2WVTA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron in complex with a novel iminosugar fucosidase inhibitor
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 156
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvtA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvtA01
1WDSA 4ZENA 3WQ4A 4UTFA 1M04A 4AIEA 2G3MA 1JZ2A 4TX8A 1RPKA 5M17A 1TQTA 2EQDA 4WIWA 4XB3A 3RDKA 4CCEA 4CU8A 1B3XA 1KXTA 1H1NA 1W9DM 1XGZA 1V3LA 4UQCA 3MUZ1 3VIFA 1N82A 3WDPP 1BVZA 2OYKA 1TG7A 4FNQA 1AQHA 1BGGA 4NSBA 2DGAA 3AIBA 1V3KA 3WMCA 3AHXA 5LA0A 1EH9A 1V6WA 1CGYA 1V02A 5A94A 1J0ZA 4D6HA 3DHPA 4HMEA 1JIBA 2ZUMA 4W93A 4UQBA 4FMVA 3HMCA 3GXFA 4IPLA 1GOMA 4CU7A 4ACZB 1V6XA 1EOKA 3AI0A 4R27A 1DTUA 1VFMA 3AICA 1BG4A 4FK9A 5JBEA 1OWQA 1EXPA 2PWFA 4JFTA 3D3AA 1SZNA 1BLIA 5A8OA 1PZ2A 1HJXA 3IAPA 1M01A 3OZOA 3MMWA 2WCGA 4F9JA 1KTBA 2WKLA 1GOIA 2XM1A 1UH2A 1E56A 1UYQA 3FAWA 1WNOA 4AYSA 2DQXA 3NYDA 3WNKA 1E73M 1NARA 2PB1A 2IGTA 2Y8VA 3WF0A 4NZFA 1QW9A 3WDJA 1HJQA 1WDPA 3CHCA 1RP9A 2GUYA 4M56A 1W9PA 4JHZA 4BCEA 3N9KA 5AC5A 1GJWA 4DUXA 3PZVA 1HVXA 2WXDM 1J12A 2A3HA 4P8UA 5TD4A 1JYNA 1C8YA 2XWDA 4U33A 5D8ZA 1I1WA 3CH9A 2CIPA 3VD9A 2YDSA 4FNUA 1PZ3A 4AZHA 3TTQA 4MB5A 5EB8A 3RCNA 3W53A 4TVCA 1CGTA 5BRPA 3CV5A 3ZT5A 3D5HA 1JG9A 5AY7A 1E3ZA 3I3BA 1CWYA 3L4UA 3KL0A 3FN9A 2GDVA 4CD8A 5CGTA 3HG4A 3GYCA 4W8LA 2J8FA 3D4ZA 1K9FA 2QMJA 1H11A 3H53A 2GJXB 3WY1A 1U2YA 2BXZA 2CITA 4GZEA 4H7VA 3ZR5A 3OA5A 2BY0A 1JXKA 1TVNA 1I1XA 3WIJA 3GM8A 5DFAA 2QF8A 2WHKA 3T08A 1XRVA 4AD3A 5CLTA 1HT6A 2EABA 5IFTA 3UG4A 3QHOA 3T2OA 1VAHA 4FLQA 3VSUA 1NWUA 5IDIA 1HXJA 1HKIA 3WBEA 3WF3A 4IISA 2F7QA 4HOZA 4WKHA 1W91A 5HNNA 4GO8A 4U2YA 5CG0A 2CHNA 3ZO9A 3SCRA 5I6SA 2X2JA 3LRMA 5GNYA 3WL1A 3WKZA 1T0OA 3GBDA 1GZJA 1R7AA 2WB5A 5DO8A 3ZSTA 1BYDA 2V3GA 3AISA 2ZX9A 1VFOA 5EMYA 4HZ7A 2VRKA 3WH5A 3SCOA 1UZ1A 1MW2A 3N18A 2EBNA 3OLEA 2DT1A 2BV9A 4W84A 1JFXA 4OGZA 1VBUA 1B30A 1K6AA 1GW1A 1VENA 1JAEA 2XVKA 2CKSA 3WUFA 4N42A 4PRWA 3EMQA 2WMKA 3PN8A 1KWKA 2OSWA 5GQBA 3TP4A 5CXPA 1V6YA 3FNDA 2CBVA 4PTWA 2XSBA 3L4YA 4ACYA 3WBAA 4W8BA 3T2QA 1W3LA 3VINA 1M53A 2WHLA 1ISVA 1PPIA 5A2BA 4CKQA 2BVTA 4M80A 2EADA 4UOJA 2VQTA 1WZAA 3LPGA 4XUYA 2Y5EA 2ZX8A 1BPLB 1R75A 3AS0A 5A8QA 2FGLA 3L4TA 2VVNA 2FDMA 2ZUWA 1PIGA 3I3EA 3ARQA 3IK2A 4H8VA 1PX3A 4W8AA 3DX2A 2EXOA 3WDRA 5C8BB 3UG5A 2YL8A 3ZOAA 3VIOA 3AIVA 3SIMA 3WL0A 4OOUA 4UQEA 3WNOA 2WVVA 4Z2KA 1O7DC 4F9DA 1QHZA 1C3FA 1CLXA 5ABHA 3OLIA 4HOXA 4UQAA 4B16A 4AZCA 1NQ6A 3WH6A 3AHZA 3CTTA 2F18A 2YDRA 1IV8A 4C7DA 1ZBWA 3DYOA 4H41A 3T2PA 2QLYA 2XHYA 1MQRA 2V3DA 3AROA 1JI1A 2WCSA 1E6RA 4OUEA 4W7WA 5C70A 4QLKA 2JF6A 2XN0A 4WSJA 2J7DA 3PZQA 2CPUA 3MS8A 3WELA 1E4MM 2W5FA 5JUVA 2W4XA 1AQMA 3VPLA 1ZL1A 1EDTA 5HDRA 3VSTA 2VX5A 1JL8A 3B9AA 4J3VA 1CBGA 3EDEA 2GSJA 1KFWA 3VM7A 3SUUA 1A47A 4LQ1A 1QWNA 3SEPA 1L0PA 1CYGA 1WP6A 4MAZA 4PTVA 2XSAA 5I79A 1WKYA 1XD0A 1G01A 2PC8A 2BXYA 4BF7A 3E1F1 4JAWA 1ITXA 4OOZA 2RGLA 2W61A 3BUBA 1QPKA 4W87A 2D22A 5IHRA 5E70A 2QV4A 2ZXQA 4C7FA 1V0NA 3GBEA 2D1ZA 3MUY1 3DX0A 3H54A 3SCPA 2CKRA 4TOQA 4D6JA 1V3IA 3BVUA 1RH9A 2OW7A 1ISXA 5HBFA 5JIWA 3U5YA 4W5UA 5I3DA 2G41A 4FNPA 2X2YA 5EFDA 5AYIA 2JEQA 1FH9A 3TTSA 2GDUA 3ZSSA 3PZ9A 1UD3A 4J3UA 2VZUA 4URIA 2WVTA 2FH6A 4MADA 8A3HA 3NJ3A 2YKKA 1W9BM 3F4VA 3CZSA 6A3HA 4NI3A 1MQQA 2IXUA 2F1AA 3LX9A 2NSXA 1TVPA 3FHAA 4JFWA 3WNMA 3EDFA 2J7FA 3ZT6A 1IZKA 3AZRA 1XYZA 3GH4A 3ARPA 3MANA 1ECEA 4V27A 2XIBA 1XH1A 1JD9A 2WMIA 2J7GA 3DECA 3CGTA 2ZUSA 3K8LA 1JZ5A 1UWRA 4EKJA 1NOWA 1VEPA 3BH4A 3UR7A 5CGMA 1LL4A 2WANA 3GXTA 1BFNA 2OSYA 3EJTA 3BXWA 3O9NA 2ZXDA 3KWXA 1HF6A 5E9AA 1HN1A 1W1PA 2ZE0A 4TVDA 1XYFA 4NXSA 1LG2A 1UKQA 3OB8A 1B90A 4GQRA 1C91A 5CJ5A 5A6AA 2DSVA 2CEQA 4CD4A 1UD5A 4D6CA 1DWGM 4JIEA 1K9TA 1W2PA 4Y7EA 3WUGA 1E5JA 2C0HA 2XJ7A 3AS2A 3RMEA 4OKDA 5A8PA 4Q7NA 3F5KA 2YIHA 2ZX5A 3SCTA 4J3TA 4QP0A 3OLDA 1GHRA 3A5VA 1NWTA 3U7BA 1VFUA 1GHSA 1K9EA 3RILA 3AS1A 1FHLA 3NSXA 2J47A 3A23A 3WEMA 4PMXA 4MDOA 4J3XA 4FNRA 2E9BA 4X9YA 1ODUA 1GVYA 4P7NA 1UR4A 3W28A 1UWQA 1J18A 4D6FA 2XGIA 1GJUA 4XZWA 1BTCA 4AEEA 3VNYA 5A6SA 1UG6A 1TA3B 4L4PA 1H2JA 5E0FA 3MI6A 1KR0A 4JHOA 1ZJAA 3EJUA 1JZ7A 2YL5A 3G6MA 3W24A 1UHVA 1GQLA 3OZPA 2WBKA 1E0VA 1OGBA 1P6WA 2GFTA 3PTMA 1UD4A 2DIEA 4C7GA 1DHKA 3A4XA 1CZ1A 2A3EA 3CIVA 4HZ8A 5I77A 1LL7A 1H5VA 1GQKA 2CBUA 1XC6A 1Q6GA 2J25A 3VVGA 4AIUA 1MW3A 1ZBVA 1LJYA 3HN3A 2VR5A 3D50A 3IJ8A 1R87A 1KQYA 1UR9A 4HPHA 4M82A 4HA1A 2C8NA 3AIEA 3LXCA 1QI4A 1WZLA 3WN6A 1E3XA 4U3CA 4KGJA 6CGTA 3EBVA 4TTUA 3BVTA 1H0IA 1HKJA 1LQ0A 2WVSA 5FOOA 1J0KA 2WLZA 4EANA 3AQUA 5FKYA 5GNZA 1JZ4A 2YA1A 4J3WA 1EOMA 1ODZA 5D9PA 2J78A 2GJPA 1AQ0A 4AD5A 2YL9A 1TQVA 5FL1A 3T0AA 4Z2HA 1RP8A 2VCCA 2F1BA 1EO7A 2J77A 3UERA 3W4RA 3VGEA 1UWSA 2FYVA 2G3NA 2WC3A 5A6MA 5E6YA 1BHGA 3VD7A 2RGMA 2HISA 3DX3A 3K4AA 4KGLA 1E1EA 3GXIA 4D6GA 1UH3A 2W66A 1HJWA 2PWGA 1TE1A 4AIOA 1W32A 4ATLA 2ZWZA 1OSEA 1JI2A 1UWIA 5HPCA 4UFJA 1R47A 1NH6A 3ARVA 5F7UA 2VX7A 4BS0A 1MW1A 1FA2A 1VEMA 2BVDA 2VCBA 4DUWA 3QGVA 4HP5A 1XHGA 3ARYA 5D9OA 4AD1A 7A3HA 3VIKA 4RL3A 3DC0A 1UWUA 1F4AA 4W85A 3ZM8A 2QHAA 2JIEA 1R46A 1B1YA 3LPFA 4AXNA 2Q8XA 5IHSA 3VDAA 1ESWA 3QOMA 1JZ3A 2Y2WA 2XFYA 2DT3A 2A3CA 5M5DA 3VSVA 4E2OA 3DDFA 1GVIA 2QPSA 1B3WA 2DIJA 3BAYA 3WD3A 3WQ8A 2NW0A 1W1TA 1US3A 1KXVA 3VGHA 1L8NA 4YHGA 2EACA 2OWWA 2Y24A 2JALA 2XVPA 5FCZA 1Q6CA 2ZUVA 1VEOA 1DP0A 3TTOA 3MSGA 3ECQA 1OIMA 3IAQA 2E4TA 1D3CA 2VJXA 1QWUA 1ZJBA 1MW0A 5A2CA 3D51A 2YBTA 1NP2A 4V28A 3VGDA 1F4HA 2Z1SA 2X8RA 4ATDA 1WPCA 3IANA 1HWWA 3S5ZA 4PYSA 4ZFMA 2JF7A 4KMQA 2VZVA 2OYMA 4J7RA 1BYCA 4NXKA 4GKLA 2O92A 3RJXA 1G5AA 1X6LA 2Z1KA 2XM2A 1FFRA 2E8ZA 2X2HA 4LYRA 3WDIA 4ZXOA 1CGVA 3WQWA 1QNOA 4RE4A 1G9HA 1FHDA 3BLBA 2DSUA 4JCLA 3W81A 4NZCA 2YJQA 4U3AA 3CHDA 1WAWA 4UFHA 4B3KA 2JFEX 4YPJA 3GXDA 1FP9A 2WMJA 5A69A 1GCYA 2WVUA 5BXRA 1EHNA 3RPMA 3BAKA 1XSKA 3CMGA 1E6ZA 3GNRA 1UKPA 2J74A 3M07A 3AHYA 2O9TA 1V6UA 4IM4A 4CD6A 1R33A 3LPOA 1VF8A 1TQUA 2BHUA 4AD2A 4NRRA 3W6LA 5A6BD 3BAWA 4B3LA 1XH2A 1GOOA 3ALFA 4MTVA 1KGUA 3BMWA 4X0NA 4BQ2A 5LA2A 4TUFA 3HU7A 3VIPA 3L2MA 2PBOA 4F66A 2J62A 3WFLA 2VX6A 1UKOA 1KCKA 5D9MA 1EQPA 1WZKA 3AMDA 3BAXA 1LWHA 3DX4A 2DT2A 1JGIA 3WQ5A 2PBGA 1E0WA 3TONA 4P8VA 3BVWA 1E4LA 1W3HA 1K9DA 1SMAA 2YLAA 1PS3A 3VMPA 3M7SA 2D24A 1GQIA 2VURA 3DDGA 3L4XA 4QFUA 3U57A 3OGVA 5BXPA 1QNRA 3ZJ8A 2VI0A 1E55A 3N04A 3FY1A 3W26A 3L2LA 1XSIA 1QOXA 2UY4A 2CNCA 1KBBA 2VOTA 1OM0A 5D8WA 3WEZA 4UNIA 4OJYA 3WD2A 2QPUA 2EEXA 4E8DA 2DSZA 2V5CA 4DUVA 1KTCA 4AWEA 4PMZA 1E43A 1X6NA 1UD6A 4JFVA 3HG2A 2XVGA 2XVNA 1KXHA 3W82A 4QAWA 2JEPA 2XYLA 2J75A 1W3JA 4P7RA 5A8MA 2X09A 4JFUA 2D3LA 2XGBA 1E0XA 2J7BA 5I24A 1B3ZA 2FH8A 1WCGA 2F61A 5JBFA 4MAVA 4AMCA 1CNVA 4W86A 1DWAM 2CHOA 2OW6A 4J27A 1UASA 2X05A 3SUTA 3BUPA 1H09A 5BROA 2DH3A 3L4ZA 3A4AA 3WFZA 4AISA 1LWJA 1UR1A 4CD5A 1E6NA 1MVYA 2OSXA 2VZTA 2WSPA 2CYGA 2VC9A 2ZOXA 2VL4A 4QLLA 5IFPA 2O9OA 3CUGA 1KQZA 1KGXA 2PI6A 3VD4A 5I23A 2YOCA 4M81A 1I75A 3ZQ9A 1D7FA 4MNKA 3AIQA 4L4OA 1CECA 1HP5A 1PIFA 3A21A 3QHNA 2ZIDA 3L4VA 2E8YA 1DWFM 2JE8A 2J79A 3QR3A 1JDDA 1UZ4A 4Z2JA 1UR0A 3ZIZA 3K1DA 4AC1X 3ALGA 5BXTA 1OBAA 3PZTA 3OLGA 1CIUA 5E09A 1BAGA 1BYBA 3VIHA 3TV8A 3MV11 2YL6A 1E6XM 1VFFA 1BQCA 4FLSA 1CENA 2EPNA 2A3BA 3VGGA 1UA3A 1OD8A 4DO4A 4CVUA 5E0CA 1J0JA 3CZNA 4FLOA 1EO5A 1CGUA 1CGWA 1MYRA 5ABFA 1QNPA 1HTYA 4MPKA 2EJ1A 1BG9A 2WWCA 2CXGA 4DM1A 5A95A 1ZU8A 3VGBA 5A3HA 3ARSA 1U33A 1XCWA 1E6SM 4GPNA 2YA0A 3KL3A 3T0DA 3PZNA 1E6PA 4UFKA 1C8XA 6TAAA 1UD8A 1WZMA 2G3JA 1V0MA 2Y8KA 2VRJA 3CZGA 3NDYA 4GI6A 2VZOA 3ARUA 4MNJA 2V38A 1C92A 4UFMA 3UEQA 4KH2A 3AHVA 3WF4A 3FW6A 2FHFA 3CUJA 4JKMA 2V3EA 3CUFA 1B2YA 2WM0A 1BSIA 1C7TA 3FAXA 4QLJA 4D1JA 3AYRA 1B3YA 2VZSA 3WH8A 1E40A 2W67A 4W88A 3VMNA 4OBRA 2WMGA 3TA9A 4TTGA 1B9ZA 1HNYA 4TVUA 2BS9A 1YHTA 3RM4A 1KBKA 3N12A 4S3JA 4FLRA 4RE3A 1KWGA 4E4PA 1W3KA 3N15A 4D72A 2W92A 3CZ8A 4M8UA 1E9LA 3PTKA 3VILA 1J0IA 3WH7A 2BY2A 1UKSA 2X2IA 4PMDA 2GVYA 7CGTA 3MUAA 1UWTA 1QBBA 3NCOA 5ECUA 3I3DA 4Z2IA 3WF1A 3O6AA 1MQPA 3SUSA 2XIIA 3PBGA 1LL6A 2ALWA 1V0KA 3THCA 1WDRA 2QMKA 4U2ZA 3OBAA 3SUVA 2VCAA 1ZS2A 3NIYA 2DDXA 3NDZA 1XV8A 4P7LA 4MJ4A 1KB3A 3ZJ7A 4PCSA 4TXEA 1CXFA 1MXDA 5M03A 4P7OA 1S46A 2XTKA 2WBGA 1E1FA 4WF7A 3PZOA 4HPGA 4P8WA 5JBDA 2WZEA 1TA3A 5CPQA 3UCQA 4ZE5A 1M7XA 4UQ9A 1XD1A 2EPMX 2W63A 1H3GA 4AEFA 4V2XA 4DO6A 4IPNB 1R86A 9CGTA 5DF0A 4P8XA 2BY3A 4GXPA 3N13A 3GNPA 4ZEPA 3F5LA 3AMCA 5A6KA 2ZX6A 2VO5A 3LXAA 4JZ5A 1R8LA 3VM5A 2EPOA 3GNOA 4HU0A 2BY1A 1YQ2A 2OYLA 2BHYA 4KWUA 1DWIM 2DT0A 5DT5A 1E15A 3T0BA 2DSWA 2WMIB 3T09A 3ZR6A 1H49A 2E9LA 3D52A 1UH4A 3EDKA 1SR0A 3VIMA 3IJ9A 2O9PA 3S5YA 4FNSA 1MFVA 1OT1A 2CERA 2NT1A 3A24A 4WK9A 4PTMA 4WKAA 3BUIA 4E8CA 1GNXA 4PN2A 5IXEA 3LPPA 3CC1A 1C93A 4S3KA 5FIPA 5ABEA 3VDBA 1E5NA 4MNLA 4UR9A 3OIHA 3EYPA 3ARTA 2WK2A 1AMYA 5I0DA 1CGXA 3SCNA 5I2UA 3AIWA 2XFRA 2ZWYA 5JIPA 2D2OA 4GI9A 4D6DA 1B31A 3VIJA 1C7SA 1BYAA 4AZGA 1TZ7A 2G3IA 4X0VA 4ACZA 3WMSA 3LMYA 2EPLX 5LYRA 2YDQA 2J4GA 5EFFA 3KLLA 3HZ3A 2BHZA 4PUEA 1UR8A 4N0RA 5M3WA 4MB1A 3CZJA 1HP4A 4BA0A 1OB0A 5KZ6A 1TFVA 3GXNA 3AZTA 4CCCA 1EIBA 3PTQA 1W2VA 2NT0A 1KGWA 1QNSA 1BGAA 2X1IA 4NF7A 1EGZA 3H55A 3K8MA 4WKFA 4DWSB 3AIRA 3GZAA 4PEEA 2VNCA 1J0HA 3EJRA 1QI0A 7TAAA 3KL5A 1CTNA 4XX6A 1UR2A 2YBUA 5BRQA 2DSKA 3SUWA 1MXGA 3O2LA 3SCQA 3ARRA 1EDQA 5EBAA 3WD1A 2UWFA 1OGGA 2GK1B 3K8KA 3AFBA 4GZJA 2AOSA 4M24A 4XV0A 5GNXA 1EHAA 1QI5A 3B9DA 3N1AA 3ARWA 3CUHA 4OBSA 5C71A 3BLKA 3WD4A 2WNWA 1E70M 4JKLA 2XWEA 1V3HA 3VGFA 1FH8A 3MKKA 1AVAA 3VTRA 1JAKA 5E6ZA 1PBGA 5A6BA 3BAJA 3A22A 1V02E 4UOZA 3K4DA 1GQJA 1Z32X 4LGXA 4W5ZA 4NZJA 3A4WA 2X0HA 1VJZA 2WMFA 4JL2A 4U5IA 2AMGA 3EMZA 1SFSA 4RE2A 1OIFA 3WMBA 3EJQA 4DO5A 4HA4A 4GQQA 4W89A 5HPOA 4QCEA 3B8SA 2J7EA 4K68A 4M29A 1E72M 5BWFA 1LLOA 2FE0A 2WC4A 2O9RA 4DWSD 4TX6A 2GJXA 4WJXA 1A3HA 4QCFA 1JYVA 3GTNA 3J7HA 4IUGA 2VT0A 2AAAA 1CXHA 2PWDA 2F8QA 2OWXA 1FFQA 2D0GA 5HOSA 1W1VA 3AJ7A 3CZEA 3RIKA 3W27A 3EJPA 4D6EA 3FXYA 3PZIA 3S6TA 5A6JA 3VMOA 3WQVA 4AZ5A 4GO9A 4HTYA 4BQ5A 2G8ZA 2EPKX 3W6MA 2D73A 4B15A 4ML4A 2FHBA 1X1NA 2CBIA 3F5JA 1VRXA 1CXEA 4AZIA 3MU7A 1GOKA 4UFLA 4PBGA 3UG3A 1V0LA 4CN4A 2XPKA 2V5DA 1SYTA 1W9VA 4B9ZA 4QDMA 4PMQA 2WZIA 5CQ1A 1QI3A 4NX0A 3CZLA 4U5KA 1Q6FA 2ZICA 2J7HA 3EDJA 2VVSA 3CBWA 4JFSA 1GORA 2W91A 3AOFA 3MO4A 3DHUA 3WH9A 2ZUNA 1CXLA 4F79A 3BMVA 4MB4A 4CN6A 2VQUA 4H04A 4UZUA 3WNLA 3MV01 1JDCA 1NWSA 2EO7A 4J28A 1JNEA 4MB3A 3WNPA 8CGTA 1SMDA 2WAGA 3RM9A 1NOFA 3THDA 2XUCA 4CUCA 4BQ4A 1UD2A 1LF1A 3VUPA 1OT2A 3APGA 1GOWA 2WHMA 1NWRA 4Z2LA 4WSKA 2WPGA 4DM2A 4M1RA 1G0CA 4H8HA 5ABGA 1KR1A 1NOUA 5I5RA 2GJRA 3WUBA 4Z2GA 1MFUA 2ZUUA 3BSGA 3WEOA 1ISWA 1TMQA 2VTFA 3IJ7A 5HXMA 3HG3A 2WCAA 3UR8A 3WSUA 5CLWA 3VOCA 3VIGA 3CUIA 3NSMA 2F7PA 1HVQA 3UESA 2W62A 3OGRA 2IXVA 4ZE4A 4GIAA 3MSDA 4ZXLA 2J7CA 3ZT7A 1W1YA 3SCUA 3VO0A 2ZXAA 3MMDA 1PJ9A 3LRKA 4UOQA 2CETA 1JZ8A 2UY2A 3BGAA 1HXKA 1VB9A 4W7VA 3CPUA 2IUZA 1G94A 3JUGA 4CD7A 3A3HA 2WMHA 3ZJKA 2WSKA 2EAEA 1JF5A 1V08A 2OWCA 3II1A 5E1QA 1GONA 3RO8A 2JIWA 1HJVA 1E6QM 4AD0A 2PWEA 4J3SA 3DYPA 3TOPA 3AMLA 1Q6EA 2XG9A 1J9YA 1E4NA 3U5UA 4AMXA 4PSPA 1WB0A 2PWHA 4UZSA 4PTXA 2XVLA 3RM8A 3M6DA 2V3FA 1R34A 4UCFA 1EQCA 4NRSA 1O6IA 3BVXA 3WY2A 1ITCA 3GH5A 4JCMA 5BYWA 2D23A 2WZHA 3W38A 2VR4A 2XN1A 3GXMA 4KRUA 1TQWA 2WC7A 4H2CA 4F8XA 1XSJA 4GI8A 1UQYA 1W9UA 1M03A 5FL0A 3KZSA 3AXHA 4CVWA 3MMUA 5A8NA 3VX1A 3WUEA 1WE5A 1IT0A 3SCSA 4HMCA 2BFGA 4UFIA 2MANA 4UQDA 2UY3A 3BUDA 3AHTA 2E40A 3AMKA 1JXJA 1VIWA 4EAMA 3EDDA 1W9XA 4PMOA 4D6IA 1H41A 3W37A 2Y4SA 3SCVA 3W25A 1DWJM 2DH2A 1LG1A 4XZBA 4PMNA 1VBRA 3WF2A 4AZBA 2WW5A 1UKTA 2WLYA 3AZSA 4Q22A 4CGTA 1R7OA 1E71M 1HJSA 1FP8A 4LYQA 2A3AA 4JKKA 2VMFA 3ARXA 5DEZA 2PF0A 1V03A 2WVVB 3BUQA 3VNZA 1V3JA 3AXIA 2XN2A 2DPEA 1J10A 1Q4NX 3QOKA 4MNMA 1GOQA 3SCWA 4AZCB 1QNQA 1CPUA 2TAAA 1HKKA 1PX4A 4OZOA 5LA1A 3KEHA 1WO2A 1H4PA 3CZKA 4U31A 1OD0A 3W29A 1HX0A 2E3ZA 4PMRA 2CESA 4HZ6A 3U7VA 4LXFA 5GPRA 5CSUA 1MWOA 1ISYA 1EA9C 4AZ7A 2YA2A 2OLHA 2ZX7A 3KLKA 1QW8A 3AMGA 2WWDA 1UA7A 4YN5A 1J01A 3VU2A 3VD3A 3BVVA 5A1AA 3FHQA 1PAMA 4YHEA 1DEDA 5AYBA 3POCA 3D4YA 1J11A 2DEPA 4D71A 1V3MA 1C90A 1US2A 5CPTA 1B3VA 1ZBCA 1D2KA 3N17A 5ABFB 1B0IA 1NP0A 3M46A 1CLVA 4BQ3A 4PCTA 4CCDA 3NSNA 1O7AA 3TTYA 3SURA 3MUIA 4MJ2A 3S2CA 1UUQA 1TR1A 1CEOA 4PMYA 4PUDA 5CZKA 1H0GA 1J0YA 3CHEA 4HMDA 3CMJA 4HU8A 3IGUA 1QBAA 1TCMA 3NUKA 1XH0A 4KRTA 2YFNA 1CXIA 5I78A 5A6LA 3POHA 1VJSA 4AMWA 4FF5A 3PZUA 4GINA 3WY4A 1HJUA 5D9NA 4CN1A 5BCAA 1JYWA 2FHCA 2B31A 1FOBA 2CCRA 3WDHA 3LXBA 4GZIA 1Q6DA 4AZ6A 3AYSA 4BZYA 3LRLA 3HJEA 2ESCA 4AY1A 3W0KA 4WLCA 3CO4A 2D0FA 1IZJA 3WDQA 3A6OA 3AS3A 3BLPX 3BSHA 1JNDA 3EJSA 3BAIA 4R5EA 2VRQA 2YLLA 1QVBA 2XFFA 1ZB5A 2F2HA 2C7FA 1QI2A 3UETA 1ISZA 4H8UA 1KCLA 1XCXA 4JL1A 1TQSA 2HVMA 2VUYA 4CU6A 2WKGA 2CBJA 3VDCA 3HG5A 4B9YA 5AC4A 1HIZA 3DYMA 4MDPA 2E9MA 2D3NA 3BCDA 3CLWA 3AIUA 1JFHA 1HL8A 3WD0A 2F7RA 3WQ6A 4PSRA 3AXXA 4A3HA 2G4FA 3OG2A 1JD7A 1Y7VA 4FNTA 3B9EA 1C8QA 3PZGA 2ZUTA 4LPCA 2D20A 3A47A 1PEZA 3EMCA 4PMUA 4W7UA 3BC9A 2YFOA 1BF2A 5BXSA 5KEZA 1JDAA 1QHPA 4AYGA 1PX8A 1KXQA 1NM9A 3VX0A 3PZMA 5D4YA 1V6VA 1U30A 2E0PA 5CPSA 2WYSA 3VD5A 4P7QA 4EE9A 3G6LA 3WENA 4OIFA 1OCQA 4A3YA 4DWSA 3ARZA 3VDHA 4ATWA 5DMYA 4AD4A 2VX4A 5FD0A 1JYXA 3K46A 1DWHM 1TUXA 4HA3A 3L4WA 4LX4A 5DT7A 1WDQA 1JF6A 2BNJA 1R85A 4EK7A 1GPFA 3KE0A 3VKKA 4HOWA 3WNNA 5A2AA 1CDGA 1BVNP 1FH7A 1QHOA 4D1IA 2GK1A 3BCFA 3ZMRA 1UOKA 2WHJA 1CXKA 1QX1A 2X0YA 3CHFA 3GDBA 2D0HA 1HKMA 1JZ6A 2F7OA 3GXPA 2UY5A 1OINA 4LYPA 3VIIA 4DWSC 4PMVA 3WY3A 5CSYA 3ZJ6A 2J8GA 1HL9A 1E4IA 2BVYA 1OGSA 2FGZA 1GUVA 4AW7A 1UQZA 3QHMA 3RJYA 3N11A 1ZBKA 2ZXBA 4A4AA 1RD6A 3OGSA 3PHAA 1EDGA 1G1YA 3DX1A 3GH7A
chains in the Genus database with same CATH superfamily
5FW8A 1P4CA 2O6EA 4ZW6A 2GC4C 2FEDD 1DQXA 3GC5A 1LEKB 1N82A 4B9CA 2IBZX 3PWUA 3B7RL 1V3KA 4EI0A 4HWZA 3ZE1E 5LGYA 2HTMA 4G7FA 4UV7L 1N67A 3AREA 5CEZL 4O02B 1S5MA 3IU4H 4QS5A 2YXFA 2BINA 2QPEB 3EH2A 3M16A 1OJXA 1YECH 2PPFA 1E5ZA 3AREC 2J56A 1KTBA 1L8PA 1I8IA 3Q8CA 4U1JB 3B2UC 1UG9A 3I9IA 3RGTA 4AYSA 2PDMA 3HB3B 3VZZA 2PB1A 4OFYD 3WF0A 2X5PA 3F6LA 5C0EB 3HQOA 3O2DA 1QNVA 4Q6IB 2OZ4H 2R8SH 2Z4GA 4GIOA 5B7EA 5DQDL 2WUBH 4Y6GA 3CH9A 4PGEA 5DLMH 2QFRA 1XF5A 3ZKSD 2Y7DA 4TVCA 1CGTA 5DR5H 4YHKL 3HUJA 1VFLA 3N1GC 4JQ4A 4WJ5A 3LB0A 1M6OB 4UNUA 3DUUA 3UTZB 1NJJA 2BLFA 2GVGA 1BGXL 3LKPB 4ZNEA 4AQ1A 4IP4A 2GB2A 5LHFA 4AB4A 4YWSA 4RFNC 4Y2OB 2V37A 4O2EB 5IFTA 3QNYB 3T2OA 4NUWA 1NWUA 1W0YT 2BRRH 2WOQA 1OLLA 1W91A 1MUJB 2PR4H 3QZEA 2YUWA 3AM8A 3J2PA 2X2JA 2OGYA 2XH7A 2VN7A 1AJZA 3OJDA 3SJ3A 4Z1BA 1R7AA 4ZUTB 3PPEA 2VFEA 3AISA 4P2RD 3PANA 4QY8A 1GYCA 4M19A 3BQUA 3PWGA 3LKQA 1ACXA 1KJ2A 2AAVA 5HDBF 3OLEA 4GIYA 4OGZA 2GT9B 4X2PA 3IF1B 3W2UA 3WE6B 3ZL1A 1XYCA 3EMQA 4YBLB 2GL5A 2YZRA 4RZ4A 3QEGH 3WHXB 3KPOB 1EGJH 3QFDA 3PP7A 3FNDA 3U9IA 3NTYA 1P6AB 1ETB1 4LRNL 2WHLA 3AG4B 1NSNL 1MG3C 3FFDB 1TZGH 2CM5A 3RWJB 2OXHB 4PPTA 1AQDA 1XICA 2VQTA 1WZAA 3FPYA 2ICWJ 1PCXA 3AS0A 4UU9B 5E8PA 1XCTA 2YBRB 1CYWA 3ARQA 4IFKA 1OP3K 2EE3A 4TULL 1K4DB 2XQBH 4NSKB 3APMA 3ZOAA 4RE0A 1H62A 4JTIA 5I5MA 3TEWA 3KPNA 2VEKA 4X7SL 1QHZA 2X1WL 3N73A 3SW6A 1KN2H 4DJEA 1UZHA 4JFDD 1K7FA 1Q9KB 4PJXE 1IV8A 3WLHA 2QYGA 5DCCA 3MUGA 3CLFH 3Q94A 4FFYH 5T3ZD 3BT0A 4HCGA 2JF6A 1O6SB 1X5AA 1NAMA 2CPUA 3CAFA 3JT0A 3WELA 1QSFA 1TPH1 3SDAC 2AQSA 2VLRD 1XLGA 3B9AA 4PCYA 2GYIA 3NM3A 4XKYA 2A9AA 3VXPA 3QPZA 4XZLX 2I07B 1BECA 1WKYA 3GC2A 1ACCA 5D2LB 2ADGA 3O4LA 1NCOA 2WYZA 2VMCA 3LBCA 1OZMA 1PYWB 4WWOA 1KEGL 2TRSA 4MD0B 2MTPA 5D6DA 4R7DB 1T41A 1G84A 1CBVL 2Q71A 2V9UA 3RX9A 4TQEH 4F0HA 3QV6A 1S9VA 2YWYA 2G41A 3C2YA 4F15C 1UJQA 2VE6A 2G4GA 4G8GE 4GA8A 4GACA 4DGYL 4H01A 2NSMA 5D6DC 2AL2B 3ZSSA 4PJ8B 5G2IA 3W7DA 4YWIA 4PJ9C 4GY7A 3QLLA 1P7HL 3LIUA 2P8LB 4EVNA 3AALA 4K7YA 1Z0NA 1WYJA 2R0ZH 1MQQA 1XMWA 4KK8C 1PZDA 4LVOC 3BSZA 3I2CH 5KOMC 5EZIL 4BHYA 4D9LH 5GGRY 3ZT6A 3OG4B 3F05A 3HFML 2HH0H 2OR2A 1JZ5A 3NZGA 4HJJL 1TZIA 3REVB 3UNDA 1EEPA 1N64L 3TC9A 1YEEL 5FHAL 5C09A 3NDZE 2DJMA 1HN1A 1DVXA 1LM8V 5A6AA 1WWWX 1HHIA 4PWGA 3E6HB 1QFUL 2BWDA 2GJZB 3F5KA 1TNNA 4QP0A 1R4XA 3G6JB 3PYCA 1RJRA 1DVFD 3KWVA 5LLIC 3GSOA 2G60L 3PWNB 1M3IA 5AW1B 1J9TA 2FECI 5EO1A 1MVFA 2PYEB 4X60A 4KBPA 2NY7L 3NG5A 4QE5A 3B83A 3U0WL 5FCSH 2DWXA 4FA6A 1VKXA 2QJJA 4KW2A 1HYRC 4L8BB 4JHOA 3WNJA 5E1HB 2LLEA 2J8TA 4WJ8A 1INEH 4R7NA 3V0IA 5TF1L 4RRPG 4ZFZA 1H7OA 3ZKXB 3V0UA 4P8QA 5F89B 5GRJH 2BK8A 4GMEA 3ID7A 2L7UA 2YPKB 3O7UA 2ICWI 3RJDA 4N5EC 2BVEA 3SDCD 4FLHA 4GOAA 3BVTA 3E02A 1R3IL 3V7MA 3QPKA 1YEKH 3SKMA 4GQBA 2EC9U 3VWKC 3N9GH 4ZNCD 2J77A 1BQLL 3K2MC 3ZVHB 3VWJA 1EL3A 4QWWC 4Y90A 3TURA 1TE1A 2HKFL 5CJBA 3KLHC 1XBYA 3QUYB 4XPAL 4KI5D 4NRXA 4AH7A 2DEXX 5JXAH 4PUNA 5GGRA 3VWJC 4B4FA 3VIKA 5JDSB 1XEDA 3PGDA 5C0DA 4JFZH 1V7NH 1YYCA 1QNIA 3MVIA 2A77H 2G9HB 4OCXH 5GVJA 1JZ3A 3S3CB 1DQWA 4YXLH 4YL9A 4WJKB 3T1FB 5LSMA 3PIQA 4EE2A 2WGXA 2NLIA 2EACA 4ORMA 3MJ8B 3ECQA 3QCUL 1RERA 5I1IH 2ISVA 2NY1B 3PG8A 1UZ8B 2A74B 2WMPB 4PYSA 2FB2A 3G7TA 3FZUC 4OUOA 5JOPE 4GKLA 2O92A 4LPWA 2X0UA 2NXYB 2QUVA 4LLWA 4KPHL 1OGAB 4TQHA 4OF8A 5HQEA 1A3RL 1EHXA 1J93A 3W22A 2WYHA 1OFRA 1QSEB 2AEQL 4HIXH 2WMJA 4PWKA 5A69A 4DGIL 3HB3D 4OCSL 5LNDA 3CMGA 4JO4L 1XR9A 5B8CA 3G5VA 5E8NB 1E8WA 4M7LT 2WXQA 3DO3A 4PS8A 3GMMB 2NCMA 1TQUA 4PRRA 4KWWA 3KRBA 1V7MH 1JGEA 1F56A 1PZSA 3E8VA 4B3LA 3FS9A 1U8NA 1E4KA 4TUFA 4L1LA 1OAUL 1TTRA 2AV7A 2FX9H 2B9BA 5D72H 2J62A 3ZYJA 3BJTA 4NQ1A 3W2NA 4ZO8A 1TVBB 2BS71 2Z34A 1E6OL 3SO3C 2IC2A 2HG0A 4K8EA 1GQIA 2BXVA 3LHYA 1E4KC 4HZLB 3O3DB 4OIIL 2YX0A 1T1WA 2OMYB 4YYCA 4W6XB 2VDOB 2P0IA 3LH9A 1NLBL 2PCFA 4HHAB 2VFHA 2CNCA 3S37L 5D8WA 1F3JA 1KBGL 5IK3B 2A9DA 3OKKA 4PFHA 2OMWB 1FNAA 3UPAA 5DFVC 4PN6A 3L7EB 3W82A 3V6ZB 4JFUA 2DIBA 2H1XA 3X1NA 3IJSB 3UXDA 4DVOA 5JHLL 2CLFA 2P3EA 1HL2A 3GKFA 1XGPA 1A1MA 4G11A 4S23A 1AS6A 1BQRA 2EINB 1R3KA 4DF0A 2LLLA 4YXGA 1E6NA 5D2NA 3UWYA 1I4FA 2ZOXA 1D5ZB 1E3FA 5DHYB 5HWMA 1KV8A 1P7BA 4MAYB 2PI6A 3WCYA 1LMIA 3QY7A 2JB5H 1H7NA 5FGRA 3CQ0A 4HJUA 1KFAH 3ZIZA 4PJBB 3MLVL 1EF3A 1VBGA 1JCYA 5E09A 4KRPC 3HC0A 1BQCA 1LOSA 3MCG1 1GAFL 4XBEL 3FKKA 3KRZA 1EO5A 2PO6C 3TJEH 5IJCC 1OFQA 5HHME 2D7PA 2V63A 5A3HA 4GPNA 3P30L 2YA0A 4JZOA 3KL3A 1TG8A 1G4MA 4F9LA 1C8XA 1Y18A 4N7QA 1UPPA 5CZSA 2RHGA 2HK1A 4KDTA 3JW7A 4AEIL 4L6DA 3NYKA 1S8DA 2EJAA 3NL6A 4MNJA 3GAYA 3WAJA 4U1IA 4B27A 2F19H 4E9QA 3CUFA 1B2YA 1SEQH 2G2NA 5F8RC 4F9LC 4AYBA 4UINL 1Z9OA 2C34A 3VI3B 1N10A 4Y9AA 4I9WE 3RM4A 3FHEA 5D05A 2MNWA 4YGAB 2V5YA 3SGZA 3CU1A 1IE7C 2P5PA 4XXCC 3WH7A 4RGOL 3ME0B 5FKAA 1KCBA 1U3YA 2X4OB 4PB0H 3FEMA 5DMKA 1V0KA 2QMKA 4PJ5B 4YSQA 2YQGA 1J6PA 4HIHB 2DQHH 4EKXA 2R23B 1UGNA 3AWNA 4EXPX 3HIJA 3BI9X 1DQQA 2KZ1B 4LEOB 5EWIL 4C4KO 4X8JA 1PY4A 1TTAA 3BGFC 4PJ8D 1KIUA 5CPQA 3RAOA 3R7RA 4AEFA 3P0YL 2R69H 1NDWA 2DUAA 4IFOA 1K4GA 4N90D 2VB5A 2Z4QA 2VD8A 3K13A 1DKWA 4LCYB 3D87B 2VDOH 1WFUA 2VQ1A 3F5LA 3RUGE 5I0ZA 1PY0A 3ZLHA 2EPOA 3GNOA 3TBTB 3KNBA 4G5ZL 3ULUD 1TIUA 3MWAA 1EX5A 3S36X 5I1HL 3LGGA 5D2TA 4HALA 1JGMA 2B81A 1GVEA 3FYIB 3VIMA 1SVDA 3S5YA 1BWKA 4ZQNA 5I1LB 1XKYA 3UCCA 3K72B 3FQXB 1AGCA 4AXKA 5BXFA 5J13C 2TRYA 1ZHNB 2GLKA 4UAOB 4NM4H 3W9EB 4WW1A 4UR9A 3UGRA 3EYPA 3QZ6A 1AMYA 5I6MA 3LN4A 5FECB 2AL1A 2A7BA 3UBXG 3RNDA 2BC4B 3O45A 3NFNA 4WZHA 3VCLA 3LAFA 4RZ5A 1I3VA 3DG6A 3KPRA 2XRAH 4M7TA 3LMYA 2EPLX 1A4JA 4PBVC 3S9YA 2BHZA 5D6CB 3MO7A 5M3WA 3AAZB 4BA0A 2BMKB 1TFVA 4CCCA 2OL3H 4KXCA 2C26A 4O1FA 4F9PA 4IKIA 3EX2A 3AIRA 1TEGA 4RK8A 2QJMA 7TAAA 4MXWH 4UR7A 3PWAA 1I3GH 2PW1B 4RMQA 2AV1B 5EBAA 1F42A 4Y9FA 5ALCL 3A4FA 2NRDA 4F9PC 1V3HA 1K7XA 4G70B 2NW3A 1PZ0A 1KDJA 3N41B 1V02E 1ED3B 1Z32X 4FR1A 2Q76A 5L4MA 1UUOA 5CSGA 1CDUA 4J9JA 4FABL 4MVAA 5KS9B 5KN5A 3MRDB 3T2LA 1A2YB 2L7JA 5G2HA 2XTSA 2G5BB 5BQ7B 4NJAL 2D3VA 3IIVA 2OEKA 5IGXL 3B05A 2PPDA 5AD0A 4IBWA 2RDUA 3V79C 1FN4B 1ITQA 4QCFA 4HCFA 3GJEA 1IEXA 2OZ3A 2G2PA 2F15A 5EO0A 1KBIA 2J88A 2F58L 3NIGE 1UACH 2ADJA 5A6JA 4P59L 2FT6A 4LUSB 4N6EA 4H8WC 3QUYD 4O1AA 1ZLPA 1HEZA 2EG6A 5JH1A 2CJUH 4I3SL 3OPZL 3WLLA 3QDJA 5CQ1A 4QHRA 4FQLH 2V69A 1H5BA 4HS8H 1F3WA 1SDDB 2V8LA 1JUEA 3VVVA 3GJFH 5F2FA 1DJYA 2E9GA 3B8VA 1AGFA 2XICA 3V6OA 4TV5A 4GX9A 4PHZA 2A5HA 2LABA 3CO8A 5FF0A 2WQAA 4ONGH 3THDA 1FAIH 1D9KA 3F2CA 5F7DB 3UWWA 2NYYC 3N9SA 3KR3L 4HUXB 2NY1D 3QEHB 4XMKH 1AD4A 3V6OC 2B3IA 1SO6A 5I5RA 3FGCB 1D9KC 3E0FA 2AGTA 2NXYD 4IGHA 4MFEA 4TSBL 1OGAD 2Y06L 4K2SA 3L2IA 2DEWX 4MMYA 2XUWA 1M41A 1QSED 1GWJA 3NIFE 1BF6A 4B97A 3QNZB 4KXDA 3PBUA 4L9YA 3FYOA 3I10A 3VFLA 4UQIM 3NCCB 4HXAH 9RUBA 1KN4L 5ACLA 2PA6A 4O1DA 3O6LH 4AQOA 3L65A 3H85A 4HGKC 3SKJH 2ZA3A 4HKXA 5E24E 3VD1A 4X7TA 2WMHA 4EN3C 5DEFA 2VDKB 5FYKL 5E1QA 4APQA 1Q94A 5C0JB 3C0SA 5MEPB 4HYVA 1HXMB 4C56B 2NZ1A 4TLUA 3QORB 2P5EA 1I8AA 3NRQA 1NBVL 4AGOA 5TE6H 3N0PB 1L7IL 3V1HA 3LY6A 1J87A 4H88L 1EJSC 1EQCA 3MNWB 1CQKA 4MXVF 3ECBB 4QE1A 4WTZG 4Q8BA 2HT4D 1FGVL 1ZT7A 1UQYA 2XXCB 3HJ0A 3KS5A 3WQGA 5A8NA 4NUQA 1JK8A 4UIMA 4FNLH 5CMAA 4DOHB 3ROOB 1FBAA 4KC3B 4L4LA 4XNZC 1SXSA 4CCZA 2Y4SA 5E0QA 3SCVA 4HBKA 5D1QB 1LG1A 3G1VA 4PI0A 1HJSA 5DBUA 2AJVH 5IBTL 3X3FH 2QSCL 4FOKA 3ABKB 2PP7A 3SSGA 1NINA 5MI0B 5K9QG 2X16A 4M51A 3WQFA 5AVXB 2XXFA 4MAYD 1S9KC 2A9ML 5HPMB 4YFEA 1OCRB 2QGCA 1L6FA 3G5ZA 3UPBA 1E9QA 4HC1L 1ISYA 4H0LC 5D7SH 3HEIB 4AUUA 3ORJA 1P43A 4IK6A 2EKCA 1IJNA 3GWQA 1MRAA 2IH8A 4Q8PA 2V2DA 2OQLA 3S4TA 1AIZA 1ZBCA 4E3VA 3JV5A 2ANUA 5F7MC 5L7XL 2PSNA 4MJ2A 3BG3A 2GTWB 4P46B 1MRCH 4FHJA 1IGMH 3QPEA 1TCMA 2YFNA 5I78A 1OVZA 3CXDH 4ZOCA 4QRTB 3V5KA 3WGVB 2DUZA 1NUGA 5TDNA 1WHPA 4ZUSB 1HJUA 3MRNA 5AVNA 4FQXB 3GNML 5CGYD 4F2UA 3RDJA 2GPTA 4GZIA 5CZJA 5F21B 1FZMB 3TJHC 4JN2A 1JNDA 3EJSA 4XD5A 3I6GA 2P49B 1GW0A 5EV7A 3NQBA 1J1XL 2E9IA 2Z29A 3MVSA 5C92A 4F2FA 4ZL1A 3GT6A 2WKGA 4MX7B 3VDCA 2Q7NA 3DVIA 1KJMA 3B7YA 2OMAA 3M47A 1F8IA 2F7RA 4Y1TA 2L7EA 4PRAB 4PJ5D 1WCBB 1A3ZA 2JCCB 2V7NB 2JK5A 4ETQB 4WFGD 1A4BA 2B4CH 4JMNA 4HSOA 4HJ0C 1XLHA 2WKJA 1J5HA 1MUCA 5BXSA 2QCLA 1X1OA 1UMLA 4RMSA 4R4BA 4A3YA 4ZPTA 3BFOA 1DWHM 4PY8J 2I7GA 3G0UA 3VH8G 2I16A 5XIAA 1OWRM 4NIKB 4Z5RB 3NCYP 1NL0H 3CK5A 1JCJA 1IQ8A 2XJLA 3V0AC 2WHJA 1DQKA 3FOMA 3EF7A 3NSDA 1XGRB 3VIIA 4H1LG 4AE1A 2Z7UA 4PUKA 4HNUA 2FGZA 2DQMA 5ILTH 2V5RA 4R3SB 1RD6A 3DX1A 3ZR4A 4R7LA 1AD0A 4E9RA 3OKMA 3PJSB 4N2OA 3T6XA 4F8TA 2FWOA 4HH8A 3JZYA 4NQCB 1DL3A 2V2TA 1OCJA 1P7KB 2QR6A 2WSYA 3WMCA 4K15A 3RDTB 2Q8LA 5EFIA 4J6RH 1M65A 2QNEA 2HFFB 4GXUM 4JHMA 1DBTA 1UXSA 3Q43A 3DBXB 4OVXA 3F5WB 4LLVA 3D3AA 3IAPA 1M01A 1ZDQA 5MENB 3ZK0A 4QO1B 1J5TA 1Q65A 2GQ8A 1NCNA 4X80H 1WNOA 5B1CA 4AIBA 4UTBA 3WIHA 4NZFA 3WDJA 1P4BH 2WZAA 1DQMH 1GJWA 5E9NA 4R96B 2QJDA 3L5XH 3MB9A 4GUFA 5DK0A 1T03L 4DW2H 2V17L 5LWYL 2KQMA 3LZ3A 4MB5A 1F3DH 3P0VL 4Q8WA 4OT1L 3D3VA 5CUSL 5AY7A 3ES7A 4M3KB 2CO4A 4XNDA 3V4VB 1CFNA 4Y5XB 3OX8A 4S3AA 2QMJA 4IOFC 4KOBA 5EORL 2BY0A 4UQ2A 1I1XA 1C8PA 5GIRA 3A3YB 4HFUH 4IU3B 1WBZB 1A0QH 2VW7A 1I8UA 4WUUB 1WAAA 1QZ1A 4FLQA 3K2KA 1U3ZA 1E9ZB 5CG0A 3SCRA 3N3TA 5FI8A 5DLLA 4XVUD 4NJGA 3MBEB 4C6OA 1R3LA 2V8MA 4CGUB 3WKZA 3GBDA 1FWGC 4OCRL 1ONQA 1F11B 4U1LB 2Z91B 5JHDE 5SWQA 3F12B 2V5JA 4OGQC 3RTQC 2FSEA 5KSUA 1CFTB 4K71B 4DSYA 3LIZH 3W84A 2ZCHH 2V30A 5GQBA 4CMHC 3ZU8A 4Z0BH 3EYUL 4OJEH 4M62H 1W3LA 2BERA 3SE9H 1FVEB 4JPIA 3N2CA 3D9AL 1MFBH 4M00A 1ISVA 3ZTCC 2BVTA 1AJ7H 5EGRA 2ZX8A 3W1PA 4PY8I 3QS2A 4NQTA 2IPTL 4HULB 1ZHBB 4QGTA 1YPXA 1T7VA 1JOIA 4KJQD 3WLMA 2YXWA 4DBSA 2ADIA 4XGZB 2C4XA 3C52A 4YAQB 4MNQB 3OLIA 4X0KA 2EDOA 1ZBWA 4H41A 3NTCH 2AABL 3ILDA 3RWIA 4KK5C 3BEWB 5D4HA 5IQ7L 2XN0A 3BAEL 2R4RL 4HT1H 2N4IA 2J6XA 4K3ZA 3S5LG 3M0YA 4PS3A 1UOLA 4NENA 1AY1L 2C3GA 1XLKA 2WUCH 4C56D 1BOYA 4Y5YB 3S4SB 4X83A 4LQ1A 4ZG1A 4OGYL 1CYGA 4HS6A 2JI2A 3CSTA 5BMXA 4ZB5A 4JN6A 5IHRA 5C08B 2AJ3A 2ZXQA 5J11B 3MUY1 5HHOA 4Y2WA 4KKPA 2OFQA 1SLVA 1NFDE 4EDWL 3B8WA 1LO4L 5B21A 1AO7B 1MIEH 2QGEA 3CQPA 2IWEA 4OGXL 4Z1DA 2X2YA 4GY1A 4AMKH 3C2SA 5AYIA 1PD6A 5D1QD 3BO8A 4XVJL 4LSVL 4KRNA 4G1NA 3CFEA 1G7LA 1MI5B 5AFDA 4R4ND 4GNVA 4A2SA 3M9YA 3BLFA 3NJ3A 2CIKB 4RMBA 1FAKT 4KERA 2AFNA 4J8QA 4G42B 3ANYA 2ZKYA 2O4EA 3UC0H 1F97A 4MJ6B 2D2CC 1JD9A 4L1TA 3VQLA 2YD2A 3OQEA 4IRZL 4L8CA 4NNPL 3BQVA 1M2VB 1NOWA 1VEPA 1MHHA 3L1GA 5EF0A 3EGXA 1U8CA 1L0YA 2E27L 3C5SA 1MCQA 35C8H 2E6PA 1KTLA 4M7ZB 2GK0B 1XYFA 3ESOA 3KPPB 1HAUA 1TQXA 3WUGA 1EJOH 4G1MA 4RH4A 4P46D 2YIHA 2FJGA 5F3FA 4U6XA 2EDQA 4M6AA 4O17A 3HGOA 4RX4A 2R56L 4X9YA 4FQXD 5F7EL 3O0KA 4XNYH 4QQ3A 1CFQA 3PSWA 2W65A 4L4PA 1LVEA 4QLRA 1PO9A 1B3IA 3U2EA 5KJRH 2C4FT 1OTSC 3ULUF 3BP5A 1PE1A 2VDMB 3UWVA 4YL4A 5T3XD 4ZMVA 3V55A 3E5BA 3T42A 3A4XA 1LL7A 5HMEA 3CDCA 3SBFA 3BE1H 4OU3A 1KQYA 4KOCA 1KG0A 2RALA 3N2BA 1BMGA 5I3IA 4ZFOL 3MPCA 3IDJA 1N3NA 2VDNL 3MRMB 1ML1A 4K5LA 4C5YA 5GJMA 2I26N 1WA2X 3HHMA 4LU5H 2Q8BH 1LO0L 2ID5A 4I5UA 3G6JF 5D9PA 3SRDA 3T81A 3MV9E 5EUOE 4EDXB 1OLZA 1V6TA 2OLAA 2FYVA 5A6MA 4X6FA 4L1DA 2SODB 2IPUK 3CSYA 5BRZA 1XTMA 3G5YA 4LL4A 1W32A 3GHSA 2GHWB 1OSEA 2D9QB 5HPCA 3NABL 3SFKA 4P4KA 2VX7A 3QW3A 2XY1A 4AD1A 3NQKA 1F4AA 5EOTA 3NPXA 4MJZA 2DY2A 4KEUA 3QOMA 2V2XB 4OZ4B 4KEMA 4NQCD 3BPOB 2DIJA 3WD3A 3DEQA 5HSFA 2CDGB 3RDTD 2NZIA 2F8VA 3L6FB 1PL9A 3TXVA 2ZOUA 3BH9B 2DQCH 1QMLA 1QWUA 3DTXB 1MW0A 4YXHL 1W72A 3VGDA 4ZFMA 1IB5A 2VR6A 3KVJA 1GGIL 1KEML 3ITVA 5L9FA 4X6DE 2I1OA 3RJXA 4K39A 3R0UA 1ZGLB 3Q8EA 1USZA 4RBPH 5MEND 2NVCA 3WBWA 2YSSA 1O75A 3QZPA 4X4YA 2WVUA 4F7PB 2QHRH 3CFDB 3MGOB 2VP8A 4C83B 4KBXA 5C9WA 1NCTA 5G4OA 5E2WH 5CR8A 1E27A 4GIPD 4JIRA 2A38A 2BHUA 4ZZ9A 1BEYH 5EUKB 5A6BD 1REQB 2XC8A 1Y5WA 4YPGB 3CL6A 4F7TA 3VQ1C 3D0LB 4UYPA 3R7QA 3TASA 8RUCA 4NP4H 2ODHA 4FOMA 5TNVA 1W3HA 3ZDYE 5CCKH 4NHCH 4P2QE 3OVQA 1C08A 5B39A 4GW5A 2M1KA 4ZTPL 3DX6A 2VDMH 3BV7A 1EIXA 5TFSH 3FY1A 4RAUB 3DURA 2EH7L 2P80D 1ZLUH 4TVPH 3DSFH 1QOXA 5GJNA 4WUUD 2ZRZA 2VD9A 1XG3A 3AQZA 3KPMA 5FFLA 4HPYL 1KTCA 3E2VA 1IQWH 2WV3A 3RFZB 3VJ6B 1QFEA 2LR4A 3MBED 3GLCA 5F9DC 4YSAA 3OR7B 1ITBB 1ZE3H 4AMCA 4QITA 4DY1A 4PRHD 5CJOH 3ALPA 1PZ5B 3WFZA 4DCQB 4AISA 4GJTB 3SZKC 2ZOLB 5AWNL 2GTZB 5DCEA 4R4FH 2WSPA 5BVPL 2VC9A 2P5WA 2EKGA 4AIZA 3MKVA 1CC3A 5M95B 1EJUC 1W2KT 5DY2A 4J5VA 1WFTA 1DWFM 4C6PA 1T5XB 1Q7ZA 4GXUN 1VGAA 5C8JA 4ANVA 4LCUA 4JFHE 2CHWA 2XSXA 1EBPA 3HMWH 3OM3B 4AQZA 3QEQB 4UAHA 2YL6A 4KTDL 4HDIB 4ICMA 2VXQL 5DJ2B 3JVGA 4WNSA 2OK0H 4YSPA 1J0JA 1YN6A 5MERB 4J2PA 3FMGL 1D8CA 2AJXH 5GGSB 1OCWH 4BZ1H 3T0DA 2D4FA 3BLIA 3US1A 1BMZA 4MNQD 3T3PE 4PBDA 1BBJB 3BIKB 3JVGC 2ZOOA 3UPWA 3HFTA 1QLEL 3V95A 4YSCA 3OKOA 3S1UA 3LM3A 4JKMA 2ADFL 3P73A 1BSIA 3ZE2E 1LNUA 2P46B 3TNNA 4D1JA 1CGSH 4Y4KA 2WXFA 3DUSB 3FSWA 1QAPA 1G6RH 1I1RA 3HTWA 4I5BA 1PCSA 2ZCLL 3V5HB 4A2DA 2RJHA 3CZ8A 1BQHA 2HSIA 2FGBA 3CS2A 3HMXH 1UWTA 4Y4KC 3L3DA 5I1JH 2MQ3A 5C08D 3U48A 1ES0A 1BXCA 3FOKA 3HG1E 3PLYA 2GSIA 2BH0A 1E4XH 2MCMA 1BJ8A 1AO7D 3QDGB 4DPPA 2F8IA 2ZRUA 3L9YA 2IH1B 1MEWA 3TL5A 4LBEA 4Q4RA 1VZIA 3A13A 3CPLA 5JBDA 1MI5D 4EF3A 1M7XA 2YPLE 4Z7VE 4LNRB 1WZ1L 5DO2C 2RAGA 3LN5A 1JZDC 3H2FA 2B59A 4DKFH 4ZO6A 2DQIH 4PLKC 3VI3F 1L5GB 1S2EA 3NRFA 3T8MA 4KVNH 1GGCH 1JVKA 4ODTL 2NT1A 4WK9A 2EG8A 2VDRB 2H0EA 5GGVH 5FV1L 1GG1A 2FDBP 1GNXA 1VZWA 4LCWB 5RUBA 5K9OA 5GISH 2WO4A 3QA3B 3OZ9H 5MKGA 1NBYB 2NCEA 3SQBB 3OIHA 4QT5B 1EC8A 3P4OB 4ASTA 3ASNB 2WCPA 1TZ7A 3WMSA 2YDQA 3SPHA 4XO8A 1S7RA 2DZWA 4JKWA 3EBIA 1MFMA 3V75A 1J5DA 3QZOA 3RWHB 2AK4E 1T6BX 1MFAH 5D7JA 3LZLA 1OK0A 2E5CA 1YEWA 4J3OC 4QRUA 1XUZA 1KFCA 4AYFB 5E08L 4KK6D 3BYYA 3U82B 5HI4D 5JHMA 2AXGA 2YZ8A 5HNRA 1J88A 1OSPH 3V0WL 4JKLA 1E70M 3FONB 2XWEA 1A6PA 1MZHA 1HXYB 5EEWA 3IPWA 5L9DL 3LA4A 3CFKA 4DI8A 3MREB 4UOZA 1M5WA 4GS7C 3A4WA 4F7MA 5DJYB 4U5IA 1SFSA 3MMEA 3M1BA 1XDJA 4XD3A 2R24A 4EXAA 4DERA 3F7LA 2DWEA 4L37A 2AKMA 4D94A 2DYPA 2H41A 5CZVL 2P48B 2OJPA 3D08A 4G8AC 4MY8A 1A3HA 1VHPA 3NQ2A 1S7XA 2W88A 2AXFB 4U6VL 5BS0A 2XIJA 2FHBA 1LT7A 3IJYA 4D0DA 4WFHE 3QYSA 3B8UA 2PPCA 4XNXH 1FRGL 4L3CA 1RMFH 3MJGX 1RZJC 3KXQA 4LALA 4XRCA 3AUWB 4MB4A 4L5FH 3DA0A 1NCHA 3HUJE 2ERJB 4G71B 1MQKH 2XFXB 3E0IA 2EYSA 3MYPA 4G83A 2HMCA 3GBNH 5I1AA 2TMDA 5DD0L 3BPCB 3AXLB 4OVUA 4QCIB 3P9LB 5CC5A 1SOXA 1KYFA 1HSAB 4Z42C 2LQRA 4M1RA 1NA8A 2CCVA 4GCAA 2R1WB 3R06B 2KT6A 4P3DA 1BFVL 2ZUUA 1JGDA 2JKAA 5F2MA 3MXVH 4ZDHA 4AQ1C 4NQDE 2VDRH 2NVDA 4N2HA 5CLWA 2CLZA 3ZHDA 3WS3B 2FLIA 1TQBC 3OGRA 1D2PA 4WK0B 4ZXLA 5DD5H 3W1QA 3AM8C 4CVZA 2NQJA 5B7YA 1NGQH 3EZJB 1GKQA 1Q6OA 3VFVB 4QR6A 1FG9C 3BQUC 1JF5A 5TTRA 3VQ2C 5K1NA 4L7ZA 4HS3B 5JIHA 2GITB 3DVNA 3EOOA 5DD1L 1AG1O 3GIVA 1VZHA 2BIPA 1E4NA 4MJMA 2HZGA 4APXA 2IKJA 3WLOA 6ALDA 3CH1B 1VGEL 3V6FA 2K7QA 3AT9A 3WY2A 1WT5A 2CLRA 4GGBA 1YRRA 5FIEA 1JVLA 4H2CA 4Z95H 1Q72H 2IQAA 4CC1A 2H3NA 5ESAB 5TH2A 4YX2H 1YTKA 3EO1A 1WT5C 2APXA 2MPAH 2ADAA 2J4WH 1S1RA 1OCBA 2DW7A 5EC2A 1Y1UA 4YTUA 2OLDA 3WQOA 3W1ZA 2BRQA 1TSHA 4DJEC 3GY1A 4Z1YA 1WXZA 3GU1A 2WJZA 3FCTB 4U1MB 3TN3A 3X3GH 3GKWL 3AXIA 2AQQA 1OANA 3TYUA 1HDMA 1OHQA 1B4JL 1PAZA 1IEAA 1PNCA 3FCBA 4RNRB 3CIQA 3O4LE 1H4PA 4LVFA 2NY5H 1C5CL 4DI9A 1TJIL 3P2BA 5INDA 5SX5H 3TLLA 1HKFA 3FXGA 2E1DA 3WMLA 1A5LC 1QLFB 1PW3A 3LTPA 3QEQD 4ALAH 4FG6C 1H3VA 3PV6A 5IFHL 3VU2A 2X4TA 3FH7A 2QJGA 4NOFA 3QWNA 1PAMA 1JMZA 4ZFFA 1TYGA 2YC1A 4RGNC 1UZ6F 2HMIC 1RHFA 2J20A 4MJIA 3C8HA 2VMDA 3NPZB 4AQAB 3FRUB 1UUQA 2CLVB 2W80C 4NKIH 3TC7A 3W0WE 5G5DA 1TJHH 1NGWA 1XH0A 4YHOH 3H7BB 4H25B 1TPWA 5GGTH 2OCZA 2NQ3A 3KPLB 2PP8A 4MLJA 2NWRA 3FFCB 3NZQA 1ETZA 1HKLH 5AHMA 3QUML 4G2DA 3Q6GL 3WDQA 3BSHA 4G6JH 5G4WA 1S7WB 1QI2A 1BD2A 4FQ2H 4M02A 3JR2A 1ORSB 4H8UA 5C09E 4NNYB 2HVMA 2J3SA 3HG5A 2X1TA 3M0JA 1RIUL 3FKRA 2ICEA 5JO5B 2NLJA 4R8WH 4B41A 1PSCA 3LD8C 3OG2A 2D20A 2B7PA 3QDGD 5E9DB 4BZ2H 3L08A 5FO8A 2A6IA 2ICEC 5C7ZA 4AC7C 1AR1C 1MH5A 1EPVA 3E12A 1XISA 4HCLA 4JDBA 3PTDA 3VFCA 4A2MA 3RGBA 4OD2B 1G0YR 3NACH 2FTAA 4A66A 4JPQA 3GZOA 2AS5M 3GDBA 4PQXA 2AQTA 1TF4A 3DROA 3KBPA 2DAVA 5T1KB 3VYPA 4FL4C 1OCNA 3U9PH 1ZBKA 4A38A 1BXBA 3H8AA 1E4HA 2UWEE 1F3RB 3GH7A 1W37A 4B5UA 1VKFA 4LCWD 2H9GA 3VGAC 5J1AA 1NDGB 1ESOA 3LRHA 2CUHA 2X30A 4QRBA 4XHJD 3B2MA 3BPLB 4YBHA 4HH9B 3FQRB 3AHXA 3ZUCA 1U3JA 4AXWA 3B5HA 2X9YA 4Z7UA 5FF4A 2B3RA 1M71A 1U21A 4P04A 4D8PB 3P4NB 3CLEL 4KKXA 3BMXA 4OLZH 5L88H 3SQSA 4CU7A 4JGDA 5IG7B 2QJNA 1PSKH 1DTUA 1BQUA 1OIOA 4JQXA 4FK9A 3GSNL 4PAZA 4K9EH 2R1NA 4EAEA 1JERA 2XZQL 4NIYE 3G6DH 4JGMA 1K5NA 1RY0A 3C6SB 3ZE1B 1CL7L 1RJZA 1BYPA 4Y9BA 2UV3A 2VM8A 1UEMA 2GFBA 4I2XB 2OTUA 4AEHH 2XH0A 4JHZA 5IMMB 4G5DA 4QXIA 2ZRYA 2X4SB 3EFDL 4Z3EA 4R2GC 2VYOA 3WQPA 2QW5A 3JV6A 2C9AA 1A6UL 4HU2A 1EXBA 1AYOA 3W53A 5L8JB 1UENA 1XLCA 3OB0K 4YDLC 4OLUH 3S9ZA 1NBZB 5LN8A 3D4ZA 4N6RA 3PWIA 2VGBA 2BXZA 1KPVB 2IAAC 4YN3A 3TOYA 5B4MC 1L9PA 1I1AA 1ZHKA 1A5UA 2X7LB 2QF8A 3T07A 2BVPA 2YOAA 5CLTA 4RGMB 1VAHA 5C86A 3UZQA 1U8PB 2DYSB 5FHBL 1IGCL 5ITFB 3LD5A 3GINA 4M6QA 5B8CC 1JEZA 2W38A 1R3WA 4ZTOL 2QDEA 5E94A 3U4BL 1MCDA 1UZ1A 1KPRB 3B56A 3TJXA 1J79A 2VDLB 5IESH 2XG4B 3ISRA 2CKSA 3RYSA 4N42A 3VXTB 2FJHA 2LE9A 4Q0XL 1BOGA 4FP8H 3MHFA 1Q5MA 3SN0A 1YPZA 1SQ7A 3G9AB 3WFHB 5CSBA 3VRJB 3SD2A 4TNVK 3LPGA 1F2XK 4FA8A 2CLMA 2QZ5A 4EZMA 3FQ2A 1KJ3H 2CU9A 1ADDA 4B5WA 2J71A 8PAZA 1OF6A 3HFFA 3ZIMA 3N91A 2UX6A 1ZLSH 2V6AA 4JJ5B 2YL8A 3SIMA 2YGQA 3V36A 1PCWA 3WNOA 1X9RA 3W74A 3JTSB 2O4MA 1ZIBA 4M1DL 3E7JA 4Q6YA 5ICZA 3E3QC 2BVQB 1MLBB 1CLXA 1DJSA 2YO3A 3QYQA 3NQAA 3LQAL 4M7KH 3L3IB 5D2NE 4LV9A 3PB2A 3AROA 4QRPA 5C70A 3F58H 2NQHA 1HYSD 5FUZL 1FWSA 2VUOA 5D2NC 2G3ZA 2CBPA 2W5FA 5JUVA 2OL3B 4M8QB 3J8F7 1Q9OB 4ZQPA 4H9TA 2WJ5A 1QWNA 1MEXL 4PJXB 2VEGA 3KBHE 3QULA 1DVYA 4OF3A 3K2UL 3S4SG 4ELKB 2LV4A 3KWUA 3UC2A 3OSVA 3SCPA 1X7IA 4HU3A 2OFJA 1YNYA 3NEOA 1M57B 4ZW8A 4IMAA 1ISXA 3EX4A 3SGEH 2Z8VC 4DGUA 3KOFA 1KYOK 5T9BG 1U6AH 5CCZA 5E03A 4J3UA 2WINA 2WVTA 3MRJA 4KDTC 1UZGA 3O2DH 3HS0B 2KBGA 5KSVB 4O28A 2FJKA 3PF2A 1YJDL 4IIGA 4JXCA 4Q6XA 3SB0A 3NJXA 3LS9A 4G8GB 1VFBA 3G5EA 5FM8A 3AZRA 1QTSA 4X4XA 1R3SA 3T1WA 3U6XS 3C2AH 1MEHA 3BH4A 1HINH 2OKTA 3H9ZA 1Z9LA 3BXWA 3NQEA 2FB3A 3ETTA 4TXVB 4A7GF 3ULSA 5HI5C 1F0LA 3GJFB 1UKQA 1C91A 4RWYH 1NEZG 3M0XA 4HXBL 2VDLH 3OGCB 1XP3A 4ZFGL 2KPWA 2BIIA 4PG9A 1EEQA 5H91A 1RUKL 3A5VA 1NWTA 1OAXH 1OAKH 1GY2A 1BZ7B 1TKKA 3W7GA 1ODUA 3FFCD 4F58H 1JWUA 3ZXAC 5I1GL 3SRKA 1BTCA 3BZ4B 3GDMA 1YIXA 5EU4B 2A79A 5E0FA 4ZQRA 1RZPA 4YC2B 1ZSDB 3OZPA 3Q58A 4GKSB 2CWNA 5CEYA 3SBRA 5J9PA 1WV2A 1CZ1A 1WA1X 3UAJD 4P06A 1GQKA 4M43H 1XC6A 1KB9J 3G6AA 4K3JL 3MRFB 5DC2A 5HYSB 3NQDA 4O12A 1TRDA 4TPRH 2FZMA 2FD6L 3RZCA 4IX0A 4TTUA 2GCYB 3WHE1 5E9DD 3P8IA 1KCRH 2PYED 1FNFA 3KPRE 4MNGA 3NL3A 3KHDA 1WWCA 2OELA 3OIXA 2Q1EA 5F9WB 2CHXA 1TQVA 2NV2A 3RZCC 3MAWA 2AQ3A 2H6UA 5FM5M 5DVPA 3VW3L 4N2GA 3M7OA 1UP3A 5DN1A 2ZYFA 4XOCA 4K8RH 2EUVA 4I77L 3T9WA 1NAMH 1TREA 5T1KD 3HPJA 1FA2A 1VEMA 4DUWA 4ADJA 2Q3OA 1NWPA 4G43B 3BP4A 5FOBB 1FFTB 4IYKA 3ZTNL 2JIEA 2GVLA 3LPFA 3IVUA 4MQXC 3MACH 2DT3A 2W81C 2EG7A 2J43A 1G7MB 3MJ9H 1B3WA 4OW6A 5EZPA 5IBLD 4WO4B 2CKBL 2XKNA 3R8QA 2XLLA 3IMSA 3P0XA 4XBPB 1TMHA 3IM1A 5CD3B 1TUPA 3S8FB 2J9YA 1UMYA 3UADA 2HK0A 4LANA 5BNXD 4RCXA 2B14A 1JHKH 1OAQL 5A40E 2FTYA 1RUMH 5DJDA 3QDJE 4WDUA 3VB9A 3SYOA 3H42L 2R9HD 1XSKA 2VXVH 6XIMA 3BSZH 1RHHB 1V7AA 5IB2A 1RIHL 5FESA 5BPPA 4Y7OC 3V6OE 4F3HA 4K7PY 1H5BC 4MLRA 3LKRB 1SXAA 4DAGL 4KHTL 2IXQB 1TPB1 2MSPA 3LHPL 1JTTA 3HU7A 3RPIB 2PBOA 3R11A 4XTDA 1NBQA 1KCKA 4H9MA 3V0SA 5CJNA 3DJTA 1TYRA 4XXWA 1Q9LB 3NFSH 4QXWA 3DX4A 1ITUA 5F1NB 2B1HL 1E4LA 2DORA 1SMAA 4WW2B 1HJCA 3MLYH 3AADB 4AZ8B 5D71L 4FFZL 4HFWB 4FEMA 3UXFA 1E4XI 5G1MA 1KF9B 4XVSH 2HWZH 4HF5H 3QCTH 2GIMA 4ZXBA 4GKNB 5IQ9A 4N8UA 1C5DA 2Q3ZA 3KBJA 5CM1A 2NR6D 3S88H 4OJFH 3L3GB 1N5AA 1WCGA 5JBFA 4TSCL 3QFJB 4ZXBC 3KVMA 3FOLB 1WAUA 3W5NA 3FB8A 2GJJA 1LWJA 1J8RA 2J6EA 2OSXA 1XRSA 2D03H 2W0PA 1AZVA 4APQC 4PJFF 4WFFE 3GVRA 3PDDA 4ZQKB 2O9OA 1JF1B 3K71A 4XP9H 1SPQA 4HBQA 1XZWA 1Q63A 4H0IA 3CX5K 2EXSA 2IALB 5LXVA 3ITXA 1SJVA 3OLGA 3RNKA 4TR9A 1E6XM 3IGSA 2ABAA 3CL8A 4RX0A 3TN0B 1FNGB 2X3BA 3VZYA 4LT7A 2JGQA 3LI1A 4JFYA 5K9DA 2DKMA 3MLUH 3NIDB 3TT3H 4AH2B 2YUVA 5L4FA 4AHQA 3Q2LA 1J8SA 1KBPA 3D8MA 1VZGA 3CUJA 3SPVB 3AQXA 3ZQXA 4JQAA 3IN2A 2PABA 4P5RA 1SJEB 1B3YA 3T55A 4YVNA 4L3EE 5HANA 4UTAA 4P2OA 1W6TA 3N12A 2PP1A 3OWEA 3HV8A 1OT4A 1NGPL 4PJEA 1XTLA 2I17A 1ND0B 3VFMB 7CGTA 5IFAL 3T4WA 1Z0MA 2PMZA 4K8RD 2XIIA 1ML0A 4Y89A 4P2OC 2MCPL 1GW6A 1ELSA 4JNYA 4KV5E 3NZRA 3MOAH 4QR7A 1DANU 1ZS2A 2VR9A 2C1PB 1PTDA 1IAMA 4B9GA 4XMPL 4MJ4A 4EI5A 1WS8A 2GEQA 1FHUA 4LB4A 2REQB 4KHXH 1S46A 1EAPA 3DIVA 4GNKB 4HWBA 4P8WA 2HFEB 5JW4M 5ANME 4YWGH 5KSAA 2V2HA 3NCEB 4EI5C 1R86A 5IKCA 1S3RA 3GNPA 4US5A 4HIJA 4B9KC 4G8GD 1CFSB 3TYBA 2G2RA 4DP8X 1OPOA 5IW6B 1HFBA 1I9CB 1B88A 1OPGL 2V67A 1QFPA 5TGBA 4KAQL 5H94B 3UBFA 5EN2A 1MMFA 1C9WA 2L04A 3RUGB 4C58B 3G22A 3DFTA 3LJ3A 1B3JA 1GYAA 3BRFA 3RA7L 2Z25A 2OSLB 4U0RB 4KKCD 3BP6B 5TQ0L 1W17A 1ZGLM 2UY7B 2BDNL 4DEPB 2WZ6A 2YD4A 4YVXA 1XC4A 1NCAH 2NT0A 1W2VA 1G6VK 4QXVA 3EWZA 5AYUL 1K8YA 3P11L 5I02A 2YBUA 4TNWK 3GSUA 1DSFL 4KUCD 4A3QA 5C7HA 4TRPH 1MJ8H 5E1AA 3PWJA 4N87A 2UWFA 4GZJA 2WHVA 3ARFB 4MFDA 4XV0A 3SGGA 1NCWH 3SQLA 2UXVA 3A67H 2YCEA 4JB9H 1AIFB 1CF8H 4EPDC 1JAKA 4HGXA 5E6ZA 3BZGA 4WHDA 5DHVB 3SBQA 4GFXA 4BFKA 3G0XA 1GC1C 3L81A 1HHJB 1DUZB 3D3FA 3QIBA 5KYXA 1J9CT 2QT6A 3UWEA 1RAKA 5J3HC 3RVXC 3QC3A 5K9KA 1ACYH 1EJWC 1NC4A 2WZPA 3L13A 2Z8WC 3RX2A 2WC4A 2X7VA 5I16A 1GGOA 1B57A 4WJXA 4FEZA 2WQDA 2WO2B 2FJUB 5HDLA 1I9JL 1FVDA 1WCQA 3TJIA 1WYIA 4KI5F 1G1CA 1TYJA 4QG8A 5HOSA 1W1VA 3HE7A 1TPDA 2J57A 3ZTEA 4KDWA 5T1LB 2XZAH 4NAFA 1W56A 1RQ5A 5KSBB 1SJHA 2CJSA 4NI6A 4MVBC 4UNLA 3S5SA 4QRSA 3HE7C 1M1XB 3DVGB 5DJZA 1BXNA 4LESA 1CB2A 5J7CC 3CBWA 3WLIA 3SDXE 4NUGL 2VISB 4B5TA 3D3VE 4KQNA 3QJAA 4UZUA 3QEUB 2Z8RA 7ODCA 1RJLA 2PYFA 4C6JA 5IF0A 4WO4D 4F20A 4IJCA 4NZDA 2JGYA 2OMZB 4HPJA 1GOWA 1Q8JA 4Z2LA 3LS5L 4DM2A 1F13A 4OCWL 4Y4HB 3NAVA 5JPMB 1KM2A 4FQQA 4Z7WA 4XAWH 3MC5A 3D39A 3HG3A 4ADTA 2K6YA 2VXSH 5I5JA 1T7YA 2FLBT 1U8LB 1NU5A 3BPNC 2FO1A 2QCMA 1LE5A 5D03A 5D8JL 1IVLA 2UZXB 3HPFA 4H9YA 3B8DA 1NJ9A 4IOIB 2A85A 4N0YH 5JOPD 1MREH 4ZMQA 3IJEB 1Z41A 1T5WB 4U4BA 4YZFE 3NIFB 5IOBA 4JFQA 4S3DA 4UTLA 4NZUL 5GGUB 4AD0A 3VFOA 1TOXA 3DFSA 4PTXA 2PWHA 1XF4B 5I8EB 2CO7A 4I3RL 3C87A 4OFDA 3MLRH 1FKXA 1U36A 2P3YA 1X5YA 3VXRA 1U5HA 2NNAB 1M03A 5FM5O 3N06B 1T1XB 2MOGA 2XA8L 5LIYX 1MPAL 5DHVH 5FPIA 2L7QA 2WSQA 2WIIA 2O61A 4WY0B 4C1NB 3ITYA 1DWJM 1EC7A 2GGEA 3OXSB 3WF2A 4DHLA 4L8DB 3QFJD 5AZ2L 3QORD 2ZOTA 2A3AA 4F37K 2GGGA 4XC3H 2BNRA 3BUQA 4IBYA 1RZIB 1L9OA 1VPOH 2J24A 4NN5C 1YNKH 4PMRA 2A9NH 1YSOA 1TZZA 3U7VA 5DANA 5HHOE 1JNLH 1JCTA 3GIPA 4AZ7A 1DFBH 1SVBA 1UA7A 4H8WH 3ZMNA 5DMMA 4UT6L 1J11A 4YHIA 4YO0A 2FGWH 1US2A 3EOEA 3N42B 4AY0A 3UXIA 3TN0D 3M46A 4K5NA 5ABFB 4GEIA 4LAQL 4ODXA 3T3ME 3LRSB 4PREA 4KWSA 4PMYA 4HKBA 1I1YA 2QCFA 1OTUC 2C71A 1A7NL 1XWVA 2CKNA 4FYTA 2XWTB 2EE9A 3RU8H 4S2SB 4FF5A 3KGTA 4QNPF 4HG4J 1VACB 5DD6A 3UJSA 1OB1A 5IRPA 5IEHA 3UY8A 4BCYA 3MOBL 3CZFA 2NY6B 1EZLA 4DZHA 3ZMEA 5D2LF 3BGMA 3EOBA 4P57B 3IJLA 3P9MB 4PB3A 1T20B 1IAOA 3B7SA 4ZPVB 4LKXB 2F2HA 4PJCA 2RH9A 4YHYB 5HDQH 1B4KA 4WSGA 5M2FX 4XXDB 4NUJA 3B6SB 3CHXA 3ITLA 4MA8H 3CLWA 3V0EA 1O6VA 2EXYD 5AYTA 3GIZH 4WKZB 1Y7VA 3B9EA 1C8QA 3BFWA 3DGRA 4I9WD 3OTTA 1EXUA 4DUOA 3NN8B 1FZJA 5G1YA 4PS7A 2F1EA 2H0PA 5L4JA 2FSDA 2YXGA 1QHPA 2R0WL 5LCVA 4NT6A 3ZQWA 5TE7L 3IXAB 1REIA 2AGJH 1RZFH 1KM4A 2FBJH 3GPEA 4DWSA 1ZPUA 5HJGA 4TOYH 3L4WA 4DVRL 5C6MA 4PG2A 4PJHA 1AQKL 2GK1A 4IKLA 5IMKB 1NUDA 2DQEH 5CWSA 4O9HL 1R2TA 4HYRA 2AITA 1LQAA 1LT8A 4DWSC 3HF3A 2J8GA 4TUOA 3MHUA 4IMFA 4Q9QH 4ONOA 2DZBA 5DRNA 1RH8A 2DL9A 3D09A 1W3TA 1WDSA 2ZNXA 4IQHA 4ZYKB 4M4RA 5MF5A 5C0BA 5E51A 5IOPA 4TX8A 3PWVB 5ENWA 1QRNA 4WIWA 3ZYIA 3C12A 4N02A 1A5MC 2H1LM 3V4LA 1UVQB 3V4PH 4AY7A 1U42A 4Y4FB 2D2GA 1FNHA 1BGGA 3CQJA 1RCYA 3BTNA 1J0ZA 3JV0A 4DB7A 2QCCA 1MCPL 3S48A 3GO2A 2QKIA 4PULA 5BRZE 4J3BA 1KCUH 1T66C 3GS0A 5KYWB 1EXPA 1A9EB 3P61A 3TBSB 1BLIA 2MRYA 1PZ2A 2YGYA 1M9WA 3CXOA 3G5WA 1GSKA 5I30H 2QKIC 3NOEA 3NXLA 4P4KC 3MV8A 3ARFD 4BH7B 1IIIA 1HJQA 3CHCA 4DF9A 3WFCH 1HVXA 5TD4A 4Z0XB 3VD9A 1NCDL 1F76A 2UZPA 1JRHH 5IHWA 3AUJA 1WICA 4O02L 1W0VB 1LJMA 4P61A 2XI9A 3MBFA 4BFRA 1PVNA 1MSPA 1FL5B 2B2XH 1G6RB 1H11A 3NSCA 5JW4N 3GBMH 1QATA 3OKDA 2V6HA 5T1LD 3ZLFA 4PRDB 4RZCA 3SGEI 3QHOA 3ZE1F 5E4EB 1IR2A 2XZCH 3PXJA 5F0MB 3CB8A 2I24N 4DVBB 1CLYH 4Q14A 1GZJA 1HI6B 1E2WA 3C2OA 1IEVA 3FSAA 4N9EA 3QQ3B 1CI1A 4IWWA 1MW2A 3N18A 2DT1A 3NEXA 5BW6A 1GW1A 4PA8A 1J1PL 4X5WA 1U0QA 1VD6A 3WIAA 4PGBA 4NM8H 4MS8D 4KCVA 4M48H 1G7IB 3NBNA 4R7OA 4D0CA 3U9WA 4Y4HD 3L5LA 3BLDA 5JHDB 4KY1L 2HX9A 5KYYA 5DMIL 2VH5H 2Y6ZA 5DUBA 3D48R 4KFMA 5ETUA 4O0QA 2VVNA 3A4EA 2GEEA 1PX3A 1GTEA 3VA6A 4U3XA 4F8PA 2I9LA 3PHSA 4FA7B 5I8KH 4FDWA 3W02A 1T1ZA 1C3FA 3CL7A 5ABHA 2X0VA 5IW1B 5EEYA 2G50A 4GG9A 3CFJA 2P5WE 4PJIE 1XFCA 2DQGL 2EECA 4U0QB 1ET8A 2J6VA 3IB4A 1XGTB 1DDHA 1WK0A 3REQA 3MTWA 1XB8A 3FDWA 2VX5A 3QG6A 1N0LA 3G0SA 3VM7A 1UJTA 1HZLA 5LBSL 4WEMB 1U83A 5EULV 2ZNWA 2B7QA 5ABTA 3GW0A 1ITXA 2FX7L 1XXXA 5I66A 4MRBA 1TJ0A 2I25N 4JFPA 1VCGA 5HGBA 1HQRA 3MBWB 4AQEA 3EADA 4LK4A 3VKDA 2ZBTA 4QLWA 1LO5B 3N0AA 5FCUH 3TKFA 4MFHA 4ZOAA 1OC5A 1PVHA 1INDL 1NCCH 3E3HA 1TV8A 5IVXA 1F2QA 4NUMA 1M68A 2XH2A 1FIGL 3VFTB 4ICNA 2XY2A 1NFDB 1JJKA 3V4UL 2BP8A 2X9XA 3GHUA 2XZ9A 1DQDL 4PJBF 5L2JA 1H8LA 2KUTA 4PYHA 3L3OB 4M1GH 4OD1L 3CGTA 3IUDA 1CD1B 1CLOH 3CE1A 4WNQA 3BOLA 5J8LA 3QAQA 3UU0A 2MJWA 4Z7OE 4P07A 1JK9B 3UJIH 4CD4A 1MHPH 1KBJA 4N8VB 2NNRA 4D6CA 2DIKA 3OMAB 1PG7W 1W2PA 4ODWA 1ZALA 1G9NL 5HJLA 1I60A 3CFTA 1ZT4B 1BRLB 1TZHB 2QEJA 3FUHA 2VW6A 1CU4L 1RCXB 1YUKB 1MCCA 5I19L 4LASH 3HZKA 4IGBA 3TYAA 4NQEB 1U8IB 1E1CA 4GNJA 3V0VB 3ULUL 1CCWB 2EDRA 1OY0A 2I69A 3MFFB 3GDLA 4EWJA 3RVWD 1UHVA 4LCIL 2B39A 2BW4A 1NKRA 4A22A 3OQRA 1A6WH 1RVGA 2A0LD 7FABH 4OZFA 3MYJB 4CLMA 3CUPA 3B34A 1SFDA 3GGWA 3QQ0A 3KCPA 2X6CA 1TIMA 4HA1A 3AIEA 3GMPB 3U4EB 2R29A 1E3XA 5CZXC 5D30A 5HYSG 2GZXA 4YK4C 3IBOA 2A73B 2X38A 1WTGT 2ED9A 3N55A 4AX3A 2EVJA 2MMXA 3VC5A 3VI4B 2N7AA 2Q3XA 1FH5H 2F1BA 3GDRA 3QAZB 2KX9A 1L9NA 3NPUA 2X89D 5BOJA 4V1XA 2AQ2A 1OARL 3LVEA 1MRDH 5LQBH 4TVPD 2ZPKL 1HG3A 3T8LA 3H4FA 1V54B 5D7JC 4KUCF 4BS0A 3Q1EA 3MV9B 4HP5A 4BGLA 2WQWA 7A3HA 4PFEA 5EUOB 5JTWA 1W8GA 3EYOB 2GJLA 4AG0A 4PH8A 4PBEA 3DCPA 3AB0B 1CE6B 2AJZB 1ESWA 4XB7A 3J27A 5E8EA 1S5TA 5IP4A 3FU5A 3ZJAA 1MKFA 4Y4FD 3KYOA 1C5BH 2BBFA 5IJKA 3HTLX 3D0CA 2V0TA 4FQ1H 3V5DB 1JXGA 3LQZA 4LB8A 4RWHA 4ANXA 4YHZH 5BS0E 5MEQA 3S5ZA 2JF7A 4KRZA 4HIEA 1G7UA 1URZA 1BZEA 2C3HA 1LXMA 4NFCA 3PFRA