2WW4A

A triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-DIPHOSPHOCYTIDYL-2C-METHYL-D-ERYTHRITOL KINASE
publication title A Triclinic Crystal Form of Escherichia Coli 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase and Reassessment of the Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 90
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 2ww4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2ww4A01
1XMQE 2UXCE 1DARA 1VISA 1H7UA 3WU5A 4FW9A 2UUAI 2BM1A 4ED4A 2F4VE 5LMNI 4JV5E 1N36E 3J80C 4DPWA 2BM0A 4AQYI 4LF5E 4LF8I 4DR6E 3OTOI 3K17A 1PKPA 4GKJI 2UU9E 1MG7A 2V34A 4P52A 4GKKI 4DR7E 4B3MI 4DR3I 4DV5I 4USMA 4X65E 1KVKA 1MX0A 1S16A 1KKHA 4X64E 1PVGA 4DUZE 1EI1A 4LF7E 1IBLE 4URLA 4DV1I 1Z5AA 3JAMQ 5A2QQ 2V8PA 4DUYE 4OX9I 1H74A 4B3TE 4WUBA 2HKEA 5IWAE 4M1KA 3ZZ0A 4NXNE 1QZRA 4JI0I 4I3HA 2HFUA 4RPFA 4HXZA 4X62I 4YY3E 1XMOE 2GS8A 2XEXA 4WUDA 4JI5E 1N0VC 1ZXMA 1XHKA 5IT9C 4JI6E 2UXDE 4JI8E 3Q1QA 1H72C 4KHPI 2VQEI 4NXME 4DV4I 1XNRE 5BR8I 2NPFA 1A6FA 1Z0BA 1Z0VA 2UXBE 4DPUA 1NHIA 4Z7YA 1XMQI 2UXCI 4DU8A 2HK3A 1RREA 4LF9E 4LF4I 4DV2E 1I94E 4JV5I 5FLXQ 4JI7E 2ZM6E 3JAMC 1N36I 4LFAE 3HULA 4DR4E 5A2QC 4FWHA 1N34E 1BKNA 4JI3E 2R42A 4LF5I 2DEJA 4DR6I 3T1HI 3QT7A 1ZM4A 1B62A 1ZM9A 2UU9I 1HNZI 4DR7I 2A2CA 3V2UC 1Z0GA 4X65I 1HNWE 4DPYA 1XNQE 3WU6A 4UT4A 4WUCA 4X64I 2UUBI 1FWKA 4DUZI 1N0UA 1FI4A 1FWLA 1KTVA 2X7IA 4JI2E 4JYAE 4DV3E 1OJ4A 3T1YE 4ZVIA 2ZITA 4DUYI 1PIEA 4B3TI 4DXLA 1KIJA 4NXNI 1N32E 1IBME 2V2ZA 4DR2I 5GMDA 3CWVA 1ZXNA 1XMOI 2J7KA 1Z59A 4DR1E 4X66E 4JI5I 4YHHI 2AJ4A 4LF6E 4HYMA 1N33E 2UUCE 5LMUE 2UXDI 2OI2A 4HACA 1NHJA 1ELOA 1K47A 4JI8I 2DEIA 1NHHA 3ZKDA 5LMNE 4NXMI 1XNRI 2UXBI 4B3RI 4AQYE 2E5LE 1B63A 3J7AM 3PYDA 4DV6I 4LFBE 3D4JA 3QT8A 4LF9I 4DV2I 2Q2EB 4DR4I 4GKKE 3H4LA 1N34I 5L3JA 1IBKE 1J5EE 4B3SE 5GMEA 3PYGA 3QT5A 2X36A 4R1FA 1Z0WA 4DV1E 1HNWI 4PU9A 1XNQI 3M6AA 3B78A 3V5RA 2F4VI 4OX9E 4FN5A 3ZM7A 1Z5CA 3WU4A 4JI2I 4DV3I 4JI0E 3F0NA 1Z0CA 4P7AA 3ZKBA 4LFCE 4MYUA 3LNUA 1H73A 4K0KE 1N32I 1IBMI 1NZ0A 2EFGA 2CZ9A 2HFSA 4DPXA 4KHPE 3QT6A 4LF7I 4DR1I 4X66I 4LF6I 1IBLI 1N33I 2UUCI 1Z5BA 4FWGA 4JI4E 5LMUI 4Z7CA 4DV0E 4LF4E 1HNXE 3B82A 1D6TA 4DV7E 4JI1E 1HR0E 1FJGE 3J81Q 5IWAI 1Z0TA 4UTGA 2E5LI 4FWDA 5FLXC 4YY3I 4LFBI 2VQFE 3WU3A 2VF3A 4HACB 3T1HE 5IT9Q 4DR5E 1FNMA 2HHHE 1HNZE 4PRXA 1EA6A 3B8HA 4JI6I 1RR9A 2HK2A 2UUAE 1IBKI 1J5EI 4B3SI 4PRVA 2HKJA 1U2RA 5LL6R 2UUBE 4DU7A 3LPSA 1Z0EA 1WUUA 4LF8E 3OTOE 2ZBKB 3ZZUA 3LTOA 4GKJE 1I94I 2ZM6I 4JI7I 4LFAI 2R3VA 4DR3E 1ZM2A 4DV5E 4B3ME 3PYFA 1S4EA 4JI3I 1H7SA 4DR2E 2E1RA 3J81C 4LFCI 4K0KI 1UEKA 4JG4A 4YHHE 3K1JA 2A2DA 2BV3A 3J80Q 1ZM3A 2V2VA 4XTJA 2WW4A 3PYEA 4EMDA 4USKA 1FKAE 4JYAI 4B3RE 3ZZTA 3T1YI 4JI4I 4X62E 4DV6E 4DV0I 3GONA 1HNXI 4DV7I 4JI1I 1HR0I 1FJGI 3J7AG 4DPTA 4MYTA 2VQFI 2V2QA 1MU5A 2VQEE 4HY1A 2LJPA 4DV4E 4DR5I 5BR8E 2HHHI 4KQVA
chains in the Genus database with same CATH superfamily
4K5SA 2N82B 5LXYA 2W2MP 1KNZA 2BOAA 2ZNYA 2Y1IA 3QATA 5LMNI 4JV5E 5IOLA 1YJWS 3SQGB 1RXOB 2PO4A 4JV2A 2DK2A 1U1KA 1JQGA 4N3OA 4DR6F 1X7VA 1NLKL 2UU9E 4RNMA 4N77A 1TZ0A 4MK8A 5D77A 2KZMA 4USMA 1Y3KA 3TZWA 5D6GA 2P9EA 1G7CB 3W5YA 4Y2IA 2NLWA 5T14A 2J9DE 5A2QQ 2UUCF 2GC8A 1Q86T 2OPRB 4JP8A 2BA9A 2IESA 3G6XA 2LA6A 2ZH9A 4YFUA 4JI1J 5KFBA 4JI0I 4I3HA 2FPHX 4X62I 2W9CB 4RNHA 1IVZA 1IM4A 4Q0BA 1HHSA 3GJSB 5I3QA 4DR6J 4IH6A 1DLOB 2WBRA 5DRKA 2QGFB 2N3LA 2GVDA 5K36D 2NYIA 3TZZA 1O6XA 4G1PA 3SDEA 1XMQI 3DLHA 1VRUB 5KFSA 1RREA 2ZJQQ 5KFYA 4OV1A 5FLXQ 3BH7B 1LK7A 5FLXU 1R6YA 2BKOA 2EFVA 1LW0B 3OL8A 5GAEU 1TKDA 3ILLA 1N54B 4LSNB 1SQFA 4MIBA 2FC9A 1P9YA 2O66A 1HNWE 3TAMA 4PAAA 1C2PA 3PX4A 4DFKA 3MOZA 1FK9B 3F44A 4QWDA 1IR0A 3GCMA 1T9WA 1WC4A 4ECUA 2MGZA 1KHWA 1XTZA 3CCZA 2HMIB 4H4OB 1RE1B 4ZN1A 2KXHA 2VG6A 1IBME 2V8GA 2YY3A 1Q53A 2RDIA 2Z5CB 4JI5I 1QSYA 3HHEA 5J2MB 2DGSA 7FD1A 4A8MP 2QMWA 2MQPA 1NK9A 1TK8A 1UJ5A 1RWOB 2YXLA 4B3RI 3L95X 3R27A 5K8MA 2H5IB 5LJ5Y 3HLUA 1KLNA 2PO2A 1UTAA 4DV6I 2Y1LB 2BRKA 4DV3J 2W9BB 3I0SB 3TJ8A 2QA4G 1YGYA 1HWLA 1P27B 2NYHA 4NYZA 2EKNA 4M5NA 2MTLA 4B3SE 4EFAC 4ENOA 5K8NA 1TQLA 2R2UA 2QL7B 3C16B 2CPFA 5JEAB 2HHVA 1VDHA 1YJTA 2WONB 3LPEA 1XNQI 2B4VA 3HVTA 4FP9A 1NJIT 4OX9F 3D54A 2XNQA 3ZM7A 7FDRA 3F0NA 5IWAJ 3PR5B 3BB5A 2LDYA 2CKWA 2HHQA 1T9YA 1FDAA 4YY3J 2HBRB 2WSFC 3DU5A 2RSQA 1Q8IA 4X84A 1RA6A 1ZYQA 2VBZA 2RU3A 4CO2A 1C4CA 4LF7I 5HI7A 4RW6B 1IBLI 4Q7AA 2XO6A 4J37A 2WVFA 2PEHA 4B9LA 2CNNB 2PDAA 4HYKA 3CT9A 4ZVGA 3PS2A 2MHEA 4WFYA 3CC4S 1HBNB 4U7CA 4IRKA 2VF3A 2OFGX 2JVOA 3T1HE 2HBZB 3BBBA 5C0XC 4C48A 3F41A 4PPDA 4PRXA 3I4HX 4B9UA 4ALZA 4C8YA 4OO1E 3MDFA 1W26A 1Y10A 1H0HB 1OPIA 1IKVB 1WTFA 2M0GB 4P2MA 2FZKB 4GKJE 2CQPA 2DITA 2JJ4D 4DV5F 4CT9A 3AAWB 4JUZA 1NK6A 1FHTA 1DAXA 1JNZB 1B0VA 3D67A 4K0KI 1U4BA 4O44A 3OR1A 4IO9Q 3C46A 2PI5A 3IM8A 2WVDA 5F0UA 3KNGA 2BR2B 4Y2MA 1N52B 2VFRA 1M5HA 3DNCA 1KEKA 2YNFB 2AGQA 3UI3A 5AJ3F 5CA5A 2ZC4A 3UWTA 1IKXA 4LCHA 2JNJA 5K8PA 4DV7I 3OFEA 1FJGI 2RS8A 4M5MA 2ATLA 1TAUA 4DV5J 4ECQA 3DOLB 1X4BA 3AJDA 2R7XA 3EPIA 4YDXA 2FTRA 5DG9A 1S1UA 2M8DB 3GPAA 1UWBA 3RR7A 1F2GA 1KD1T 2EK6A 3MECB 5L8RC 2CNOB 4DQQA 5A8WA 2CAJA 2CNLB 4OI0A 2IAJA 4GKKI 2DCLA 2NN6A 2PI4A 3KOAA 1SVDA 1AA1B 2DRBA 3NCQA 3RRHA 2DNMA 4DR1F 2D3ZA 3MM5B 5H1SV 4HDGA 1N33F 5HBMA 5IS2A 3ZZPA 4WTOB 2CPHA 3BZQA 2HFNA 3JXOA 3KWMA 3PW5A 4CO1A 1DTTA 3I96A 2V50A 2ASDA 1V3RA 4QU7A 5IT9C 4AT1B 4JI6F 1QSLA 1RT5B 2OPSB 3CO0P 4DWIA 1A6FA 1Z0BA 2CPIA 4N7TA 2CJYB 1NMEB 2BJ8A 3MMAA 1M1HA 2LQ9A 1OQ3A 2YKQA 3BYPA 3WC0A 2HGLA 2PFDA 2GMJA 2BJ7A 3MTKA 4JI7F 4P10A 3PO4A 4MIAA 2NUHA 1KQSR 3L7ZA 3W9HA 3LALA 4IG0A 3OLAA 3EVWA 2YQ3A 4UQGA 3QIPA 3HZEA 1T9XA 5D3GB 2W7PA 1YJ7A 2UV8G 1EKSA 4UUWA 1V9OA 1OIAA 2OUGA 3FZBA 2Y0SD 2R2SA 1PC4A 1KTVA 1LWCB 4Q5VA 2FC8A 2RNEA 3DM2A 2VICA 4MU3A 1CJVB 3HZGA 4I1TA 4X62J 1TVRB 4B3TI 5I3UA 1Z2ZA 2HRUA 4CRJA 4DV2J 2KFZA 1YQHA 1N32E 2YX1A 1SUQB 1FF2A 4O3QA 2WSEC 1Z59A 3SIPB 5L1LA 4QYZJ 4FS1A 4C98A 4HYMA 1WNEA 3KK1A 1BQMA 3JQJA 1KBRA 1N5YA 5CCMA 1K1QA 3WC2A 4M94A 4ELTA 2V4JA 2DH8A 1HW8A 3DC2A 3UN2A 3KLHB 3BPDA 2Q6CA 2UP1A 1R31A 2KHCA 1AT1B 4C0BA 4IOCQ 3SCKE 2HBYB 4X4TA 1IJFB 3GSIA 3ILIA 5KFXA 2YKPA 4ZVTB 1JLBB 2OPRA 4ZCIA 1U6FA 1T95A 1PBUA 2ZOMA 4B3OB 1HHQA 3MR2A 4R1FA 5E2QA 4NLDA 4B08A 2WHOA 1F60B 1KQKA 4E98A 1VQSA 1U1QA 2WRMA 4KGVB 1OY6A 3GWCA 1VR6A 4Q2MA 4OHYA 2NQPA 1UW4A 3KUHA 2FY1A 3KLIB 3KXDA 1W25A 4JI5J 4C0HA 1RT3B 2C37B 3D28A 1SJ4P 2CZ9A 3QT6A 2R7SA 3N5FA 3PKYA 1U24A 2UUCI 3AB4B 2CJ9A 4RL1A 3TJAA 5KOXA 3HKZD 3Q22A 2IBKA 3G86A 1SC3B 4DV0F 2PMHA 4IFDD 1YG0A 3I82A 4X4VA 2BJDA 3RBDA 3P96A 2XULA 3U1KA 3M9OB 4K2JA 2O1VA 3FSXA 5FLXY 1TL7B 5IT9Q 2ASYA 4DR5E 5IT9U 4NLPA 2HHHE 5DLFA 2WOMA 2UUAE 3P45B 3W2WB 4PRVA 1UVIA 1DTQA 2OLWA 3M8YA 1Y6ZA 4YB1P 2U2FA 4R8UA 3FGVA 4F0KA 3QZ8A 1FX4A 3OVBA 1IKYA 1IWAA 3N79A 4DV0J 1TFYA 4H4MA 4Y28C 4DR2F 3W9IA 5E3CA 7AT1B 4LFCI 2PNMA 4JG4A 3SSQA 1WOPA 3C15B 2YWHA 5AXKA 3CDBA 1N6QB 3SYZA 2CZVC 4BHQA 3G8TA 4Y0FA 2HFZA 4PG8A 1FKAE 1EARA 1KOOA 1WC1A 2ZKUA 3MM8B 1VLOA 3CJ3A 1HR0I 2OPQB 2PD1A 2GAGC 4ZITA 5HLFA 3OHBA 3OW2R 4DUTA 2BOPA 2D9PA 1EZZB 4NLRA 1YJVA 4RW8A 2QZ8A 1FTRA 4DV4E 5BR8E 2F63A 2B51A 3Q8RB 2ATCB 5JVHQ 4BBYA 2ZE2A 3EWGA 2Z2ZA 3LW5C 4C3LA 2N7CA 5E3QA 2F1FA 4XDDA 4JV5F 1N36E 5A6WA 4DPWA 5HANA 1TL1A 5KFEA 2CQ1A 2J0XA 2UU9F 4B3MI 2I8EA 1FVQA 1B0PA 3DRYA 3BPSP 1HMVB 2NS1B 5BJRA 3IM9A 3BO3A 3ET6A 5B0AA 2ZWOA 2ZBPA 2BKNA 2DNZA 4RW9B 1UVKA 3VAGA 3D6TB 5DQIA 4CDIA 3JAMQ 3MCSA 1CJTB 3O1LA 1NJWA 2FHJA 2ROPA 4OX9I 1CPZA 1FRXA 4IFYB 3CJSA 4F3MA 5KG1A 4PXBA 2ZHOA 3H2UB 3HSZA 4RPFA 1TK0A 3BR9A 2ZFHA 2MDAA 4LRAA 3SFUA 1IR1A 3MM6A 3G9CA 3PM9A 1Q16B 2UU9J 3PW7A 1HNZJ 4DQIA 5JEAE 3HVAA 4D3HA 5CYMA 3Q1QA 5HJYA 2NPFA 1TELA 1J5OB 3E3XA 3SSSA 2QMXA 1QTMA 4PKDB 3IRXA 1WKJA 3Q8SB 5C42A 4DR4E 5HAOA 1BKNA 1FRHA 4KPYA 4HTJA 3DHXA 5JUMA 2CA9A 5KFKA 5DGAA 4NMXA 1K1SA 1KS2A 1H2VZ 1FE4A 3V6HA 3VAKA 2HS4A 1WORA 4ZLLA 4URGA 2UVVA 1TL3B 4NL5A 2C2NA 4FBTA 1FWLA 2NXJA 1SI9A 5ETNA 1N88A 1EJ7L 2CPXA 2SXLA 4YOEA 2VFVA 4JI4F 3A8KA 4R25A 4M5JA 4N8NA 2W1BA 2IRXA 4RBTA 1JJ2R 2E9TA 2AYBA 1QD1A 3PVXA 4DOZA 4ZVOB 4F7VA 3FVYA 3PW4A 1QLNA 4X66E 3KJVA 2AJ4A 4LF6E 4ZPCA 4CP5A 4CLTA 5SZTA 2C3PA 3LH2S 3QJPA 2PNLA 1QY7A 1HNWJ 2OO4A 1HA1A 4KKOA 2A10A 4PQUA 2F4VJ 1ZTTA 3TAPA 3B4DA 2UVUA 2PO1B 3TUIC 5RUBA 4ECVA 1B63A 3PFOA 2R8HA 4C8LA 2RE1A 2B5JB 4ZVSB 1RISA 4QIVA 3MM5A 4DL2A 4FXDA 4NYOA 1RYRA 2ASLA 3G71S 4LR8A 1IBMJ 3VR1A 1RT6B 3OQ2A 4ATNA 1X4GA 3I0RA 4DV1E 5C5JA 3M6AA 1KVIA 3NY0A 4UOFA 1NB7A 2MEWA 2WBMA 1DQ9A 2HPUA 2PE8A 1HYSA 4LCFA 1RT4A 2FYXA 2ZH1A 1H73A 4J9LA 5IFMA 3U1YA 1W2BR 1MU2B 5B0DA 1NZ0A 1URNA 4E2FB 3OL7A 1RWVB 4ZP9A 4B3SJ 4DR1I 4EK2A 4B9TA 3FBBA 4ZJOA 1N33I 3CCTA 1FX2A 3D6HB 4LF2A 4LF4E 5JJBA 1PCAA 5CABA 4CTAB 4C8KA 1RT2B 2HZCA 3TZXA 5DROA 2I9SA 3VGSA 2V4RA 2DO4A 1Z0TA 4LFAJ 2DPJA 4IR1A 2R2RA 4JI3J 2QFIA 4LF5F 3TEHB 5H9EK 4FYVB 3T1HF 4USWA 4A48A 1HHTP 1EA6A 3W66A 1RWPB 4JI6I 3PZPA 1SB6A 1KLMB 1J5EI 1HD1A 2GO8A 2Z30B 1NJYA 2W2PP 2XCAA 3M8PA 2JFKA 5J1NA 4FNIA 5LL6d 3K58A 2N4CA 3OTOE 4QW9A 1VS3A 3D0HE 3UR3C 4ZS6A 4GKJF 4JI7I 2N3OA 5F8LA 3G87A 4QWBA 1FO1A 2IVMA 1RTDA 4L3KA 2CQDA 2XMMA 3L4BC 1S49A 2WVBA 3MUTP 4DSKA 4FW4A 2ZDOA 3K1JA 1PC5A 3ZXWA 1JLGB 3RAXA 3NAIA 2HQFA 1C1BA 4FPRA 1B4SA 2VPYB 8ATCB 2B0GA 4CO4A 3N6NA 3PYEA 3CCMS 3OHAA 4M95A 2DYAA 3TOQA 3OJUA 1X5PA 3IGNA 5DNLA 1RAGB 1RTJB 1RKIA 2GNKA 3NNCA 2ZH6A 5KFAA 4GKJJ 4ZVUB 1VIOA 4Z37A 3EGNA 3OJSA 4HI1A 2GHPA 1N34F 4DL3A 4DMZA 3J7AN 4F8RA 5GAGI 2VQEE 3KLEA 3MCNA 5HK4A 1PAEX 3TJ9A 3SV3A 1RAEB 2AYGA 2E29A 1NSQA 3R3TA 4OYIA 1HARA 3M05A 4YQWA 2BM1A 3D2WA 1JNRB 1T9UA 3KLIA 1Y11A 1DQAA 3GCXP 4I2PA 2VFTA 2I2YA 2BZ2A 2MLZA 1NAQA 1MG7A 2V34A 3NRBA 4GO5X 2KG1A 2JEBB 3KRNA 2HHPA 4X65E 3RUBL 2Z0GA 4WFXA 1FJ7A 5J2PA 2BANA 4F4ZA 3K2YA 4WZQA 4URLA 3BDEA 5HP1A 3P6YC 2YNGB 1XR6A 2IJRA 3DLLQ 2V8PA 4BA1B 1IQZA 4WUBA 3ETOA 4NXNE 2UUWA 3UN3A 5M2RA 3TP2A 2GS8A 2CIMA 3R7SB 5F8HA 4JOUA 2HNDA 2P8IA 4KV8A 1XHKA 2CJAA 4PR6A 3EPGA 5IT9Y 2GAHC 2RHQB 3S1TA 2XSJB 4ZN3A 1JKHA 3T5HA 3UD4P 3KHRA 2XYHB 3QFHA 4IG3B 3G96A 3IAM9 2X3GA 3MPWA 1JLFB 3ILOA 2ZUGA 2CG8A 3OBIA 4QWAA 4FKYA 4FWHA 3C15A 2R42A 4AD6A 4RW7B 3GB0A 4X4OA 4WXWA 3OFFA 3VZIA 4FF2A 5KFUA 4NI2B 1OMSA 5FDLA 4YHHJ 4DPYA 4F25A 3OXLA 3WU6A 1VMBA 3HJCA 1REVA 4XAKA 2B9WA 4JI2E 2IOQA 3EXYA 4OHWA 3QRPA 2B7BB 1LEOA 3Q2SC 2OSRA 2GQ2A 5LSRA 5FIIA 3DD6A 1BD6A 1KIJA 1M1GA 2DNOA 4DR2I 2LKZA 3PIOQ 1XMOI 3AOCA 4CLKA 3IAS9 3UR0A 1RAJA 3KLVA 2MSSA 1HK7A 1S1XA 2D69A 5LMUE 4F36A 2DCUB 3JTPA 3MAAB 1K47A 2OMLA 3SFGA 3Q8QB 2VBWA 3DXSX 4K4XA 1VQ9S 4CH0S 4OO1D 1WHYA 3EVMA 1H3DA 3W1YC 2LXIA 4HT5A 2LFVA 1CJUB 5K20B 1K0VA 5L3JA 2CPEA 1IKWB 1RABB 1VQ6S 2VOOA 1N32J 3ICLA 4WK1A 5AE2A 1Q95G 4ZVHA 2ZKTA 4G65A 3NEKA 1CQNA 3U1NA 2VA3A 3GG1A 2L9DA 1HNVB 5GAGU 2EG1A 3EGZA 2AE8A 2E7XA 1E6YB 5F8NA 2FJBB 3VALA 3C6UA 3GR1A 2IIHA 2AWZA 5K5MA 3IP0A 3C6TB 3DOMA 3KK2A 2LU2A 2OH2A 2OKQA 2CPYA 2QV6A 2C42A 1CC8A 4KHPE 4DDFA 4IDKB 1WC0A 3MMCA 1HBUA 5KG2A 3UCGA 1SJFA 2FUG9 5DGBA 1D6TA 1TKZA 2AMCB 2L48A 2QLBB 1X4EA 4PUOB 3H7HB 2DNNA 4OJHA 3ZTPA 4LFBI 4FW6A 2Z5EA 3OV7A 4NLTA 1UL3A 4I7FA 1H2UX 4DR5F 3KHHA 2XMVA 2HHHF 3LAKA 3R6LB 1IBKI 2UUAF 2HWTA 1YH8A 4R0EA 4G1QA 2E5GA 1IQTA 4DU7A 3FSYA 4NZ0A 3UVJA 1ZA1B 2LQ8A 2E1CA 5KT6A 2RT3A 3TARA 3PFEA 1LWFB 1S57A 3TVKA 4YN3B 3T1YJ 3A12A 3DI6B 5FD1A 3KLFB 3CJKB 1CEZA 1S4EA 3EMTA 2IM0A 4PWDB 5KTQA 3K85A 3IR5B 2PO1A 2YTCA 2W7OA 2HHHJ 2UXDF 1UPMB 3D0IE 2UUAJ 4OYXA 2WNRB 5LT5A 1N5QA 1FKAF 2V0NA 3ZFVA 5C25B 1GTEA 2G2ZA 1U8SA 4FF1A 4JI4I 2D41A 4YR3A 2JC0A 2G1HA 2QA1A 3OTDA 3GONA 1J2VA 4GO7X 1S6PB 2HGMA 1VC0A 4A46A 4ZPVR 3CF5Q 2XWXA 1T03B 4WK3A 3ZZYA 2VQFI 1J5EJ 3FFIA 4DV4F 3QIDA 4KQVA 3OFHA 3CSKA 4A8WA 3PY8A 4N76A 2ZZMA 3KJQB 4WFBQ 4NRUA 4YP3A 4OZLA 5J1PA 1NKCA 2Q43A 2YKMB 3TZYA 1VC5A 5L1KA 3RAQA 3RYLA 2A3JA 4OHXA 4DR7E 2V69A 4DR3I 5HVHA 2DISA 4BC7A 2C2RA 3I6PA 2VG5A 4LSLB 4C0OC 2D74B 2D3O1 4TY8B 3LGMA 4DV4J 5BR8J 2CDQA 3BGRB 1PJ6A 2X51A 2LXUA 1GFWB 5E7OB 3NOGA 4W92B 2GO3A 3HJVA 1H2TZ 3AJ1A 1N36J 4LJMA 1QM9A 1NXIA 2B56A 4O4GA 3M30A 3ISZA 1VFJA 2GHWA 2AGOA 2FLNA 4ED3A 3NLCA 3IBFB 2Y3YA 4PG5A 3EGVA 5KFIA 2V4QA 6AT1B 4CO0A 1V3SA 2UUBJ 2VASA 4TYBA 2VJVA 1FE0A 2QE5A 1NSPA 4NE9C 2DRDA 2F40A 2RKIB 2YNIB 3E8OA 3E01A 3BQ2A 1B0TA 5CD4A 2IVFB 4U95A 2KN4A 4LF5I 1VK8A 1JLCA 3T1HI 2KB2A 1HD0A 3GV7B 5F8GA 2R8GA 5AE3A 3V2UC 1X60A 5C7PA 4X64I 3MEKA 3L09A 1OYEA 2F8EX 5HQ8A 3CCRS 2FJWA 5IT4A 2PMZD 1M5PC 3TR5A 2Y8YA 2I38A 1KONA 3W63A 1FRMA 3P06A 4DR4J 4Q45A 3NZKA 1QE1B 1ACMB 4WF9Q 2E9ZA 2PN6A 3E2EA 1X9SA 5C24B 3Q83A 2OD4A 4X66F 4J9KA 4IOAQ 4HACA 3HD1A 1X0FA 2HRYA 3C8YA 1XNRI 5LJ3Y 2UVRA 5A0YA 3MD1A 4LF9I 2KT5A 3SCIE 3M6VA 1U02A 1N34I 1RWWB 3DYAA 1GMUA 3OR2A 5GMEA 3RB3A 1ZAWA 2KO1A 3R7NB 3BGOP 2VPWB 1RAAB 2W8KA 4L76A 4X66J 1WSVA 3MTJA 4IRDA 4DV1F 4LF6J 2XMUA 1GEHA 1P8GA 3TA1A 4C11A 4KAIA 4DX7A 3LP2A 1S0OA 1C0TB 5AXLA 2BE2A 2JE6A 2RRBA 3UDVA 1N5TA 4M5GA 4MQYA 2YWGA 3BBCA 4ZPBA 3CCWA 2I5JB 1Y0HA 2XSJA 1YBAA 2ZBRA 1D0EA 1R6MA 2RILA 1UA1A 3OUYB 2EC2A 2CDRB 2EKYA 4USIA 3D66A 2MQQA 3IWXA 2C39B 2UXCF 2W9AA 4YS2A 4LF4F 4JI1E 4MK7A 5DM6Q 4NI2A 1RCOB 3O5TB 3MCOA 3R7BB 3ENAA 2ZM6J 4NCGB 2ALZA 3HVRA 5HATA 2NXUA 1S7HA 4HVZA 1SC6A 2EBGA 1RU2A 1NHKL 5GMKa 2KT3A 5KFRA 2F9DA 3NNAA 3FBCA 4AFFA 2K8GA 3EDQB 1RTHA 1TU0B 4U7UD 2POKA 1B64A 3CC2S 2CJKA 3GLLA 1LV5A 5C0XB 3LAMA 3I87A 4X4SA 4OZJA 4P7VA 2FY8A 3EGWB 5KFNA 4NLUA 1ROFA 4KH1B 2EI5A 3CMQA 1A0OB 4Y2KA 1LW2B 3C19A 4IZJA 3M8QB 3KUEA 2XGPA 4OV6A 2GGPB 4HI2A 3Q8YA 3NWGA 2MQOA 3P8BB 2LYVA 2FVSA 2OHDA 1DJ0A 3MAAA 5SUHA 4P2XA 1GX6A 1S6OA 2N4DA 3HSJA 2AJ2A 2BR0A 2HHWA 3ISNC 1S9GB 4XTJA 4PRFA 4EBCA 3GJRB 1R0AA 4J9OA 2F3JA 2DNLA 5CYJA 4NXMF 2FJXA 1IKWA 4WE1B 3HD2A 5JEAD 1NNDA 1HNXI 3OTOJ 3H8YA 1OWXA 3WIVA 2FZCB 4P73A 3CVKA 2A6OA 3CJQA 4I6AA 5KFOA 1TKXA 2HVEA 1R43A 1RGVA 3GMEA 2VQEF 4I67A 3TWZA 1GMWA 3BJYA 2CGEA 3IG1A 1D3WA 1D8YA 3NOCA 3O3LA 1FEEA 4AIDA 1X8DA 3TUZC 3OFGA 1ZOTA 4HL9A 1UKUA 4NA2A 1TL5A 3J80C 3VGTA 2RQCA 2JZ5A 3M2VA 1C0UA 5T7LB 1JLEB 3V6KA 1I1GA 2ACYA 3D68A 4AL7A 4PYDA 4X65F 1S79A 1VRTA 1O51A 4DUZE 4DSJA 1ULRA 1UPPA 2VQEJ 3JS9A 1YDLA 4CYUA 3QPIA 4NLYA 4RUHA 2P6SA 1WD6A 3D3CJ 3CCES 1S48A 2ERRA 4DZ6A 2V8DA 5AE1A 5IWAE 5HVFA 4CT8A 2WP8B 3ZZ0A 4NXNF 3JB9k 4RWXA 2MZQA 4YY3E 4TU8A 5FJ4A 2GA7A 3CTRA 2YWEA 3MFHA 1XEZA 4HTIA 1XJWB 2OFHX 1ITPA 1VRQC 3VF0B 1TL4A 2IA0A 2DIVA 4O23A 1WG4A 1U2FA 3VVTA 2A18A 3W9JA 3EZOA 2XS2A 2PNZB 3DDKA 3RZAA 1URRA 3BF4A 1HLWA 3I31A 1FERA 3GCWP 4DF8A 3SQOP 3KG4A 4LR9A 1C1CA 4TU7A 3PDNA 4NXNJ 4ECTA 3CDUA 3M6XA 3ZNUA 1ZM4A 1JX4A 4HHUA 5C25A 2Z58B 4Y00A 3HO1A 1DBDA 3D9BA 4FKXA 1N0UA 3VGUA 3KMQA 4DL4A 3EICA 3HKWA 3K5OA 4JI2F 5J2NB 3Q8UA 3BREA 4DXLA 1RAFB 3ZTOA 2VBYA 3M1VB 3QNWB 1SPBP 3DRSA 3G8SA 2UXDI 2OI2A 5LMUF 3TQEA 4C2MA 2YPYA 1RADB 3CCJS 4Q0BB 2YKNA 3SBMA 3MI7X 2UXBI 4YR2A 2E5LE 3MMBA 1CVJA 2BXJA 4JI2J 3H5XA 1X0PA 1OY8A 3W3SA 5M2UA 2GVDB 4U67Q 3AH6A 5DZ6A 2RS2A 3BKFA 3EX7B 3FBEA 3THPA 1NRKA 3G82A 1HBOA 2CQIA 3PYGA 2JWNA 4AE5A 3LA0A 4TXSA 2J8SA 5B09A 2OJ3A 3J80U 1E6VB 5LMUJ 1M5SA 2DNQA 8RUCA 1BMQB 3R5BA 2OPPA 1WI8A 4A8XA 2XG8A 3M7ND 3TAMB 4WFZA 3A8JA 3LNUA 1RWNB 1X5OA 3MR5A 1MN7A 1K8AT 2MGZB 5K14A 3Q6MA 4IFDE 2FB0A 4KHPF 2KYXA 4OYPA 5L9NA 3NCRA 1RHYA 2ZZNA 1TUVA 3D6FB 1CSJA 1Q79A 1Q81T 4QYZK 4J9UE 2B8PA 1YIJS 1I94J 1ZBTA 5IZHA 2C38A 1FRKA 1XMBA 1FFSB 2DGXA 4LUBA 3W64A 1FRJA 4H54A 4USUA 5IQQA 2RQ4A 2HKJA 2PO2B 2B6AA 2DNKA 1SKUB 3K89A 2F1DA 2QYGA 4CQ1A 1IR2A 4IOBA 4F0HA 3AOBA 4HH1A 4AUKA 1S10A 1QE1A 2YNHA 2HG4A 2XNRA 1KWMA 3CCLS 3OSNA 2EWHA 4ZP7A 1P42A 2ZC3A 3HP6A 3J81C 3HVTB 1YJNS 3GG0A 4M5KA 2A2DA 2VDHA 4K4YA 2BACA 2NREA 3ADAC 3FJ2A 4JI8F 1HWJA 3K5NA 3OL9A 1EP4A 4OZ5A 4ID5A 4KGZB 2XZDB 4X62E 1VQ7S 1SKSA 4MKAA 3QLHA 4K8RA 1SCJB 3W2VB 4O4RA 1N8RT 5KG6A 3P3GA 1OSCA 4W98A 2R2TA 1NKEA 1XMQE 4DI6A 4K4TA 2CJXB 1WJ9A 2CG4A 4WWSA 3SCJE 3V4IA 1A9NB 1CC7A 1NZAA 2QMUB 2CXEA 1PYTA 2DR5A 3HHLA 1MLAA 3M7NG 3R1HA 3KJFB 1OS5A 4NWBA 4KJIA 1JLAA 2MY8A 2IMWP 3EXCX 4ITSA 4W90B 4K4ZA 2VESA 1KKHA 4A8FA 1WWHA 3M9MB 4ZPAA 3V81A 2BJ9A 4ES2A 3MMJA 3GV8B 4ZP8A 4DV1I 1BHNA 1EQ0A 3J7A1 3P3EA 3DRPA 5I42A 3BV8A 2C3YA 4PYAA 1T0TV 4O44B 1UVJA 3OR1B 3P3CA 3I5AA 2Z2LA 2XEXA 2YWWA 1ZZNA 2HBQB 4JI5E 5K36F 4PXDA 4FW5A 3OTEA 2XHCA 5ETPA 4DR7J 1T02A 5I3PA 3I9V9 1R0BG 1NHVA 1IKXB 4CNYA 1SH0A 2UZAA 3D6MB 1QJHA 3LQVA 3BGFA 2UXCI 2BA1D 4LF4I 2GIQA 3JSBA 5A2QC 3KG0A 1S1UB 3A13A 5L39A 1UWBB 3DRRA 1FESA 2KRRA 4IQMA 1XNQE 4KFBA 1GAOA 4IO1A 4OI1A 4MU1A 2IA6A 5A8WB 2BA0D 3DRXA 1XC9A 1YBUA 3QAEA 4ER8A 1JMTA 1E3PA 3FQKA 2IAJB 4OZ3A 2FQQB 3J7YI 3O2IA 5F9LA 3AFGA 2MZSA 2ADBA 2G4BA 4K4VA 4CI0B 1IM6A 4NRTA 3KYLA 3J81U 4V1Ak 2N7YA 1YSJA 2EK1A 5GMDA 3CMAS 5HBMB 4R5PA 1NK4A 4CCHA 2VU5A 4GC7A 5C0XE 2XB2D 3NMAA 4QIWD 5D4OA 1JLEA 1SC1B 4NXMI 2DRAA 1DTTB 4I64A 3IRWP 2ZDPA 3T5LA 3A1YG 4EEYA 5D4NA 2PMWA 2NZCA 2QN6B 3H4LA 2DNGA 3MMAB 1U0HA 1YX2A 2CADA 3BS9A 2QO3A 1WSRA 2BJEA 4F0MA 5ETTA 1FKPA 1LKZA 5KT3A 3ZTQA 5K36A 4OHZA 1S6QA 3T6JA 2CWKA 1N5VA 1RT7A 1VLYA 3W60A 3L7ZB 1U48A 1HNIA 1BGXT 4IG0B 3WU4A 3QIPB 5DETA 4P2SA 3BGUA 3R5CA 4LRFA 1G1XA 4C97A 4K0KE 2JEJA 4M5DA 3CD7A 3CDJA 4WYWA 3VCDA 2HVHA 1CQMA 2XMAA 1LXJA 3DM2B 2GMHA 4Y2CA 5H9FJ 3PG9A 4K7QA 4DPXA 2Z57B 4YR0A 1FKOB 5HQLA 5I3UB 4V19X 4BA2A 3HHKA 4LIWA 2HNZA 4ZVEA 4CLUA 1DHMA 2O67A 1QVGR 2BA1G 4OI2A 4DV7E 1UP1A 4KQZA 1FJGE 4JI1F 2XY7A 1S6UA 1KOHA 3TUJC 3KK1B 4C8OA 1BQMB 2AZ1A 4HLBA 3SEOA 1N5YB 4LSZB 2MKHA 1BC6A 1OYRA 3PRVA 4G3IA 1HNZE 1WF2A 4C8MA 2V4JB 2KH9A 3DN9A 5KT5A 5J2NA 4FYXB 2XHWA 2B4PA 4IZKA 3MAHA 4OFZA 5IV3A 2ZWPA 4ZIVA 3IN5A 2BA0G 3KLGA 2Y0BB 1HQEB 3M1VA 1A7GE 4JYAJ 1F3FA 1AUSL 5A2QU 2O3ZA 5F0WA 2J9EA 4A8SA 1PILA 1B99A 1YJUA 2HVZA 2ZVSA 2CJBA 4DLEA 1U0SA 2H9ZA 5EX3A 2BMBA 3C14B 3RRKA 2RH3A 4ED0A 3M8SA 5EWFA 3MR7A 1CBKA 1D8ZA 2VJUA 2HW3A 2BV3A 5HO4A 2DH9A 2GVZA 4OYMA 1S12A 3ZC4A 2KT2A 1EHWA 4EMDA 5L46A 1FD2A 1NPRA 2FDNA 3AQPA 3OD2A 4B9MA 4AQYJ 4G6VB 5T41A 1RI7A 1NH8A 2HRTA 4ZHRA 3R5JB 4CLLA 3UDEA 3J7YU 1E6VA 2EFOA 4WP8A 2AX0A 4YB6A 3RU0A 2R7TA 1DARA 2HEKA 1VISA 4CWBA 2W2QP 1EIYB 2F4VE 2J7WA 3CWJA 4ZLPA 4F4XA 2BM0A 4LT6A 3DLBA 3J80Y 2WOMB 3H5SA 2XS5A 4DV3F 3NMRA 3RB4A 5EHHA 2RF2A 1DTQB 1TMJA 1QVFR 2VA2A 1XERA 1R89A 1MSWD 4ZK7M 3ELHA 3N9UC 1S0NA 4R8UB 4DUZF 4FYWB 3MURP 1IKYB 2M7SA 2AD9A 2H65B 2FJEB 4H4MB 1CS4A 2FJVA 4PWWA 2C2EA 1NDKA 4B3TE 3M2RA 1VBZA 3NL0A 5DQGA 5IWAF 3GIJA 1SL0A 1ZA2B 4ELVA 2QC3A 2MJNA 4YY3F 2QT7A 3F56A 3FC9A 3PNIA 4KR0B 3ITHA 4C8NA 3Q86A 2UV8A 1U09A 1YJRA 3M8RA 4W4MA 2VONA 4C3KA 4KHPI 2OTJS 5F3TA 4DL5A 4KRWA 1NHIA 4PEOA 4DX8H 4DUZJ 2I1RA 5HLFB 2HK3A 4HT7A 4ECXA 3M32A 4PQAA 1NM2A 3DLKB 3PO5A 2ILYA 4RW8B 1GT8A 2RU9A 2FHMA 1L3VA 4LFAE 1GMVA 4ZCLA 1KN6A 2R7WA 4JI3E 2OEKA 1LFPA 5THWA 4EZ6A 1RBLA 1H98A 3HHLC 3NKYA 2DEJA 1RU1A 2VKRA 2AJQA 4FPIA 2HQGA 2ZE2B 5EGYA 4CLZA 2PO0A 1SL2A 2A2CA 2GFFA 4DSLA 3IWLA 1Z0GA 1RTIA 3K8WA 1OYDA 1TL1B 4ILLA 2MZ1A 3PW2A 3W2VA 4LVNP 2V68A 1JJ4A 4OYBA 1OJ4A 3IWNC 4DUYI 1Y5IB 4DQPA 4QZVB 2XMKA 3ET6B 4I6WA 5BYQA 5KFQA 1MROA 4OLOA 1B3TA 2V9KA 2BVZA 3GFXA 4U9RA 1VBKA 4RZRA 2MHNA 2ZHBA 1VQMS 2J76E 3IXQA 2UUCE 3U7JA 2RIJA 2AIRB 1Y5LB 3R8YA 1F9EB 1D9DA 2R8IA 4JI8I 1KHVA 1OO0B 3MM6B 2VOPA 4NLOA 1Y5NB 5CYMB 1IWGA 2DHHA 1MWYA 5LM7E 5DDQC 1Q8KA 4EBEA 1ZPVA 3MD3A 1USUA 1HPZA 4QW8A 2QEXS 2L41A 1F1BB 4MKYA 2C2OB 1UFWA 2M52A 3IRXB 4PG7A 1Y9OA 5HMZA 4Q8EA 2BEFA 5C42B 5IC6B 3VAHA 3JYTA 2HQ3A 2AKWB 4TLRA 3R97A 3V5RA 4ZP6A 5ITHA 3I9ZA 3PW0A 4OLPA 1Z5CA 4XTTA 5D4LA 2E5LJ 4LFCE 3ZZRA 1SH2A 3HSGA 1NPPA 4BS2A 4XPCA 2HFSA 4IFDF 3Q8PB 1S97A 4P9SA 2GW8A 1FXLA 2RVJA 4CH1A 4I6YA 1HR0E 4XDCA 1U1NA 2VBXA 2LEAA 3KJVB 4NZ7A 2E5IA 1N56A 1PYSB 3MXHP 1R8HA 2X3DA 3K57A 2MQ8A 1EX8A 5HSPA 4KKOB 3QRRA 4HKQA 4PQUB 3WZ0A 3UD5A 3QO9A 5KG3A 2IYGA 3LP1A 3DMJB 4CO5A 4ICLB 1AZSB 2EBEA 2ZOFA 4ECSA 1WUUA 2Z4PA 2AYEA 2OIHA 4JBCA 5K36C 1K0TA 5B7WA 1Y7PA 4KPCA 4WKYA 1VBXA 1KSPA 4J9RA 2W7AA 4B3ME 2JX2A 3PYFA 1FVSA 3I0RB 1NDPA 5B0BA 3NBPA 4DQSA 3JSYA 3J81Y 2Y8WA 3ILJA 4YHHE 2ZD1A 1HWUA 2G0JA 2OELA 2GJ2A 2KKHA 1KTQA 2V67A 1U1OA 1YZ7A 4EGLA 1HYSB 2NSBA 1DRZA 1RT4B 5A8RA 5LMNJ 2VDIA 1S59A 2R8KA 4X62F 1YK9A 3RW6A 4NMLA 4DV2F 3PHEA 3J7AG 3NAHA 4WFNQ 4NYPA 1XXEA 1U8WA 1J27A 1UEUA 4X4RA 2F7VA 2CPZA 1N4LA 1DQ8A 2KFNA 4RW4A 3VZHA 4CLPA 6FDRA 4QR0A 1UVNA 3ENQA 1HQUA 4I2QA 1XMQF 3WU5A 4DSEA 2ZZTA 1HL6A 2NCKL 2NN6E 2YKOA 3TO8A 1RSCA 5A6PA 2DR6A 2ZBIA 5KAKA 3M6WA 2BUNA 2LVWA 4LF8I 4JI0J 1JLQA 3MFIA 3H5UA 3MEGA 1FKOA 1QAIA 1KVKA 3M8PB 4QIFA 1KQFB 1EI1A 5K9FA 4WCEQ 2MQMA 1JJCB 2MKKA 1R8AA 1XMQJ 1RTDB 5KFFA 2R4FA 5KFDA 2HKEA 4M1KA 5KOWA 3NCPA 4HXZA 2JDJA 3BN4A 1B7FA 1C1BB 1SIZA 4JI5F 5AT1B 2O01C 4RUCA 3ZZOA 1WOOA 4PG6A 1HQEA 3K8VA 4FBUA 2J0WA 4NASA 1VQPS 3C14A 1U7LA 4GVBA 4O3OA 4YUDA 4F4YA 2RUGA 3JAMC 2PC6A 3NXZA 4QR2A 3KLEB 5I4MA 3CCVS 2AP6A 5A2QY 4P2FA 1RLCL 4TY9A 3MUMP 4DR6I 4BC9A 2JEGA 1TKTA 3QT7A 2RRNA 1VJWA 2A1BA 1CULA 3AOAA 1OQ6A 3VAIA 2PGCA 1G3OA 1XNQF 4PZVA 4I2PB 2CQGA 3CIZA 3NS5A 3SSRA 4F2RA 1FWKA 3LO3A 1X31C 3H1CA 4L3NA 4AL5A 3T1YE 1T7PA 4B3RJ 2VC1A 4O3NA 5J2PB 2BANB 1YI2S 4DV6J 5KT2A 3M2UA 3K5LA 1PAUB 1U1LA 2K1RA 3HKMA 2GJIA 1S1VA 3QMQA 5HP1B 2ZEJA 2Z8QA 1YBTA 1UA0A 4X4NA 4DR1E 3MUVP 3UDCA 2J0QD 2H51B 1N33E 3CDIA 1PKUA 4U7UK 3X3UA 2CZ4A 4O3PA 2ALYB 1XNQJ 1U2CA 2LEBA 1RDRA 1RP5A 3GJQB 1JB0C 3CCSS 3H42A 4DEZA 2HNDB 1AFJA 2VPZB 2M2BA 1F5CA 4KV8B 3PYDA 5K8OA 3IR7B 2HHXA 5JXSA 3FCHA 1YJ9S 5ETOA 4ANEA 1V5VA 3T1AA 1FD8A 1PSDA 1FNOA 1JKHB 1J5EE 5L1IA 1BUXA 4DFJA 3AXKA 3MGJA 1LWEA 1NK5A 5J1EA 3QT5A 2D9OA 3LANA 4DFMA 4LF7J 2Q6BA 3POTA 1M5KC 4PU9A 5E0OA 4WBFA 4URQU 1IBLJ 3I5BA 5CAAA 4KC5A 3PRYA 2Q1LA 1U1RA 2OAUA 4DV3I 5FDLB 1S1TA 2R7OA 1K44A 3I56S 1MMNA 1REVB 4K0KF 1NU4A 1RLDA 3PRDA 3DLKA 2HURA 2EFGA 2WSCC 2KG0A 2J6SA 2UUTA 2CQ2A 2ZVIA 1CJKA 4ZLJA 3IBCB 2KXNB 2BABA 4N8OA 2ZH4A 4TQSA 2KM8C 4USVA 4FWGA 4IFVA 1F5AA 5B0CA 4NLXA 4Q44A 1IJEB 2MKYA 1NSAA 1XBWA 5IWAI 2W4PA 2BE7D 1X4AA 4ZPWR 1S1XB 4YY3I 2OEMA 4DL7A 2HNYB 4D3GA 3CULA 3T41A 2G13A 3H2VE 4ZDNA 2IC3A 5DJBA 1HNZF 4WIQA 4K0KJ 1NKBA 4WU3A 2H1YA 1WC5A 1VOMA 2UUBE 2GV1A 1R3NA 1DURA 1AYEA 1GX5A 3JAMU 3ZZUA 2G1DA 5KFPA 3HK2A 2W2NP 3GIKA 2DGUA 1ZM2A 4MT1A 2KJVA 4DV7J 1FJGJ 3DLJA 1H7SA 2ROEA 3H40A 2GIRA 3PTWA 4ETXA 3LP0A 2W25A 1KC8T 2J6TA 1KQGB 1PGZA 2AT1B 2DPIA 3C6UB 2XSFA 2Y1RI 2P9GA 2M9KA 1Q5VA 2ZNZA 2H5EA 3FCWA 3DOMB 2B7CB 2LQJA 3KK2B 2LQBA 2AGPA 1TV6A 3D1QA 4ED7A 3SZ2A 2GQQA 1VQYA 3T9NA 4Y2AA 3DGPA 4GKKJ 4MYTA 1F6TA 3MMCB 2V2QA 1HBUB 2KDOA 1TKZB 4CLWA 1S7IA 4QBUA 3CDEA 1HNWF 4MFBA 3Q23A 2Z56B 4ED4A 2FGCA 3DLEA 2F4VF 2CNKB 1UCNA 3ZO7A 4I7FB 3NGRA 2VPXB 3D7SB 3I32A 3Q0AA 4OIXA 4I56A 2WCXA 3K17A 3GR0A 4WYLA 3J7ZT 2ZH5A 4G1QB 4P52A 3TEGA 2MB0B 4J9QA 4DV5I 3GLJA 1RT1A 1UJ4A 3UVJB 4HDHA 2HZVA 2KVQE 4YDDB 2K3KA 1IBMF 1XN9A 3Q6NA 3AODA 4JB8B 2JSXA 4HHJA 2IOPA 1TTHB 5KFMA 4LRBA 2E9RX 1H74A 3IS9A 3TANA 4B3TF 4IRCA 3M8WA 2CVEA 2C3MA 5C0XD 4FNHA 1U26A 1XMOE 3DMJA 4ICLA 3B4MA 2U1AA 1AZSA 4L72B 2J9DA 2RUSA 3S7RA 1XQIA 5EKWA 3HT3A 3VAFA 2DT9A 5F8MA 1H72C 2AEMA 4B3SF 2YH0A 2LMIA 3IMQJ 2HIQA 1L3UA 3HI9A 4DPUA 1Z1ZA 1VQOS 1RAHB 4RJVA 3CJ5A 3LUYA 1WDDA 3NGUA 3AJ2A 3W5ZA 2ZM6E 3FFIB 2QLJB 4LFAF 3CMES 4B3TJ 5KFLA 4IFDC 4JI3F 4KHMA 3IC1A 4ETZA 2MPUA 1YVFA 1Q0NA 3AD8C 3G2XA 3A3PB 1FI4A 2X7IA 2MSTA 2IERA 1PJ7A 3G4SS 5G4DA 4F67A 2G0IA 2DNYA 2DGTA 4C4WA 2VG5B 4FDFA 1F5BA 1BWEA 2FVCA 2Y1JA 4J90A 2VG7A 2RAQA 1FTCA 2CQBA 1RQ0A 4F26A 4DG1B 3TW0A 4CZCA 3H5YA 2QJ3A 4OO1F 1NO8A 1U6BA 1NHHA 4O4GB 4B9NA 3ZNJ1 3M30B 3NS6A 4DHVA 3K0JA 4LFBE 1WACA 4MAKA 1T9VA 3HHNB 4DV2I 3CJ8A 4L75A 4FW7A 2J5AA 3H98A 1U1PA 1KR4A 1IBKE 3D5MA 1UZHA 2EFNA 1V5IB 4I0WA 1S99A 2EFPA 1UFLA 3MEEB 3OPKA 4ZVPB 2HFVA 1UZDA 3E01B 1RWMB 2WAQD 1SJRA 3AD7C 5KT7A 2UUCJ 2BQUA 4GQUA 2FD2A 1JLCB 4FN5A 4Y3CA 2LCWA 5E33A 5MAOA 3ZKBA 3BKTA 4LFCF 1VK3A 5DG7A 6FD1A 1Q82T 1PBAA 1AB8A 2V9WA 3DDNA 3B4TA 4FVCA 5F8JA 3HFZB 2D3OR 1TR0A 4JI4E 3WIUA 5HROA 3I4PA 4CLYA 4CLSA 1HR0F 3MOJB 1BLUA 2C2ZB 4MKBA 2VQFE 4HACB 4EYHB 1Y00A 1HBMA 2AX1A 4PABA 3MM7A 4EO6A 4LFCJ 4KHRA 3LGNA 5A0YB 3LPSA 1T9TA 2YVSA 4WP9A 3VV2B 4U8YA 3HFVA 3QGPA 3CGIA 3C3LA 2C2DA 3DYAB 1NB2A 1R27B 4DCOB 1Q4RA 2DTJA 3OR2B 5F9NA 4OO1A 4AIMA 4DR3E 4AL6A 3M6UA 4B3MF 5BYSA 4OX8A 1HR0J 1G6BA 4QJVA 1WC6A 4ES1A 4C11B 1UEKA 3UFCX 3LP2B 5KFJA 4YHHF 2DBBA 2BE2B 1WDTA 3P4UB 2JE6B 3QQCD 4DZDA 1WHVA 3CXCR 4FF4A 1X5TA 3IO1A 3JQMA 2MJUA 4NLQA 4QWEA 4DV0I 4GVLA 3EZ5A 5ETKA 4Q2LA 4EO8A 2RQMA 3HX9A 4E8UA 4B3MJ 3W61A 2FVRA 1NPKA 2HVIA 5DLGA 1HW9A 4N5SA 1U47A 4ZOSA 4IS9A 2NN6F 1RACB 3HXMA 4RWWA 3CJ4A 1HQ2A 3UCUP 4OX9J 3SMZA 2C22A 3PX6A 4OYAA 1RCXB 3P76A 4LF5E 2M3DA 1RTHB 1KFDA 3OVSA 1XR5A 2IFXA 4WU2A 3DHWC 1LQ9A 2LXFA 3TQ1A 1N32F 1LWXA 1S16A 5EL9A 4X64E 1GXLA 4H4KA 1UWAA 4JV1A 4IZJB 2B8QA 2E5JA 2LDIA 2HNYA 5J2QA 1Y4ZB 3P49B 2XC9A 2LA4A 1K9MT 1PO6A 2EFQA 5CYQA 4HHHA 1QZRA 2ZH8A 2HFUA 3GSDA 2BE9B 2G2YA 1SIWB 4FS2A 2PEBA 3EZUA 1N0VC 2YWFA 2C3OA 4XO0A 3SXLA 1R0AB 4OMFG 2XY5A 2GCFA 1OYPA 4NLWA 2HGNA 1XNRE 2VFSA 3IFEA 3FCVA 1SV5A 4LF9E 1WC3A 3NNHA 1TKXB 3DLGA 1I94E 4JV5I 2LP4A 2WB4A 3JAMY 1N34E 2IM1A 3IG1B 4ED5A 2DR7A 1GNKA 1ZM9A 2UU9I 1HNZI 3MEDA 4DCJB 3VAJA 2XO7A 3D3BJ 3KK3B 2QSWA 2VV5A 3M2VB 1C0UB 1UVMA 2V5HG 4FZVA 1JWWA 2HAIA 4CNZA 1SJ3P 2LQ5A 2R7RA 5U47A 5EN1A 3QJJA 3OT9A 2VHGA 4WTYA 1WG1A 3PJ9A 1YRUA 3T1YF 5AJ3J 5DS7A 1VRTB 1WF0A 4A8QA 3AT1B 1R6LA 5G0RA 1F0XA 4USHA 4UUXA 2WK4A 2ACMA 3ENWA 3R2CJ 4CYUB 3S6EA 1HIYA 3WDOA 2E1AA 4KO0A 4QYRA 2YX7A 2Z2YB 3JQKA 1NHJA 1E3HA 2K7KA 4OI4A 1RWKB 1M90T 3K5PA 5HMYA 2J7UA 2FJDB 3J7AM 3H59A 4A8KA 2Q2EB 2AEFA 4YB5A 5A8KA 2V8HA 1EETA 2ILZA 1J5EF 5KG5A 4QNJA 3R5GA 2M88A 5D8HB 2C28A 2X36A 3DOKA 2BDPA 3CJRA 4DR1J 5IM0A 2OD6A 4DQRA 1HNWI 1S1WA 2MZRA 1C1CB 1N33J 2F4VI 4LRCA 1F9HA 1SKWA 2XMTA 1S9EA 3V6JA 3AA9A 3JSMA 1KVJA 2O1WA 2RQKA 1FRLA 4LOMA 5D4PA 1PG5B 4P7AA 4OJ3A 1WEZA 4EUVA 2IVYA 3RG6A 2MQNA 1LNQA 4P72A 4UOGA 1SJ1A 2E7WA 4ELUA 3BSAA 1HI8A 1IBMI 1M5VC 3FMWA 3QSYB 3UNGC 4ECWA 4JI6J 3QZ7A 2CG9A 2AYMA 2WVCA 5BR8F 3CB4A 1SXLA 2PSZA 1Z5BA 5ETQA 5KG0A 1HNXE 3CCQS 3DRSB 3UDLA 3QFWA 1N36F 1SQGA 5LSLA 4JI7J 4FWDA 2Q3PA 2H4WB 4WZMA 3WU3A 2NN6D 1HKAA 3SQGA 1TUWA 3C2PA 2YKNB 1BQNB 3HHDA 1DY3A 4OYOA 1RR9A 3MMBB 1YKWA 3FBFA 4B3SI 1RBOB 2ABYA 1U2RA 3IBWA 3R5AA 2DGQA 2IM3A 3GMGA 2UUBF 2KVIA 4M8LA 1FFGB 2EW9A 4M5IA 3FK4A 1M0SA 1FDDA 1SL1A 4DG1A 3T5KA 5D0HA 3G82B 4BCAA 3GV5B 1I3OB 1A6LA 4LFAI 1HBOB 4OZ2A 4EZ9A 1V6HA 4JI3I 1WI6A 2J65A 1S4FA 3F73A 2F65A 3WBZA 4ZPTR 3OTCA 2IJNA 1R7IA 4O3RA 1M5OC 2QRRA 3R6GB 2OPPB 2IPOB 2W9CA 3VAMA 2YX4A 3UHMA 4LF1A 3P5TL 5JEAF 4PXCA 3A8EA 1DLOA 3FQLA 5H9FK 3ZZTA 3DU6A 1U25A 1OSDA 2LLZA 3PACA 2BYCA 3LF0A 2A0FB 3MEEA 5K14B 3WX8A 4UY85 1VRUA 2Y9HA 4DR4F 3VQTA 3O8WA 4NPOA 1Q8LA 2F8MA 4Y65A 2KRBA 1W2IA 1LW0A 2C38B 1SC4B 4LSNA 5CXTA 1RB0A 4A4JA 2CQ4A 1FK9A 2E5HA 5CH7B 2HHTA 4GKJI 2B6AB 1FXDA 3BYRA 4LCGA 5BYRA 4OO1C 1Z2LA 3AD9C 1X4HA 1I5OB 3FMBA 2HMIA 4ZCMA 4H4OA 2YNHB 1PVGA 3V6DB 1ZETA 1MWZA 4LF6F 4J9NA 2V94A 4TN2A 2QTWA 4C7QA 5IT0A 2Z5CA 1RAIB 2DKOB 2XLIA 4M5LA 5J2MA 4IH5A 4ZVQB 4EI2A 1VQNS 5E5NA 4N41A 1Z4UA 2IRYA 1XMOF 3M8ZA 1ZXMA 2EXUA 1EP4B 1V3ZA 1NBEB 2UXDE 4ID5B 4ERDA 4ZKAA 2W9BA 5E41A 2AW0A 4LBPA 2KXFA 3DFEA 2BQRA 3I0SA 4CIOA 1F2HA 3QWPA 3HJFA 2UXBE 3QLHB 5ETRA 1YHCA 4Z7YA 1RTZA 3S8SA 4FVMA 2ZUAA 2M5YA 3ZTSA 4CM2A 2MYFA 3C16A 3HF5A 5JEAA 1Q78A 2ZM6F 2WONA 3MM9B 2DXEA 2JH3A 3PRBA 1T8EA 1XR7A 4UQTA 1XIQA 3V4IB 4DR2J 1QSSA 3QRQA 1XMOJ 4PCQA 5DZ7A 5DDPC 1L3SA 1P1LA 5IC4B 3HHLB 2R9LA 3GFZA 2E1MC 3GU0A 4ANDA 4H4KC 2XCPA 3HPOA 1FCAA 1LK5A 2QA4S 1JLAB 4JYAE 3P5BP 4YEAA 1LXNA 2VB6A 2XYPB 1S77D 2L9NA 4MH8A 4RW6A 2IMOA 5B08A 1D09B 2MKJA 3CDAA 3LOUA 1WF1A 3V81B 1VCTA 2V2ZA 4HR2A 2NZ4A 2XI3A 1ZXNA 4N56A 3DRPB 2J8AA 5I42B 4NLSA 4YHHI 1TAQA 1HBNA 3KJNB 2HLTA 4CM0A 1UAWA 5JVGQ 3PS1A 2A6MA 2RDJA 4G1IA 3G6ES 1Y4SA 4KBIA 5HVGA 4JV5J 3THVA 4AQYE 4EBDA 2XS7A 2V63A 4LFBF 2KL8A 3OTOF 1IKVA 4ED6A 3D1HA 4NLVA 1NSKL 1IBKF 2EG2A 4UZCA 2IY5B 1FA0A 4IH7A 2BRLA 2IRUA 5E3RA 4Q43A 3QBCA 1ZTWA 2MZJA 1NDCA 3FDSA 1UW9A 3B78A 2APOA 3C66A 3GQCA 1KRPA 2DR9A 5ETVA 4J91A 2MQLA 2FLOA 1VC6A 3DRRB 3GIIA 4NCAA 2BR2A 4KFBB 3HM9A 3DKDA 2FJAB 1U49A 4LFBJ 3SI8A 2YNFA 2NN6C 1N32I 3CCUS 3KNAA 1HI1A 2PA8D 3SV4A 3LPYA 4LQ9A 1IBKJ 3MZIA 1AUDA 3BR8A 1IBCB 4ZJLA 3M9NB 3DOLA 2J9CA 3FRYA 1KFSA 1JJHA 4R5PB 3J81j 3KK3A 1CG2A 2KFYA 2FVQA 4OQJA 2VD3A 2VQFF 2NUUG 3P3DA 2CVIA 2XMWA 1H38A 3MECA 5DRRA 2QLXA 3B8HA 1UDNA 1WHWA 1BY9A 3MWBA 4OHVA 2BQ3A 2K2PA 3RW7A 3QGIA 3FSIA 2L08A 5LL6R 3CC7S 2CQ3A 2FHJD 1RHUB 2DVIA 1U1MA 1NHUA 4AM3A 1Q8BA 4IQXA 2HQIA 1U0HB 4JI4J 5KT4A 2GZOA 3H4BA 2E66A 3CEDA 1FKPB 4F3QA 4ED8A 4DR3F 2O1UA 3H25A 5K36B 2JOQA 1S6QB 4DF4A 3IR6B 2NSCA 1RT7B 2KI2A 2MKSA 2VQFJ 4DL6A 3R5DA 2I0XA 3MPVA 4L6V3 1HNIB 3VGVA 1VQKS 4RKUC 4A8YA 2COLA 8AT1B 1W7WA 4TYAA 1YRTA 3TA2A 4USKA 3HVWA 1NH7A 3GP9A 4B02A 2IM2A 1DFDA 3OVAA 3GYGA 3W65A 4M5DB 1OY9A 1RT5A 1RBAA 2OPSA 2CJQA 3T1YI 3OLBA 1NJXA 4F4WA 3I55S 2JEAB 4ID8A 3N28A 3PS3A 4ZLNA 3KKFA 3CD5A 4DN0A 4DR3J 4BA2B 4TVAB 1RWXB 2HNZB 4X4UA 4HY1A 4LQ3A 4DR5I 5ADZA 2HHHI 3KDNA 2BKPA 1F9FA 2UXCE 3MPYA 4YB7A 1H7UA 3UCZP 2UUAI 2AQ4A 3N6LA 1GH8A 2R7UA 3LWMA 5EWEA 5D3GA 2QLFB 4I4BA 3Q2TC 3O44A 3WHIA 4J9SA 3G6YA 2QA2A 1LWCA 1KDNA 3GFHA 4IZKB 5HL7Q 1SJQA 1U6ZA 1CJVA 3D1OA 3KLGB 2YWKA 1TVRA 4X64F 4NOHA 2ZH3A 3HDSA 1SUQA 2AV5A 4TQRA 1RK8A 2P5VA 1SH3A 1Z5AA 1RHMB 4KGXB 4PG4A 3UQSA 2X1GA 2M4MA 3UPFA 4DLGA 2QSFA 3H90A 2MLYA 1BQNA 3L7UA 3AA8A 2XBPA 4R0JA 4LF5J 4F3OA 2GVZB 2JLGA 3X1LB 5EDWA 3T1HJ 1XK8A 3DGVA 3KLHA 3NGTA 4RU2A 2QLWA 2C2KB 3TAQA 4NXME 4DV4I 5BR8I 4ZA1A 1Z0VA 1XNRF 4X64J 3W8GA 2XMJA 4ZHRB 3EUNA 1JLBA 5B0FA 3N01A 1ZS6A 4LMZA 5IQ6A 4LF9F 2D1CA 4B3OA 1DZ5A 4RUAA 2CQ0A 1I94F 1N36I 3HULA 1K73T 1L3TA 2MMYA 2YPZA 3KHGA 5C2GA 1S0VA 2OSQA 4ANCA 1AROP 3OXFA 2ZJPQ 2H4YB 2OMOA 2P6TA 2AHOB 4DS5A 2DO0A 3ONQA 3N5BA 4UT4A 4WUCA 4RLEA 5KFTA 5DQHA 2UUBI 4QWCA 5KFGA 3OSPA 4O0NA 2RF2B 1RT3A 9ATCB 2R7QA 1FWPA 2C37A 1XNRJ 2QG9B 3VWSA 2ADCA 2GIFA 3CD0A 4LF9J 4QNKA 3TI0A 2B9EA 3L7OA 3J7Z5 3GE9A 1N34J 2J7KA 1L3KA 1CS4B 2L9WA 2R7VA 2MKIA 2Z5BB 3M2RB 4ECZA 1TL7A 5B0EA 3A3NB 5KG7A 3WQPA 3KMSA 2PT0A 5LMNE 3UW1A 3ITHB 4AXIA 4KY3A 3W2WA 1B70B 2YQ1A 4DN9A 3D4JA 2KHDA 3V6DA 2VH7A 2DGOA 4DR4I 1VYAA 5JEAC 1WHXA 5ETSA 2PIIA 4CLFA 4E0DA 2ROGA 2VZ9A 3M32B 1XWLA 1VQ4S 4OZNA 1S76D 1R8CA 2LU1A 4NLGA 5EUHA 3TNVA 5L9XA 4NBQA 3GJTB 4C3MA 2EPIA 2K7JA 4FF3A 5GADI 4N47A 1JXLA 4MU4A 5ETMA 2PO0B 4JI0E 1N6QA 2UVWA 3PJWA 1RTIB 3VTIA 5HMXA 1JXVA 2JLFA 4OX7A 3MF5A 2JVRA 3KTQA 1FXRA 4QIEA 1O0PA 4ZPDA 2NPIA 4J9MA 2LECA 3MM8A 4MU0A 2OPQA 2RDDA 2M70A 1QTNB 4X66I 2V8VA 4LF6I 4AYBD 4IUFA 3MM9A 3CJTA 1MROB 3B82A 1HNXF 1S0MA 4KGMA 5LSOA 2W2OP 2X1BA 4RNOA 4QOTA 4UTGA 2KM8B 1X5SA 2WW8A 4MJKA 4EU0A 3THTA 1FNMA 4ZVFA 1AFIA 3GZ7A 4DR7F 3PXGa 1KP6A 2CRLA 4X2BA 1L5UA 1QAXA 1X4CA 2H3EB 2OEJA 4K50A 1EB0A 3M85D 1HMVA 1RHQB 3GTYX 2H54B 3PEHA 1HPZB 4RW9A 1RA7A 2FGOA 2ZM6I 4DX6A 2ZOGA 1HNXJ 3T19A 1JIHA 1CJTA 4QCLA 1P6TA 2B43A 1P9QC 3JYTB 4KSEB 1JK9B 4IFYA 2HHUA 3CPWR 4QR1A 3U1LA 2XYGB 4KE5A 2DNHA 2GQ0A 1SBRA 4B9SA 2BJ1A 3FEZA 2HAFA 1X9MA 4I68A 4B3RE 3HCXA 4DV6E 2ZBCA 3TX0A 3GYXB 4KYZA 3OTBA 2HIYA 1J5OA 2IDEA 5DRQA 1VI7A 2J0SD 1N5SA 2XGQA 2QX0A 3NG8A 2ASJA 2CUYA 4DSIA 1MU5A 5DDOC 3H4DA 3W7BA 2B4UA 2ZHAA 3PR4A 4UF4A 2DH7A 3N0VA 2C2MB 1VGYA 1WG5A 1D9FA 2OTLS 4FW9A 2HWIA 3GILA 3EVOA 1D9AA 4I69A 1HI0P 5LOQA 2W4CA 3LGHA 3US5A 3QAUA 4V19J 3RBZA 2OP5A 3RJMB 3RAMA 3OTOI 3L9ZA 4MDTA 4ISAA 1TL3A 3VHQA 3QO9B 3LP1B 4U96A 1TUGB 4BWMA 1RHRB 2HFOA 2W01A 1RHKB 5M2PA 5D0RA 4LF7E 1ZAXA 4A8OA 1IBLE 2AF6A 1S9FA 1UDSA 4DUYE 3UNYA 3NWRA 3MR3A 3NBPB 3L3CA 1VIXA 4OZEA 2ZD1B 1UJ6A 2FVPA 4URSA 2AJ0A 5GADU 5A8RB 4DR5J 5HN0A 3H20A 4JI8E 1YTYA 2B5JA 5F41A 2VQEI 1X9WA 2UXBF 4DU8A 4F02A 3M85G 3KG1A 1RT6A 4RW4B 2VIHA 5KFCA 3FEYB 5L38A 4WKRA 1HQUB 4I2QB 5KFWA 1RWUA 3ISND 3CD6S 4X65I 2DY1A 1S72S 3RBXA 4IFDB 4TNOA 3H0PA 1SQEA 1FNXH 2UXDJ 4BLGA 3BSNA 2JEAA 4ZMMA 1RAOA 1JLQB 2XWYA 1EKRA 3MEGB 4ES3A 1MU2A 3BM7A 2WB1D 4JYAF 2P2CB 2UXBJ 2ZITA 3GYNA 4DL0C 4NXNI 3NP5A 4LR7A 3W8PA 1FFWB 4PWUA 2JHEA 4CTAA 2HYIB 1RT2A 3TUPA 2JEFA 2JRSA 1VHIA 4F4AA 4J7CA 1USVA 4L73A 2DB1A 1ELOA 1WOSA 2B4OA 2DEIA 2G2OA 5B0GA 2DY9A 1ICEB 1Y60A 4GMKA 1GXTA 1D1UA 3QWUA 4AQYF 1KLMA 1LOUA 4ECRA 5LXRA 3AQOA 3RBEA 3GIRA 3QT8A 5K36E 3K59A 4GKKE 5DRPA 2DJWA 3L7PA 4GVBB 3TYTA 5F8IA 2VKZG 2Q66A 2GHVC 4KIAA 5ETLA 3EDRB 1UDOA 1Q7YT 1TKTB 3AB2B 1JLGA 4JI2I 1CULB 4K4WA 1FDNA 1VJQA 1ZZFA 2O1TA 5HMWA 2VFUA 3EYZA 1YLXA 1NK7A 4NZ6A 4LVOP 2W24A 1RTJA 3OXGA 5E3AA 2GMLA 5A76A 3U02A 2JT2A 3M2UB 2HQCA 4ZJQA 5LMUI 1BE4A 2K1RB 1S1VB 1Q1KA 5KG4A 5L1JA 2FHKA 1QAJA 3EJMA 4M63A 4C8ZA 1IUJA 3EM1A 4OKGA 4KH0B 3U27A 1GXUA 3FEXB 1HWIA 3K7RA 3Q8VA 5FWKA 1RJJA 2X1AA 2F9JA 4FXVA 2HK2A 5D15A 4MMOA 2RMLA 1T05B 2DXDA 1R6VA 2JEBA 2VL1A 4USJC 4K4SA 2WZ1A 4DX5A 4LF8E 3M7VA 5GAHI 1I94I 3V4MA 2Z5BA 2FLLA 2CPDA 1JXEA 1LWEB 2YNGA 5J1EB 3DXBA 2NXEA 4BA1A 1VBYA 3M4XA 3POTB 5JMNA 2FIUA 2IBOA 1VQLS 4K59A 1RUSA 1S5ZA 1LFWA 4NA1A 1GK8A 2JLEA 2OGUA 1UMJA 4MKVA 3TA0A 1S1TB 2H48B 2YH1A 4LRDA 2DHGA 2DIUA 1F3VA 1I51B 4EYIB 4NX9A 5F3ZA 3HT0A 4DBQA 3H2LA 3DCAA 3CJ2A 4IG3A 1CJKB 4DPTA 4U8VA 1JLFA 3FKBA 1TMMA 4IFVB 1G2EA 3TVZA 2FLPA 1C4AA 4ED1A 4FW3A 5CD4H 2CFXA 2HSEB 3PJXA 4RW7A 4CH7A 4DV1J 2ZH7A 1TK5A 2M8HA 4RR5A 2IC3B 1VQ5S 2BX6A 3ENVA 4DR6E 3PKMA 2VUGA 1IXKA 4MTPA 4OI3A 1PKPA 2PA3A 2QL5B 1MX0A 1PYOB 4KB7A 3FRZA 4B17A 2ZJRQ 3BKUA 2MZTA 5DDRC 2IHR1 2Z2MA 1EAYC 3TX8A 2HQDA 4F4KA 1YWXA 4NCBA 2UXCJ 2WVEA 4XIUA 3ZTRA 4LF4J 1APSA 3LP0B 4TU9A 1H6KX 2D7SA 1NUEA 1WKLA 3VVUA 3JTNA 2E5LF 2HVDA 4ZCKA 3VQSA 2QYCA 5CZVA 4DJBA 2BW7A 3HFKA 4J9VA 4UOHA 4Z2XA 3BSCA 5C2CA 4WJBA 1YZ6A 1NK0A 5KFZA 2PFFB 4U6PA 1TV6B 4FYYB 1CJUA 1X4FA 3BEGB 3NS7B 4P74A 3UE2A 2GO9A 4OJ1A 3QYYA 3N4WA 1ZAVA 3DGPB 4YMEA 3N6MA 3RGIA 2O5DA 5CHCB 3MAQA 2HS3A 4KT0C 4UY8T 1HNVA 3BO2A 3BSOA 3U1MA 2DR8A 1E6YA 4MFBB 4RNFA 1B62A 2W4DA 1OPZA 3DLEB 2O1PA 4DR7I 1RKJA 1HFEL 1NZ8A 2XZWA 3CNQP 3W62A 2F4FA 3C6TA 2ZH2A 4M5HA 3B54A 2KYZA 4DV3E 4NXMJ 1RT1B 3JTOA 4ZVIA 4LPFA 3EE3A 3RB0A 1PIEA 4IDKA 3UN5A 3OL6A 2MY7A 3CWVA 2AJ1A 2DHXA 5GAHU 4IKAA 3IS9B 2RHSB 4PUOA 2RRAA 1Q5YA 1I6JA 1N48A 4HH0A 2C1EB 5KFHA 3CDWA 9RUBA 5DM7Q 3GIMA 3O6QA 5LMNF 5H9EJ 2EVZA 5DG8A 4IZJD 2Q79A 1GTHA 3G6VA 4EWTA 1P1TA 2NXNA 2XLKA 1WTBA 3PV8A 1T3OA 2CQHA 1LWFA 1NK8A 1AW0A 4B9VA 4X65J 1H7XA 2AEJA 2KTQA 3DI6A 3KLFA 2JFDA 3CJKA 3RB6A 4DFPA 4RNNA 3CIMA 3QSIA 4QU6A 1Z0WA 4PWDA 1MW7A 1UETA 1G4CA 3BBFA 4OX9E 3BQ1A 4ZVRB 4USTA 4UZBA 4JI0F 4U3DA 3CW2C 4RU9A 2WNRA 2QFJA 4MYUA 3NGDA 2B3TB 4P71A 1U45A 3QGGA 2IYIA 1GMWD 3KFWX 4DS4A 4FXWA 1S6PA 1UVLA 1AXQA 4L74A 1T03A 1Q7LB 4DPOA 2ZBQA 3MR6A 2VG7B 3MPUB 4Z7CA 1RZMA 2HWHA 3AHPA 1HWKA 3D0GE 4WIIA 5IV4A 4RBUA 4UOCA 4IFDA 1EQMA 4ZIWA 3B6BA 2XI2A 3Q24A 4LBHA 1FJCA 1O8BA 4RBVA 2F8HA 2YKMA 1SKRA 4O3SA 4AXJA 5E3PA 3HSDA 4IYQA 4GRSA 4P7TA 4QPTA 4C6AA 1ZPWX 4OZ0A 2H5JB 3R9LA 1MNEA 4LSLA 2BBEA 3LTOA 4TY8A 1MN9A 5KFVA 1UEVA 4DV5E 4ECYA 4OYZA 3T5JA 3SDEB 1PJ5A 2D3UA 3BGRA 3KUGA 3A8IA 2E1RA 2X1FA 3R2DJ 3R1LA 2RB7A 2O3DA 2L3MA 1T94A 1REGX 2EC0A 2XM3A 3J80Q 2J6UA 2V2VA 2GQCA 4UW2A 4KTQA 2DD8S 4NEYA 4JYAI 2AJFE 4B3RF 4O0IA 4DSFA 4DV6F 5CZXA 2FHOB 4JI1I 4K4UA 2XQCA 4BWJA 1BQXA 1QUVA 2RKIA 2YNIA 3FZ2A 5HROB 2AZ3A 2LJPA 4RO0A 2IDLA 2VG6B 3NGKA 3BO4A 3S01A 1HBMB 4WPAA 1X4DA 3MM7B 4AQYI 3MCMA 1ZH5A 1R8PA 4IR9A 2DNRA 3MHYA 3ETMA 3PX0A 4WP3A 4PXEA 2GX8A 3BH6B 4PPZA 1NDLA 5EX0A 4C9DA 5MLCV 4LF7F 1WKKA 4K2XA 4KHPJ 4OO1B 4U3BA 1IBLF 5C0XF 4HEA9 2DXFA 4DUYF 5C24A 2P9CA 2KZZA 2HS0A 2K06A 1YITS 4FYDA 2GO4A 3TVYA 1T05A 2FZGB 2AU0A 4WUDA 4F50A 4X4PA 1H7WA 1RYSA 2YQ0A 1QDUB 3GFYA 3PCOB 4JI6E 4MIWA 3RR8A 3SCLE 1FEHA 3WX4A 2NR0A 3T3FA 4RUBA 2XLJA 3KDOA 4Y34A 2HLUA 4P6QA 1IN0A 2E7VA 4DV2E 4JI7E 4DUYJ 2MXYA 2VODA 3CUNA 3NGSA 4OI6A 4P75A 1O5JA 1T11A 3UD3P 2CWXA 1C0TA 2KU7A 4Y6IA 2K3IA 1R0CB 1TP7A 2E1PA 2I6WA 4S0MA 2I5JA 4ILMA 4XK8C 1M1KT 1Y5YA 4DUZI 4JI8J 2C3UA 5DO2A 3ZZZA 3RRGA 5D0GA 4F04B 3OUYA 1T3NA 3BQ0A 3IA0A 1MMDA 2JC1A 3BN7A 4TLQA 4DV7F 1FJGF 2C39A 5AXNA 2F5GA 3AXMA 1FJEB 5HJXA 2CQCA 5J2QB 3W5XA 3HMJG 5D78A 3AY0A 4NCGA 5CYQB 4WXOA 3ULHA 3BGLA 4XPEA 1NEEA 2HHSA 3ZKDA 2KJWA 5HQMA 4QQBA 4ED2A 3CO9A 1YRXA 3PHTA 3FNNA 5C0XA 5D0EA 4GKKF 1SV5B 3DDIA 4OJGA 1LW2A 3QJLA 5EWGA 3E51A 3M8QA 5CCLA 2YKAA 2CYYA 2GGPA 2YBVA 3DLGB 1TFWA 3IGVA 2HZAA 1UFKA 3PIPQ 2MLXA 4OL8A 4OX6A 4JV0A 4ILRA 2IJFA 3MEDB 2E44A 2BW2A 4NEZA 3LWLA 2CPJA 1S9GA 3CE8A 1Z0CA 2DGWA 2RJZA 2DGVA 1CLFA 2XY6A 1Y4UA 1FT8A 4WE1A 3KHLA 1OYSA 3RTVA 4OYWA 1VHFA 2RD5C 4F2SA 2DHAA 4DCPB 1GQEA 1FDBA 2R8JA 2NN6B 5G0RB 3QGHA 2XZTB 3A4TA 3PEJA 5GVQA 4K5RA 2MKCA 2G9OA 4QIGA 4LIRA 5GAEI 2LEPA 4DV0E 4BDPA 1FRIA 1R8BA 2BJ3A 3HHLD 1VQ8S 3J81Q 1NCLA 4KO0B 2JEIA 2E5LI 2DNPA 2V6AA 5FLXC 4QPXA 1YHQS 2G0CA 5ELWA 5CQGA 3A3OB 4LBIA 5T7LA 3UO0A 1MWQA 4J5OA 4J3DA 1QUPA 3CJ0A 4J9PA 4TKTA 1Z0EA 3JSRA 4MK9A 3FUYA 3T6BA 4NA3A 5A8KB 2W8LA 4OZ1A 2ZBKB 4LF8F 1EETB 2JL9A 2QL9B 3K5MA 2R3VA 1NJZA 2EEYA 4RX6A 3G8QA 3DOKB 4DR2E 5IM0B 4X4QA 1WEYA 1S1WB 2DHSA 1BWVA 1QAYA 2NXCA 2WP8A 2B9XA 5DNXA 1S9EB 4CO3A 3JSMB 1RHJB 1WEXA 1ZM3A 5IXUA 3BDPA 1MMLA 2WW4A 1WELA 1BXNA 5AXMA 4GC6A 4LREA 3T9ZA 5BXIA 1B7YB 4Q8FA 3TRGA 4LF8J 4A47A 4WFAQ 2GJFA 3I5CA 2PNZA 2QIFA 3Q89A 2B9YA 3MPDA 1Y3JA 2VC0A 2WTFA 2V2KA 4KGKA 1UDQA 2XTJP
chains in the Genus database with same CATH topology
1XMQE 2UXCE 1DARA 1VISA 1H7UA 3WU5A 4FW9A 2UUAI 2BM1A 4ED4A 2F4VE 5LMNI 4JV5E 1N36E 3J80C 4DPWA 2BM0A 4AQYI 4LF5E 4LF8I 4DR6E 3OTOI 4N3OA 3K17A 1PKPA 4GKJI 2UU9E 1MG7A 2V34A 4P52A 4IZKB 4GKKI 4B3MI 4DR3I 4DR7E 4DV5I 4USMA 4X65E 1KVKA 1MX0A 3Q6NA 1S16A 1KKHA 4X64E 1PVGA 4DUZE 1EI1A 4LF7E 2IOPA 4IZJB 1IBLE 4URLA 4DV1I 1Z5AA 3JAMQ 5A2QQ 2Z5CA 2V8PA 4DUYE 4OX9I 1H74A 4B3TE 4WUBA 2HKEA 5IWAE 4M1KA 3ZZ0A 4NXNE 1QZRA 4JI0I 4I3HA 2HFUA 4RPFA 4HXZA 4X62I 4YY3E 1XMOE 2GS8A 2XEXA 4WUDA 4JI5E 1N0VC 1ZXMA 1XHKA 5IT9C 4JI6E 2UXDE 4JI8E 3Q1QA 1H72C 4KHPI 2VQEI 4NXME 4DV4I 1XNRE 5BR8I 2NPFA 1A6FA 1Z0BA 1Z0VA 2UXBE 4DPUA 1NHIA 4Z7YA 1XMQI 2UXCI 4DU8A 2HK3A 1RREA 4LF9E 4LF4I 4DV2E 1I94E 4JV5I 5FLXQ 4JI7E 2ZM6E 3JAMC 1N36I 4LFAE 3HULA 4DR4E 5A2QC 4FWHA 1N34E 1BKNA 4JI3E 2R42A 4LF5I 2DEJA 4DR6I 3T1HI 3QT7A 1ZM4A 1B62A 1ZM9A 2UU9I 1HNZI 4DR7I 2A2CA 3V2UC 1Z0GA 4X65I 1HNWE 4DPYA 1XNQE 3WU6A 4UT4A 3HJCA 4WUCA 4X64I 2UUBI 1FWKA 4DUZI 1N0UA 1FI4A 1FWLA 1KTVA 2X7IA 4JI2E 4JYAE 4DV3E 2IOQA 1OJ4A 3T1YE 4ZVIA 2ZITA 4DUYI 1PIEA 4B3TI 4DXLA 1KIJA 4NXNI 1N32E 1IBME 2V2ZA 3P06A 4DR2I 5GMDA 3CWVA 1ZXNA 1XMOI 2J7KA 1Z59A 2Z5CB 4DR1E 4X66E 4JI5I 4YHHI 2Z5BB 2AJ4A 4LF6E 4HYMA 1N33E 2UUCE 1HK7A 5LMUE 2UXDI 1USVA 2OI2A 4HACA 1NHJA 1ELOA 1K47A 4JI8I 2PNLA 2DEIA 1NHHA 1Y4SA 3ZKDA 5LMNE 4NXMI 1XNRI 2UXBI 4B3RI 4AQYE 2E5LE 1B63A 3J7AM 3PYDA 4IZJD 4DV6I 4LFBE 3D4JA 3QT8A 4LF9I 4DV2I 2Q2EB 4DR4I 4GKKE 3H4LA 1USUA 1N34I 5L3JA 1IBKE 1J5EE 4B3SE 5GMEA 3PYGA 3QT5A 2X36A 4R1FA 1Z0WA 4DV1E 1HNWI 4PU9A 1XNQI 3M6AA 3B78A 3V5RA 2F4VI 4OX9E 4FN5A 3ZM7A 3PRYA 1Z5CA 3WU4A 2O1WA 4JI2I 4DV3I 4JI0E 3F0NA 2O1TA 1Z0CA 4P7AA 3ZKBA 4LFCE 4MYUA 3LNUA 1H73A 4K0KE 1Y4UA 1N32I 1IBMI 1NZ0A 2EFGA 2CZ9A 3Q6MA 2HFSA 4DPXA 4KHPE 3QT6A 4LF7I 2CG9A 4DR1I 4X66I 4LF6I 1IBLI 1N33I 2UUCI 1Z5BA 4FWGA 4JI4E 5LMUI 4Z7CA 4DV0E 4LF4E 1HNXE 3B82A 1D6TA 4DV7E 4JI1E 1HR0E 1FJGE 3J81Q 5IWAI 1Z0TA 4UTGA 2E5LI 4FWDA 5FLXC 4YY3I 4LFBI 2VQFE 2O1VA 2VF3A 2Z5EA 4HACB 3WU3A 3T1HE 5IT9Q 4DR5E 1FNMA 2HHHE 1HNZE 4PRXA 1EA6A 3B8HA 5FWKA 4JI6I 1RR9A 2HK2A 2UUAE 1IBKI 1J5EI 4B3SI 4PRVA 2HKJA 1U2RA 5LL6R 4IZKA 2UUBE 4DU7A 3LPSA 1Y6ZA 1Z0EA 1WUUA 4LF8E 3OTOE 2ZBKB 3ZZUA 3LTOA 4GKJE 1I94I 4IZJA 2ZM6I 2Z5BA 4JI7I 4LFAI 2R3VA 4DR3E 1ZM2A 4DV5E 4B3ME 3PYFA 1S4EA 4JI3I 2O1UA 1H7SA 4DR2E 2E1RA 3K85A 3J81C 4LFCI 2PNMA 4K0KI 1UEKA 4JG4A 4YHHE 3K1JA 2A2DA 2BV3A 3J80Q 2GQ0A 1ZM3A 2V2VA 4XTJA 2WW4A 3PYEA 4EMDA 4USKA 1FKAE 4JYAI 4B3RE 3ZZTA 3T1YI 4JI4I 4X62E 4DV6E 4DV0I 3GONA 1HNXI 4DV7I 4JI1I 1HR0I 1FJGI 3J7AG 4DPTA 4MYTA 2VQFI 2V2QA 1MU5A 2VQEE 4HY1A 4DV4E 2LJPA 4DR5I 5BR8E 2HHHI 4KQVA 2CGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ E;  2UXC E;  1DAR A;  1VIS A;  1H7U A;  3WU5 A;  4FW9 A;  2UUA I;  2BM1 A;  4ED4 A;  2F4V E;  5LMN I;  4JV5 E;  1N36 E;  3J80 C;  4DPW A;  2BM0 A;  4AQY I;  4LF5 E;  4LF8 I;  4DR6 E;  3OTO I;  3K17 A;  1PKP A;  4GKJ I;  2UU9 E;  1MG7 A;  2V34 A;  4P52 A;  4GKK I;  4DR7 E;  4B3M I;  4DR3 I;  4DV5 I;  4USM A;  4X65 E;  1KVK A;  1MX0 A;  1S16 A;  1KKH A;  4X64 E;  1PVG A;  4DUZ E;  1EI1 A;  4LF7 E;  1IBL E;  4URL A;  4DV1 I;  1Z5A A;  3JAM Q;  5A2Q Q;  2V8P A;  4DUY E;  4OX9 I;  1H74 A;  4B3T E;  4WUB A;  2HKE A;  5IWA E;  4M1K A;  3ZZ0 A;  4NXN E;  1QZR A;  4JI0 I;  4I3H A;  2HFU A;  4RPF A;  4HXZ A;  4X62 I;  4YY3 E;  1XMO E;  2GS8 A;  2XEX A;  4WUD A;  4JI5 E;  1N0V C;  1ZXM A;  1XHK A;  5IT9 C;  4JI6 E;  2UXD E;  4JI8 E;  3Q1Q A;  1H72 C;  4KHP I;  2VQE I;  4NXM E;  4DV4 I;  1XNR E;  5BR8 I;  2NPF A;  1A6F A;  1Z0B A;  1Z0V A;  2UXB E;  4DPU A;  1NHI A;  4Z7Y A;  1XMQ I;  2UXC I;  4DU8 A;  2HK3 A;  1RRE A;  4LF9 E;  4LF4 I;  4DV2 E;  1I94 E;  4JV5 I;  5FLX Q;  4JI7 E;  2ZM6 E;  3JAM C;  1N36 I;  4LFA E;  3HUL A;  4DR4 E;  5A2Q C;  4FWH A;  1N34 E;  1BKN A;  4JI3 E;  2R42 A;  4LF5 I;  2DEJ A;  4DR6 I;  3T1H I;  3QT7 A;  1ZM4 A;  1B62 A;  1ZM9 A;  2UU9 I;  1HNZ I;  4DR7 I;  2A2C A;  3V2U C;  1Z0G A;  4X65 I;  1HNW E;  4DPY A;  1XNQ E;  3WU6 A;  4UT4 A;  4WUC A;  4X64 I;  2UUB I;  1FWK A;  4DUZ I;  1N0U A;  1FI4 A;  1FWL A;  1KTV A;  2X7I A;  4JI2 E;  4JYA E;  4DV3 E;  1OJ4 A;  3T1Y E;  4ZVI A;  2ZIT A;  4DUY I;  1PIE A;  4B3T I;  4DXL A;  1KIJ A;  4NXN I;  1N32 E;  1IBM E;  2V2Z A;  4DR2 I;  5GMD A;  3CWV A;  1ZXN A;  1XMO I;  2J7K A;  1Z59 A;  4DR1 E;  4X66 E;  4JI5 I;  4YHH I;  2AJ4 A;  4LF6 E;  4HYM A;  1N33 E;  2UUC E;  5LMU E;  2UXD I;  2OI2 A;  4HAC A;  1NHJ A;  1ELO A;  1K47 A;  4JI8 I;  2DEI A;  1NHH A;  3ZKD A;  5LMN E;  4NXM I;  1XNR I;  2UXB I;  4B3R I;  4AQY E;  2E5L E;  1B63 A;  3J7A M;  3PYD A;  4DV6 I;  4LFB E;  3D4J A;  3QT8 A;  4LF9 I;  4DV2 I;  2Q2E B;  4DR4 I;  4GKK E;  3H4L A;  1N34 I;  5L3J A;  1IBK E;  1J5E E;  4B3S E;  5GME A;  3PYG A;  3QT5 A;  2X36 A;  4R1F A;  1Z0W A;  4DV1 E;  1HNW I;  4PU9 A;  1XNQ I;  3M6A A;  3B78 A;  3V5R A;  2F4V I;  4OX9 E;  4FN5 A;  3ZM7 A;  1Z5C A;  3WU4 A;  4JI2 I;  4DV3 I;  4JI0 E;  3F0N A;  1Z0C A;  4P7A A;  3ZKB A;  4LFC E;  4MYU A;  3LNU A;  1H73 A;  4K0K E;  1N32 I;  1IBM I;  1NZ0 A;  2EFG A;  2CZ9 A;  2HFS A;  4DPX A;  4KHP E;  3QT6 A;  4LF7 I;  4DR1 I;  4X66 I;  4LF6 I;  1IBL I;  1N33 I;  2UUC I;  1Z5B A;  4FWG A;  4JI4 E;  5LMU I;  4Z7C A;  4DV0 E;  4LF4 E;  1HNX E;  3B82 A;  1D6T A;  4DV7 E;  4JI1 E;  1HR0 E;  1FJG E;  3J81 Q;  5IWA I;  1Z0T A;  4UTG A;  2E5L I;  4FWD A;  5FLX C;  4YY3 I;  4LFB I;  2VQF E;  3WU3 A;  2VF3 A;  4HAC B;  3T1H E;  5IT9 Q;  4DR5 E;  1FNM A;  2HHH E;  1HNZ E;  4PRX A;  1EA6 A;  3B8H A;  4JI6 I;  1RR9 A;  2HK2 A;  2UUA E;  1IBK I;  1J5E I;  4B3S I;  4PRV A;  2HKJ A;  1U2R A;  5LL6 R;  2UUB E;  4DU7 A;  3LPS A;  1Z0E A;  1WUU A;  4LF8 E;  3OTO E;  2ZBK B;  3ZZU A;  3LTO A;  4GKJ E;  1I94 I;  2ZM6 I;  4JI7 I;  4LFA I;  2R3V A;  4DR3 E;  1ZM2 A;  4DV5 E;  4B3M E;  3PYF A;  1S4E A;  4JI3 I;  1H7S A;  4DR2 E;  2E1R A;  3J81 C;  4LFC I;  4K0K I;  1UEK A;  4JG4 A;  4YHH E;  3K1J A;  2A2D A;  2BV3 A;  3J80 Q;  1ZM3 A;  2V2V A;  4XTJ A;  2WW4 A;  3PYE A;  4EMD A;  4USK A;  1FKA E;  4JYA I;  4B3R E;  3ZZT A;  3T1Y I;  4JI4 I;  4X62 E;  4DV6 E;  4DV0 I;  3GON A;  1HNX I;  4DV7 I;  4JI1 I;  1HR0 I;  1FJG I;  3J7A G;  4DPT A;  4MYT A;  2VQF I;  2V2Q A;  1MU5 A;  2VQE E;  4HY1 A;  2LJP A;  4DV4 E;  4DR5 I;  5BR8 E;  2HHH I;  4KQV A; 
#chains in the Genus database with same CATH topology
 4K5S A;  2N82 B;  5LXY A;  2W2M P;  1KNZ A;  2BOA A;  2ZNY A;  2Y1I A;  3QAT A;  5LMN I;  4JV5 E;  5IOL A;  1YJW S;  3SQG B;  1RXO B;  2PO4 A;  4JV2 A;  2DK2 A;  1U1K A;  1JQG A;  4N3O A;  4DR6 F;  1X7V A;  1NLK L;  2UU9 E;  4RNM A;  4N77 A;  1TZ0 A;  4MK8 A;  5D77 A;  2KZM A;  4USM A;  1Y3K A;  3TZW A;  5D6G A;  2P9E A;  1G7C B;  3W5Y A;  4Y2I A;  2NLW A;  5T14 A;  2J9D E;  5A2Q Q;  2UUC F;  2GC8 A;  1Q86 T;  2OPR B;  4JP8 A;  2BA9 A;  2IES A;  3G6X A;  2LA6 A;  2ZH9 A;  4YFU A;  4JI1 J;  5KFB A;  4JI0 I;  4I3H A;  2FPH X;  4X62 I;  2W9C B;  4RNH A;  1IVZ A;  1IM4 A;  4Q0B A;  1HHS A;  3GJS B;  5I3Q A;  4DR6 J;  4IH6 A;  1DLO B;  2WBR A;  5DRK A;  2QGF B;  2N3L A;  2GVD A;  5K36 D;  2NYI A;  3TZZ A;  1O6X A;  4G1P A;  3SDE A;  1XMQ I;  3DLH A;  1VRU B;  5KFS A;  1RRE A;  2ZJQ Q;  5KFY A;  4OV1 A;  5FLX Q;  3BH7 B;  1LK7 A;  5FLX U;  1R6Y A;  2BKO A;  2EFV A;  1LW0 B;  3OL8 A;  5GAE U;  1TKD A;  3ILL A;  1N54 B;  4LSN B;  1SQF A;  4MIB A;  2FC9 A;  1P9Y A;  2O66 A;  1HNW E;  3TAM A;  4PAA A;  1C2P A;  3PX4 A;  4DFK A;  3MOZ A;  1FK9 B;  3F44 A;  4QWD A;  1IR0 A;  3GCM A;  1T9W A;  1WC4 A;  4ECU A;  2MGZ A;  1KHW A;  1XTZ A;  3CCZ A;  2HMI B;  4H4O B;  1RE1 B;  4ZN1 A;  2KXH A;  2VG6 A;  1IBM E;  2V8G A;  2YY3 A;  1Q53 A;  2RDI A;  2Z5C B;  4JI5 I;  1QSY A;  3HHE A;  5J2M B;  2DGS A;  7FD1 A;  4A8M P;  2QMW A;  2MQP A;  1NK9 A;  1TK8 A;  1UJ5 A;  1RWO B;  2YXL A;  4B3R I;  3L95 X;  3R27 A;  5K8M A;  2H5I B;  5LJ5 Y;  3HLU A;  1KLN A;  2PO2 A;  1UTA A;  4DV6 I;  2Y1L B;  2BRK A;  4DV3 J;  2W9B B;  3I0S B;  3TJ8 A;  2QA4 G;  1YGY A;  1HWL A;  1P27 B;  2NYH A;  4NYZ A;  2EKN A;  4M5N A;  2MTL A;  4B3S E;  4EFA C;  4ENO A;  5K8N A;  1TQL A;  2R2U A;  2QL7 B;  3C16 B;  2CPF A;  5JEA B;  2HHV A;  1VDH A;  1YJT A;  2WON B;  3LPE A;  1XNQ I;  2B4V A;  3HVT A;  4FP9 A;  1NJI T;  4OX9 F;  3D54 A;  2XNQ A;  3ZM7 A;  7FDR A;  3F0N A;  5IWA J;  3PR5 B;  3BB5 A;  2LDY A;  2CKW A;  2HHQ A;  1T9Y A;  1FDA A;  4YY3 J;  2HBR B;  2WSF C;  3DU5 A;  2RSQ A;  1Q8I A;  4X84 A;  1RA6 A;  1ZYQ A;  2VBZ A;  2RU3 A;  4CO2 A;  1C4C A;  4LF7 I;  5HI7 A;  4RW6 B;  1IBL I;  4Q7A A;  2XO6 A;  4J37 A;  2WVF A;  2PEH A;  4B9L A;  2CNN B;  2PDA A;  4HYK A;  3CT9 A;  4ZVG A;  3PS2 A;  2MHE A;  4WFY A;  3CC4 S;  1HBN B;  4U7C A;  4IRK A;  2VF3 A;  2OFG X;  2JVO A;  3T1H E;  2HBZ B;  3BBB A;  5C0X C;  4C48 A;  3F41 A;  4PPD A;  4PRX A;  3I4H X;  4B9U A;  4ALZ A;  4C8Y A;  4OO1 E;  3MDF A;  1W26 A;  1Y10 A;  1H0H B;  1OPI A;  1IKV B;  1WTF A;  2M0G B;  4P2M A;  2FZK B;  4GKJ E;  2CQP A;  2DIT A;  2JJ4 D;  4DV5 F;  4CT9 A;  3AAW B;  4JUZ A;  1NK6 A;  1FHT A;  1DAX A;  1JNZ B;  1B0V A;  3D67 A;  4K0K I;  1U4B A;  4O44 A;  3OR1 A;  4IO9 Q;  3C46 A;  2PI5 A;  3IM8 A;  2WVD A;  5F0U A;  3KNG A;  2BR2 B;  4Y2M A;  1N52 B;  2VFR A;  1M5H A;  3DNC A;  1KEK A;  2YNF B;  2AGQ A;  3UI3 A;  5AJ3 F;  5CA5 A;  2ZC4 A;  3UWT A;  1IKX A;  4LCH A;  2JNJ A;  5K8P A;  4DV7 I;  3OFE A;  1FJG I;  2RS8 A;  4M5M A;  2ATL A;  1TAU A;  4DV5 J;  4ECQ A;  3DOL B;  1X4B A;  3AJD A;  2R7X A;  3EPI A;  4YDX A;  2FTR A;  5DG9 A;  1S1U A;  2M8D B;  3GPA A;  1UWB A;  3RR7 A;  1F2G A;  1KD1 T;  2EK6 A;  3MEC B;  5L8R C;  2CNO B;  4DQQ A;  5A8W A;  2CAJ A;  2CNL B;  4OI0 A;  2IAJ A;  4GKK I;  2DCL A;  2NN6 A;  2PI4 A;  3KOA A;  1SVD A;  1AA1 B;  2DRB A;  3NCQ A;  3RRH A;  2DNM A;  4DR1 F;  2D3Z A;  3MM5 B;  5H1S V;  4HDG A;  1N33 F;  5HBM A;  5IS2 A;  3ZZP A;  4WTO B;  2CPH A;  3BZQ A;  2HFN A;  3JXO A;  3KWM A;  3PW5 A;  4CO1 A;  1DTT A;  3I96 A;  2V50 A;  2ASD A;  1V3R A;  4QU7 A;  5IT9 C;  4AT1 B;  4JI6 F;  1QSL A;  1RT5 B;  2OPS B;  3CO0 P;  4DWI A;  1A6F A;  1Z0B A;  2CPI A;  4N7T A;  2CJY B;  1NME B;  2BJ8 A;  3MMA A;  1M1H A;  2LQ9 A;  1OQ3 A;  2YKQ A;  3BYP A;  3WC0 A;  2HGL A;  2PFD A;  2GMJ A;  2BJ7 A;  3MTK A;  4JI7 F;  4P10 A;  3PO4 A;  4MIA A;  2NUH A;  1KQS R;  3L7Z A;  3W9H A;  3LAL A;  4IG0 A;  3OLA A;  3EVW A;  2YQ3 A;  4UQG A;  3QIP A;  3HZE A;  1T9X A;  5D3G B;  2W7P A;  1YJ7 A;  2UV8 G;  1EKS A;  4UUW A;  1V9O A;  1OIA A;  2OUG A;  3FZB A;  2Y0S D;  2R2S A;  1PC4 A;  1KTV A;  1LWC B;  4Q5V A;  2FC8 A;  2RNE A;  3DM2 A;  2VIC A;  4MU3 A;  1CJV B;  3HZG A;  4I1T A;  4X62 J;  1TVR B;  4B3T I;  5I3U A;  1Z2Z A;  2HRU A;  4CRJ A;  4DV2 J;  2KFZ A;  1YQH A;  1N32 E;  2YX1 A;  1SUQ B;  1FF2 A;  4O3Q A;  2WSE C;  1Z59 A;  3SIP B;  5L1L A;  4QYZ J;  4FS1 A;  4C98 A;  4HYM A;  1WNE A;  3KK1 A;  1BQM A;  3JQJ A;  1KBR A;  1N5Y A;  5CCM A;  1K1Q A;  3WC2 A;  4M94 A;  4ELT A;  2V4J A;  2DH8 A;  1HW8 A;  3DC2 A;  3UN2 A;  3KLH B;  3BPD A;  2Q6C A;  2UP1 A;  1R31 A;  2KHC A;  1AT1 B;  4C0B A;  4IOC Q;  3SCK E;  2HBY B;  4X4T A;  1IJF B;  3GSI A;  3ILI A;  5KFX A;  2YKP A;  4ZVT B;  1JLB B;  2OPR A;  4ZCI A;  1U6F A;  1T95 A;  1PBU A;  2ZOM A;  4B3O B;  1HHQ A;  3MR2 A;  4R1F A;  5E2Q A;  4NLD A;  4B08 A;  2WHO A;  1F60 B;  1KQK A;  4E98 A;  1VQS A;  1U1Q A;  2WRM A;  4KGV B;  1OY6 A;  3GWC A;  1VR6 A;  4Q2M A;  4OHY A;  2NQP A;  1UW4 A;  3KUH A;  2FY1 A;  3KLI B;  3KXD A;  1W25 A;  4JI5 J;  4C0H A;  1RT3 B;  2C37 B;  3D28 A;  1SJ4 P;  2CZ9 A;  3QT6 A;  2R7S A;  3N5F A;  3PKY A;  1U24 A;  2UUC I;  3AB4 B;  2CJ9 A;  4RL1 A;  3TJA A;  5KOX A;  3HKZ D;  3Q22 A;  2IBK A;  3G86 A;  1SC3 B;  4DV0 F;  2PMH A;  4IFD D;  1YG0 A;  3I82 A;  4X4V A;  2BJD A;  3RBD A;  3P96 A;  2XUL A;  3U1K A;  3M9O B;  4K2J A;  2O1V A;  3FSX A;  5FLX Y;  1TL7 B;  5IT9 Q;  2ASY A;  4DR5 E;  5IT9 U;  4NLP A;  2HHH E;  5DLF A;  2WOM A;  2UUA E;  3P45 B;  3W2W B;  4PRV A;  1UVI A;  1DTQ A;  2OLW A;  3M8Y A;  1Y6Z A;  4YB1 P;  2U2F A;  4R8U A;  3FGV A;  4F0K A;  3QZ8 A;  1FX4 A;  3OVB A;  1IKY A;  1IWA A;  3N79 A;  4DV0 J;  1TFY A;  4H4M A;  4Y28 C;  4DR2 F;  3W9I A;  5E3C A;  7AT1 B;  4LFC I;  2PNM A;  4JG4 A;  3SSQ A;  1WOP A;  3C15 B;  2YWH A;  5AXK A;  3CDB A;  1N6Q B;  3SYZ A;  2CZV C;  4BHQ A;  3G8T A;  4Y0F A;  2HFZ A;  4PG8 A;  1FKA E;  1EAR A;  1KOO A;  1WC1 A;  2ZKU A;  3MM8 B;  1VLO A;  3CJ3 A;  1HR0 I;  2OPQ B;  2PD1 A;  2GAG C;  4ZIT A;  5HLF A;  3OHB A;  3OW2 R;  4DUT A;  2BOP A;  2D9P A;  1EZZ B;  4NLR A;  1YJV A;  4RW8 A;  2QZ8 A;  1FTR A;  4DV4 E;  5BR8 E;  2F63 A;  2B51 A;  3Q8R B;  2ATC B;  5JVH Q;  4BBY A;  2ZE2 A;  3EWG A;  2Z2Z A;  3LW5 C;  4C3L A;  2N7C A;  5E3Q A;  2F1F A;  4XDD A;  4JV5 F;  1N36 E;  5A6W A;  4DPW A;  5HAN A;  1TL1 A;  5KFE A;  2CQ1 A;  2J0X A;  2UU9 F;  4B3M I;  2I8E A;  1FVQ A;  1B0P A;  3DRY A;  3BPS P;  1HMV B;  2NS1 B;  5BJR A;  3IM9 A;  3BO3 A;  3ET6 A;  5B0A A;  2ZWO A;  2ZBP A;  2BKN A;  2DNZ A;  4RW9 B;  1UVK A;  3VAG A;  3D6T B;  5DQI A;  4CDI A;  3JAM Q;  3MCS A;  1CJT B;  3O1L A;  1NJW A;  2FHJ A;  2ROP A;  4OX9 I;  1CPZ A;  1FRX A;  4IFY B;  3CJS A;  4F3M A;  5KG1 A;  4PXB A;  2ZHO A;  3H2U B;  3HSZ A;  4RPF A;  1TK0 A;  3BR9 A;  2ZFH A;  2MDA A;  4LRA A;  3SFU A;  1IR1 A;  3MM6 A;  3G9C A;  3PM9 A;  1Q16 B;  2UU9 J;  3PW7 A;  1HNZ J;  4DQI A;  5JEA E;  3HVA A;  4D3H A;  5CYM A;  3Q1Q A;  5HJY A;  2NPF A;  1TEL A;  1J5O B;  3E3X A;  3SSS A;  2QMX A;  1QTM A;  4PKD B;  3IRX A;  1WKJ A;  3Q8S B;  5C42 A;  4DR4 E;  5HAO A;  1BKN A;  1FRH A;  4KPY A;  4HTJ A;  3DHX A;  5JUM A;  2CA9 A;  5KFK A;  5DGA A;  4NMX A;  1K1S A;  1KS2 A;  1H2V Z;  1FE4 A;  3V6H A;  3VAK A;  2HS4 A;  1WOR A;  4ZLL A;  4URG A;  2UVV A;  1TL3 B;  4NL5 A;  2C2N A;  4FBT A;  1FWL A;  2NXJ A;  1SI9 A;  5ETN A;  1N88 A;  1EJ7 L;  2CPX A;  2SXL A;  4YOE A;  2VFV A;  4JI4 F;  3A8K A;  4R25 A;  4M5J A;  4N8N A;  2W1B A;  2IRX A;  4RBT A;  1JJ2 R;  2E9T A;  2AYB A;  1QD1 A;  3PVX A;  4DOZ A;  4ZVO B;  4F7V A;  3FVY A;  3PW4 A;  1QLN A;  4X66 E;  3KJV A;  2AJ4 A;  4LF6 E;  4ZPC A;  4CP5 A;  4CLT A;  5SZT A;  2C3P A;  3LH2 S;  3QJP A;  2PNL A;  1QY7 A;  1HNW J;  2OO4 A;  1HA1 A;  4KKO A;  2A10 A;  4PQU A;  2F4V J;  1ZTT A;  3TAP A;  3B4D A;  2UVU A;  2PO1 B;  3TUI C;  5RUB A;  4ECV A;  1B63 A;  3PFO A;  2R8H A;  4C8L A;  2RE1 A;  2B5J B;  4ZVS B;  1RIS A;  4QIV A;  3MM5 A;  4DL2 A;  4FXD A;  4NYO A;  1RYR A;  2ASL A;  3G71 S;  4LR8 A;  1IBM J;  3VR1 A;  1RT6 B;  3OQ2 A;  4ATN A;  1X4G A;  3I0R A;  4DV1 E;  5C5J A;  3M6A A;  1KVI A;  3NY0 A;  4UOF A;  1NB7 A;  2MEW A;  2WBM A;  1DQ9 A;  2HPU A;  2PE8 A;  1HYS A;  4LCF A;  1RT4 A;  2FYX A;  2ZH1 A;  1H73 A;  4J9L A;  5IFM A;  3U1Y A;  1W2B R;  1MU2 B;  5B0D A;  1NZ0 A;  1URN A;  4E2F B;  3OL7 A;  1RWV B;  4ZP9 A;  4B3S J;  4DR1 I;  4EK2 A;  4B9T A;  3FBB A;  4ZJO A;  1N33 I;  3CCT A;  1FX2 A;  3D6H B;  4LF2 A;  4LF4 E;  5JJB A;  1PCA A;  5CAB A;  4CTA B;  4C8K A;  1RT2 B;  2HZC A;  3TZX A;  5DRO A;  2I9S A;  3VGS A;  2V4R A;  2DO4 A;  1Z0T A;  4LFA J;  2DPJ A;  4IR1 A;  2R2R A;  4JI3 J;  2QFI A;  4LF5 F;  3TEH B;  5H9E K;  4FYV B;  3T1H F;  4USW A;  4A48 A;  1HHT P;  1EA6 A;  3W66 A;  1RWP B;  4JI6 I;  3PZP A;  1SB6 A;  1KLM B;  1J5E I;  1HD1 A;  2GO8 A;  2Z30 B;  1NJY A;  2W2P P;  2XCA A;  3M8P A;  2JFK A;  5J1N A;  4FNI A;  5LL6 d;  3K58 A;  2N4C A;  3OTO E;  4QW9 A;  1VS3 A;  3D0H E;  3UR3 C;  4ZS6 A;  4GKJ F;  4JI7 I;  2N3