA 4MDPA 5C8BB 1T0OA 2CKRA 1FH7A 3OB8A 3H54A 3FW6A 1C7SA 3WMCA 1E5JA 4PMZA 2YBTA 4U33A 2X05A 2J62A 2VUYA 2HVMA 3EDDA 1JI2A 3WKZA 5E70A 3WY3A 2XWEA 1R8LA 3F5JA 3DDGA 2UY2A 2XVKA 3HU7A 2WNWA 4HU0A 5A8NA 1UR4A 2VZOA 4GZIA 1QI4A 2J74A 1HL8A 2XJ7A 3VD7A 3A24A 1JDCA 1LL4A 2WBGA 2XWDA 4IUGA 1W9XA 2D0HA 1UA3A 3ZO9A 3WDIA 3OZPA 3VDAA 3RDKA 1JF6A 1OD8A 2GK1A 3WSUA 1CLVA 1OINA 3NDZA 1UZ1A 1VAHA 1E55A 2G3NA 2WCGA 1FP9A 4J28A 1KQYA 3WQ5A 1HWWA 1MW0A 4WF7A 3WD3A 3NUKA 1WNOA 4AISA 1ZJAA 1WAWA 4M24A 2QHAA 3MI6A 3VD3A 5A6AA 3GXIA 1QBBA 1HKKA 2GSJA 4AD0A 4UQEA 4AWEA 2BY1A 2V38A 3EBVA 4H04A 1W1VA 1OWQA 1QWUA 4W5ZA 3EJSA 2OYLA 3DX1A 4B16A 4L4PA 2E8ZA 5A6JA 3AICA 5I5RA 3MANA 1H41A 1JFHA 2V3FA 3QOKA 3OLGA 3VIKA 1Q6GA 3VSVA 5M03A 4AMXA 3WEMA 4CCCA 1W1YA 2X2HA 1L8NA 3CHCA 4QLLA 1W9VA 4KH2A 4C7DA 5I78A 1LF1A 5D9OA 4UOZA 2VZTA 3SUUA 5IFTA 1JXKA 4W88A 4YN5A 3ZJKA 1W1TA 3FHQA 1V0MA 4PBGA 1V3JA 7CGTA 2AAAA 1H0IA 3AIEA 5AC4A 5HOSA 1ZJBA 1EO5A 3D50A 3BUPA 2QMKA 2J7HA 2CPUA 3M46A 5E1QA 3VNYA 3BAIA 2WHKA 3BC9A 1ZBVA 1B3WA 2A3AA 1NWUA 4H8HA 2DSZA 5ABGA 3WUBA 4XV0A 4IISA 4UOQA 3UETA 3RJYA 1IT0A 3VGFA 2CCRA 5ABEA 3PZ9A 4CD5A 2FHCA 5FOOA 4OZOA 3VVGA 4M29A 3SIMA 5A1AA 5F7UA 3WY4A 2XVGA 4MADA 1CYGA 4NX0A 1JAEA 4Z2JA 1CWYA 1HXJA 2EO7A 1LLOA 1AQMA 1KXVA 4P7RA 4D1JA 1CGUA 3BGAA 3SCSA 3ARQA 3ARRA 1PX3A 4TX8A 7A3HA 3VGEA 1XSIA 3AXXA 4OBRA 3JUGA 5KZ6A 3EJUA 1J12A 2YL5A 4EE9A 2EAEA 3WH5A 1XCXA 2G3MA 3EYPA 4K68A 5ABFB 3ZT7A 2DSUA 2WB5A 3WMBA 1C3FA 3AQUA 2X2JA 1BTCA 3FAWA 3T2PA 4AD3A 1UWSA 3EDFA 3K4DA 3K8MA 5M5DA 1PEZA 4S3KA 1HN1A 4F79A 1K6AA 2EACA 1BVNP 3LRKA 5E6YA 3W27A 1G94A 5CGTA 1JAKA 1V03A 4NRSA 1HF6A 3VSTA 2CBIA 5CPTA 3CZLA 4W85A 4DUVA 2D73A 4GQQA 1HVXA 3BVTA 1HJXA 2DPEA 1GOWA 4L4OA 4GI9A 1UKPA 4HZ6A 5E9AA 2J7GA 3EDEA 4JFVA 3GXTA 3WF1A 2JE8A 1TVPA 4FLOA 2ZICA 2VCCA 4AMCA 3GXPA 1JNDA 3VIGA 1WDSA 4FNSA 1ZBKA 3BVUA 1HKJA 3GH7A 4CU6A 1DWGM 4LX4A 4JAWA 4BS0A 1DHKA 3VU2A 2WHJA 1KCLA 3ZMRA 1QBAA 1OT2A 3GM8A 1MW2A 4FK9A 4QDMA 2VVSA 3VIHA 1O7AA 3IGUA 1CGWA 2V5DA 1W1PA 3LPFA 3A6OA 1ISVA 4ACYA 4GXPA 2VRKA 3LXAA 1V6YA 3RPMA 1BVZA 2VC9A 4PN2A 3I3DA 5I2UA 5BRPA 3EJTA 1GOMA 3N04A 1NWSA 1J0ZA 1R34A 3VOCA 4D72A 4V2XA 1GHSA 4URIA 1HJWA 2PWHA 4D6JA 4WSJA 5A6LA 3ALGA 4IPLA 3CHDA 1LG1A 4KGJA 3EDJA 1TQTA 3WN6A 2YJQA 3DDFA 1QI2A 1WZMA 1TVNA 2J75A 4W87A 4GQRA 3W29A 2OYKA 3W38A 2FH8A 4FNUA 3CZSA 1W2VA 1CXFA 4WKFA 4TUFA 1FOBA 3WL0A 2EPOA 4UFLA 3VD9A 5CSUA 1BQCA 1EGZA 1KBBA 2EPMX 4PMOA 1CTNA 1V08A 1L0PA 3BAXA 4UQDA 1H09A 1O6IA 4W86A 1QNOA 5GNXA 1GVYA 2F8QA 1TQVA 3VO0A 1GOQA 3J7HA 2JIEA 4U5IA 3WNMA 2J8GA 1V3MA 4QAWA 1V3HA 4GI6A 2E8YA 3GH5A 2JF6A 3BUQA 4AD4A 2BHYA 4P7LA 4RL3A 1BPLB 1BF2A 5JBFA 1VFMA 1W9DM 2W4XA 2CBVA 1GZJA 1KBKA 1AMYA 2WAGA 1HJVA 2CEQA 3QHNA 2GDVA 1C93A 4YHEA 2OSWA 4CD7A 1BYDA 4X9YA 1JZ8A 4U5KA 3ZSTA 4OGZA 2JEQA 1B9ZA 3L2LA 4AMWA 3PTKA 2GDUA 3TOPA 1U2YA 2F61A 3BLKA 3ZT5A 3BLBA 3LPGA 2E9BA 5DT7A 1JZ3A 1QNPA 5GNYA 1B3ZA 3W24A 2J47A 4JHOA 3SURA 4JL2A 1WZAA 3KZSA 4AC1X 1Q4NX 3WD2A 2ZXDA 1QI0A 1UKSA 3KEHA 1E43A 4B3KA 2DSKA 1SFSA 3GNRA 3EMCA 3ARSA 5C70A 3S5YA 1C90A 1OD0A 3H53A 2BS9A 3WQ8A 5GQBA 2WVTA 1PBGA 3OIHA 4W5UA 3OA5A 1OT1A 1BYAA 1IZKA 2Z1SA 2VJXA 2WZHA 2J8FA 1W9BM 2VOTA 4M81A 1WE5A 4FNPA 2D0GA 2DT3A 3ARPA 3H55A 3CUJA 3DYOA 2EPNA 2YBUA 4AZ7A 1G9HA 2VR4A 2W92A 3FAXA 5D9MA 2BHZA 4J3TA 1EA9C 3WDHA 4J3VA 1JZ5A 1D3CA 1BYCA 3GXMA 1TE1A 2X1IA 2GVYA 1UWRA 4HZ7A 3AMKA 1UD8A 1GPFA 4TX6A 1EDQA 1E6SM 1XD1A 4HMEA 3B8SA 1TA3A 5GPRA 3L4TA 4P8WA 2BXYA 1XHGA 3GTNA 3WEZA 4DO4A 1BYBA 4UCFA 4TVCA 1DP0A 1B3YA 2ZWZA 3GNOA 1UR8A 4FF5A 2BFGA 3VMPA 4W7VA 4PRWA 2DSWA 2XFRA 2JIWA 2X0YA 4XB3A 4HP5A 4F66A 4H41A 3WD0A 4DUXA 3GYCA 3WIJA 3MV01 5I79A 2YOCA 3LRMA 1HP5A 2QPUA 1OSEA 1UKOA 3L4WA 1VEMA 4GO8A 1DWIM 2OLHA 5HBFA 2Y8VA 3BUBA 4UFJA 4EK7A 3RM8A 5A6BD 1OGSA 4UZSA 3WEOA 3UG4A 4D6CA 1GQIA 4NF7A 3AMLA 4JFSA 3NIYA 1A3HA 3SCRA 2EEXA 3POHA 4PTXA 2OW6A 2G41A 3EMZA 1HKMA 3RIKA 2J4GA 2VT0A 1UWUA 2WZEA 3B9EA 1UASA 1VFUA 4Z2IA 3VMNA 2QLYA 1V3KA 3TTSA 1Q6EA 2VZVA 2ZOXA 4H2CA 2ZUUA 3A22A 4AIUA 3APGA 2EPLX 4CD6A 3A23A 2B31A 5BRQA 2WWDA 2EJ1A 2V3DA 3T0AA 1I1WA 3D4YA 1OIMA 2YDRA 5A94A 5A95A 5C71A 3U7BA 1QPKA 3AZSA 2WSKA 2IUZA 1BSIA 1UG6A 2BVDA 3PTMA 1OGGA 2DSVA 4UFHA 4JKLA 2G8ZA 4LGXA 3MO4A 1E4LA 1QHOA 1UD5A 4CCEA 1E5NA 3SCNA 4CKQA 1CXLA 1GORA 2W66A 2XG9A 4P8UA 2D3NA 4HMCA 3PZNA 1OIFA 5EB8A 4CD8A 3B9AA 3ZR6A 2VZUA 2YA0A 3AIBA 4HOXA 1WP6A 5FL1A 4CN6A 5LYRA 2D0FA 5AYIA 1H11A 3AMDA 4PSRA 1P6WA 1C7TA 4OIFA 5A2CA 1V6VA 5CSYA 1JZ7A 1AQHA 3OGRA 4NZJA 2W67A 2ZUNA 3CTTA 3QGVA 2J78A 5HPOA 2PWFA 4PMXA 1TQSA 2DIEA 3N18A 1G1YA 3KL5A 2E9MA 3BCFA 2YL8A 4PEEA 1ODZA 4JIEA 1JDAA 2Y4SA 3PZTA 2D3LA 1E6RA 1N82A 1UWIA 1ECEA 3WNKA 1Y7VA 1EOMA 2VO5A 3VIMA 3ZOAA 2E4TA 1W3LA 1JFXA 1E0WA 1KR0A 3DX0A 2EBNA 1QWNA 2XN0A 4MB4A 1E4MM 2FHFA 1SMDA 2O92A 2PBGA 1LQ0A 1WCGA 1CLXA 3KLKA 3AROA 1XYZA 1HIZA 2NW0A 3WH7A 2DDXA 2YFNA 1HKIA 5EBAA 3HG4A 3DYPA 4P8XA 1DWHM 4AYSA 1E4NA 4ZE5A 1G5AA 3VIIA 2WLYA 1NARA 4B9YA 2EXOA 4LYPA 7TAAA 3SCVA 5I24A 2DH2A 5A2AA 1G01A 2PC8A 4W8LA 2D20A 1VRXA 1TQWA 3HN3A 2NSXA 3SCTA 3WQWA 2PBOA 1ODUA 1ZU8A 1UWTA 1E0XA 3VM5A 4MNJA 2VCAA 3BVXA 5ABHA 4AIEA 2JEPA 3ARVA 4GO9A 3AS2A 1VJSA 3CLWA 3L2MA 4PMRA 3WDRA 3N13A 3HG5A 3CZGA 5JIPA 5EFDA 5FL0A 3AHYA 1KR1A 4LQ1A 2GJRA 2YL6A 3BUDA 1VEPA 2PB1A 1SZNA 1UOKA 2BV9A 4PUEA 2ZX5A 3WQ4A 2PF0A 2J25A 1KFWA 1B3XA 1J0IA 3CV5A 3GBEA 1ISZA 1J0KA 1E6ZA 2ZUVA 2W62A 3ALFA 3BAYA 1VFOA 3M07A 1A47A 2VRJA 2XM1A 5IHRA 1OB0A 3WUGA 3F5KA 1X1NA 4PMQA 4X0NA 1JIBA 4FNTA 4HTYA 4TOQA 3RM9A 3NYDA 3N15A 2FE0A 1M7XA 1ISWA 1R47A 4AD2A 4DO6A 4HOZA 1E40A 3EMQA 4WIWA 1UQZA 1XSJA 1KXHA 4DWSD 3A4AA 1NOFA 3ARTA 5DF0A 4E8DA 1UQYA 3AHVA 1DWJM 2PI6A 3WF4A 1GOKA 4M8UA 2J7DA 3HJEA 1MYRA 1OGBA 4C7FA 1UD4A 2WMIA 3PZGA 2J7CA 2XGBA 2ZUMA 2CHOA 3S5ZA
chains in the Genus database with same CATH superfamily
4AQOA 1SW3A 4S3DA 3MSDA 3C8KA 4PUBH 4Z5RB 1J5DA 1G84A 3CZKA 4A7SA 4K7FA 1VKXB 2WNNA 4PLOB 2BVTA 1H15A 3L3GB 1HP4A 1WA1X 3B56A 2IDCA 1QLFA 2XDHA 3WNLA 1M1XA 4LVNB 1RUAH 3BGFC 1DQUA 1VGKA 2H9GB 3MRRB 1DQLL 2FFCA 4ADSA 4LMQI 2BZCA 2FPTA 4YVUA 3QS3A 4G3YH 3ZK0A 4OZFH 1PO9A 3KCJA 4PJ8A 3TTOA 4JREC 1A5AA 4KKQA 4WK9A 4ABVA 5JMUA 4Z7NF 3JZ7A 1R3RA 2D7PA 1KTJA 1E28B 4HJ1A 4OT1L 4WTXA 4KS0A 3TJLA 4F9DA 3MTWA 4Y19D 1U33A 4IYKA 4NKIL 4Z7WA 1N67A 2CBUA 4AQ8C 5I18H 4FQCH 2AV7A 3TF4A 3ABZA 3BIKB 2QADB 3B9DA 3MXVH 2ADIA 4AVOA 1NGWA 4W9TA 3GSNB 3WTTA 3GAYA 4RAUA 4RDBA 1C29A 3KLLA 3M45A 3EKLA 4WZHA 4JGUA 4A8IA 3ITXA 4M0XA 1YRRA 1WO2A 2DTML 15C8H 1H3VA 1MJ8H 1NCIA 4MTMA 3LSCA 3ESVF 4E9SA 5IB3A 1VPYA 2XTSA 3D52A 3K80A 3QFJA 4R7DA 1DWFM 1TZZA 2GW5A 1S7UB 2A21A 1WKYA 1UP3A 3VFRA 2CLVA 4RGOL 4OVUA 4EN3B 3EAUA 1OAXL 1IIKA 2WMPA 3CBWA 1CECA 1RR2A 1WBYA 1NPJA 1ZHBA 1IU1A 1XGTA 2AKRA 2BVQB 2VSKB 3ETTA 3RB5A 2WJFA 3SGZA 4KHXL 2CJSA 5ENWA 4W8AA 1ADQH 2WXLA 5CR8A 5FF7A 1MHCA 2O0TA 4PRAA 3P84A 4S39A 3HPXA 4QTHA 1B3VA 1MIMH 2QJDA 4GSUA 4WU5B 3SE4A 4Z76A 2WMHA 1Q6CA 3UG3A 2RCSH 3O8XD 1FSKB 3BVWA 3PWJB 1A1MA 1SY6A 5C0BB 4UFIA 2C3VA 3MRCB 3K3QA 4PAZA 3EJQA 2Q2EB 2ZE0A 5EY5A 4I0PA 1EFXD 4MDOA 4FXFA 1VFLA 2F74A 4JFDB 2H9AB 3E6EA 5I09A 4H1LA 4H8NA 1PLBA 3FHEA 1UGKA 3IJ7A 3Q5TA 3EH1A 1MFVA 2Y7QB 1NFDE 3W74A 3FFCE 1HNFA 1J5SA 4XH2B 1JGEA 3WLBB 1KXTA 4X6DF 4YHML 3VTTA 1JZ2A 1TEFA 4YXKL 1M05B 2NZIA 3S7GA 1X6LA 4DJFA 1PAZA 5DEFB 4UMAA 2FWSA 3UCCA 1GGTA 1FDZA 1YEEH 4LLWA 3MJ8B 3C6LB 4LSVH 2HRLA 3SDXB 3FQNA 4YBQC 3H12A 4R27A 1MNZA 3PWGA 4GAFB 3KAOA 3EHBD 4ODXA 5JQHC 1RV6X 3JV4A 1AXTH 4PGZA 4N86A 3P82A 5CD3B 4QG9A 5DBUA 2ALAA 1DJYA 3R0NA 2PWEA 3MV8E 3TBCA 2DI9A 4HPHA 3VKJA 1C8VA 4LNCA 2YBVA 3HF3A 2EGZA 3DHFA 4PLKC 4GY1A 3OOQA 2CXEA 3PNUA 2APBA 3CHVA 1V3LA 4BFBD 2JGYA 4OFIA 3FQWA 3MRFB 3O0FA 3W7JA 5BOJA 3II2A 2J7FA 3W7GA 4OLZH 1UJQA 3GSOB 1NFGA 3JZEA 3O7UA 3WCYA 5T3XH 2E6QA 5FJUA 3IKCB 2IAMA 3OZOA 5GRXG 4MS8D 1UWGH 4JPIA 1R3JB 1EERB 1K7FA 4I5UA 6REQA 3O4LA 3LQGA 4U0RB 4NO2A 3AREA 4IWWA 1LRNA 4J2XA 1ZK5A 2XQBL 1ZPTA 1UWYA 3C08L 5CBEA 4AGQA 4O57A 5CJ8A 1AP2B 4Z7WF 2VDNH 3EO1B 5MHSE 1XLKA 1RPKA 1XRVA 5MEPA 3GD6A 4G1MB 3OR7A 3VSQA 1OSZB 3WD4A 3SPVB 4CN1A 5DMNA 4POZC 2PKDA 3CZJA 2A7RA 3KBVA 5EU3A 4MHBA 3ARUA 1QOKA 2GTZB 1XGQA 1TMQA 1X7FA 4CU8A 1H49A 2PR9A 4G8EA 5EN2B 4PJGF 2QCNA 3QZ6A 43CAA 1BQ5A 3QRLA 1WT5C 2CGRL 2EQDA 4KMTL 1FDLH 3STZB 2X4RB 1JNJA 4YWSA 1LQBC 5E5MB 4G6KH 5I1EL 1DLFL 4HK7A 3WDPP 2WB1A 3SRDA 1TJRA 3AS3A 4IUGA 3TQPA 3GNXA 1YUKB 2GG1A 4HKBB 5CJQH 1D3GA 2I7GA 4UQIM 3CBKB 4GA8A 4FA3A 4G8FA 3DYMA 1K77A 1EH9A 3I3BA 4LPXA 4NQQA 3CZFB 5FM5O 3HAEH 2YYUA 3N43B 3CDFA 1QOXA 5C07E 1DANT 1JPSL 1KFAH 1RUPL 4FJZA 2ZVRA 5JH2A 3RWDB 3SDDD 3QW4B 3C09C 4YL9A 5DWUH 3C86A 1OARL 4NBZB 3IGSA 4NUJB 4FXRA 3OLDA 4GXVL 1KG0A 5C0BE 1OM9A 1SVCP 2RJMA 4Q9RL 1EZUA 1C5CH 4RW5A 4PRHD 2J44A 5IW1B 2P46B 3N85H 5KZDA 1JOIA 1RUQH 3W7KA 1NKOA 1T3FB 1CXEA 1II4E 3WFLA 3DUUA 3CYJA 5AVXB 5EUOB 1AE6H 5KJ7E 4U0RC 4L0ZA 3KPPB 4L3FA 4M6AA 4Q9QL 5DJ6B 1WOBA 1F97A 3G5YB 4NT6A 5AOZA 4L1TA 3N3MA 2R94A 3W28A 3E2SA 5DJDB 2IOOA 4XO5A 3UA3A 4LAQH 1GJWA 2ALWA 3L1OH 4NWTH 3ELAT 3HC4L 3FQRA 4HHWA 2HUHA 4PY8I 4GSRA 4WDWA 2BCKB 5LGHL 4ZUSB 5HHMB 4IU2B 1MUCA 2DJUA 4WIQA 2ZC1A 1SXSA 3GUGA 1SUXA 1EC8A 2FNBA 1BG9A 5EC2B 1MDLA 4HK3N 2KT6A 5FOJA 1QFWH 3RZCB 1DE5A 1Q7ZA 4HH9A 1RJZA 4K3HA 3L3KB 1JYNA 3TQKA 5E8OA 5JOFB 3MCLH 1L6XA 2B2XL 3QJOA 4ZQTA 5MENB 5ABZA 2XGIA 1F18A 2GVGA 1VPOH 3VG9B 3D5HA 3P0YL 4N6EA 5FKYA 3CM4A 4Q8UA 3O3UN 2JTDA 1L7IL 4HH8A 2VM9A 2D7NA 3NG5A 4ORGB 2EXYC 5CINL 1EUUA 1R3KB 3SN0A 1SN0A 2APFA 5FUZL 4WUUD 4O4WA 3D8MA 4ENLA 2O30A 1S8DA 4AQ1C 1YE4A 1QFWM 1YHPA 3UBXA 3B2DC 1FWTA 4LVFA 4MTVA 5IKCA 2PS2A 3NGFA 2Y72A 4KZCA 2P8BA 2PEVA 1OCQA 1OAQL 1A7QL 2H3KA 3ABXA 3PLYA 2YLLA 2QJNA 1SQ2N 2R29A 4N5UA 3HBGA 4EI6A 1SSDA 4DQOH 2QUNA 1K6QL 4ZG1A 4S1DC 2ARJB 1XGYH 5KAQG 2XZAL 3BKML 4Y8DC 4O53A 3TJHD 4M8QB 1HEHC 1MCSA 2MCMA 1RQEA 4F20A 3LRSB 4H9MA 1TJ2A 2WZMA 3N85L 4NQDA 3W1ZA 3IK2A 1YO4A 5ILTL 2Z28A 3TMQA 1MNUH 2H3NA 2X0VA 4XVJH 3CCHA 2EIZB 3D39D 3OBAA 4GXVH 4DGVH 5LJYH 3OPSA 2P5ED 4UM9B 5DUPL 2QIWA 2QDGA 5DQJA 2QJJA 4JGDA 4R3UA 2UX6A 5IVNA 2AEQH 2IANE 2VQTA 4XMLH 4EOUA 35C8L 3ARDA 4APQA 6FABL 4PS4H 1CL7I 2P8LA 3PQYA 4L3EB 5EU7C 4LKCB 4GOSA 2XG5B 3HGJA 2GYIA 3M41A 4IJCA 2B14A 3CV6A 1QAWA 4GXFA 1T4KB 3BESR 4ZFFA 5LBVA 4H4IA 3EOUA 5DZJA 1Q9LA 4ZAKD 3K1DA 3B4UA 2YFOA 2AW2A 5JZ7C 4TMCA 4CNIA 2ZONA 4WDIB 2KZHA 4G42B 2QIIA 4WO4D 5C0EA 4AZIA 2YEZB 4LDEB 4JO4H 4RDQG 3SQBA 5DFVC 4WY7H 2GFBB 2R4SL 3NIFF 1IE4A 4DWSA 2OTWB 5AOMA 2XETA 2YCIX 4O8RA 5ENLA 1Z41A 1K9TA 3FBKA 3A21A 3EXRA 1YQ2A 2QLVB 5E8PA 3NJMA 1A6UH 4S3AA 1POJA 5E6IB 5LZLA 4L8CB 2I5QA 4F2FA 1JPMA 1W8OA 3PFRA 4MIMA 3HS0B 4KRTA 1NGYA 4MASA 5D1QC 5D7IF 1Q0XH 5C6WH 4HX1A 3DC8A 3IV3A 2GIXA 4LEQA 4H3DA 1RUKH 2J88A 4JZ5A 4YJ5A 2FJGB 2XWRA 3KYMA 3WBEA 1KLYA 1IKFL 3WGVB 3WBWA 1H3GA 3GNMH 5J12B 4NAMA 1RVFH 1VFAA 2CLVB 4G9FA 4HJJH 4PJ6A 2VENA 4Q9CA 5H35A 4JFPA 3EKGA 4KROB 5BVPH 3P8IA 3TMLA 1WCQA 5IR1A 3CEUA 4PB0L 2WINB 3CH9A 2YXVA 4ASTA 5F7EL 3PQYD 1RSCA 4Y4KA 1E2ZA 4J4PD 1OPGH 2GHWB 1O6TA 3CSGA 3G08A 5M7QA 1HZLA 2PAJA 2VXQH 1F4AA 3QJZA 5CBBA 3B5GA 5K2ZA 2Y07L 1UKTA 3B34A 1AXTL 1MEXH 1R3IH 3R1GH 1J0YA 4I85A 2V5YA 4XCCL 4Z76B 5C8JB 3DOSA 5I1HH 1U95B 3LTPA 3F03K 3WKMH 3WXVL 1AH4A 2AGKA 4KW2A 1JULA 3VA2C 1FLRH 3FQXA 4HKJA 2RFXA 1SO5A 4LYQA 3RRAA 1V6XA 2ZG3A 3FMGH 4O02H 5CJXC 1G6RA 1U8MB 3VRJB 1HC1A 1YYML 4AOFA 5ICYB 3MJ6A 4DEUA 4JGMA 2DMKA 3RL1B 2MNRA 2AJXL 2AK1H 4OD3L 1Z1WA 4P05A 4JRLA 1KT2A 3KG5A 5HVGB 5H2BA 2QJHA 3SCWA 4AUBA 1P84J 3BXNA 3IBOA 3MVTA 1E6QM 1K7EA 1J1PL 1ZRQA 1S5TA 1SFJA 2QR0A 1V0NA 2I14A 4OCWL 3FDKA 1AD4A 4KY1L 4ZOCA 4Q3MA 4G43B 3PG9A 3KPRA 4U1HA 5AWNH 2K6ZA 3X3FH 4OM1L 3IF1B 1SEQL 4YHOH 3G5WA 2IANB 3HS8A 4L5FE 2FEDD 5CUSL 2DT1A 4DYKA 3SADA 4OIAA 1F56A 3ZTNL 3T0WA 2FVNA 2L8AA 3OG4B 4IK6A 3QWOB 5ID0A 2FGLA 3NN8B 3FKRA 2Q20A 1CZ1A 1ADQL 3QDGE 4Z77B 4QCEA 4XCYB 1ZJHA 1IYXA 3RIFK 5CZXC 1DL7L 1B54A 5IFPA 1GC1C 1H1NA 2WB7A 3UAJA 4Q6IA 4Y4KD 1ZEAH 1Y1UA 1UZDA 1MCLA 4X5LA 1G4MA 3LRHA 5D96C 4J2PA 2Y06H 4ABUA 5KSVB 4WLCA 3WLOA 4WNJA 2ZYSA 3VGHA 4AQEA 5H91A 1K3UA 5FUOH 3MRKA 2APWA 3RP1A 1JGVH 1ZA6B 3ILQD 1QFWI 3TN3A 4AIBA 4ZTOH 1HSAA 5D72H 3C0SA 3U6XS 4PTVA 3RBGA 1KD0A 4WHBA 5GSVB 4B4HA 5FSDC 1BF8A 2ZCHH 4TUUA 2P52A 2VDKH 1HCYA 3LZOA 1NP0A 1YNYA 1AS8A 3TV8A 2PZ0A 1FC2D 4C83B 1NCNA 4Z7QB 2M83A 3US1A 1O5KA 3SCOA 1R2SA 1QLEH 2B59A 1B4RA 3FTUA 1GVFA 4IJTA 1URIA 4O5LH 3HM7A 3QC3A 1CLYL 3PL6B 2MCPL 3QHMA 2V2XA 4LNRA 1O5DT 5LHDA 1ZT4B 1N3NB 2ZUWA 1YKWA 4W7UA 1TYJA 1LDSA 3VCLB 2ZAGA 3STZA 1GW9A 1U91A 2FDMA 3FLUA 3GB7A 1F2QA 2VWTA 3R8RA 4R3SA 3WKQA 1OIOA 4ORIA 4CD4A 1JZJA 4JN8A 1FJ1A 4PJFE 5KSWA 3GMPA 4WOQA 3LTVA 4IRSA 3TCLA 1LGVA 3NQ7A 1IM9D 3HG1A 4BI7A 1V54B 4N4YB 2AOSA 4FX8A 2FATH 2KZBA 3TONA 3KPLB 1QW8A 3FUFA 2OMVA 5JH1A 2MIZA 1A1OA 5FGCE 4ES8A 4EP8C 2EXWD 4JRXB 5I0VA 2XGZA 1UUOA 4EWND 3DETC 1JDDA 2OQJA 3CUZA 3WH8A 4FKEA 4O2EB 1SZEA 5G4WA 5D4IA 5FW8A 2UYLA 5ITFA 3C60C 2X8RA 5CLTA 3NSCA 2CMRL 2YQGA 4OLXL 2HT4C 4GYPA 5HP5A 3OPZL 4PS7A 1V5XA 1N64H 5HDRA 1T3FA 4X5RA 4DXXA 3ZWSA 1KWGA 1G7LA 2XPYA 1SYSB 2J2ZB 4L5ZA 1GS7A 3HS9A 3N42B 1KEGL 3UXLA 5I6PA 4LSPL 1J2WA 1JQXA 3N34A 4CKVX 2ODIA 4QX4A 2YSTA 4M6OH 1HINH 1DEEB 2A6JB 4AM0B 4PI0A 5EO9A 2ASHA 1MREL 4PE8A 1N8FA 4BKLA 2BVEA 4DKEH 5CPLA 4NENB 5EBUA 4RX0A 5HSFA 2ZUQC 2J6VA 2YB1A 1NOWA 4GS7C 4A2EA 4HLJA 3MRPB 4D6FA 4J6RH 3UZEA 2AS5M 4BWLC 5FCUH 3NXLA 3E38A 4G6AD 4DPPA 1MFAH 1EP1A 3AYSA 3BAKA 3JWOL 1BVWA 2V30A 2VLKB 3E0IA 1E9LA 3OX8B 3BGGA 4MA3A 5F9AC 2QVHA 1DBJL 1DQVA 4FXKC 5BCAA 3MLXL 3EB2A 5I1AB 1RZJC 2CBOA 2F2KA 2KZKA 1HINL 4HFUH 4PJIE 1T7XA 1YYLH 5DU7A 4A35A 4HT1L 2Y8KA 3DVGB 4XOAA 4PJEB 2GVJA 2BSEA 4MWAB 3W7DA 4DNMA 4F9JA 1TEGA 1S8DB 1OQXA 1AHKA 3QEGL 4FNLL 4OAWA 1ZLSH 2HTMA 4IDJH 4J2MA 5B80A 4MAYA 2VO8A 4DAGH 1E3ZA 3TBBA 3CO4A 1QBLH 4HVXA 4EI6B 1TZIB 3BQUA 3TROA 1RZKH 2MQ0A 2N3JA 4L5FL 5AVQB 1EXUB 2WM0A 1PSKL 3VXUA 1KGWA 1HS6A 2J24A 3QXBA 3VDGA 2PGEA 1EK3A 3CL8A 2JB5H 4BDVA 2XFGB 5HDQL 5I8KH 1ED3A 3JVFC 1ZVHA 1IJNA 4LO9A 4I9AA 3BKJH 3COOA 5DA4A 1H3XA 4OSUL 3W1QA 3S46A 2EYTB 5J6HA 1Z3GH 3CB3A 4U1LB 1ZT1B 2WAQA 2WQXA 4ONHB 1P4LB 4O16A 2IBZY 3ESUF 4QD2E 5C6TL 1WCBA 4PCTA 2OXGA 1XC4A 2UV3A 1THCA 1PQZA 3O41B 4JM2F 2VERA 4L5FH 3X1BA 4D9LL 1LHZA 4G83A 1ICPA 3F64A 2YC1B 3CN0A 1TA3B 4NQ1A 4M3PA 4F8OA 1B30A 4QRFA 1XF5B 3W0WA 4DVBB 4KQ3H 2I07B 1YIXA 2M2DA 2NVCA 2XINA 3B1TA 5A6MA 5GGUA 4TV6A 2OULB 2UZIL 3FC8A 3GO1L 4ENZA 4QYOB 2Y1YA 4ODHH 2ATPB 1HNGA 3DROA 4WNQB 3ZO0A 4JFED 3GGWA 4DP4X 4YCOA 1PNCA 1Q9LB 3FSAA 2V5SA 4YXGA 4C6CA 4AMKL 2YDSA 5D6CB 1H6TA 3K8KA 2YAQA 1YMME 2X9XA 2JJUA 3OVQA 1FPTH 5GHWL 3FB6B 3KVJA 4A3YA 4MYXA 5MHBA 4IBWA 3BLDA 3UNDA 1T1XA 2EYSB 3UR2A 3O6YX 4QTFA 3I6KB 2VIRB 1XDLA 2VWEC 3VFUA 2HVBA 4P2YA 2AEOA 5CLZA 5I71C 4GZEA 2R2EA 1TVDA 1Z7JA 3V0IA 4G6ML 5EIVA 5C7HA 1UHVA 2FT7A 4HJFA 3TO4B 2OSLB 4N8VA 3ZE2B 3ATZA 5K4XA 2HP4A 1QRND 4ICNA 5MKGA 4JCLA 4KVPA 4UQBA 1XH3B 4LESA 3MU7A 3DX4A 3GZPA 3VRIB 4WK0B 1VPQA 4R4FH 4Z8FL 1Z42A 2CKBA 1JXDA 3BE1L 5JHDD 2NYZA 1AJ0A 1JL8A 3TTEA 4MCNA 4PRNA 1JWUB 4TVPD 3DKLA 2P1YA 3GLCA 4YNGA 3B8IA 1XXFC 2CLRA 2VNCA 3WY1A 2C14A 2C9SA 3FQTB 4OU1A 3RU6A 8A3HA 4PLJC 2GUUA 3RKDD 3QZEA 3VIFA 4ZBCA 3A4FA 3SE6A 4YSEA 2IWEA 4X5PA 1FVEB 1P4IH 1UENA 4JFYA 2OXHA 3T6CA 3LNPA 6A3HA 1FWXA 2WVVB 1R85A 5E4EB 1IFHL 3OZKA 4PPTA 4OFVA 4PCFA 4O12A 2UUDH 5EO0B 3RA7L 3T0XA 4PMDA 1FFOA 1M5WA 1Q0EA 1UW9A 3UYIA 4E6MA 1COBA 2OX1A 3WD1A 1O60A 4ATLA 4IIBA 4F40A 1UR9A 2XFXA 2XQ0A 4N0UE 2YA2A 7PCYA 1QFEA 4C6MA 2BDQA 4QRQB 2VGFA 2LAGB 4JKWA 1YX1A 1BJMA 4PJDF 4WENB 1N8ZB 3NA9H 1NCBL 2R0LH 4FQIL 4RNRB 2ZF9A 4HA0A 3GFUA 3TR2A 1FHNA 3HRPA 2I5GA 1WAEA 3IETB 4PRPA 1CNVA 5AZ0A 4TO8A 3VK5A 2V6HA 4M6UA 4FX7A 4G7EB 4PJDB 2NVAA 5IGXH 2JI3A 2ZOLA 1S9WB 4F3FB 5JYMA 4U1HB 3GLEA 2B3IA 1ZNNA 1HYSC 3THML 4M6NL 4R9HA 4S3GA 3KPSD 4JFQA 1RVFL 2O5XL 3RFZB 2GOKA 4HIXL 5ID0B 3TYCA 3VPLA 3B9NA 2VKXA 3EOAB 3V4PA 4P99A 4GG6F 1DWAM 4BHYA 3SDCB 3L08A 1TLMA 2C9AA 3BH4A 5IHBA 1BFVH 3OZYA 1V7ML 4EIVA 7ENLA 1X97A 4CW1B 3IJ6A 4EUPB 3N9GL 3FF8A 2XTJC 5IW3A 4ZENA 4GEIA 2IH1A 4JY6B 5ICZB 2IKHA 1S2WA 2NY6D 4CN4A 3FCPA 5CAHA 4K94L 5J1AA 4HUXA 5I66B 1G9EA 3D3FA 2PXYA 3SZKC 3I10A 3PSWA 5GJTL 4NASA 2CD0A 1U8CA 5DT5A 3ECVA 4HIJB 3VTAA 3NPUA 3MRKB 4JL1A 1BKSA 1WPCA 3GSNL 1GMIA 4MZ3A 5E9NA 1A2YB 5L7XL 1BD2B 3FF7A 4YWGH 2J27A 3R13A 1BXVA 1PKOA 2DQHH 3IDGA 3DNKA 4Y16C 4HA1A 3GBMH 3CNYA 1L6SA 4GUQA 3MDJA 2ZQKA 3A6BH 1RZFL 4S1DD 3JU2A 4DEFA 3KPOB 4MAZA 2X4UB 3V5DB 2W60A 1RUML 3MLVH 4BEUA 5F0JB 3S3CB 1XCQA 1TKWB 4JAMB 4K7VA 5D2LB 1ZCCA 2XTLA 4IEFA 3Q9PA 4HETA 1VENA 1I4FA 2XN9B 3UPRA 3Q2CA 2G2RA 1BQUA 2BC4B 4JRYE 1QR1B 1E1FA 3O6KH 2ATKB 2DQFB 1XP3A 5F2LA 3KYOB 4AZGA 3EUDA 4JQAA 4IBQA 2RAMA 1EF2A 1F4XH 3VIPA 3AIUA 1DJZA 5AZEH 1W8NA 3ITYA 2WMGA 3CN4A 4X4XA 1ZS2A 2Q87A 2OO0A 4JNMA 3HG1B 1BCIA 1MEXL 3E6FA 3R1GL 4XCCH 5C0GA 4XNQB 2OMTB 4QHPA 4H8VA 5GS0D 3MLTB 1XH0A 1XM3A 3LI0A 3UJFA 4F58L 4UFKA 4F2TA 4I1NB 3GTTA 3NJLA 2R1WB 4KITB 3RWCB 4AEHL 3VWKD 1XUUA 3WF2A 3F7QA 1IE5A 2WK2A 4JFZL 3HE6A 4HSAC 3UTQA 4YDIH 1EIBA 2DQJH 1FVCA 1L7TH 2V7HB 1N5YL 4WVXA 1KB5H 4FQQA 5D7EA 2QCDA 2PTTB 3Q43A 1IKFH 1YDYA 3O3RA 3LV3A 1N59B 4KF1A 4GG6A 2XYBA 1NSNH 1R3LB 4LJ3A 1YEHL 5DMGC 2A6IA 4P57B 3CBRA 3OPUA 1DDTA 3F00A 3F4WA 3IJEA 3QDJA 2KKQA 1YPZF 4OZHE 1OCRB 4XT1C 3KBSA 4QP0A 2H6RA 1ZANL 1E4WH 4NO0B 4LLVB 4BKLB 1M42A 5C9JB 3SE3C 5FFLA 1F74A 2NY7L 3WH9A 3ECQA 1T04A 4YO0B 5EPDA 3B9KD 1MLBA 3CLFL 4LEBA 4N9OB 4ERIA 3I3EA 1LLAA 1B3IA 1BBJA 2OA9A 1PS3A 4YWIA 2FK9A 2AMUA 2FQEA 4IM4A 1H3TA 1BVLA 3EIFA 3OXRA 1OFAA 3GK8L 1BM3H 2I9LB 3TC9A 1LEGB 1E56A 3NQEA 3ARFC 2B20A 5I8KL 5I3GA 4NWTL 2OX5B 2X2GA 3MRJA 4YTSA 3MOBL 4OLYH 1GQLA 2H5UA 3K6SA 1AZUA 4CJ0A 3QUZD 3T0EA 4KO9A 1KYUA 3S37H 3GNDA 2VLME 4PV9A 4LF3A 5FKAB 1EXGA 3ZHNA 4M61B 3CFIC 1K1DA 3DRQB 4AYFB 5JXED 1X5GA 3D08A 2SODB 3ULUE 3NDYA 4RDWA 1OTTC 5FJIA 4KZDL 1ET8A 3ALWA 4X5WB 2FCBA 1AGBB 3T3MF 2PDXA 2QPSA 3EO9L 2CO1A 3FU6A 1UH3A 3SZ6A 3DN5A 4BY3A 1W54A 1L9SA 3Q01A 5FB8B 2I5IA 2PWDA 2CC0A 3BDYH 4AC7C 2R83A 2WKOF 4PJGB 1F05A 3H9SA 2JJWA 1W91A 3O2LA 3N2OA 3CEPA 1OP3K 3TDFA 1A0QL 1MFAL 3ITVA 2OJ1A 3HV8A 3MACH 2R2BB 5EU5B 5FCUL 2HE8A 4LVGA 5F93C 3H7LA 4NUMA 1AG6A 2PTVA 5TJWK 5HA7A 2GK0B 4D9QE 2IXVA 3N17A 5C08E 3O6FC 2Y22A 1N8WA 1M56B 3X11A 3EPNA 2RACA 3P30L 2PURA 3N2XA 1J8KA 4CQ8A 3PRZA 1KM2A 5IQOA 3M17B 2V8ZA 4XCEB 4NPYA 2CRYA 5A2LH 3MSGA 4OV4A 1K4DA 2R2HA 3AW5A 3N1PC 4Q8QA 2OS7A 4ISVA 4BJHA 2F19H 1C8XA 3V0DA 4KO7A 3UPWA 1U93A 1MNSA 2MNUA 2WV8A 3TTQA 3G3LA 4J4PA 1NWTA 2CO3A 3QHTC 3REVB 3RA7H 1BIIA 5SWSD 4Q6YA 5B38G 2Q6ZA 3CHEA 3ZVHB 1OCZB 5K39B 1FZOB 2H0FA 2YCLA 3QEQE 5DJXA 3W1NA 2ITEA 1NSNL 2OTUB 1U5HA 5HTSA 5A8OA 5AHEA 4FFVD 1M7OA 2Y25A 4H9ZA 1LD9B 3VWKB 4BEQA 3DKHA 5E00B 5BOFA 1CN4A 3AVEA 2XPGA 1O5PA 2X3CA 4I5BB 5H37H 3O16A 4EJ1C 1OFRA 1ZXKA 3K0YA 2GQAA 2Q8BL 1S7TB 3QNZA 2WMFA 1MFBL 5DHMC 3CPLA 3QUXB 4GBXA 3QUHA 4M56A 2IPTH 4UDUA 3ULAB 1DLHA 4AIZB 2BSSB 2CIPA 3AAMA 3FTSA 3NSMA 1IFRA 1PJ9A 3G6MA 1TYGA 1MFNA 5AUMA 4BE5A 3FT1A 4AV0A 4UOW0 2IDUA 4B9CA 1S39A 3NAVA 4R84A 2GL5A 1UXSA 3MV7D 3KPNB 3VNZA 3LKQB 3RRQA 3P4OB 3CLMA 3TK7A 3ORJA 4JM2D 1M4KA 5TF1H 2J21A 3VFWA 2NY5H 2AABL 2WBJA 4UTLA 4APXB 3Q37A 2YD8A 5JIWA 1QI5A 2DIJA 4B5VA 5HYSA 2E76C 1WDWA 5EO0A 5GHWH 5I17A 3DJZA 2BW5A 4Q6IC 3UYPA 2WWCA 5KVGL 1OOAA 3GMQA 4ADIA 5HYSG 2ZCKH 5D72L 5JW4Q 4AMKH 4B6ZA 1M7IB 1N0XL 2C9RA 2Y2WA 1DSFH 4KK8D 2IW0A 4Z18A 3E3HA 1FTXA 1R6VA 3SDAA 5EFFA 3H2MA 3S5SA 5ECVA 2YDAA 3S9IA 3F7YB 2IGFL 2ZG1A 1E28A 3HPLA 2PETA 1KC5H 4HUMB 1LRTA 3WFBH 1S5HA 5GGTA 4PG9A 3NOYA 2OMYB 1YY9D 1S9WA 1MQPA 2H32H 3G1YA 4DW2H 4LBAA 4ZMAT 2BOBA 1TPVA 5IBXA 1YRKA 3MA7B 1P7QD 4KXBA 8FABB 5JPNC 1HTIA 4F7MA 1PS9A 3P74A 4A7UA 4BSWA 2O6PA 5DHVA 3U9WA 1G6VK 3GDBA 3WFDH 2IWKA 1DCLA 1S9XB 3HG1E 1JRBA 4UQ2A 4PU2A 1UZ4A 2ZOKA 4WW2A 3SPCA 3EYQD 1QW9A 2WYSA 3O8XC 4MFEA 4XX5A 1MAKA 1ITBB 2XYCA 3DPBB 4OJYA 2XTKA 3CXHJ 3QI9B 4G7EA 4R85A 4UANA 1XH1A 2G4FA 4D6IA 4CW1A 3TJEH 1RZ7L 4OZHF 1QSVA 2H2SC 2OVLA 3CAWA 5BS0B 1B5TA 3EPOA 3ARZA 4PUJA 1WBYB 4MCMA 1TTJA 5J8LA 4TV3A 1NFBA 5LDUA 4YMPA 3DOPA 4MMWA 4PS3A 5D96B 1ACXA 3BP5B 2XN1A 2AXGB 4XUYA 3D48R 3K4WA 1NQ6A 3FFCB 3LH8A 4J3SA 3TFKD 4Q7NA 1VIWA 4PRAB 1YJDC 2EH8L 2WUCL 3C09B 3OKLA 1YPIA 4Z3TA 4F5CE 1IC7H 2OEJA 1SFHA 1EF3A 1A2YA 2KLSA 1F6YA 4FQIH 3CQJA 4GYPC 3IS4A 2IAMD 3PWJA 1A1MB 3EA1A 3QO0A 4Q4SA 2EKSB 2ZXEB 3CFKA 2JF1A 2P50A 2K7QA 2XHYA 2ZAHA 1BEUA 2R9HC 2WCAA 3FSUA 5BU6A 3U7VA 4WHYG 3F7VA 3IGAB 4P9HH 5T33H 2W60B 5A2IH 1X96A 1KCZA 3DIPA 1WKDA 3EWCA 5IQ9A 2RHGA 4NDMB 4NN6B 1FGVH 5D1XA 5F7EH 2I16A 3QC6X 5D93B 1QWHA 3T0ED 1G7MB 1WWWX 3QG7L 4LCCB 2V67A 1A6AA 2WZTA 2IDTA 2QF8A 3QEHA 3K71B 4Y7OC 5FO2A 1OFEA 1KM4A 2XIOA 4HC1L 4PJFF 5DEFA 3ZJ8A 1PFOA 5I73C 3NFPB 1VBUA 1T2QL 3ESMA 1FE8L 1ODAA 3WFDL 4D0CA 1IGJB 3FCSA 1D6EA 3QUZC 3TCXA 2CK2A 3F85A 5DXYA 1YN7A 2AJSL 4DXKA 1WC7A 4OQ1A 4GY4A 5FFOA 2JALA 1A3ZA 1FO0L 3OJVC 4ZO6A 1FCUA 4N87A 3DI1A 3RUBL 1MIEL 3NJHA 3OKMA 3RGVA 2GWNA 3EGJA 3MA9L 1LWHA 1GYMA 2V5BA 4LRIC 3DX6A 5SWSB 5H4YA 1Q1JL 2XVLA 4I0CC 3UFIA 3WDJA 4GWEA 3W81A 1QVOA 4IBYA 3LGEA 2WYIA 1OF6A 5D7JD 3UAFA 4JMNA 4DHGA 4TRPL 1W5QA 2O55A 4AJWA 3VH8A 3PZMA 5FEXA 1YECL 3THDA 2W9EH 1FHGA 3GSOA 1VQTA 3MUGB 3HC2A 4WV1B 1O6SA 3R7MA 3MUHL 1T5AA 3JWNC 5JYLA 3ZQWA 5ISZD 1QO2A 2W0FA 5EC1A 4GRLC 2JKJA 4QRRA 5BW7C 3LTSA 4WWNA 2ZXQA 4PJXE 1NAKL 2QDDA 1KM1A 2BDNL 5DRXA 2E6JA 1S1RA 3QORC 2N01B 5CKAA 5HHOE 1A53A 4ZTYA 1IAMA 1VLWA 4WTQA 3TIDA 1VEOA 3H85A 2H0PA 5AOUA 3T9PA 4ACZB 4ZUTA 4TSCH 4LHUB 4GUFA 4AV5A 1FH5L 5IY5B 1Q9KA 3NYKA 4JEGB 1QA9B 4NJ9H 4PJFA 4U3AA 4DH2A 3IMBA 3RK8A 4KOCA 3FULA 4B41A 4AC4A 4IHOA 4DQAA 2YAEA 2WIIB 4PREB 2Y7EA 1BQHB 5DO2D 3ZE0B 4LEEA 1QUPA 3M16A 1RUAL 5H6HA 1HI6B 1LXMA 2BDNH 4NERA 1O7DE 1UPPA 4UWMA 5DURD 2FYVA 5E03A 4FCAA 3FB5B 3F05A 3U57A 4FHBD 1MFBH 1QNVA 1CZ8H 3QJSB 1PMYA 2W1NA 2WWKT 1MNNA 1X98A 4NRRA 4UILH 1WZ1L 3VX0A 2YGPA 1W9UA 3O1NA 1QFUH 3ARBB 1MCDA 4XOBA 2P43B 4GVIA 1KUMA 4M1RA 4QR6A 2R82A 2NWRA 4OZFA 2B1AL 2DQEH 2JB5L 4OUUB 2XN2A 5J3HD 1GZQB 1WUFA 2C3ZA 3W7RA 3WQEA 1MWOA 3M43A 5DZ9A 1P9MC 3GNNA 1LNUB 4KXZH 4UTAH 1XW8A 5EBMB 1I9RH 1XDJA 3BOLA 1W16A 2YPLE 1NA8A 2OW7A 3MA9H 4NBYB 4U49A 3L95B 2NT0A 4JZNA 1UC5A 3FT9A 4R53A 2YGVA 4NZCA 1XGZA 2VLRB 2BVUA 4NI3A 5C1MB 1CLOL 3VI3B 4KXDA 1AG1O 3GMLB 5FDYA 2DEXX 3WELA 4RETB 1LTXA 4I3SL 2IH8A 2DMHA 4I77H 2XWBB 2Z4QA 4P4RA 5GGQL 2X3AA 3NBNA 1QQDB 1IV8A 4AL8C 1NC2A 1FZMA 1HYSD 4CBZA 1VBHA 1IGFL 4N0RA 4MNQB 3ID7A 2R0ZL 4XNZC 3DX5A 3KM8A 5F89A 3QQWA 3QG7H 4Y5YC 5FYLD 5I02A 3NPWA 4HAFA 1YA5A 5DI8B 5GRVL 4Z78B 1KMGA 1MHPH 2CGYA 1J8VA 1ZALA 2J7EA 3MACL 3DBPA 1DJHA 4UTIA 2UY3A 1HHJB 1PZSA 5IDZA 2GGEA 2OR9L 5GRUL 5LAXA 3N11A 4OBTA 5I3DA 2VLLA 3GRBA 1RLBA 5GGSY 4MZRA 1KXQE 3AB0C 4LGSB 5EZJA 5F0MB 2DT0A 3UY8A 5HNTA 1KOAA 3GKZA 3ZY7A 5KSAC 2VTFA 4G80A 3QO1A 3BCDA 1IC7L 2Y88A 4ERGA 1NELA 4RA3A 5FGRA 2YB4A 3CT7A 3DHDA 5D4QA 4DJED 3D18A 4Q9RH 5D7LE 5B21A 5KVDH 3QQDA 1FZOA 1BWMA 5F9JB 2PPEA 4RQQA 2Q5BA 1RU9H 2HTKD 4LDCA 4Y4HA 4A2HA 4AZUA 5FO9B 1Q65A 3BDBA 2AL1A 3CMGA 3LY0A 1SMAA 1P6FA 2V6AA 4JQ4A 2GBVA 3O3EB 4I5BA 3QPZA 5JUVA 1BMWA 1M71B 1Q9OB 3HUJB 1Q6FA 2ARJA 1D5ZB 1Z9NA 2LAAA 3QK0A 4MJ5B 3QV8A 1RZKC 2FMNA 1KELH 1N9PA 4HA4A 4DZAA 1MHHA 3MBED 4UDUB 3TF7C 2JKEA 4AAJA 3QSKB 3KNBB 1NAMA 3QCVH 1ENUA 4S3JA 5C9UA 3WNNA 2Z7KA 3QUMB 2VDPH 4QNPF 1XGUB 2DD8H 2OKOA 3QZWA 4GYKA 3OHIA 1NC2D 4BR1A 5GNZA 3ESNA 3APMA 1BAFL 2PRMA 2IH3B 3L7EA 4Y19E 3O2WL 1LEKA 1NMCB 3MZGB 5F7DA 3SDYL 3GH4A 4Q14A 3GSWB 1SXBA 1FGNL 4HWEH 2R29L 1AYOA 4JS3A 3TXZA 1L6WA 4EBQH 2WLNA 3IFNH 1KTLB 3C5JA 2C0HA 4YBLC 1KIPA 1GOHA 1IC4H 4PWFA 5ETUA 3T9WA 4H8WH 4JRXE 4MA7L 1ZDSA 4XBGB 3C2VA 2E27H 2ZWYA 2FQGA 4YXHL 3NRPA 4PVBA 3MMEA 3SPHA 2PXYC 1E51A 4RFOL 3WN5C 4NO5A 3KWSA 3C4UA 4IFKA 4E2VA 4CNIB 1RURL 4WJ8A 2A3LA 1Q72H 3P9WB 3GSVB 1VZIA 4AYBA 5E9DB 5C0DB 4O1DA 3U2CA 3QG6A 3UCQA 1QATA 2G5BB 4BH7B 3GI9L 3WUFA 1E73M 5HR6A 3EH5B 3SO5A 2RIKA 3QDGD 3N55A 5DCEA 4PY8J 1XLIA 1JGVL 3D69A 1XZ0A 5D9SA 1JCMP 1K9FA 1KZYA 4KY2A 4UBDC 4JHWH 2MKLC 4G1KA 3SY0A 1F4YL 2GB2A 1GKOA 2OMYA 1A5FL 4HU8A 3VIOA 1CWVA 4UNUA 1A5SA 4D94A 2NXZD 4TVPE 3U2EA 4X98A 4Y2LA 3CC1A 3OGOE 1O5RA 4WX2A 5D70L 3E8UH 1A9EA 4EIGB 5DHVB 1DUYB 1U3YA 1NM4A 3R4DA 4TNGA 4RDQF 5KN5B 1QDSA 4HUUB 2X0HA 3CWNA 2ADJA 3U0WH 4WI0B 1RHCA 1LWIA 2FJGA 1N4XL 3RFZC 1XINA 3S1WA 3I6RA 1ORQA 1D9KC 5AB2A 5I77A 4WCYH 4IK7A 2BOFX 5AHNA 4DN3L 2UWFA 1HH9B 1G7IB 3IDYB 5FM5M 4JFPB 5H35B 5LIXX 2Y2TA 4HN8A 4LFHD 4LDOB 5IT2L 2QMJA 5BZAA 3VOGA 3LERA 2MMXA 4PMVA 4E41D 4WEBL 4V1DD 2PPCA 3QA3B 2BXZA 5C0JA 3KTXA 3QXWA 3M44A 5AB1A 3P2VA 4R9OA 4MBRA 3AAZB 5EFIB 3SBFA 3O3DA 4JN6A 4X3ZA 3THUA 3USZA 2HTKC 3E9TA 3W7HA 5B3SB 1W1A1 2ZZ1A 5F3BA 1LLWA 2Y5SA 3C6CA 1DQDL 4HEMA 4DTGL 3P0GB 3AXKA 3H54A 1C7SA 1GEQA 3CK5A 4NP7A 3C9NB 4GKZB 3WMCA 3EA2A 3VYNA 1E5JA 1NF0A 4UF7C 4PMZA 4WJG3 3HNVL 4C56B 2YBTA 2J62A 4FXGA 3P5ZA 3STEA 1JN6A 5BO1L 1WGVA 4A7VA 4XBEL 3GE7A 4HT3A 5MF5A 3QZWG 3S8FB 3DDGA 5GZOA 3D1MC 5EG6C 1G7MA 2COVD 4HS8H 4MJ6A 4I18B 2RKXA 2X3BA 2UY2A 3CS2A 1G7JA 1GZHA 1U3HB 1M3IA 1V7MH 3OL2A 2QQLH 3CYVA 4HU0A 3TN0D 3KXFD 4Q4MA 1YDVA 5A8NA 4ZQOA 3N0PB 4C90A 4XO3A 5INDA 3QTPA 3U7WH 4KKAC 1EEPA 4XSMA 2J74A 2FWOA 1F6FB 2GEQA 1D5XA 5FGBA 4ANUA 1K8CA 1EO8H 3FUKA 5CBAB 2IANA 4XZMX 3EPMA 2BRRH 3L68A 5T1JA 2VKZG 3VD7A 2GKIA 1WC7B 3M47A 4NQCB 4HHAB 2KLTA 5I9QC 1RK5A 1RSYA 3HZVB 4LU0A 4LV9A 3S88H 1FZKA 5JQ6L 2FT6A 1UXWA 1Q90A 3P2TA 1O5QA 3GSNA 4HMNA 4DBWA 1W9XA 2D0HA 3F7PC 3WDIA 1QVOB 4YH6A 3OZPA 1ONQA 3M0HA 3NIDE 1ZLUK 3TC3A 3KGUA 2JQAA 2K3HA 1BX2B 2YQ2A 5B3JF 4AY7A 2X1XR 3QFJB 2IWFA 1JF6A 1JPSH 4C57C 4CMMB 1OD8A 2V5JA 3W1PA 2JB6A 4HW6A 5JO5A 1CLVA 1GS8A 2CPCA 2X70A 1ERNA 4B9PA 5G4NA 3RHWK 4EVNB 1UZ1A 1VRDA 1XIDA 2V5KA 4Y9PA 1ZHBB 2AKRB 1XGTB 1HSAB 1DVQA 2G3NA 1FP9A 1ZAIA 3GDMA 4O14A 1XXXA 3QP3A 5CZSA 3DPDA 3GDCA 3S88L 1MW0A 1WUNT 5KS9E 1BVNT 1PLAA 3ULVE 1H0DB 3NUKA 5I74C 5CCKH 1WNOA 4AISA 2ZXGA 1WAWA 4MLIA 4P2OA 4QGCA 3RLUA 1ONRA 2AGJH 4ZUTB 2WNZA 2VXSL 3MFGB 4F7PA 4IJBA 5FEZA 4UQEA 3CLFH 4ACPA 1HQRA 2QPFA 4PP1D 5GRYA 5K9QG 5C0BA 4AEOA 4F24A 1G7VA 3ZU8A 4DIXA 5JQIB 2QTEA 4PREA 1ZMYA 1S7SB 3HQNA 3U0PA 1QO3B 6FABH 1S5VA 1VCVA 2GCYB 2A4CA 4F2MA 1PHQA 1W1VA 4KFMA 3UGEA 1SHXA 3D25B 3O6FA 1UACL 4OZ4A 5JBFA 5KYUA 3QI9D 2R56L 2V69A 3MC5A 4W5ZA 3CB8A 2WQRA 3L8QA 4P5KB 3MSYA 4HPJA 2HEJA 4MYPA 2QVFB 3MNVB 4BZ1L 3VCRA 2YW4A 2OO6A 3KWUA 3GS7A 3KEDA 5EOCJ 2IQ0A 2B81A 3T42A 5BO0D 3W23A 3WSQH 3AXMA 5JXQA 3JV4B 4M6QA 4RNHA 2UYLB 3FUJA 1BWVA 1KACB 4XNUL 3MCKB 5LNEA 3IDIB 3OLGA 3W57A 3NXFA 4IPPA 4HPOL 3RPIB 3IJDA 1WG3A 4AX7A 1CFBA 4NM8L 1EAPA 4H20H 2QJIA 3NO1A 4YSOA 3NJJA 1MJUL 3IDNB 2N0MA 4AWUA 1NDMA 3HN5A 4Z7QF 1P0BA 4FLHA 1F5ZA 4C7DA 5ADPL 4ML9A 4LVNC 4B9KC 2E9IA 4R83A 1LF1A 3BN9D 3T1FA 4X6EA 4P06A 4GBXC 3U0WL 5CS7A 3HEIB 1UIPA 3FK4A 4O9HL 1W1TA 3FS2A 5F88A 3IIVA 4PBGA 7CGTA 3AREB 3BW4A 1EP3A 3ECBA 4XAKE 1SW0A 4H01A 3QPXH 1ZVNA 1A66A 3AIEA 3V6BR 1MI5E 1RJLA 2AQVA 3EO1A 3D50A 3PCYA 5JW4N 3HRZB 2GQ8A 5L0QB 3L17A 2FVKA 3M46A 3LKSB 3EGXB 3VH8G 3CX5K 3C5SA 3GSNH 4DJFC 1PSKH 3E49A 3D18B 3BISA 5RUBA 3ZDYE 4JQIA 3NCMA 4OGQC 4Z3GA 1JRHI 3IXAA 1BG1A 1PCSA 2EILB 3CHRA 4HDIA 1NWUA 3U1SH 4IBVA 4O1AA 4B5NA 5FEWA 3MGAA 1SPQA 3SCMD 5TH2A 1IAKA 1IC4L 3U82B 1Q0YL 1H3WM 3IDMB 3O3EA 3ZUNC 4M51A 5J11C 3BICA 4IMDA 5JPMB 3GIZL 4DZBA 1OD7A 4OD1H 4OR1A 3UETA 4RMWA 3CUXA 4P9HC 1IT0A 3MREA 4U1GB 1E9PB 1G9MC 2TRYA 2QSCH 3BO8A 4YFLF 1PU0A 5D55A 3UZQB 2APXA 1MHHB 5AC7A 5KJ4A 4XN4A 5HJ3A 4CD5A 3UC2A 3CN1A 3VFLA 4R8WL 4DI9A 2E7LC 4U1LA 2VYRE 2XN9D 4NNPL 3EBAA 4PW4A 5LXXA 3MNDA 5DVPA 2VR2A 4Y16B 2QADC 5JPNA 2IAMC 3VVGA 3GD1C 2VDPL 1SGKA 4M29A 4N0YL 4WHYH 3FDWA 4P3CH 5F7UA 1LE9A 1S2VA 4JFXB 2XVGA 1KBGL 4H1LG 4NX0A 3KS6A 2HRPH 4M48L 3KPPA 3SI9A 5F2GA 1AO7E 1CWYA 1NUGA 2EO7A 3AREC 4RZ4A 5IQNA 5CN3A 4JJ5B 3GSWA 3O8XA 2FAUA 2P42B 4MLRA 4KQNA 4P7RA 3UTTD 1IIIA 4N0FB 4QYOA 1D5IH 3UP8A 4EPKA 4A3QA 3FTGB 1INEL 1CGUA 3IWPA 1LILA 4OF5A 4JM0A 1RAMA 3SCSA 4NSKB 5EC2A 4TX8A 1FXPA 4YXLL 7A3HA 3B0PA 1UVQA 2F53E 5HMDA 5KZ6A 2MH4A 4QHUB 1NFPA 1PXGA 3WQFA 2V5TA 1RZIA 1KM5A 4YUEH 4HD9A 1QR7A 4PH8A 1BQRA 1O7VA 5MENA 1XCXA 4ZGYA 2B8OT 2J5LB 2NUPB 4MCYA 4MDIA 2G3MA 3RI5F 3MWCA 3CC5A 4YTUA 5DJYA 3AM8C 1NGQH 3EYFB 3SDCD 4HNOA 3R4RA 3KM2A 1D7KA 2IJ0C 2WB5A 4RPPA 3Q1SL 4GW5B 1HAWA 4KI5C 1C3FA 1T2XA 3VQ1C 4HISA 2G96A 3MFFA 5GS0C 3H4XA 4HHMA 2AJZA 3FAWA 4N9BA 1ZV5A 1X38A 3PABA 2C4FT 3VRIA 3K4DA 3D05A 3K8MA 1GYCA 3TBVA 5LNGA 4L0PB 2F6AA 4Z8FH 2O61B 5M5DA 1CT8B 1ORQB 2CJTA 2LU7A 3DUHA 1WUZA 1OM3L 1Q38A 2PR4H 1HFUA 2CLRB 2YRLA 5J04A 5GS1A 3H4GA 1BVNP 3LRKA 1S2TA 5E6YA 4GKNB 4I6VA 3W27A 1JFQH 1G94A 5CGTA 4BQ9A 1XXDC 1MFDH 1OGAA 4PR5B 4PRHB 5HPMA 2AV1B 1HF6A 3L4CA 4NQDB 4ES9A 2F5BH 3L3OB 3WHXA 4L6OA 5CPTA 1TSRA 4LRIA 4WQ6A 3FT3B 2F6KA 3FO2A 4LZKA 1XYMA 1FPTL 2YWYA 2CDEB 2D73A 2Y7SA 3IN0A 3JUYA 3JWDL 5D5MA 5C0BD 3SCMB 3TCTA 4AL8H 1HJXA 5DVNA 5B1CA 5LGZA 4GI9A 1D7BA 1D5RA 1UKPA 5E9AA 3PBYA 1D6VH 4GKZA 1I4NA 2HLFC 5LXVA 5CGBA 2G30A 3IBEA 5FUOL 1RZ8B 1SGJA 2JE8A 1T4KA 4XP1H 4Z23A 4WW1A 4Q4EA 3TFBA 2BSLA 2B39A 2RDUA 2NRDA 1U8NA 3VIGA 2QZRA 3C2EA 3LGGA 1CB4A 4GH3A 4J1OA 4FNSA 1AJ2A 4ZMXA 4NPKA 4O9HH 4WDUA 5GJNA 3IJHB 2NY6C 2JXMA 2GABA 5HGAB 3TYFA 4A6YA 3FCGA 1V7YA 2AL2A 4KTDL 4TQPA 4KCTA 1CG9A 5DUML 1DHKA 2DL9A 4N8VG 4DP7X 1MVUA 4UTBH 2CFFA 3ZMRA 1MJUH 4DK5A 3OQ3B 2QQNL 5E6IA 1JPKA 4FK9A 1ZTVA 3M5ZA 2VD9A 4OCWH 3SY5A 4K5PA 1BF6A 2HLEB 2VVSA 1CDJA 2HFFB 3MLSH 5DGRA 4Y19B 1NL0H 2VDLB 1OGAD 1JERA 1ES0B 3LPFA 3NCEB 1YEJH 1GKQA 1UJPA 1ISVA 1AJ7H 1YY8B 4HWZB 4CMMA 3LXAA 3RPMA 1BVZA 1CDHA 1I3GH 3LCWA 3OQEA 3WLHA 4JHBA 8XIMA 4HNTA 1MWAA 4O02L 3ASNB 5BRPA 5F7BA 3M1ZA 3L5WB 3N04A 1NWSA 1R34A 4LP5A 1O6VA 1TWDA 4DSYA 1WXJA 2NY4B 3AWNA 3VG0H 5HI4C 4JR9H 3LUTA 4V2XA 3CSYA 1GHSA 3OA3A 3GW3A 4CNSA 2PWHA 4HPYL 1E5ZA 2CDFB 4B7LA 2VDQH 3ALGA 1KCVH 4PL2A 1HZKA 4JTDA 3EWXA 1OAYH 4MDRA 1HEZB 2A38A 5CZRA 4KGJA 1PWMA 4FIQA 3EDJA 2VLMD 1BOYA 2LLEA 4B9IA 3KWWB 3WLRA 2WXQA 3LCGA 3WN6A 2XC8A 2E5DA 1I1AC 4HJGB 3D39E 4FULA 1OEPA 4L61A 5FDWB 4JO2L 2GI7A 1KLGA 2NY6B 4DKEL 1BVOA 4DPCX 2J75A 2ATKA 2DQFA 4KEZA 5GGTH 2X89A 2X5PA 3KYOA 3R43A 4IRJB 3NAAH 3PWPA 4KHTL 4YHNA 2OYKA 3W38A 4OLWL 2HVJB 4HUCA 4E0CA 3MN8A 1YMYA 1LQ2A 3P80A 5T33L 2D7TH 1CXFA 1F61A 5IB2B 5G4HC 1SOSA 1N10A 5EOTB 3MNVA 2GGJA 2BNQE 2P7TB 1FOBA 2EPOA 3GVVA 5HANA 3VD9A 4NRYB 2K45A 3KZ8A 4L1DA 1BQCA 1RD5A 2X4QA 2V7NB 5KSAA 2EPMX 2EDHA 4DGWC 2C1HA 3R11A 2AK4B 1L0PA 4WWKB 1IQWH 3CSBA 3DMMA 3S5LA 4XCNB 4CADB 2Z91A 3ERXA 2VXTH 4UQDA 4Z77A 5FPIA 3NDZE 3LV3B 4I8YA 2DJXA 1IUZA 4W86A 4Y4HC 5I26A 1QNOA 2HLAA 2YGNA 1FYTB 2QCLA 1GVYA 5A6TC 4NRZB 3UJJL 4JY5H 3BRGC 4FHJA 4IBSA 4MA8L 1DQQB 4GH7B 3CIXA 1GOQA 3J7HA 3PHQB 3WNMA 1O9VA 2J8GA 1H19A 3TWBA 3T1FB 2XZCL 3CMOL 3GMNA 1V3MA 4QAWA 1V3HA 3NJXA 2AAMA 1J5HA 3TX9A 3APDA 2VN3A 5SWSE 4X6CF 4Q2ZA 3FXGA 4M5ZH 2AEQL 4TL5A 8RUCA 4F27A 2DRUA 4S1SL 3SJVA 1BVKB 3V95A 2EKGA 4B2DD 3J8F7 1TV7A 4U4MA 1HCZA 3HNVH 3STGA 1SJMA 4HCDA 1EEQA 4HS3A 5LHEA 1YXCA 3TZVD 4MNGA 4OJCA 2I9LA 4NZ4A 3NQVA 3EGDA 4XTRC 1R0AL 4H5SB 4F37K 5KSUB 1GK8A 2CLMA 2H8ZA 4DBSA 2A9NH 4HIIB 1BQKA 3C8HA 5DMIL 1UC4A 5J13B 3XISA 1AGCB 1BYDA 2V2DA 4OM0L 1N0XH 4BFOA 1YUHB 4IMLB 2GQ9A 2QS8A 2K1MA 4NILA 4O1CA 5JOEA 2X0WA 1TPH1 3RWJA 2WJEA 4K3JL 3U3HA 3W9ZA 3BGMB 3ZSTA 3ISWA 5HVWA 2JEQA 4MNQE 3GBLA 5AHIA 3IJYA 2ROYA 2OFQA 4YDKL 5GSRB 1B9ZA 2ITFA 3L3IB 3GTVA 4J12A 1AGBA 1QFHA 1RIHL 4FG4A 3WD5L 3EF7A 3ML8A 2Q3ZA 2GDQA 4HSNA 3L3JA 2F61A 3URNA 3BLKA 2TPSA 2AQOA 2YSSB 5I5IA 2E9BA 5IMLB 3UWWA 2D3JA 1W0MA 4JTAA 4OECA 3SIZA 5TF1L 3W0WD 5CP7B 2W95A 3K1KC 4EXQA 3ETBJ 4LL1A 2GBTA 4UQ3A 4F80A 2J47A 3OGCB 4JHOA 3IVKA 3VKBA 4JL2A 4AC1X 4HUKB 2OFJA 4MXWH 2OMUA 4JDZA 2VUNA 3M5YA 3W11C 4JQIL 4PMFA 2LTQB 5GZNC 4V2BA 3LCYA 4RZKA 2G60L 1X39A 2VDRH 3C0LA 2APVA 5CU5A 2Q8BH 2QZ5A 4HJEA 2ZRUA 3DI2B 4ODTH 4NNXB 5E4EC 5L4MA 2DSKA 4KROC 4YDJB 2EG8A 4A05A 1A3RH 1AO7A 3EMCA 1MF2L 3RGBA 1ZHAA 2P44B 3BPWA 5C70A 1HILA 1KPVB 4RFOH 3WKML 3WXVH 1MJJB 3H53A 3LD8C 4K38A 3GHBH 2N1TE 5GQBA 1SBBA 1VCGA 3L9RB 2Q7YA 5FYJH 2VISB 2WVTA 3T71A 5J13C 1QMLA 3BG3A 1PBGA 3L21A 1PHWA 3OX8A 4XE5B 1U83A 5EOQH 4S2CA 3FJLA 2Q09A 5DDHB 5J0BA 2NUPA 4N8PA 4MCYB 4OFYD 4IRSC 2J8FA 4IOFC 1H6UA 1W9BM 4I90A 5IM7B 2CK0H 4YX2H 3QVAA 5A16A 4HVBA 2GUOA 3NEOA 1WE5A 2YZ1A 4WQOA 3MFFB 3PJWA 4Z1YA 3CUJA 3ARPA 1JHTA 2GSMB 2KMWA 4EPSA 3L5LA 4QJ1A 1KY6A 2XWCA 2A6LA 2YBUA 2P48B 3PPSA 3MVSA