2WW4A

A triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
b'MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-DIPHOSPHOCYTIDYL-2C-METHYL-D-ERYTHRITOL KINASE
publication title A Triclinic Crystal Form of Escherichia Coli 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase and Reassessment of the Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 90
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 2ww4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2ww4A01
4X64I 4AQYI 1HNXI 3QT6A 2V2QA 4GKJE 4B3MI 2HFSA 4Z7YA 1K47A 4NXMI 4YHHI 1Z59A 2CZ9A 3PYFA 3JAMC 4RPFA 4K0KE 4DR4E 4JI3E 3PYEA 4HACA 4YY3E 5LMUE 1ZM2A 4DPUA 5IWAI 1N34I 1PVGA 4DV1I 3J7AG 4DUZE 4HXZA 1J5EI 1KVKA 4B3SE 4LFCE 2BV3A 3J80C 3ZKDA 4DV6E 4JI6E 4DU8A 4DR7I 1NHJA 4FW9A 4FWHA 4DV4E 4JI4E 4FWDA 1PIEA 4DU7A 4DUYE 4M1KA 2ZITA 1B62A 4DR3I 4JV5E 5LMNE 4PRVA 2VQEI 2VQFI 1XNQI 2DEJA 4OX9I 1VISA 1KIJA 4DV0I 4X62E 1ELOA 1QZRA 4ZVIA 2V2VA 1H7SA 2E5LE 2UXCI 1HR0E 2UXDI 2HKEA 4NXNI 1MG7A 4DV2E 4DR2I 2UXBE 3JAMQ 4DV5E 4DR1I 2A2CA 4DPYA 1B63A 4URLA 1I94E 2A2DA 4DR6I 4FWGA 4LF7I 3T1YE 4DV7I 4B3TE 2HKJA 1IBKI 4DV3I 4USMA 1IBLE 4X64E 4AQYE 1HNXE 4JI5I 3J80Q 1EI1A 1HNZI 4B3ME 4GKKI 1H7UA 4X66I 2HK3A 4HYMA 1XNRI 1IBMI 3M6AA 4JYAI 4NXME 2VF3A 4XTJA 4YHHE 5GMDA 3H4LA 3WU5A 4LF5I 4LFAI 2UU9E 4UTGA 3ZZ0A 4LF6I 4JI7I 3B78A 1N34E 5IWAE 3B8HA 1FWKA 4DR5I 1J5EE 1A6FA 1S4EA 2V34A 3CWVA 4KHPI 4LF4I 1FJGE 5GMEA 3B82A 2GS8A 1ZM3A 4DR7E 3QT5A 1KKHA 1D6TA 1U2RA 1PKPA 2UUBI 2AJ4A 3HULA 1MU5A 4DR3E 2BM1A 5BR8E 4DXLA 2VQEE 1XNQE 1OJ4A 4JI0E 4JI8I 1Z5AA 4WUCA 4OX9E 1ZM4A 3ZZTA 4DPXA 3LNUA 2V8PA 4KQVA 2UXCE 2X36A 3OTOI 1N0VC 2UUAI 2DEIA 1NHHA 1XMQI 3WU3A 3T1HI 2UXDE 3F0NA 4WUDA 2F4VI 1N33E 4MYTA 5A2QC 2J7KA 4DR1E 1N36I 4JI3I 4B3RE 2UUCE 4DR6E 1ZXMA 4LF7E 1XHKA 2ZBKB 1Z0EA 4DV7E 5LMUI 3PYDA 4R1FA 5LL6R 1IBKE 1FI4A 5L3JA 2HFUA 4JI1I 1Z0WA 2V2ZA 3LTOA 1Z5BA 3LPSA 4JI5E 1N0UA 5FLXC 1HNZE 4GKKE 4JI2I 1XNRE 1IBME 4JYAE 1HNWI 2NPFA 3Q1QA 1RR9A 1H73A 4MYUA 4LF5E 3V2UC 4P7AA 4LFAE 4WUBA 4Z7CA 4LF6E 4JI7E 4LF9I 1ZM9A 4DR5E 4HY1A 2HHHI 4ED4A 4HACB 4UT4A 4KHPE 1BKNA 4LF4E 1N32I 3PYGA 4PU9A 5A2QQ 3T1YI 4DV1E 2UUBE 3J7AM 2ZM6I 1IBLI 4P52A 2E1RA 2R42A 4PRXA 1EA6A 1Z0CA 3J81C 4LFBI 4LF8I 4JI8E 3ZKBA 4X65I 3ZM7A 5FLXQ 2R3VA 2WW4A 3OTOE 1XMOI 2UUAE 1XMQE 3T1HE 2X7IA 2HK2A 3WU4A 2F4VE 4EMDA 1N36E 1H72C 2OI2A 2VQFE 2UU9I 4GKJI 3WU6A 4DV0E 1H74A 1FKAE 1Z0TA 1Z5CA 4JI1E 1NHIA 3D4JA 1MX0A 4NXNE 4DR2E 1Z0GA 1FJGI 2LJPA 4K0KI 4DR4I 2Q2EB 4JI2E 1NZ0A 4YY3I 1UEKA 1HNWE 3K17A 4DV3E 4I3HA 5IT9C 4DUZI 5BR8I 4B3SI 4LFCI 3K1JA 2XEXA 1KTVA 4DV6I 4JI6I 4JI0I 4FN5A 3J81Q 4JG4A 4X66E 2BM0A 1FWLA 1DARA 4LF9E 4DV4I 4JI4I 4DUYI 1ZXNA 4USKA 3ZZUA 1Z0VA 2HHHE 4JV5I 5LMNI 1N32E 1N33I 4B3RI 2UUCI 3QT7A 1S16A 4X62I 2E5LI 2ZM6E 1WUUA 1HR0I 3GONA 1Z0BA 4DPTA 4DV2I 2UXBI 1RREA 4DV5I 4LFBE 4LF8E 1FNMA 4X65E 1I94I 4B3TI 1XMOE 3V5RA 3QT8A 5IT9Q 2EFGA 4DPWA
chains in the Genus database with same CATH superfamily
1KNZA 4GKJE 2RKIA 2FTRA 3W1YC 1TZ0A 3CCZA 4OMFG 3JSMA 2CNOB 2GAHC 1FFGB 2QE5A 2XYPB 4HHHA 3KHGA 1W2BR 4F2SA 3CDUA 3T9ZA 4DR4E 2GQCA 5F9LA 1N5YA 1WI6A 4ZA1A 4TY8B 1HQEA 1X4FA 1LXJA 2DGXA 3FJ2A 2IFXA 3WC2A 3IXQA 4OO1C 3M1VB 4EWTA 2JDJA 1ZPWX 2QA1A 4ETXA 2HNYB 2YH1A 2GCFA 2BEFA 5K8PA 1Q8BA 3DM2B 2QA4G 1U09A 4Z37A 2HQ3A 3T1HJ 3U1YA 1EJ7L 2KXHA 3IAS9 1CJTA 3C6TA 3ETMA 1SV5A 4GVBA 5C0XE 4ED6A 4OYBA 2QMWA 5RUBA 2FC8A 4OZ0A 4DR2J 4BDPA 3H7HB 1LXNA 1KLMB 2ASJA 4FWGA 4WJBA 3SBMA 4DV7J 4MIBA 1FDBA 4J9MA 1VQPS 2W4CA 2HKJA 2L9WA 2POKA 3W3SA 4USMA 3GZ7A 4AQYE 4JI5I 1XEZA 2WVEA 4F50A 3JSMB 1Q8IA 4OI4A 4HYMA 2BQRA 4XTJA 3EZUA 2V50A 1SVDA 1N5YB 1R7IA 1HQEB 4NLQA 4EYIB 1WWHA 1TKDA 3FKBA 4MU3A 2WSFC 3TWZA 2VASA 4LF4J 3T5HA 3B82A 2RS8A 1RTDA 2HVZA 3M2VA 3H90A 2YKMA 4NCGA 2VBZA 3EXCX 1M5VC 1V3RA 1XMOJ 3SCLE 3AQOA 1CJTB 1SB6A 3C6TB 4FS1A 1SV5B 4GVBB 2MZ1A 5K14A 2V8GA 1KLNA 3J7ZT 3GB0A 3NBPA 3M30A 1NH7A 3M2RA 4AL5A 3PX6A 4H4OA 2ALYB 1YK9A 2J7KA 3KLFA 2GQ0A 2NR0A 3D0HE 1OY6A 3PW4A 2ZM6F 2HBYB 1HNZE 2HHPA 1R3NA 4MH8A 1OYRA 3MR3A 4DV4J 4DI6A 4X64F 1RACB 2WK4A 2HWTA 4ATNA 3W63A 4LR8A 3V2UC 1FHTA 4LFAE 4C48A 3I5BA 3OTEA 4ZPAA 2FJAB 1AYEA 4AL6A 1LW0A 3ZZOA 1RTDB 2XMKA 2DHGA 4URGA 2SXLA 4LRCA 4ED4A 2W9AA 2YKMB 3CCTA 3M4XA 4KC5A 1T8EA 1N32I 4NCGB 4FYXB 2UXBJ 1WOPA 5SZTA 1OWXA 3J80Y 1TAQA 4K4SA 3N01A 4OI0A 4ZMMA 4NLRA 4QCLA 5K14B 3AA9A 5BYSA 2UUBE 5KFJA 5J2QA 4YFUA 3W9HA 2R42A 2O1TA 5GADU 3X1LB 2RILA 1Z0CA 4LRFA 4A8OA 1KC8T 3R5AA 3NBPB 3M30B 3NP5A 2W2NP 1LV5A 2FY1A 1RAAB 1PYSB 4F02A 3QGIA 4H4OB 2ZH3A 3B4MA 1PBUA 1VQ8S 3LW5C 4PRFA 3IFEA 4Z2XA 1P6TA 4OX9F 3W5XA 5L1JA 4GKJI 2KM8B 3IBCB 3MF5A 2K3IA 1N34J 5GADI 3RBDA 2BA1G 2CG9A 3UN2A 4IOCQ 1FVSA 4ZK7M 4QNKA 4Y2KA 1Y00A 4DR4I 3HKZD 4KRWA 2BMBA 2K1RA 1RAOA 3LP2A 2AJ2A 2JRSA 1RTZA 1DJ0A 4I3HA 4P75A 1GTEA 3BPDA 3LOUA 1M90T 4JYAF 1A7GE 2B4OA 3LANA 1LW0B 3Q8QB 4PUOA 1XNQJ 2I0XA 3H5XA 1FWLA 1WKJA 4UY85 4JP8A 2J9EA 1H6KX 1QDUB 2BRKA 3NLCA 1N33I 5H1SV 3UWTA 2GHWA 5KOWA 2FZKB 2UUWA 5J2QB 4NPOA 2XLKA 1XR6A 2HNDA 2O1PA 1GFWB 5HQMA 1WHXA 3CJRA 1B7YB 1GMWD 1YVFA 2LQ5A 2VESA 1Q95G 2G2OA 3V6KA 1HHTP 1FTRA 4AXIA 4YOEA 3MD1A 5IOLA 3OTBA 1QAYA 4YB6A 2DHHA 2W2PP 4CO2A 2CAJA 4OZ2A 3OL8A 2WONA 1KSPA 5HATA 2KDOA 2XI2A 3N79A 2J9DE 4AQYI 3AODA 5GAEU 1Q81T 2YVSA 4B3MJ 2HFOA 4X4OA 2XZWA 4K4XA 3CJSA 5HMYA 2K1RB 5F41A 1Q7YT 3G2XA 4FDFA 1BQMA 2NXNA 1Y6ZA 3ZTQA 2UV8G 3HZGA 1PVGA 2B5JA 4PUOB 2HHTA 3FC9A 5GAEI 1JJ2R 3FRYA 2QV6A 4LMZA 1RHRB 5DNLA 1FRMA 5G4DA 5ETSA 1PIEA 1WF2A 1B62A 3PO4A 1S99A 3V81A 2IOPA 4PQUB 3HD1A 1VGYA 2CQBA 3BB5A 3I9ZA 3HHDA 4FBUA 2J9CA 3IWLA 4ZVIA 3QJPA 4IOAQ 4YR0A 3IRWP 4M5GA 2WVCA 3MDFA 1MG7A 1XJWB 4AL7A 1K1QA 2BDPA 5KFMA 1FDNA 3EGWB 5D15A 1HNWJ 1AROP 4DZ6A 2BJ3A 1HMVA 3N0VA 5KOXA 4MK7A 4X64E 2R2TA 1N54B 2XHCA 1HNZI 4HTJA 1H7UA 2HK3A 1BQMB 4MIAA 2HVEA 3P3CA 2R7UA 1ZAVA 2N7YA 2VL1A 3QFHA 3HJFA 4ETZA 2JEBA 1V5IB 4LFAI 2Q3PA 1X9SA 4YDXA 2RUGA 3POTA 3BQ0A 4IFYA 5FIIA 3PZPA 2ZM6J 4QIWD 4KIAA 5AXLA 2IY5B 1HL6A 4YY3F 3CMQA 1S4EA 4ZVHA 4DUZF 3MWBA 2MQNA 3QT5A 3V81B 1LK5A 2N3OA 3RBXA 2UUBI 4M94A 2A18A 3G6VA 4DXLA 2QGFB 4YEAA 4OX9E 2KJWA 4OZJA 3L9ZA 4KQVA 4ZVUB 1DBDA 2X36A 3HZEA 3CC7S 3EZOA 4JI3I 5T14A 2RRNA 1HMVB 4K4TA 2DR6A 3S01A 4A8QA 5L3JA 3AB2B 4Y0FA 4C2MA 4NL5A 4RNHA 2MZTA 5D78A 4P2FA 4BA2B 1UW4A 4JYAE 1Y10A 2W7OA 2JEBB 2NN6C 1XR5A 4CT8A 3HJCA 2W1BA 2ATLA 3OLAA 3POTB 5IV4A 4IFYB 5C0XA 4B17A 4P72A 4HH0A 4W4MA 4HACB 3CB4A 4KGKA 2DITA 4QWCA 3GFYA 4RWWA 3FEZA 3D28A 2XO6A 4WK3A 3NGDA 4CH7A 1KN6A 3UNYA 2ZBIA 2DRAA 1Y5LB 2ZDPA 1RAGB 3PEHA 1CG2A 3ONQA 2XS2A 3T5KA 2NSBA 1T11A 4ECUA 4KY3A 2O1WA 1YHQS 1RLCL 5KG1A 2X7IA 1M5PC 3MXHP 3WU4A 2QLXA 4ZVGA 2AJ1A 2UU9I 1NK9A 1J5OA 4KGMA 1SC6A 1ZAWA 5KG7A 5I3PA 4G6VB 2ZOFA 2E5LF 1IBKF 2BE2A 5C25A 1VJQA 4MQYA 4UOGA 3DHWC 4IR9A 4PG4A 2D7SA 1A6LA 4WFNQ 1X5TA 5C0XB 1WNEA 2DO4A 4WTOB 1FFSB 1HKAA 2CJYB 2XEXA 3SIPB 5L8RC 4DPOA 4FN5A 3J81Q 1VIXA 1PCAA 1PC4A 5HQ8A 2M3DA 1JIHA 1BE4A 4UOCA 1WSVA 1NDLA 3DRYA 5CZXA 5JVHQ 4M5JA 1S9FA 3GIJA 3H20A 1HA1A 4TYBA 5ETTA 2AYBA 1WHYA 1T9UA 3TZXA 2V2KA 4OYIA 4BWMA 1VHFA 1J5OB 5IT9Q 4X64I 3AHPA 4P6QA 4C9DA 4RO0A 3R5DA 3I31A 4Z7YA 2RRBA 2HFNA 2BE2B 2DHSA 1MNEA 5K36D 2E5HA 4GRSA 5T41A 2LQ9A 4BC7A 3VAJA 4YY3E 5EX3A 4K8RA 4DUZE 1NSQA 2MPUA 1OPZA 4LRBA 2C3YA 1IVZA 3U7JA 1WF1A 3N5BA 1TUWA 2NN6F 3GLJA 3T5LA 4OX9I 3R5CA 2HNZA 5HJYA 1FCAA 1XQIA 3EZ5A 5FLXU 2CPZA 3DOLA 2BW2A 3H25A 4NXNI 2D3ZA 2HLTA 4URLA 3T3FA 4NMXA 4LF8F 3TJ9A 4JOUA 4KFBA 2R8JA 2BZ2A 2EKNA 2IPOB 1IKXA 1UDNA 2P6TA 4JYAI 4LF9J 2DJWA 2COLA 5GMDA 2PA8D 3GIRA 3S8SA 3G9CA 5HQLA 2OEKA 4B9UA 2XS7A 4FPRA 5B7WA 2F4VF 4ILMA 5HROA 4F3QA 3QLHB 1S57A 1ZS6A 4F36A 3PKMA 3MM5A 1Q7LB 2JEAA 1CVJA 4IG3A 3M6UA 3JTOA 3QQCD 2C2KB 2CUYA 3CUNA 1U4BA 1S1WA 1CS4A 1UMJA 4OFZA 2HNZB 2J9DA 1U0SA 2XC9A 3DOLB 1ZM4A 4CLKA 2AD9A 4ZN3A 4BWJA 1BGXT 4K50A 3HX9A 1FNXH 4I0WA 3PS2A 3F0NA 3G86A 5MLCV 5LOQA 2V8DA 2MY7A 3DGVA 2XYGB 4BCAA 2R8HA 4F3OA 2XY7A 3MR6A 4KGVB 3H40A 1WKKA 4KFBB 4NYZA 3U1NA 5L1KA 1WELA 5AJ3J 3LAKA 1IBKE 4W98A 4P73A 1IKXB 3OJSA 4LUBA 5C42A 2G9OA 2NXUA 3KNAA 5KAKA 1Q79A 3UNGC 1CJKA 2DNHA 4RNNA 4HHUA 4ZIVA 5HROB 1FJEB 2MY8A 4WUBA 4CLYA 3MM5B 4ANEA 3CXCR 2JEAB 2ROPA 2ZKTA 2EK1A 5AXMA 3J81j 2QL9B 2QYCA 2E5LJ 2VONA 4DR5E 4IG3B 1TKZA 4HY1A 3CF5Q 2HHSA 2HURA 4KSEB 1BKNA 2B9WA 3ENQA 1S1WB 4FKXA 2AWZA 4S0MA 2BANA 5A2QQ 1CS4B 4ZCIA 3MUMP 3NS6A 2D9PA 2RHQB 1YJWS 4N56A 3G96A 2KRBA 1HD0A 2RAQA 1VI7A 2FVCA 2ZH6A 4J5OA 3PS3A 1R89A 3QIDA 2HHQA 3GYXB 2IM0A 3A3PB 3NGTA 1IR0A 2OGUA 3NOCA 4YHHJ 4USWA 4LF1A 1GAOA 2HG4A 1H72C 2WCXA 2E66A 3W8GA 2DXFA 2APOA 5C42B 3NNCA 3D6TB 1ZZNA 4A46A 5I3UA 2UUCF 1UFKA 1UAWA 2LXFA 1IJEB 1MX0A 1J5EJ 1Y7PA 5LJ5Y 4LR7A 1FJGI 3HHLC 3TAPA 2G0JA 2CIMA 1CJKB 2V69A 4DR7J 5AT1B 1RZMA 4YY3I 3GJSB 2QA4S 5F8HA 4DUZI 3FBCA 4OHZA 4Q8FA 2A6OA 5KG6A 1PG5B 4O23A 1TKZB 4LF5F 3KG0A 2G2ZA 2ACMA 2PMZD 4KH1B 3THTA 2BANB 1L3VA 1JWWA 3Q23A 1PGZA 1N33J 1PC5A 3RB0A 4B3RI 4D3GA 4LR9A 1SL0A 1VQSA 4FW6A 5KT4A 1QTNB 5HVGA 4ILLA 3U27A 4EBDA 1IQZA 1SJRA 2GVZA 3BO4A 3IMQJ 2Y1JA 4OI2A 3GFHA 3LGMA 2LP4A 2D9OA 2JEJA 1EAYC 4LF8E 2K8GA 3QNWB 3TA1A 4Y2CA 3HKWA 4FF4A 3TR5A 1FERA 4C0HA 3SSRA 2IM3A 2WBMA 1S49A 3UO0A 5I3UB 3MPVA 3E2EA 1UZHA 3PW5A 5KFGA 2EXUA 2FB0A 4NLXA 1NB7A 1NPPA 2RU9A 2GZOA 3KLEA 5KG5A 3IGVA 4KKOA 2GIQA 2NS1B 2PO2A 5LSOA 3L4BC 1N5SA 4A8YA 5JMNA 3VAGA 4DR1F 1GMVA 1RBAA 2IHR1 1K0TA 2IBOA 2J0SD 1RGVA 2WVBA 1NJXA 4X4QA 3MFIA 1WTFA 4JI6E 4WZQA 4QU6A 2QZ8A 5M2PA 1KVJA 4FWDA 4LT6A 3ZXWA 2KB2A 4OYMA 2F4VJ 4PXBA 5A8KB 2GVZB 1HK7A 2QTWA 5DGAA 1H7SA 1QY7A 1TL5A 2YX1A 2J6TA 5KT5A 2P5VA 2EFOA 4RW9A 4DV2E 2WSEC 2MZRA 1QE1A 5DO2A 3PJWA 2V5HG 2ABYA 5KT7A 3P06A 4KBIA 2CNLB 1IBKI 3VQTA 4X65F 2WAQD 2RQ4A 4NLYA 3DDNA 2JC1A 2JE6A 5IV3A 4X4NA 2JHEA 3OVSA 3KLEB 2AHOB 2L41A 2ROEA 1TK0A 2PNMA 4KKOB 5KFSA 2PO2B 2UVRA 4WU3A 3H4LA 3ZFVA 4IFVA 5ETKA 2G1HA 2RDIA 1N52B 4WK1A 3F73A 3KG4A 4DFJA 2DNNA 2MQOA 4DR5I 1QM9A 5KFTA 1UCNA 3MAQA 4RZRA 4EUVA 1UJ4A 1IQTA 4A48A 2FHJD 2RT3A 5F0UA 2BVZA 3D3CJ 4XDCA 1KDNA 2H54B 5JEAC 2Z2LA 2YQ3A 3UHMA 3CCRS 1UW9A 1GH8A 4RW9B 2EK6A 2LEAA 4C4WA 3GMGA 5DZ6A 4ZVEA 4OJ1A 1QE1B 1RCXB 1CJVA 1F3VA 3EVOA 2KVIA 1RA7A 2UXDE 1WF0A 1U26A 4AFFA 3MI7X 4JI3J 2HHVA 2UUCE 1NZAA 3OJUA 1YQHA 3UVJA 3OD2A 1Z0EA 3N9UC 4E0DA 3CCVS 2JE6B 2LMIA 1P42A 4DL4A 1U24A 4LFCJ 3LPSA 2R7OA 1T3NA 3O6QA 4GKKE 4UW2A 4IFVB 1BMQB 3LA0A 4OQJA 2Z58B 1SJ1A 2PEHA 4C7QA 2W25A 4LF5E 4DBQA 5KG2A 4NXMF 1D8ZA 2CQPA 1WC6A 3VHQA 4KTQA 1CSJA 4IZJD 3I0SA 4Z7CA 4MK8A 1X9MA 3DLJA 2B6AA 1LWEB 4OZ5A 3K89A 3FZBA 4FBTA 2LYVA 4ZN1A 3T1YI 2A6MA 2OIHA 4ES2A 5KFNA 1YTYA 2RNEA 1T9VA 3FQKA 5IC6B 3LPYA 1HNXJ 4LF8I 1CJVB 2GHVC 4OLOA 2CDRB 9RUBA 2HGLA 2XS5A 4CLLA 2M8DB 4FW3A 3KLIA 3ENVA 3UVJB 2UXCF 1N36E 4HKQA 3TW0A 2UU9J 5H9EJ 4BS2A 1VLYA 4DL5A 3FCWA 5IWAJ 2ZEJA 1JMTA 1T0TV 2DY1A 3W2WA 4DR6F 3KDNA 2ZZNA 2Z5EA 3CVKA 1N88A 4ELUA 5LL6d 5L9NA 4ZP8A 3BV8A 5KFOA 3DRPA 1U47A 3I0SB 1B99A 4FW4A 4I6AA 5E33A 4DJBA 2Z4PA 2B6AB 4JI6I 4JI0I 1TKXA 4DS4A 4RLEA 3IA0A 1KFDA 2CQHA 2Y8WA 3QZ7A 1Y0HA 4USKA 4YB5A 3ZZUA 1FJ7A 4IFDF 2VIHA 4KGXB 4DF8A 2CXEA 4W92B 1RCOB 1NPRA 4DR1J 1TL7A 1RT2A 3ISNC 2LU1A 4TN2A 3HI9A 4I56A 3NGRA 1SQFA 2H1YA 1WUUA 2AJQA 5CHCB 3VGVA 4DV2I 3QYYA 2HAIA 4CCHA 4M5DA 5H9FK 4X65E 3KLIB 4O4GB 3QJJA 3CDAA 5C0XD 2KYZA 1UA0A 3RG6A 3I5AA 1X4CA 5HL7Q 2OHDA 2LQJA 4LSZB 2R7RA 3W2WB 2ZZMA 4V1Ak 1DLOA 3Q6NA 1UP1A 4JB8B 4F3MA 3NCRA 3J81U 4MK9A 3L95X 4ID8A 4X2BA 4DV0F 3FFIA 3KHHA 3NRBA 1S0NA 3VTIA 1KOHA 3DRPB 4UY8T 4A8KA 1UWAA 4I68A 4OHWA 4CO5A 4L6V3 1C4AA 1IJFB 2FUG9 4Y3CA 1TKXB 3NS7B 3GFXA 4YN3B 3P76A 3MAAA 2KHCA 1KEKA 1JLEA 1UKUA 1G6BA 3RW6A 5KT2A 3KDOA 3CGIA 4M1KA 5KFFA 4K59A 1TL7B 1V9OA 1RT2B 3M8RA 1X4GA 1BC6A 4KHRA 3R6LB 3Q24A 2Z5BA 4NZ6A 3EX7B 4O4RA 4OJHA 3C3LA 1S48A 4M5DB 2UXDI 4FS2A 4NXNJ 2JVRA 3LQVA 3JAMQ 4DV5E 2HHUA 4DPYA 4IH7A 2ADBA 3W65A 1Z2ZA 4KHPF 2Z5CA 2VFTA 3HFKA 4IS9A 2XMWA 1M1KT 5A8WA 2HBZB 1DLOB 1H38A 4AM3A 4GKKI 4L75A 1B0PA 4EBCA 1FD2A 3FFIB 3D0IE 4NXME 1UDOA 5GAHU 4LF5I 1CBKA 4O0IA 1RWPB 2OLWA 1GX6A 2XMUA 2CPXA 1RISA 3C2PA 3BKUA 1DTTA 1KQFB 4Y34A 1TUGB 3WC0A 4HTIA 3BQ1A 1Q53A 3RUBL 5LMUF 3I96A 1JLEB 3L7OA 2CG4A 4WCEQ 3TARA 2YKNA 2IBKA 2IOQA 5GAHI 4B3SF 2YWGA 5DRPA 1PKPA 3B4DA 1CULB 3M8WA 3TNVA 2Z5BB 4Y2IA 1UVNA 5CABA 1F0XA 1J2VA 3NG8A 3OQ2A 2W7AA 1O8BA 2AZ3A 5DRRA 3OL7A 2AYGA 2I1RA 2KT3A 2V8VA 3ZZTA 2WNRA 2H5JB 2UXCE 2DEIA 4NRTA 1YHCA 5SUHA 2Z5CB 5D4NA 1N36I 4IG0B 4DR6E 5A8WB 3CDBA 4QBUA 4AD6A 1RSCA 3QIPA 1FI4A 4RX6A 2V2ZA 1KD1T 4B3TF 2F7VA 4M5HA 2HMIA 3UCZP 2B51A 5AE2A 3CJ0A 4NEZA 2DIUA 3P3EA 2AE8A 5IQQA 5LJ3Y 4P2XA 2MB0B 2E1AA 4F0HA 2IJFA 2F9JA 3OXGA 1DTTB 2H4WB 3FDSA 3MMCA 4IFDE 4K2XA 3MR2A 5BJRA 2EFPA 1NO8A 2BJ8A 2YKNB 3MPDA 1QTMA 1YI2S 3UN5A 3PS1A 1ZTWA 4LF2A 1I94J 2ZC3A 2BOAA 2H5EA 2PDAA 2QX0A 1R8HA 3V4IA 3J7YI 4IDKA 2VKRA 4NLOA 2WNRB 2A0FB 3KK2A 3J81C 4FVCA 1Q5YA 4X65I 3WIUA 3O5TB 3WX4A 2BE7D 2VC0A 3W61A 3MR7A 2ZBRA 1KHWA 2CJKA 3QIPB 5C2CA 2QLFB 1FE0A 2H4YB 2JT2A 2Z2MA 1NK8A 5C5JA 2CNNB 4DV0E 2ZH4A 3SEOA 3SFUA 2DYAA 1T95A 3WZ0A 2OP5A 2HMIB 3BO3A 3CC2S 2UZAA 4OI6A 3FRZA 1LW2A 2NYHA 3BSAA 1FJGJ 1Z1ZA 2CPHA 1WACA 1BUXA 3DLKA 2IDLA 4Q2LA 2ZVSA 2HVIA 1GK8A 4DLGA 3GR0A 2OMLA 3FNNA 3MMCB 5IT9C 1XNRF 5BR8I 1RWMB 3F41A 4R0JA 4ZLLA 3KJVA 5KFBA 2XGPA 3I87A 5L38A 2IYIA 4V19J 4WP9A 2K7KA 3SQGA 3IM9A 2HRTA 3R97A 2EFNA 3DLEA 1VQOS 1S0MA 2CJXB 3LPEA 3V4IB 8ATCB 4B3RJ 5IS2A 3IR6B 3M6VA 1HHQA 1RABB 4IDKB 3EYZA 3KK2B 2DD8S 3C14A 1QVFR 4CLTA 1V5VA 3ENAA 4DX7A 1IN0A 4DV5I 4GC7A 3RYLA 4CO3A 3NGUA 3D6FB 3IP0A 4ED2A 2J5AA 4UF4A 5DG8A 3MM7A 1S77D 3UQSA 4Q2MA 2WRMA 2OUGA 2QLJB 2XMJA 2DHXA 4NXMI 1LW2B 2VQFF 1LQ9A 1ACMB 3DLKB 2DNKA 4WP8A 2Q6BA 2CZ9A 3QAEA 3THVA 1JNRB 3MEKA 2EC2A 4RBVA 4JI1F 3JQMA 3EVMA 1W7WA 5LMUE 1ZM2A 2H5IB 3HF5A 3M7VA 2FZGB 4YDDB 1T94A 3DI6A 4B3SE 1FRHA 4M5MA 4USJC 3PJ9A 1TKTA 2DNPA 4GO7X 3SQGB 2NXCA 2BQUA 5GAGU 2UUAJ 2Q6CA 2B3TB 2LVWA 3PRBA 1NXIA 3C14B 3MURP 3MTKA 1OS5A 4KQZA 2UXCI 1R0AA 3TAQA 1SBRA 4I67A 2CJQA 4JI7F 3U1KA 4CTAA 5DLFA 2HHWA 4QPXA 2A2CA 3MM7B 4U8YA 5GAGI 4DR6I 2OSRA 4B3TE 3E51A 3OUYA 1VQMS 2Y0SD 2MSSA 3PW7A 4DV3I 4EEYA 3CJ2A 3D54A 2YWHA 4TYAA 1L3SA 1U2FA 4DX5A 3I55S 1SKSA 4KPYA 3CDEA 2DGOA 4LBHA 3TOQA 1EIYB 3OPKA 1ZH5A 5CQGA 4X66I 3OHAA 3MCMA 3DU5A 1JLCA 1TV6A 4M95A 3R9LA 1S4FA 3PRVA 1RWVB 2E7VA 1GX5A 3JSRA 4KYZA 3DI6B 5FWKA 4MMOA 3T6JA 5KFPA 4DR5J 1TKTB 2W9BA 5HK4A 3WIVA 1U2RA 2QIFA 1SQEA 2ZBPA 5KFCA 5M2UA 1R0AB 3R5GA 4J9QA 4CTAB 1FRKA 1ZA2B 3UDLA 5KFDA 3WU3A 4DL3A 1RBOB 5A2QC 3OUYB 3UN3A 1HR0F 1RWOB 5L1IA 1XHKA 1RWKB 2ZBKB 2MKYA 2PSZA 4R1FA 3RAQA 3FCHA 3PACA 2LXUA 5E7OB 5HAOA 1DRZA 3OL6A 1RI7A 4DV6J 3GSIA 4FXVA 2QSFA 2VFSA 1YBTA 2O66A 1XNRE 1HQUA 3VVUA 1REGX 4ZP9A 4GQUA 1YG0A 1VQ7S 4EFAC 3E8OA 1RR9A 2LLZA 4J9NA 2JFKA 2BA0D 1VJWA 2VA3A 2FGCA 1O5JA 1JJ4A 2RIJA 3CO9A 2MGZA 2W9BB 1ZTTA 3TA2A 2KVQE 4OHXA 3BR8A 1AUDA 1Y5YA 1QVGR 3ENWA 2H48B 1X5OA 1GXLA 3VAHA 3SV4A 4HT7A 3R7BB 3T1YJ 2LA4A 2Z2ZA 3AQPA 3FBEA 2FLOA 1IBLI 3UPFA 3MM8A 4DR3F 2NUHA 3L7UA 3PJXA 2JOQA 4IZKA 1NMEB 1F5BA 4JI4F 3CSKA 2QSWA 3EJMA 2VQFE 3UD4P 2ZDOA 3CJ5A 1PKUA 3M7NG 1NJWA 2OSQA 2MMYA 4LJMA 4A8MP 1IXKA 3J80U 3HSDA 2DPJA 1VC5A 4JI1E 1FA0A 1HQUB 2E9RX 4OYPA 1U6FA 4F4ZA 2PFDA 3KUHA 7FDRA 3SV3A 4JBCA 2IJRA 4ISAA 1KRPA 1D8YA 4DCJB 3K59A 1UVKA 1RHQB 1IBMF 3DRRA 4B3SI 2MGZB 2E1MC 1WOOA 4O3RA 3GG1A 3I32A 4CO1A 4JI0J 1AB8A 3GJQB 1UVMA 2CZ4A 2MSTA 3X3UA 2HQGA 4QIVA 1MN7A 1NJZA 1UL3A 5E41A 1TVRA 2C2NA 4DQIA 1E3HA 4WKYA 1VC0A 1NSPA 2MZJA 3MM8B 3PFOA 4PEOA 4F25A 4QR2A 2ZJRQ 3RW7A 3W5YA 4IZKB 5DRKA 4PG7A 2BJ9A 4B3TI 3Q2TC 1HI1A 3JXOA 4UZBA 1N8RT 4DPWA 3M8PA 2YPZA 4IFDA 5D6GA 1R43A 3FMBA 3QGGA 3T1HF 1SJ4P 4JI7J 5D4LA 1U6ZA 4IYQA 2B4UA 3LALA 1HI8A 1FO1A 1FT8A 1WOSA 3LAMA 1F9HA 5EKWA 2CQCA 2W2QP 1S1TA 2RMLA 3GILA 4NLSA 4PWUA 1H0HB 3DRRB 4DR2F 1O6XA 2KFYA 3J7AG 3D66A 4PYAA 4WFAQ 1QJHA 4DV7F 2QL7B 2IERA 1G1XA 4AE5A 4DU8A 4USHA 2GC8A 3RAMA 1GT8A 4HHJA 1X4EA 2VPWB 3TRGA 2W2MP 2BQ3A 1OYPA 1ULRA 1TAUA 3QPIA 1U02A 3V6DA 1HR0E 3P3GA 4LF6F 1OSDA 2VUGA 5DS7A 4TQRA 4ZPVR 1FXDA 4HLBA 2IESA 3K5PA 4LF4F 3AJ2A 1X0PA 5K36C 4GMKA 4IFDB 4IO9Q 4EI2A 5J1EA 2WB4A 4RU2A 1U1LA 4J3DA 1TTHB 1LFWA 3EXYA 4N5SA 3GTYX 1XNRI 2HRYA 1FE4A 4ELVA 1Y4ZB 5LSLA 1S1TB 3J7A1 3WU5A 1OYSA 5B0BA 2AEJA 3DLLQ 1G4CA 4N8NA 1S9GA 3B4TA 3CEDA 3DC2A 3ZTOA 3HHKA 1DZ5A 3IG1A 2PO0A 3HJVA 3NCPA 3BO2A 2U2FA 3GE9A 4TQSA 5KTQA 1URRA 5KFXA 3BN7A 3AA8A 1MWQA 1DQ8A 2KXFA 1D6TA 1RT5A 3KFWX 1W2IA 4P9SA 4DR3E 4DV4F 2VQEE 3P96A 2PT0A 3V6DB 1Z5AA 2WOMA 3MTJA 2FGOA 2J76E 3PHEA 1X7VA 3OXLA 4FYDA 3M05A 1MWZA 2VG5B 1U6BA 3BDEA 2AGPA 3D6HB 5ADZA 4QIGA 5J1EB 1NKCA 3M85D 4LF7E 1RU1A 1Y5NB 2UXBF 1HQ2A 3D1HA 3N6LA 2HGMA 4PPZA 4JI1I 3VZHA 3CPWR 4TY8A 3LTOA 2F1FA 3MPUB 1XK8A 2KZZA 5KFVA 5EWEA 3FSYA 1IBME 2M70A 4JI4J 3G8QA 4HEA9 4DUYJ 4LFBF 2NSCA 4LRDA 3ETOA 1S9GB 4ECWA 1H73A 3BM7A 1BWVA 2DGUA 3RRKA 3SFGA 2KH9A 4X84A 3ET6A 4DUTA 2LEPA 3NMRA 3IG1B 2PO0B 3GFZA 2AW0A 4NASA 3MM6A 4UT4A 1N34F 2FVRA 1S5ZA 5B09A 5D0RA 1RT5B 4K4VA 1Q0NA 2QT7A 5CH7B 5IT4A 4NLPA 1C0UA 2ZNYA 1LK7A 2WOMB 2NN6D 1NSAA 3WBZA 2CVIA 5A0YA 3K0JA 3O8WA 3KJNB 4RKUC 3TX0A 5FLXQ 1HWIA 3H42A 1Y4SA 1R0BG 4CLZA 1XNQF 4M5KA 3T1HE 2EPIA 2YQ1A 4F26A 1WEXA 1T9YA 3TUJC 4QWAA 2VU5A 2KKHA 1MROA 3HM9A 3ISZA 2C38A 1ZBTA 3HSZA 4DR2E 1FK9A 2XY6A 4DG1B 3UDEA 1G2EA 1B70B 3DLGA 5JJBA 4JV1A 2M2BA 2WW8A 3P3DA 3ET6B 2CGEA 5J2PA 5BR8J 4DQPA 2V6AA 5J2MA 4ZVSB 2ILYA 3DHXA 3MM6B 1F6TA 4B3MF 1QSLA 2M4MA 5B0EA 1NJIT 1X5SA 1C0UB 2B8QA 2DKOB 3QT7A 1RHMB 2M9KA 4Y2AA 2VJUA 2LQ8A 4UOHA 2D69A 5A0YB 1HR0I 4PAAA 4X4TA 4CLUA 4O3PA 2BW7A 3DOKA 4ZP6A 3OTCA 2CYYA 4WF9Q 3R27A 3TZZA 3PFEA 1XMOE 3Q8PB 3V5RA 1C1CA 1TFYA 4LSLA 2VBYA 5HI7A 3KRNA 3QT6A 1ICEB 1MROB 1MMDA 1VQKS 2C38B 4LF6J 4AIDA 1T9WA 4LIRA 1FK9B 2NYIA 4MU4A 2QC3A 3DLGB 5JVGQ 3JAMC 2XYHB 4F0MA 2LDYA 3CT9A 1RAFB 1NDPA 2HWIA 5EDWA 5J2PB 4DV1I 2F40A 5J2MB 4HXZA 1YBUA 1F5CA 2KM8C 4L76A 1C2PA 1HNWF 2FHKA 1OMSA 4WFBQ 1VCTA 3AB4B 1U0HB 4CP5A 3K5NA 4DV4E 4C8MA 4Y2MA 4G1QA 2F5GA 4DR3I 1N5VA 4NLTA 4XPCA 2C39A 2VQEI 1HD1A 2PC6A 1ZOTA 4ZJLA 4AUKA 1ELOA 2ZH5A 4IRDA 2P9CA 2ZUAA 3GMEA 3IS9B 3DOKB 1VBXA 2BACA 4C97A 2UXBE 2DPIA 4OKGA 2YH0A 4JI2J 4LF7I 2UUTA 2FC9A 4QWEA 3ILOA 1C1CB 2ALZA 4LSLB 4DN9A 3BPSP 3SSQA 4DV3J 1EQMA 2FLLA 3CJQA 3BGFA 3W8PA 5LM7E 1P27B 3Q8RB 2X51A 2LQBA 4RNFA 2CPDA 4X66J 4MTPA 2UP1A 1IBMI 3UDVA 2DR9A 1H2VZ 3BKFA 2VDIA 1NK5A 2N3LA 4N47A 3ZZ0A 3HKMA 1HFEL 1N34E 1RT7B 2WB1D 4N77A 3TAMA 2OPRA 2ZZTA 2XLJA 1EETA 4J9OA 1I51B 4LQ3A 4LFBJ 2ERRA 4OO1F 1HIYA 4G1QB 4OZ1A 4IRKA 1KKHA 4ELTA 2C39B 3HULA 1OQ3A 3EWGA 4LSNA 1N56A 5JXSA 5KG3A 1XNQE 2CPJA 1OYEA 3G4SS 2MQQA 2ZKUA 2E1PA 1R8BA 3ZZYA 3MEGA 5CYQA 1UPPA 4DSLA 3T1HI 4FW7A 2A10A 4ED8A 1RA6A 3GCWP 3TVZA 1TU0B 2MDAA 1CPZA 5F8JA 4DS5A 3NEKA 3UE2A 3QRQA 1Z0WA 2V9KA 2BA9A 3RRGA 4ES1A 5E3AA 3R6GB 2JSXA 2R7TA 1Q4RA 2J7UA 2NPFA 3DRSA 2DNGA 2FZCB 4JV5J 2JX2A 4QW9A 4FYYB 3O2IA 3TAMB 2OPRB 2XSJA 4ZLJA 4PQUA 1EETB 3QRPA 4NLGA 2W9CA 1E6VA 3AXMA 1H98A 3CTRA 1K1SA 3PYGA 2C2RA 1M5OC 1D9AA 3OR1A 3RR7A 2F63A 4LSNB 4HL9A 2JFDA 1HWLA 2ZJQQ 2FJVA 3GP9A 1CEZA 5DQGA 2QMXA 1U2CA 3AFGA 2FHJA 1IBLJ 4P52A 4OHVA 3FGVA 1DY3A 4B9MA 1RP5A 1BLUA 3MEGB 5CYQB 4WFYA 4G3IA 5E3PA 3F44A 3NS5A 3C16A 4DL6A 1XMOI 2G2YA 2L48A 1WHVA 4L73A 4B9VA 5LMNF 4DZDA 5K9FA 2GX8A 3LWMA 3PG9A 1WORA 4TY9A 2CNKB 3LF0A 3DCAA 4P71A 3DRSB 3DU6A 1X4HA 1JLFA 1HNWE 1IKVA 1TUVA 1U8WA 4QR1A 2Y1LB 3NZKA 2XSJB 4C0OC 3E01A 1UETA 4NZ7A 4WXOA 1UVJA 4ID5A 1RBLA 2ROGA 2W9CB 1FJCA 1E6VB 2FJEB 4BBYA 2QO3A 2ILZA 4A8SA 4DV4I 3AH6A 4XAKA 5F8GA 3CDJA 2O3DA 1EB0A 4NLUA 3OR1B 1RADB 4IZJA 5BYQA 5F0WA 3SMZA 3M32A 2R8IA 4ZPDA 2MQPA 2OD4A 3RJMB 4NI2A 3T41A 1G7CB 4O3SA 4C8ZA 4NLDA 5LXRA 1LWXA 2NREA 1YWXA 2ZM6E 4IQMA 1APSA 1ROFA 4RR5A 1RB0A 4U9RA 2UXBI 3C16B 1A9NB 4PQAA 4QJVA 5J1PA 4DFKA 2DGQA 2XSFA 3SCKE 3W62A 2HQCA 2FPHX 4BA2A 5HVFA 1A0OB 1XTZA 1B7FA 1EX8A 2V2QA 2VA2A 2V4RA 2R7XA 4LVOP 1NKBA 4J9SA 4C8KA 1IM6A 3DRXA 2DNZA 3K57A 4LQ9A 4EO8A 1JLFB 3BQ2A 1FNOA 1IKVB 1K9MT 5D8HB 4ENOA 2BX6A 4HACA 1SIWB 2PO1A 1N34I 3E01B 2YX7A 2O1VA 4ID5B 1IKYA 4F7VA 2Y8YA 2MYFA 4OO1E 2DNRA 3V6HA 2JLGA 3JS9A 1SJFA 4MKAA 1SUQA 3GYGA 1FESA 4JI8J 4IZJB 2DGSA 3NNHA 5DDQC 3W66A 4FWHA 3PW2A 3H5YA 3M32B 3MOZA 3OTOJ 1RT3B 1XMQJ 1S7HA 4NI2B 1UJ6A 2IRYA 4LF9F 2GO4A 1WC0A 4RNOA 1ZYQA 1MSWD 1XNQI 5E3CA 3PX4A 5C0XC 3IWXA 3NOGA 2ZWOA 4NOHA 3IR5B 5CZVA 2JZ5A 3H5SA 4B9TA 1C1BA 3A12A 2HVDA 4KB7A 3RB6A 1DQAA 1TMJA 3J81Y 5L46A 4U3BA 4NE9C 2VG7A 1UPMB 1QLNA 4RW6B 3UR3C 1M5SA 2ZHAA 2N4DA 2XMVA 3C6UA 4J9RA 1I1GA 2HHHJ 3Q6MA 2PO1B 5IQ6A 1IKYB 1VMBA 3KJQB 3MUVP 4OHYA 2XZDB 3AD9C 1SUQB 4CI0B 2RQKA 3KMSA 4OZLA 5IT9Y 5HN0A 3CWVA 5AJ3F 1FKAF 3VR1A 3BYRA 1YX2A 1QSSA 2LEBA 3HPOA 4IFDD 4EK2A 3P6YC 1VFJA 1O51A 4IRCA 1RU2A 2KHDA 1QD1A 1Y3JA 1UJ5A 2DNOA 2QN6B 1C1BB 4DPXA 1T05A 4ZPTR 1JQGA 4ZPWR 1UDQA 1F2GA 3QWUA 1N0VC 2R7SA 1Z2LA 2XWXA 4K0KJ 1J27A 1NKEA 1DTQA 4MKYA 1PYOB 2VG7B 4X4SA 2X1AA 3I0RA 4FYVB 4HDHA 3EDQB 3HFVA 4DFMA 1NEEA 2W7PA 1HBUA 2IVFB 3HVRA 3C6UB 4XTTA 5D0EA 2DXEA 3S1TA 2BA1D 1VRQC 3CJKA 1WI8A 3H2UB 3ICLA 4OYOA 3Q8VA 1HNWI 4DSFA 1DAXA 3AAWB 5LMNJ 3DGPB 3KHLA 4B9NA 4YHHF 3WHIA 2BJ1A 2OO4A 3NAIA 4X62J 3NGSA 2BR0A 1FRIA 5CD4H 2ZH2A 4CO4A 1FKOA 3KUGA 1XWLA 2RU3A 3AJDA 1J5EF 3SXLA 5E2QA 2NXJA 4RJVA 1M5KC 4ZP7A 8AT1B 5KG0A 4PXDA 2MJNA 1EQ0A 2ZM6I 1NNDA 4G1PA 4DR7F 4J7CA 3FVYA 4ZVPB 1T05B 3R2DJ 1EA6A 4Y28C 5K5MA 3FBFA 2HZVA 3D1OA 2AGQA 3VV2B 2WW4A 2R2RA 3FUYA 2PA3A 1DTQB 1Q82T 2LXIA 1VDHA 2PFFB 2ATCB 3I0RB 2B4PA 5KFEA 3D1QA 1HBUB 2OKQA 3WU6A 3AD7C 4CRJA 1N33F 3Q22A 2FDNA 1W25A 1Z0TA 3M6XA 2C3UA 3GJTB 5A6WA 3CJKB 1IKWB 3QLHA 2BUNA 4LCHA 3MPWA 4K2JA 3R7SB 4USTA 2P8IA 2YWEA 4CO0A 2IDEA 4PXCA 1NPKA 4CLFA 1OQ6A 5BXIA 4QYZJ 2C37A 1TK5A 4ZVFA 2AT1B 3FQLA 2XNRA 4CT9A 1DARA 2O01C 4LF9E 2ACYA 1YITS 1FKOB 4AQYF 2XI3A 3M8SA 1R27B 2DNYA 2WVDA 4RW8A 4ZOSA 4DF4A 2VZ9A 4WP3A 4ES3A 1R8CA 3BN4A 1IM4A 1G3OA 4WFZA 2XO7A 1QUVA 4CH0S 4I6WA 3H1CA 3DMJB 2XBPA 3W60A 3K58A 4JI5J 4OYXA 2PO4A 4MU0A 2YNGA 2OAUA 5ELWA 5A2QY 2AQ4A 5CA5A 2HAFA 3G82A 4NX9A 4USIA 3THPA 3Q86A 4U67Q 3M9MB 1VQLS 2Q1LA 2HZCA 3GV7B 4OL8A 3CW2C 2RRAA 5K8OA 2RDDA 4C3KA 4HI2A 1R6LA 3RB3A 4IOBA 1JKHA 2C2EA 1RT4A 2C37B 3Q8YA 4DPUA 3GIIA 2I5JA 4DV1J 1U1NA 2CFXA 2K3KA 2EW9A 4ECXA 3RZAA 3DXBA 3KLHA 4CWBA 4JV2A 2CQDA 4RW8B 1IWAA 4FW9A 4QPTA 4YB7A 3PV8A 3CJ8A 4C0BA 1HNZF 4Q43A 3EPIA 3PNIA 4CLSA 1T7PA 1PJ6A 1C4CA 4NLWA 4UQTA 3LO3A 4QYRA 2E5LE 3BZQA 1KFSA 2XWYA 2M52A 1L3KA 2WSCC 4PABA 2BJ7A 1U1KA 5ETMA 5KFHA 1LEOA 3DN9A 1B63A 4LBIA 5E5NA 5KFUA 2YNGB 2ZBQA 4YR2A 1X4DA 3PKYA 3NL0A 1HHSA 4RUBA 3G82B 3SI8A 2A1BA 1SC3B 1VQ6S 1NB2A 1RKJA 4X4VA 5CCLA 2FY8A 3FZ2A 2CJBA 3DOMA 3BYPA 4YHHE 2IRXA 1JKHB 5JUMA 1RT4B 4ZDNA 1CC7A 4IH6A 1N32J 1FRXA 2C2MB 2I5JB 2W01A 3BF4A 3GLLA 4FKYA 1U45A 5CD4A 1HYSA 5E3RA 3KLHB 2DNMA 4JI3F 5EN1A 3GR1A 3CJ3A 1J5EE 5B0GA 3GPAA 3BJYA 3MD3A 4O3NA 4URSA 4DR7E 4HVZA 3PM9A 1S1XA 5IFMA 4LFCF 3ZZZA 3R3TA 3SSSA 3TVKA 4YQWA 2JWNA 4GKJJ 2MHEA 4ECZA 4AYBD 4ANCA 4EO6A 2V8PA 3JQKA 3W7BA 1TK8A 4URQU 1Y3KA 2RH3A 1N33E 4DR4J 1VC6A 2KXNB 4TKTA 5AE1A 2G0CA 5IM0A 2GFFA 2YKAA 5DRQA 4QIEA 4IUFA 4OO1A 2UVWA 3NY0A 1WDDA 3QO9B 4HDGA 3GQCA 2KT2A 5CCMA 1Z5BA 3DOMB 5FLXC 5D4PA 1AT1B 4ILRA 4U95A 1T9XA 2AF6A 2NN6E 1HNXF 1FXRA 1B4SA 1HYSB 3TEGA 5D77A 2RKIB 3DNCA 5HVHA 2E7XA 5I42A 3KWMA 2MQMA 2KZMA 3OSPA 2X3DA 4LF9I 2UU9F 4LVNP 5A8KA 3CNQP 1HARA 3H4BA 5IWAF 4RW4A 1S1XB 1HW9A 2IM1A 2JEIA 1MMLA 1SI9A 2F9DA 3WX8A 1KWMA 2L9NA 5K8NA 3Q8SB 4OV6A 4AQYJ 3ZKBA 1RDRA 5F3ZA 2MTLA 4Q44A 4ZHRA 3CCMS 3N5FA 5IM0B 3MZIA 3PO5A 2Y1RI 2PNZA 2F4VE 5HBMA 1IR2A 4OO1B 1KHVA 4PWWA 1OIAA 2YQ0A 3HO1A 5D4OA 2EVZA 5AXNA 4M63A 3Q8UA 1CQMA 4L74A 4R25A 3DD6A 4DX8H 5B0DA 2CPFA 3NGKA 2IJNA 4RBUA 3SCJE 5EWFA 1OO0B 5I42B 1NK4A 1YRXA 4Q5VA 3OT9A 4ED1A 4DSIA 2NXEA 2CADA 2PIIA 4WXWA 3G6YA 2KI2A 3I56S 3CIZA 4RW4B 3VGSA 3IM8A 2R8GA 3ITHA 5ETVA 4NA1A 3K5OA 2GO3A 1F60B 1I6JA 1SXLA 1RAIB 2EEYA 5FD1A 3AOAA 2OH2A 2E5LI 2OTLS 4P7TA 3M2VB 2HFVA 1GEHA 4ZHRB 1YJNS 4H4MA 1UVIA 5ETPA 2V8HA 2DCLA 1HNZJ 3RAXA 3MM9A 4Y6IA 2L3MA 2PNZB 1D09B 1R8PA 3IN5A 5HBMB 3C15A 2ZH7A 1XC9A 5KFZA 4J90A 1LKZA 1R6VA 2WBRA 1NRKA 4LFAJ 2MKJA 5IC4B 3M2RB 1PSDA 3PR4A 3W9IA 2P2CB 1S10A 2DVIA 4U96A 4LBPA 4YHHI 2CQ2A 2CKWA 2MKHA 1VOMA 3EPGA 3QGPA 4OZ3A 3KLFB 1VBKA 2EG2A 1JLAA 2ZOMA 1LWEA 4JI3E 1N5TA 3OVBA 4NXNF 1RUSA 4QNJA 4A47A 2UUBJ 3MEEA 4QZVB 1J5EI 2C22A 4NMLA 4XIUA 3TEHB 3VWSA 4LFCE 2BV3A 3ZKDA 3I6PA 1S97A 5K8MA 3OFEA 4KV8A 4A8WA 1KQGB 1S6OA 3S6EA 3Q89A 4DR7I 3ITHB 1NHJA 4O44A 1M1GA 4DU7A 2HRUA 1O0PA 2XMMA 4MU1A 5ETNA 3KMQA 1JJCB 3OFFA 3EE3A 2YKOA 1JNZB 4H4MB 1NHKL 2ZNZA 2GQQA 2Z2YB 3MM9B 1KTQA 2FJXA 1C0TA 1IWGA 4K4YA 3C15B 2A2DA 1P9YA 5EUHA 2AX0A 3ILIA 4I64A 4Q45A 2XB2D 4K5RA 2P9GA 1T03A 4NCAA 1VK8A 1OPIA 2EG1A 4JUZA 1YJUA 2QFIA 3MAHA 4YUDA 1HNXE 3J80Q 3CMES 2RHSB 2XMTA 3PXGa 1LWFA 1JLAB 2M0GB 3O3LA 2HWHA 1UEVA 5ETRA 4A8XA 1JLGA 2KFNA 1OYDA 2F8MA 4F2RA 4C8OA 2UU9E 3IBWA 3MEEB 5CXTA 4WBFA 4IH5A 3M8QA 2XGQA 5IWAE 3MHYA 2AU0A 3B8HA 4BA1A 1NJYA 2Y0BB 4KV8B 4N41A 2EWHA 3LP2B 1A6FA 4O44B 3I9V9 3V4MA 3R5JB 4OLPA 4DLEA 3NWRA 1WTBA 4O4GA 3T1AA 1HLWA 3G8TA 1BY9A 3RB4A 4IR1A 1TL3A 3EMTA 1DURA 2RD5C 5DQHA 4DL7A 4MT1A 5B0AA 1N48A 1P9QC 2KYXA 2RQMA 4Y00A 1C0TB 4KGZB 2RDJA 2V4QA 2C28A 2C3PA 1SKUB 2AZ1A 2HNDB 2F4VI 2AEFA 4DR1E 4OX7A 1T03B 1RAEB 2VD3A 1UFLA 4CM0A 2DGWA 2EKYA 7FD1A 5DM6Q 1I94F 3KTQA 5KT3A 4RNMA 1LWFB 3CD0A 1VLOA 2Z30B 1RWUA 2W24A 1U1MA 1RXOB 1JLGB 2WONB 1YJ7A 1M0SA 1B0VA 4RUHA 3Q1QA 2U1AA 2C42A 3RTVA 3M8QB 2N4CA 3JAMY 4BA1B 1YIJS 1B64A 1HWKA 4D3HA 1M1HA 1XXEA 1HI0P 4DQSA 1RYRA 4IKAA 1DQ9A 4WU2A 3U1LA 3A3OB 4ZLPA 1REVA 2CZVC 3FK4A 2B5JB 4U7UK 1KVIA 3EUNA 1Q5VA 4OI1A 1FJGF 2OPPA 1TL3B 1VIOA 4ZCMA 1LNQA 4PRXA 2E1RA 3TA0A 3BBBA 4ZCKA 4X64J 1TL1A 5JEAF 1HPZA 3P8BB 1HNIA 3ZM7A 1FFWB 2KFZA 2ZHBA 2HK2A 4ZCLA 4ICLA 5THWA 2DR5A 4KO0A 4FYWB 2V67A 4H54A 3EDRB 5H9EK 4B3RF 2CPYA 1NK6A 1RHUB 4QQBA 4V19X 4NXNE 3PX0A 2LJPA 3ULHA 3R1LA 4OYZA 1VQNS 3IO1A 2CVEA 3GV5B 2GA7A 1UEKA 4EBEA 1AFIA 4EYHB 3A8KA 2J7WA 1GQEA 1EHWA 4J91A 1SC4B 4LFCI 1KTVA 1CULA 4WE1A 4JG4A 4HYKA 3JTPA 4OX9J 4E2FB 2DT9A 2W8LA 1RLDA 2OD6A 2O3ZA 1REVB 3TANA 1LWCA 2BBEA 1I3OB 3LP1A 4CNYA 3IWNC 3JB9k 2OPQA 2CPEA 2OPPB 4HR2A 1U1OA 2GMJA 2W4DA 3FCVA 4FP9A 2J6SA 1NLKL 6FDRA 2UUCI 4WTYA 2FVPA 4G1IA 2CDQA 2W2OP 4IG0A 1TL1B 2WTFA 1HPZB 1HNIB 2F65A 5CYMA 5KFRA 3VF0B 5KG4A 4K4UA 4I6YA 1Q16B 2WZ1A 2NN6A 3UDCA 4JYAJ 4ICLB 4PXEA 2M5YA 1AUSL 4TU7A 2GMHA 4KO0B 3OFGA 1KQSR 1PAUB 2VBWA 2HYIB 4I2QA 2UUAF 1HNXI 5F8NA 2JEFA 1F5AA 1K47A 1T02A 1SJ3P 2VODA 5B0CA 2QYGA 3UI3A 3MMBA 3LH2S 3ZTPA 3PYEA 2R7WA 3QBCA 1RHKB 2YPYA 5IWAI 3HMJG 4XK8C 3G6XA 4WE1B 2HIQA 2HIYA 1XIQA 4FZVA 3R5BA 1LWCB 3LP1B 2BOPA 1WG4A 2IM2A 3OHBA 1NCLA 4O0NA 2GW8A 2OPQB 2HS4A 3GCMA 5CAAA 1YRTA 1UDSA 2GJFA 2E9ZA 2CQIA 3OVAA 2G13A 2V4JA 1UVLA 2CQ0A 1QZRA 5CYMB 1YJ9S 2GMLA 5F8MA 4C8NA 2HKEA 2NN6B 4DR5F 4DR1I 2KJVA 1EZZB 6AT1B 1I94E 4J9VA 2MEWA 4YP3A 4K5SA 4I2QB 3MCOA 4ED7A 3US5A 4CZCA 4OZEA 2ASYA 3L3CA 1E3PA 2Y1IA 3IC1A 2F3JA 3MMBB 2R2UA 3M6AA 5DDPC 2AX1A 1S1VA 3CO0P 2KRRA 4ZPCA 3PIOQ 3TJAA 4F4WA 3DLHA 1TL4A 1YZ6A 1P8GA 1FEHA 1RKIA 3TVYA 3N28A 1QAXA 1SL1A 1ITPA 3B78A 3KG1A 2MLXA 2EBGA 4YR3A 5C25B 2J0XA 1RTIA 1FJGE 1YH8A 3PRDA 2VFVA 1HW8A 1R8AA 3M9OB 2OEMA 1EP4A 4DV6F 3DDKA 2V4JB 4NCBA 5JEAE 1D3WA 4FNHA 1V3ZA 2DGTA 3BGOP 4NA2A 3HDSA 2FJBB 3UD3P 2AEMA 2ZH8A 3C66A 2XNQA 3PTWA 3OR2A 2IVMA 5DGBA 3EGZA 5DJBA 1K44A 4B3RE 3AT1B 1ZXMA 2BR2A 4FF3A 2E9TA 3AXKA 4YY3J 1X9WA 3OLBA 2BJDA 1W26A 4QWDA 4DUZJ 3T1YF 1H2UX 4OZNA 1S1VB 4HT5A 4B9SA 3UCGA 3EGVA 2BKPA 2GJIA 3K5MA 1VYAA 4K4ZA 1UA1A 2XG8A 5EL9A 3NKYA 5DDRC 1MLAA 4NWBA 2PGCA 2JL9A 4P7AA 1PO6A 1RTIB 1JLQA 1ZM9A 2HEKA 3ZNUA 2CJ9A 4MIWA 4FNIA 1X31C 2KTQA 2LA6A 1CQNA 4KHPE 2HBQB 3BDPA 1EP4B 2BXJA 3CD5A 4O3OA 2B9YA 1IUJA 1RHJB 3BS9A 5CYJA 3HXMA 3AD8C 1XBWA 5A8RA 4UZCA 2KL8A 2BYCA 3OR2B 3P5TL 1S7IA 2R3VA 1NZ8A 1KONA 1K0VA 3BGUA 4JI6F 1X4BA 4JI0F 2UUAE 3TZWA 3H59A 5ETOA 4PWDA 2BR2B 1SPBP 2VFUA 1WSRA 2MZQA 3CWJA 3BH7B 2RE1A 2RF2A 3FSIA 1RQ0A 5EGYA 3B54A 4MKBA 1NHIA 4H4KC 2HBRB 5D0HA 2UVVA 3C46A 2FLNA 1VQ5S 2C1EB 4DV2F 4UQGA 2B9XA 3J7AN 4U8VA 4O3QA 3E3XA 3GCXP 5L1LA 4Q0BA 4HH1A 4NRUA 1JLQB 4LIWA 3W5ZA 3BSOA 2Y3YA 2B7BB 4CIOA 2VKZG 3O44A 1YLXA 4H4KA 2HSEB 1YJRA 2AV5A 1TELA 3MUTP 1ZA1B 3IBFB 2CWXA 4OO1D 3GU0A 2GO9A 3C8YA 4CYUA 2J65A 2PMHA 5A8RB 4ECRA 4DMZA 1NK7A 1IBKJ 1RK8A 3MGJA 2DCUB 4ZITA 3BEGB 1XR7A 4ECSA 2VOOA 2YKQA 4TU9A 3OFHA 1I94I 1PJ7A 4PWDB 1KOOA 1D9FA 1WG1A 3DXSX 1S79A 3HVTA 3BREA 3M8YA 4DX6A 3CE8A 1NH8A 3PCOB 4NEYA 2RF2B 2EFGA 3CDWA 4Q8EA 2DRBA 5L9XA 5DG9A 3QAUA 5IXUA 2HLUA 2R4FA 4PPDA 4JV0A 3OTDA 4F4AA 3DLBA 3A8JA 1RE1B 4RPFA 2PNLA 1Q8KA 4TXSA 5KFIA 2UXDF 2FLPA 4Q0BB 1HBMA 1SCJB 3QFWA 2XHWA 4RUCA 5I4MA 4YS2A 3N6NA 3PEJA 5KFYA 4DV6E 3Q83A 4ZLNA 2ASLA 1EKRA 2Y9HA 2F8HA 3G8SA 2C3MA 2MZSA 2DH8A 5HMZA 2HGNA 2J6UA 3HCXA 4QW8A 2ZITA 4CNZA 4GKKF 3EICA 3HT0A 2D74B 4CYUB 1L5UA 1NU4A 4PRVA 2PD1A 3OXFA 1YZ7A 2VPZB 1P1TA 1YJVA 1VISA 1KIJA 4DV0I 1F1BB 2V2VA 4OV1A 1XMBA 2GV1A 3N4WA 3GG0A 2OELA 4F04B 5LXYA 3HHLA 2IMWP 4UUXA 3HVTB 2EFVA 2VV5A 4ED3A 3GSDA 4I1TA 1WEYA 2N82B 2CJAA 2GGPA 3DYAA 3T1YE 3MMJA 1Q78A 2DH7A 4N7TA 2QA2A 2JVOA 2DH9A 1YJTA 2KG1A 3BBFA 4CDIA 4OYAA 1I5OB 1NDKA 3I4HX 1T3OA 4I69A 3BGRA 1S6UA 3RBZA 3CDIA 1HBMB 1U1RA 5BYRA 4F4XA 4XO0A 5HMXA 2HQDA 1D9DA 2DGVA 2DRDA 2JLFA 3QATA 4ECQA 1N36F 3CCSS 1FWKA 3D7SB 3H2VE 2JLEA 4DOZA 1FRJA 1SH3A 1B0TA 1U1PA 2V34A 4KHPI 4M5LA 2DHAA 2MKIA 4LF8J 3TX8A 1UFWA 1AXQA 3A13A 1ZZFA 5U47A 4B02A 4DFPA 2AJ4A 5M2RA 4DN0A 1RHYA 1JJHA 4DUYF 3L09A 1IR1A 3CC4S 4JI0E 4KH0B 4WUCA 4OI3A 2E5GA 1PAEX 3HHLB 4P2MA 4K7QA 4KR0B 2FYXA 1ZAXA 1N5QA 3LNUA 2DIVA 2X1GA 2UUAI 4PG6A 2GGPB 3DYAB 4NYPA 2AYEA 4LOMA 4WUDA 2KO1A 2CRLA 3PHTA 1FEEA 3K7RA 4I4BA 4YB1P 2JC0A 5LMUI 1RAHB 5LL6R 3G87A 1QAIA 2K06A 3HVWA 3PDNA 2QEXS 1HBOA 1X0FA 4JI6J 1HWUA 3KLVA 2MKCA 3BGRB 2I38A 4ECTA 2OMOA 4J9UE 2AMCB 1MU2A 3QJLA 4MYUA 4X4UA 3A3NB 4IFDC 4JI7E 4CH1A 4DL2A 5G0RA 4TLRA 2D41A 2Z57B 4DSKA 3BGLA 2BE9B 3HD2A 4DV2J 4DSJA 4ZVTB 2GIRA 3D2WA 2H9ZA 4RWXA 3TUIC 3OBIA 2IVYA 3MR5A 2YKPA 2QFJA 2B43A 2ZHOA 4BC9A 5DROA 1E6YA 3EM1A 4FF1A 3NXZA 1AZSA 3UCUP 4P7VA 3CMAS 1VBZA 3BSCA 5BR8F 2G1DA 5KT6A 2B4VA 3HHNB 2VH7A 2AJFE 1S59A 5KFAA 4CLWA 3RR8A 4KHMA 2MLZA 5DETA 3Q0AA 4M5IA 5ETLA 3HT3A 3L7PA 3B6BA 1MN9A 4GC6A 3A4TA 4F4YA 3G6ES 1SL2A 3QMQA 3TZYA 5E3QA 1S12A 2O1UA 1HBOB 3D4JA 2BKNA 2CA9A 1S72S 4EZ9A 1Z0GA 2OPSA 4WYLA 2B7CB 2YX4A 3GJRB 2Q2EB 1MU2B 1OY9A 2GIFA 4DEZA 4DHVA 3BH6B 4OJGA 4DV5F 5JEAA 2WP8A 1YRUA 5G0RB 3CCLS 3K1JA 1NHUA 1JK9B 4DV6I 3HSGA 2VBXA 4USVA 2FVSA 3DFEA 2FJWA 4W90B 3NAHA 1VHIA 1RWWB 1YBAA 2E29A 2UXDJ 3SZ2A 3T5JA 1WJ9A 3ZZRA 1E6YB 2UUCJ 1AZSB 3P45B 2VG5A 1LFPA 1WC3A 2V9WA 3K8WA 4MDTA 2IRUA 4ECVA 5H9FJ 4R5PA 1DFDA 2ZC4A 4C6AA 3P4UB 5D3GA 1KP6A 1FNMA 4GKKJ 3KKFA 2R7VA 1FF2A 1TP7A 2JJ4D 5K20B 1B3TA 4LF5J 3QT8A 1KS2A 1RT1A 1FRLA 2DK2A 3ZC4A 1FVQA 2OPSB 2AGOA 5KFQA 2B0GA 2Z0GA 1Z59A 1U7LA 1FX2A 3PYFA 2GVDA 3JTNA 4F4KA 2DISA 5JEAB 5FLXY 1DHMA 3AOBA 4C98A 2WP8B 5EHHA 2AP6A 4JI2F 4UOFA 2O5DA 2NZCA 4CQ1A 3J80C 4DV3F 3QWPA 2J8SA 2UV8A 3IGNA 4JI4E 2N7CA 4DUYE 3QSIA 4XDDA 1F9FA 4B08A 4X66F 2G4BA 2O67A 2WHOA 2AJ0A 1N36J 2VQFI 1QAJA 4X4PA 1MW7A 1TFWA 2DEJA 4KPCA 2VJVA 4R5PB 3W2VA 3BKTA 5D3GB 3CJ4A 3KK1A 1JLBA 3UFCX 4M8LA 3FEXB 2R8KA 2DXDA 4ZJQA 1WC5A 4DG1A 1RT1B 4L3NA 3ILJA 2LDIA 3PW0A 2B56A 3J7Z5 3A8IA 4OIXA 1SIZA 5ETQA 2B9EA 2VFRA 2AKWB 2W4PA 3T19A 2XZTB 5AE3A 4EZ6A 2GVDB 1V6HA 2NPIA 1S6PA 3VZIA 2LECA 2MHNA 2EFQA 4TNOA 3VQSA 3TUZC 2HVHA 3LGNA 3BSNA 4JI7I 5FDLA 4RBTA 4ZVQB 1Q86T 4MAKA 3CIMA 3TQ1A 2VICA 5GMEA 4J37A 2PI5A 4A8FA 1ZM3A 4X65J 2EBEA 5J2NA 3Q2SC 1M5HA 2LKZA 5BR8E 1NDCA 4PG5A 1NUEA 4ED5A 4ANDA 3TO8A 3MFHA 2I2YA 2CQ3A 3W2VB 4HI1A 4JV5F 4FXWA 2HS0A 2AYMA 3KK1B 1JLBB 5HP1A 2FIUA 4ALZA 2IIHA 3K85A 3EVWA 2MXYA 4LCFA 2J0QD 4OYWA 1FKPA 3GWCA 4QR0A 1SH2A 1VQ4S 4MYTA 3KLGA 4XPEA 5IT9U 3H2LA 3FEYB 4YMEA 4DV7E 3WQPA 4B3OA 4FVMA 4DCPB 2YXLA 1NSKL 4I2PA 4WPAA 1CLFA 3I82A 2MQ8A 3M7ND 2XTJP 5K36F 1S6PB 1SKWA 1VR6A 1IBLF 1NBEB 3I4PA 3FBBA 2XCAA 4M5NA 1U0HA 3K2YA 3K5LA 3KHRA 5FDLB 2R7QA 3MEDA 2GHPA 3ZNJ1 2MJUA 1L3TA 1Y11A 4LF6E 5AXKA 2FJDB 4F67A 1BD6A 2DNLA 2V63A 4MJKA 3JSYA 5LSRA 2DB1A 2M88A 4CM2A 1XN9A 1L3UA 5J2NB 4LF4E 2AIRB 1CC8A 2K7JA 4DV5J 4PU9A 2V68A 2W8KA 3IS9A 4WWSA 2F4FA 2KG0A 3CCQS 2CWKA 3MAAB 2R9LA 5C24A 2BRLA 5HP1B 2ADCA 1Q8LA 3CULA 3CCWA 1R6YA 2F1DA 3UW1A 1OSCA 1FKPB 4NXMJ 3KLGB 4DQQA 2OTJS 2XULA 3TUPA 4B3OB 2C2DA 4A4JA 2OI2A 1KQKA 1H7XA 1UZDA 1H74A 3P49B 2YNIA 4I2PB 2PEBA 3VVTA 4QOTA 3HHEA 2NUUG 2LCWA 1RT7A 3PRYA 3AOCA 2Q66A 2BA0G 1GTHA 4JI2E 9ATCB 3MEDB 4Y65A 1USVA 4K4WA 4DV3E 4NA3A 3SQOP 1S1UA 3U1MA 3G71S 1NK0A 2VC1A 4X66E 2YBVA 2J8AA 3L7ZA 4JI4I 4LRAA 4ECYA 2I6WA 4DUYI 1ZXNA 2UXCJ 2E5IA 4LPFA 1Z0VA 1UWBA 2RB7A 2QLBB 3NCQA 1EKSA 2FHMA 4LCGA 3H4DA 1U25A 3J7YU 1HNVA 4DR6J 5B08A 5C24B 1NHVA 2OEJA 5EWGA 2DBBA 1QSYA 4LFBE 1YSJA 4PCQA 1F3FA 5E0OA 2V94A 4JI8F 2CQGA 5LT5A 1GNKA 2YNIB 4F0KA 1AW0A 3OTOF 4U7UD 2R2SA 1XMQF 4DWIA 2HPUA 2M7SA 2NZ4A 3T9NA 3R2CJ 3K8VA 2NLWA 5T7LA 4IO1A 4P2SA 1BXNA 2E5JA 2YWKA 2BABA 1S1UB 2QMUB 3M2UA 3LP0A 1WHWA 2KT5A 4P74A 2DR7A 3AY0A 3OW2R 3NWGA 4P10A 2RJZA 1VK3A 2FVQA 3L7ZB 4WYWA 4MFBA 2IYGA 1VS3A 1UWBB 1WD6A 3ZTSA 5F3TA 1F9EB 5A2QU 1Z4UA 4EU0A 1R6MA 5F8IA 3JSBA 3S7RA 3VALA 1S0VA 1HNVB 4JV5E 3M8ZA 4ZKAA 1SH0A 2HHHF 4DV0J 3RBEA 5HSPA 3ZTRA 4FPIA 3IAM9 2ASDA 1FDDA 4R0EA 3VAKA 4DR2I 4LREA 2RUSA 3UD5A 1URNA 4DV7I 4OJ3A 2PE8A 3PY8A 6FD1A 5B0FA 5K36E 2JNJA 1X5PA 1WG5A 2X3GA 1IBLE 3F56A 1EI1A 3TYTA 4B3ME 1PBAA 3D0GE 3PVXA 5T7LB 2ZE2A 1UTAA 5C2GA 3M2UB 3LP0B 1SQGA 4ZS6A 4RUAA 4U7CA 2Z8QA 1WEZA 1BQXA 3IRXA 8RUCA 1U1QA 3NMAA 1OY8A 1N4LA 1NM2A 4LF6I 1JXLA 4ZVOB 5KFWA 4K0KF 3QGHA 2VG6A 3H5UA 2GQ2A 4MFBB 3I5CA 2QLWA 5MAOA 2XY5A 2H51B 3W64A 4KHPJ 3D5MA 1MMNA 4LF4I 2L9DA 2GS8A 1YDLA 2Q43A 3GIMA 4KE5A 4KAIA 3KJVB 3PIPQ 1MU5A 2HQIA 2BM1A 3KK3A 2ZVIA 2YWFA 3RGIA 4WIQA 2H3EB 2VPYB 1S9EA 2GO8A 3DLEB 1EARA 1GXUA 2OJ3A 2I9SA 3RU0A 4X62F 2UVUA 2CG8A 1RT6A 4C3MA 5LMUJ 3MMAA 3TJ8A 2HFUA 4OX6A 5DLGA 1WDTA 4B3SJ 2GNKA 3KUEA 4NYOA 2ZE2B 2XQCA 4E98A 1N0UA 5DDOC 4JI2I 3SDEA 1RAJA 3SYZA 3U02A 1GMWA 3IRXB 5J1NA 2HW3A 3KYLA 2ZH9A 1F2HA 3AJ1A 3D9BA 2VG6B 2MQLA 1RT3A 2D3UA 2EC0A 3GYNA 3HHLD 1VQYA 2QJ3A 1FDAA 2VDHA 5L39A 5A76A 3QZ8A 3D6MB 4ZJOA 2H65B 3TP2A 3KK3B 2Z56B 5DQIA 3CCES 4B3TJ 5DZ7A 2C3OA 1GMUA 1S9EB 4AXJA 2EI5A 4RU9A 4LFBI 4JI8E 4BLGA 2FHOB 1BQNA 1VRUA 4RW6A 1UEUA 2PI4A 1FX4A 3N6MA 3M85G 3OTOE 2QL5B 1H7WA 1RT6B 1XMQE 2D3OR 4RW7A 3MMAB 1FXLA 1FD8A 2QG9B 3KXDA 2V0NA 2IA0A 1TR0A 3HFZB 5HANA 1RTHA 1Y4UA 3BBCA 5HLFA 4TU8A 2K2PA 5F8LA 4ITSA 3SDEB 1RWXB 3VCDA 5DNXA 1PJ5A 1RWNB 2L08A 4JI5F 3K17A 3HVAA 2YNFA 3ELHA 3H8YA 1HWJA 4C8LA 1K73T 1JLCB 1TV6B 3MECA 5IZHA 3KOAA 3R1HA 1XERA 3BR9A 2E1CA 4ERDA 2HHHE 4JV5I 3HP6A 1K8AT 2X1BA 4L3KA 4FW5A 3LGHA 5DG7A 4TVAB 3CD7A 5GVQA 2YY3A 2XM3A 1BQNB 2DTJA 1VRUB 4PR6A 3UR0A 1HBNA 4DV1F 4DPTA 2G0IA 1RREA 3A8EA 3R8YA 5F9NA 2YNHA 3GIKA 1ZETA 1XNRJ 2X1FA 2A3JA 4RW7B 3HSJA 3DDIA 2QRRA 1BWEA 1TMMA 4R8UA 4WFXA 3KJFB 4PG8A 4PZVA 3LWLA 2YWWA 1RTHB 3OV7A 5HLFB 4B3MI 2DR8A 2HFSA 3DGPA 1USUA 2VQEF 1WC1A 5EX0A 3MOJB 3MCNA 1JB0C 3VAMA 1KBRA 4E8UA 3R7NB 4K0KE 4FXDA 3CCUS 3D67A 4C11A 3A1YG 2YNFB 1PILA 3C19A 4QIFA 2LFVA 3MECB 4N8OA 4LF7F 3VAIA 1KVKA 1RTJA 2HQFA 3KNGA 1U48A 1SC1B 3ILLA 4NZ0A 3RRHA 4J9LA 1Y9OA 5HO4A 2P6SA 2HFZA 4DL0C 2M8HA 1TQLA 2ZWPA 5LMNE 1X4AA 5IT0A 4FF2A 2VQFJ 4ZIWA 1V3SA 3DKDA 2CQ1A 1N32F 4ZVRB 2ZUGA 4X62E 1HBNB 2IAJA 2KN4A 3GV8B 4JI1J 4NLVA 2YNHB 3SCIE 3H0PA 4IQXA 2I8EA 5JEAD 1KR4A 3EGNA 3MCSA 2D1CA 1H3DA 4R8UB 1FWPA 3M6WA 1IKWA 1S76D 4KT0C 1RYSA 1AFJA 2IA6A 4USUA 3FMWA 2XMAA 1S6QA 2HHXA 2VF3A 2JH3A 4GKJF 4C11B 1N6QA 2IC3A 2YTCA 4PKDB 2DY9A 1QUPA 4UTGA 3TI0A 2VPXB 1RTJB 4BHQA 4DR4F 1AA1B 1BHNA 3MPYA 4UUWA 2MKSA 3D3BJ 4MKVA 2VOPA 4J9PA 4C8YA 3M9NB 1X60A 5I3QA 3QSYB 3JQJA 3DMJA 2C2ZB 2RS2A 2Q79A 3OSNA 2ZD1A 2RQCA 5FJ4A 1CJUA 2B8PA 4N76A 5DM7Q 2ZFHA 2NQPA 5D0GA 1OJ4A 2IAJB 4JI8I 1TVRB 1D0EA 1Y5IB 4X4RA 3OTOI 1NHHA 1XMQI 5C0XF 3TQEA 1WKLA 1JXVA 2GJ2A 2ZOGA 4ER8A 2C2OB 1T9TA 3PYDA 4AT1B 1S6QB 4L72B 4QU7A 1IBCB 3NNAA 7AT1B 5GMKa 4I7FA 3O1LA 2OFGX 2F8EX 2XLIA 4J9KA 3JYTA 4JI5E 2ZH1A 1N6QB 2RVJA 2IC3B 4N3OA 4DCOB 2VHGA 2GAGC 1U8SA 3M8PB 4RL1A 3OL9A 4G65A 4DDFA 3W9JA 1XMOF 2CPIA 2E44A 2DO0A 2WVFA 4WZMA 4AIMA 2OFHX 2CQ4A 3CJTA 1VQ9S 3IR7B 1VRTA 5ITHA 1HR0J 3QRRA 2HHHI 4KJIA 4ZPBA 2JEGA 2DNQA 1Q1KA 2ZBCA 1YKWA 2E7WA 2ZD1B 1CJUB 4WKRA 3T6BA 2HZAA 5K36A 2VB6A 4DV1E 3J7AM 2KU7A 1S0OA 1JX4A 1WC4A 1YGYA 2XCPA 3JAMU 3V6JA 3LUYA 3VGTA 2J0WA 3ISND 3ADAC 3HLUA 3HK2A 2FD2A 4DSEA 1R0CB 4DQRA 1Y60A 2RSQA 4EMDA 3FSXA 5KFKA 1H2TZ 2D3O1 4GVLA 3H98A 3ZZPA 2MLYA 4EGLA 1GXTA 4I7FB 4F8RA 4ED0A 2PMWA 1FKAE 3JYTB 1Z5CA 4TLQA 1LOUA 3D68A 4PYDA 4K0KI 2BJEA 1SKRA 1JXEA 3WDOA 2P9EA 1NZ0A 5C7PA 2MKKA 1FTCA 5A6PA 4DR3J 4OX8A 4QYZK 4C3LA 5HMWA 2VQEJ 1VRTB 2ZJPQ 2IMOA 1SJQA 2BKOA 3M1VA 2BM0A 4LFAF 1R31A 1ZPVA 4B9LA 1MWYA 2HNYA 4U3DA 5LMNI 1N32E 3P5BP 5K36B 1PYTA 3DM2A 4U6PA 2PN6A 1X8DA 4QWBA 5HJXA 5KFLA 3CCJS 1S16A 4LF7J 1U49A 1P1LA 4X62I 1NAQA 4NBQA 4WIIA 1RJJA 4GO5X 3PR5B 3GONA 1Z0BA 2UUBF 4CLPA 3VAFA 2FQQB 1VBYA 3QO9A 1IBMJ 1KLMA 3ZO7A 2NCKL 3CD6S 3VGUA 2HS3A 1D1UA 4Q7AA 2LU2A
chains in the Genus database with same CATH topology
4X64I 4AQYI 1HNXI 3QT6A 2V2QA 4GKJE 4B3MI 3Q6NA 2HFSA 4Z7YA 1USUA 1K47A 4NXMI 4YHHI 1Z59A 2CZ9A 3PYFA 3JAMC 4RPFA 2PNLA 4K0KE 4DR4E 1Y6ZA 4JI3E 3PYEA 4HACA 4YY3E 5LMUE 1ZM2A 4DPUA 5IWAI 1N34I 1PVGA 4DV1I 2O1VA 3J7AG 4DUZE 4HXZA 1J5EI 1KVKA 4B3SE 4LFCE 2BV3A 3J80C 3ZKDA 4DV6E 4JI6E 4DU8A 4IZJB 4DR7I 1NHJA 4FW9A 4FWHA 4DV4E 4JI4E 4FWDA 1PIEA 4DU7A 4DUYE 4M1KA 2ZITA 1B62A 4DR3I 4JV5E 5LMNE 2IOPA 4PRVA 2VQEI 2VQFI 1XNQI 2Z5BA 2DEJA 4OX9I 1VISA 1KIJA 4DV0I 4X62E 1HK7A 1ELOA 1QZRA 4ZVIA 2V2VA 1H7SA 2E5LE 2UXCI 1HR0E 2UXDI 2HKEA 4NXNI 1MG7A 4DV2E 4DR2I 2UXBE 3JAMQ 4DV5E 4DR1I 2A2CA 4DPYA 1B63A 4URLA 1I94E 2A2DA 4DR6I 4FWGA 4LF7I 2Z5CA 3T1YE 4DV7I 3P06A 4B3TE 2HKJA 1IBKI 4DV3I 4USMA 1IBLE 4X64E 4AQYE 1HNXE 4JI5I 3J80Q 1EI1A 1HNZI 4B3ME 4GKKI 1H7UA 4X66I 2HK3A 4HYMA 1XNRI 1IBMI 3M6AA 4JYAI 4NXME 2VF3A 4XTJA 4YHHE 2PNMA 5GMDA 3H4LA 3WU5A 4LF5I 3Q6MA 4LFAI 2UU9E 4UTGA 3ZZ0A 4LF6I 4JI7I 3B78A 5FWKA 1N34E 5IWAE 3B8HA 1FWKA 4DR5I 1J5EE 1A6FA 1S4EA 2V34A 3CWVA 4KHPI 4LF4I 1FJGE 5GMEA 3B82A 2GS8A 2IOQA 1ZM3A 4DR7E 3QT5A 1KKHA 1D6TA 1U2RA 1PKPA 2UUBI 2AJ4A 3HULA 1MU5A 4DR3E 2Z5BB 2BM1A 5BR8E 4DXLA 2VQEE 1XNQE 1OJ4A 4JI0E 4JI8I 1Z5AA 4WUCA 4OX9E 1ZM4A 3ZZTA 4DPXA 3LNUA 2V8PA 4KQVA 2UXCE 3K85A 2X36A 3OTOI 1N0VC 2UUAI 2DEIA 1NHHA 1XMQI 3WU3A 3T1HI 2UXDE 3F0NA 2Z5CB 4WUDA 2F4VI 1N33E 4MYTA 5A2QC 2J7KA 4DR1E 1N36I 4JI3I 4B3RE 2UUCE 4DR6E 1ZXMA 4LF7E 1XHKA 2GQ0A 2ZBKB 1Z0EA 4DV7E 5LMUI 3PYDA 4R1FA 5LL6R 1IBKE 1FI4A 5L3JA 2HFUA 4JI1I 1Z0WA 2V2ZA 3LTOA 1Z5BA 3LPSA 4JI5E 1N0UA 5FLXC 1HNZE 4GKKE 4JI2I 1XNRE 4N3OA 1IBME 4JYAE 1HNWI 2NPFA 3Q1QA 1RR9A 3HJCA 1H73A 4MYUA 4LF5E 3V2UC 4P7AA 4LFAE 4WUBA 4IZJD 4Z7CA 4LF6E 4JI7E 4LF9I 1ZM9A 4DR5E 4HY1A 2HHHI 4ED4A 4HACB 4UT4A 4KHPE 1BKNA 4LF4E 1N32I 3PYGA 4PU9A 5A2QQ 3T1YI 4DV1E 2UUBE 3J7AM 2ZM6I 1IBLI 4P52A 2E1RA 2R42A 4PRXA 2O1TA 1EA6A 1Z0CA 3J81C 4LFBI 4LF8I 4JI8E 3ZKBA 4X65I 3ZM7A 5FLXQ 2R3VA 2O1WA 1Y4SA 2WW4A 3OTOE 4IZKA 1XMOI 2UUAE 1XMQE 3T1HE 2X7IA 2HK2A 3WU4A 2F4VE 4EMDA 1N36E 1H72C 2OI2A 2VQFE 2UU9I 4GKJI 3WU6A 4DV0E 1H74A 1FKAE 2O1UA 1Z0TA 1Z5CA 4JI1E 1NHIA 1Y4UA 2CG9A 3D4JA 1MX0A 4NXNE 4DR2E 1Z0GA 1FJGI 2LJPA 2Z5EA 4K0KI 3PRYA 4DR4I 2Q2EB 4JI2E 1NZ0A 4YY3I 1UEKA 1HNWE 3K17A 1USVA 4DV3E 4I3HA 5IT9C 2CGEA 4DUZI 5BR8I 4B3SI 4LFCI 3K1JA 2XEXA 1KTVA 4DV6I 4JI6I 4JI0I 4FN5A 3J81Q 4JG4A 4X66E 2BM0A 1FWLA 1DARA 4LF9E 4DV4I 4JI4I 4DUYI 1ZXNA 4USKA 3ZZUA 1Z0VA 4IZJA 2HHHE 4JV5I 5LMNI 1N32E 1N33I 4B3RI 2UUCI 3QT7A 1S16A 4X62I 2E5LI 2ZM6E 1WUUA 1HR0I 3GONA 1Z0BA 4DPTA 4DV2I 2UXBI 1RREA 4DV5I 4LFBE 4LF8E 4IZKB 1FNMA 4X65E 1I94I 4B3TI 1XMOE 3V5RA 3QT8A 5IT9Q 2EFGA 4DPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 I;  4AQY I;  1HNX I;  3QT6 A;  2V2Q A;  4GKJ E;  4B3M I;  2HFS A;  4Z7Y A;  1K47 A;  4NXM I;  4YHH I;  1Z59 A;  2CZ9 A;  3PYF A;  3JAM C;  4RPF A;  4K0K E;  4DR4 E;  4JI3 E;  3PYE A;  4HAC A;  4YY3 E;  5LMU E;  1ZM2 A;  4DPU A;  5IWA I;  1N34 I;  1PVG A;  4DV1 I;  3J7A G;  4DUZ E;  4HXZ A;  1J5E I;  1KVK A;  4B3S E;  4LFC E;  2BV3 A;  3J80 C;  3ZKD A;  4DV6 E;  4JI6 E;  4DU8 A;  4DR7 I;  1NHJ A;  4FW9 A;  4FWH A;  4DV4 E;  4JI4 E;  4FWD A;  1PIE A;  4DU7 A;  4DUY E;  4M1K A;  2ZIT A;  1B62 A;  4DR3 I;  4JV5 E;  5LMN E;  4PRV A;  2VQE I;  2VQF I;  1XNQ I;  2DEJ A;  4OX9 I;  1VIS A;  1KIJ A;  4DV0 I;  4X62 E;  1ELO A;  1QZR A;  4ZVI A;  2V2V A;  1H7S A;  2E5L E;  2UXC I;  1HR0 E;  2UXD I;  2HKE A;  4NXN I;  1MG7 A;  4DV2 E;  4DR2 I;  2UXB E;  3JAM Q;  4DV5 E;  4DR1 I;  2A2C A;  4DPY A;  1B63 A;  4URL A;  1I94 E;  2A2D A;  4DR6 I;  4FWG A;  4LF7 I;  3T1Y E;  4DV7 I;  4B3T E;  2HKJ A;  1IBK I;  4DV3 I;  4USM A;  1IBL E;  4X64 E;  4AQY E;  1HNX E;  4JI5 I;  3J80 Q;  1EI1 A;  1HNZ I;  4B3M E;  4GKK I;  1H7U A;  4X66 I;  2HK3 A;  4HYM A;  1XNR I;  1IBM I;  3M6A A;  4JYA I;  4NXM E;  2VF3 A;  4XTJ A;  4YHH E;  5GMD A;  3H4L A;  3WU5 A;  4LF5 I;  4LFA I;  2UU9 E;  4UTG A;  3ZZ0 A;  4LF6 I;  4JI7 I;  3B78 A;  1N34 E;  5IWA E;  3B8H A;  1FWK A;  4DR5 I;  1J5E E;  1A6F A;  1S4E A;  2V34 A;  3CWV A;  4KHP I;  4LF4 I;  1FJG E;  5GME A;  3B82 A;  2GS8 A;  1ZM3 A;  4DR7 E;  3QT5 A;  1KKH A;  1D6T A;  1U2R A;  1PKP A;  2UUB I;  2AJ4 A;  3HUL A;  1MU5 A;  4DR3 E;  2BM1 A;  5BR8 E;  4DXL A;  2VQE E;  1XNQ E;  1OJ4 A;  4JI0 E;  4JI8 I;  1Z5A A;  4WUC A;  4OX9 E;  1ZM4 A;  3ZZT A;  4DPX A;  3LNU A;  2V8P A;  4KQV A;  2UXC E;  2X36 A;  3OTO I;  1N0V C;  2UUA I;  2DEI A;  1NHH A;  1XMQ I;  3WU3 A;  3T1H I;  2UXD E;  3F0N A;  4WUD A;  2F4V I;  1N33 E;  4MYT A;  5A2Q C;  2J7K A;  4DR1 E;  1N36 I;  4JI3 I;  4B3R E;  2UUC E;  4DR6 E;  1ZXM A;  4LF7 E;  1XHK A;  2ZBK B;  1Z0E A;  4DV7 E;  5LMU I;  3PYD A;  4R1F A;  5LL6 R;  1IBK E;  1FI4 A;  5L3J A;  2HFU A;  4JI1 I;  1Z0W A;  2V2Z A;  3LTO A;  1Z5B A;  3LPS A;  4JI5 E;  1N0U A;  5FLX C;  1HNZ E;  4GKK E;  4JI2 I;  1XNR E;  1IBM E;  4JYA E;  1HNW I;  2NPF A;  3Q1Q A;  1RR9 A;  1H73 A;  4MYU A;  4LF5 E;  3V2U C;  4P7A A;  4LFA E;  4WUB A;  4Z7C A;  4LF6 E;  4JI7 E;  4LF9 I;  1ZM9 A;  4DR5 E;  4HY1 A;  2HHH I;  4ED4 A;  4HAC B;  4UT4 A;  4KHP E;  1BKN A;  4LF4 E;  1N32 I;  3PYG A;  4PU9 A;  5A2Q Q;  3T1Y I;  4DV1 E;  2UUB E;  3J7A M;  2ZM6 I;  1IBL I;  4P52 A;  2E1R A;  2R42 A;  4PRX A;  1EA6 A;  1Z0C A;  3J81 C;  4LFB I;  4LF8 I;  4JI8 E;  3ZKB A;  4X65 I;  3ZM7 A;  5FLX Q;  2R3V A;  2WW4 A;  3OTO E;  1XMO I;  2UUA E;  1XMQ E;  3T1H E;  2X7I A;  2HK2 A;  3WU4 A;  2F4V E;  4EMD A;  1N36 E;  1H72 C;  2OI2 A;  2VQF E;  2UU9 I;  4GKJ I;  3WU6 A;  4DV0 E;  1H74 A;  1FKA E;  1Z0T A;  1Z5C A;  4JI1 E;  1NHI A;  3D4J A;  1MX0 A;  4NXN E;  4DR2 E;  1Z0G A;  1FJG I;  2LJP A;  4K0K I;  4DR4 I;  2Q2E B;  4JI2 E;  1NZ0 A;  4YY3 I;  1UEK A;  1HNW E;  3K17 A;  4DV3 E;  4I3H A;  5IT9 C;  4DUZ I;  5BR8 I;  4B3S I;  4LFC I;  3K1J A;  2XEX A;  1KTV A;  4DV6 I;  4JI6 I;  4JI0 I;  4FN5 A;  3J81 Q;  4JG4 A;  4X66 E;  2BM0 A;  1FWL A;  1DAR A;  4LF9 E;  4DV4 I;  4JI4 I;  4DUY I;  1ZXN A;  4USK A;  3ZZU A;  1Z0V A;  2HHH E;  4JV5 I;  5LMN I;  1N32 E;  1N33 I;  4B3R I;  2UUC I;  3QT7 A;  1S16 A;  4X62 I;  2E5L I;  2ZM6 E;  1WUU A;  1HR0 I;  3GON A;  1Z0B A;  4DPT A;  4DV2 I;  2UXB I;  1RRE A;  4DV5 I;  4LFB E;  4LF8 E;  1FNM A;  4X65 E;  1I94 I;  4B3T I;  1XMO E;  3V5R A;  3QT8 A;  5IT9 Q;  2EFG A;  4DPW A; 
#chains in the Genus database with same CATH topology
 1KNZ A;  4GKJ E;  2RKI A;  2FTR A;  3W1Y C;  1TZ0 A;  3CCZ A;  4OMF G;  3JSM A;  2CNO B;  2GAH C;  1FFG B;  2QE5 A;  2XYP B;  4HHH A;  3KHG A;  1W2B R;  4F2S A;  3CDU A;  3T9Z A;  4DR4 E;  2GQC A;  5F9L A;  1N5Y A;  1WI6 A;  4ZA1 A;  4TY8 B;  1HQE A;  1X4F A;  1LXJ A;  2DGX A;  3FJ2 A;  2IFX A;  3WC2 A;  3IXQ A;  4OO1 C;  3M1V B;  4EWT A;  2JDJ A;  1ZPW X;  2QA1 A;  4ETX A;  2HNY B;  2YH1 A;  2GCF A;  2BEF A;  5K8P A;  1Q8B A;  3DM2 B;  2QA4 G;  1U09 A;  4Z37 A;  2HQ3 A;  3T1H J;  3U1Y A;  1EJ7 L;  2KXH A;  3IAS 9;  1CJT A;  3C6T A;  3ETM A;  1SV5 A;  4GVB A;  5C0X E;  4ED6 A;  4OYB A;  2QMW A;  5RUB A;  2FC8 A;  4OZ0 A;  4DR2 J;  4BDP A;  3H7H B;  1LXN A;  1KLM B;  2ASJ A;  4FWG A;  4WJB A;  3SBM A;  4DV7 J;  4MIB A;  1FDB A;  4J9M A;  1VQP S;  2W4C A;  2HKJ A;  2L9W A;  2POK A;  3W3S A;  4USM A;  3GZ7 A;  4AQY E;  4JI5 I;  1XEZ A;  2WVE A;  4F50 A;  3JSM B;  1Q8I A;  4OI4 A;  4HYM A;  2BQR A;  4XTJ A;  3EZU A;  2V50 A;  1SVD A;  1N5Y B;  1R7I A;  1HQE B;  4NLQ A;  4EYI B;  1WWH A;  1TKD A;  3FKB A;  4MU3 A;  2WSF C;  3TWZ A;  2VAS A;  4LF4 J;  3T5H A;  3B82 A;  2RS8 A;  1RTD A;  2HVZ A;  3M2V A;  3H90 A;  2YKM A;  4NCG A;  2VBZ A;  3EXC X;  1M5V C;  1V3R A;  1XMO J;  3SCL E;  3AQO A;  1CJT B;  1SB6 A;  3C6T B;  4FS1 A;  1SV5 B;  4GVB B;  2MZ1 A;  5K14 A;  2V8G A;  1KLN A;  3J7Z T;  3GB0 A;  3NBP A;  3M30 A;  1NH7 A;  3M2R A;  4AL5 A;  3PX6 A;  4H4O A;  2ALY B;  1YK9 A;  2J7K A;  3KLF A;  2GQ0 A;  2NR0 A;  3D0H E;  1OY6 A;  3PW4 A;  2ZM6 F;  2HBY B;  1HNZ E;  2HHP A;  1R3N A;  4MH8 A;  1OYR A;  3MR3 A;  4DV4 J;  4DI6 A;  4X64 F;  1RAC B;  2WK4 A;  2HWT A;  4ATN A;  3W63 A;  4LR8 A;  3V2U C;  1FHT A;  4LFA E;  4C48 A;  3I5B A;  3OTE A;  4ZPA A;  2FJA B;  1AYE A;  4AL6 A;  1LW0 A;  3ZZO A;  1RTD B;  2XMK A;  2DHG A;  4URG A;  2SXL A;  4LRC A;  4ED4 A;  2W9A A;  2YKM B;  3CCT A;  3M4X A;  4KC5 A;  1T8E A;  1N32 I;  4NCG B;  4FYX B;  2UXB J;  1WOP A;  5SZT A;  1OWX A;  3J80 Y;  1TAQ A;  4K4S A;  3N01 A;  4OI0 A;  4ZMM A;  4NLR A;  4QCL A;  5K14 B;  3AA9 A;  5BYS A;  2UUB E;  5KFJ A;  5J2Q A;  4YFU A;  3W9H A;  2R42 A;  2O1T A;  5GAD U;  3X1L B;  2RIL A;  1Z0C A;  4LRF A;  4A8O A;  1KC8 T;  3R5A A;  3NBP B;  3M30 B;  3NP5 A;  2W2N P;  1LV5 A;  2FY1 A;  1RAA B;  1PYS B;  4F02 A;  3QGI A;  4H4O B;  2ZH3 A;  3B4M A;  1PBU A;  1VQ8 S;  3LW5 C;  4PRF A;  3IFE A;  4Z2X A;  1P6T A;  4OX9 F;  3W5X A;  5L1J A;  4GKJ I;  2KM8 B;  3IBC B;  3MF5 A;  2K3I A;  1N34 J;  5GAD I;  3RBD A;  2BA1 G;  2CG9 A;  3UN2 A;  4IOC Q;  1FVS A;  4ZK7 M;  4QNK A;  4Y2K A;  1Y00 A;  4DR4 I;  3HKZ D;  4KRW A;  2BMB A;  2K1R A;  1RAO A;  3LP2 A;  2AJ2 A;  2JRS A;  1RTZ A;  1DJ0 A;  4I3H A;  4P75 A;  1GTE A;  3BPD A;  3LOU A;  1M90 T;  4JYA F;  1A7G E;  2B4O A;  3LAN A;  1LW0 B;  3Q8Q B;  4PUO A;  1XNQ J;  2I0X A;  3H5X A;  1FWL A;  1WKJ A;  4UY8 5;  4JP8 A;  2J9E A;  1H6K X;  1QDU B;  2BRK A;  3NLC A;  1N33 I;  5H1S V;  3UWT A;  2GHW A;  5KOW A;  2FZK B;  2UUW A;  5J2Q B;  4NPO A;  2XLK A;  1XR6 A;  2HND A;  2O1P A;  1GFW B;  5HQM A;  1WHX A;  3CJR A;  1B7Y B;  1GMW D;  1YVF A;  2LQ5 A;  2VES A;  1Q95 G;  2G2O A;  3V6K A;  1HHT P;  1FTR A;  4AXI A;  4YOE A;  3MD1 A;  5IOL A;  3OTB A;  1QAY A;  4YB6 A;  2DHH A;  2W2P P;  4CO2 A;  2CAJ A;  4OZ2 A;  3OL8 A;  2WON A;  1KSP A;  5HAT A;  2KDO A;  2XI2 A;  3N79 A;  2J9D E;  4AQY I;  3AOD A;  5GAE U;  1Q81 T;  2YVS A;  4B3M J;  2HFO A;  4X4O A;  2XZW A;  4K4X A;  3CJS A;  5HMY A;  2K1R B;  5F41 A;  1Q7Y T;  3G2X A;  4FDF A;  1BQM A;  2NXN A;  1Y6Z A;  3ZTQ A;  2UV8 G;  3HZG A;  1PVG A;  2B5J A;  4PUO B;  2HHT A;  3FC9 A;  5GAE I;  1JJ2 R;  3FRY A;  2QV6 A;  4LMZ A;  1RHR B;  5DNL A;  1FRM A;  5G4D A;  5ETS A;  1PIE A;  1WF2 A;  1B62 A;  3PO4 A;  1S99 A;  3V81 A;  2IOP A;  4PQU B;  3HD1 A;  1VGY A;  2CQB A;  3BB5 A;  3I9Z A;  3HHD A;  4FBU A;  2J9C A;  3IWL A;  4ZVI A;  3QJP A;  4IOA Q;  4YR0 A;  3IRW P;  4M5G A;  2WVC A;  3MDF A;  1MG7 A;  1XJW B;  4AL7 A;  1K1Q A;  2BDP A;  5KFM A;  1FDN A;  3EGW B;  5D15 A;  1HNW J;  1ARO P;  4DZ6 A;  2BJ3 A;  1HMV A;  3N0V A;  5KOX A;  4MK7 A;  4X64 E;  2R2T A;  1N54 B;  2XHC A;  1HNZ I;  4HTJ A;  1H7U A;  2HK3 A;  1BQM B;  4MIA A;  2HVE A;  3P3C A;  2R7U A;  1ZAV A;  2N7Y A;  2VL1 A;  3QFH A;  3HJF A;  4ETZ A;  2JEB A;  1V5I B;  4LFA I;  2Q3P A;  1X9S A;  4YDX A;  2RUG A;  3POT A;  3BQ0 A;  4IFY A;  5FII A;  3PZP A;  2ZM6 J;  4QIW D;  4KIA A;  5AXL A;  2IY5 B;  1HL6 A;  4YY3 F;  3CMQ A;  1S4E A;  4ZVH A;  4DUZ F;  3MWB A;  2MQN A;  3QT5 A;  3V81 B;  1LK5 A;  2N3O A;  3RBX A;  2UUB I;  4M94 A;  2A18 A;  3G6V A;  4DXL A;  2QGF B;  4YEA A;  4OX9 E;  2KJW A;  4OZJ A;  3L9Z A;  4KQV A;  4ZVU B;  1DBD A;  2X36 A;  3HZE A;  3CC7 S;  3EZO A;  4JI3 I;  5T14 A;  2RRN A;  1HMV B;  4K4T A;  2DR6 A;  3S01 A;  4A8Q A;  5L3J A;  3AB2 B;  4Y0F A;  4C2M A;  4NL5 A;  4RNH A;  2MZT A;  5D78 A;  4P2F A;  4BA2 B;  1UW4 A;  4JYA E;  1Y10 A;  2W7O A;  2JEB B;  2NN6 C;  1XR5 A;  4CT8 A;  3HJC A;  2W1B A;  2ATL A;  3OLA A;  3POT B;  5IV4 A;  4IFY B;  5C0X A;  4B17 A;  4P72 A;  4HH0 A;  4W4M A;  4HAC B;  3CB4 A;  4KGK A;  2DIT A;  4QWC A;  3GFY A;  4RWW A;  3FEZ A;  3D28 A;  2XO6 A;  4WK3 A;  3NGD A;  4CH7 A;  1KN6 A;  3UNY A;  2ZBI A;  2DRA A;  1Y5L B;  2ZDP A;  1RAG B;  3PEH A;  1CG2 A;  3ONQ A;  2XS2 A;  3T5K A;  2NSB A;  1T11 A;  4ECU A;  4KY3 A;  2O1W A;  1YHQ S;  1RLC L;  5KG1 A;  2X7I A;  1M5P C;  3MXH P;  3WU4 A;  2QLX A;  4ZVG A;  2AJ1 A;  2UU9 I;  1NK9 A;  1J5O A;  4KGM A;  1SC6 A;  1ZAW A;  5KG7 A;  5I3P A;  4G6V B;  2ZOF A;  2E5L F;  1IBK F;  2BE2 A;  5C25 A;  1VJQ A;  4MQY A;  4UOG A;  3DHW C;  4IR9 A;  4PG4 A;  2D7S A;  1A6L A;  4WFN Q;  1X5T A;  5C0X B;  1WNE A;  2DO4 A;  4WTO B;  1FFS B;  1HKA A;  2CJY B;  2XEX A;  3SIP B;  5L8R C;  4DPO A;  4FN5 A;  3J81 Q;  1VIX A;  1PCA A;  1PC4 A;  5HQ8 A;  2M3D A;  1JIH A;  1BE4 A;  4UOC A;  1WSV A;  1NDL A;  3DRY A;  5CZX A;  5JVH Q;  4M5J A;  1S9F A;  3GIJ A;  3H20 A;  1HA1 A;  4TYB A;  5ETT A;  2AYB A;  1WHY A;  1T9U A;  3TZX A;  2V2K A;  4OYI A;  4BWM A;  1VHF A;  1J5O B;  5IT9 Q;  4X64 I;  3AHP A;  4P6Q A;  4C9D A;  4RO0 A;  3R5D A;  3I31 A;  4Z7Y A;  2RRB A;  2HFN A;  2BE2 B;  2DHS A;  1MNE A;  5K36 D;  2E5H A;  4GRS A;  5T41 A;  2LQ9 A;  4BC7 A;  3VAJ A;  4YY3 E;  5EX3 A;  4K8R A;  4DUZ E;  1NSQ A;  2MPU A;  1OPZ A;  4LRB A;  2C3Y A;  1IVZ A;  3U7J A;  1WF1 A;  3N5B A;  1TUW A;  2NN6 F;  3GLJ A;  3T5L A;  4OX9 I;  3R5C A;  2HNZ A;  5HJY A;  1FCA A;  1XQI A;  3EZ5 A;  5FLX U;  2CPZ A;  3DOL A;  2BW2 A;  3H25 A;  4NXN I;  2D3Z A;  2HLT A;  4URL A;  3T3F A;  4NMX A;  4LF8 F;  3TJ9 A;  4JOU A;  4KFB A;  2R8J A;  2BZ2 A;  2EKN A;  2IPO B;  1IKX A;  1UDN A;  2P6T A;  4JYA I;  4LF9 J;  2DJW A;  2COL A;  5GMD A;  2PA8 D;  3GIR A;  3S8S A;  3G9C A;  5HQL A;  2OEK A;  4B9U A;  2XS7 A;  4FPR A;  5B7W A;  2F4V F;  4ILM A;  5HRO A;  4F3Q A;  3QLH B;  1S57 A;  1ZS6 A;  4F36 A;  3PKM A;  3MM5 A;  1Q7L B;  2JEA A;  1CVJ A;  4IG3 A;  3M6U A;  3JTO A;  3QQC D;  2C2K B;  2CUY A;  3CUN A;  1U4B A;  1S1W A;  1CS4 A;  1UMJ A;  4OFZ A;  2HNZ B;  2J9D A;  1U0S A;  2XC9 A;  3DOL B;  1ZM4 A;  4CLK A;  2AD9 A;  4ZN3 A;  4BWJ A;  1BGX T;  4K50 A;  3HX9 A;  1FNX H;  4I0W A;  3PS2 A;  3F0N A;  3G86 A;  5MLC V;  5LOQ A;  2V8D A;  2MY7 A;  3DGV A;  2XYG B;  4BCA A;  2R8H A;  4F3O A;  2XY7 A;  3MR6 A;  4KGV B;  3H40 A;  1WKK A;  4KFB B;  4NYZ A;  3U1N A;  5L1K A;  1WEL A;  5AJ3 J;  3LAK A;  1IBK E;  4W98 A;  4P73 A;  1IKX B;  3OJS A;  4LUB A;  5C42 A;  2G9O A;  2NXU A;  3KNA A;  5KAK A;  1Q79 A;  3UNG C;  1CJK A;  2DNH A;  4RNN A;  4HHU A;  4ZIV A;  5HRO B;  1FJE B;  2MY8 A;  4WUB A;  4CLY A;  3MM5 B;  4ANE A;  3CXC R;  2JEA B;  2ROP A;  2ZKT A;  2EK1 A;  5AXM A;  3J81 j;  2QL9 B;  2QYC A;  2E5L J;  2VON A;  4DR5 E;  4IG3 B;  1TKZ A;  4HY1 A;  3CF5 Q;  2HHS A;  2HUR A;  4KSE B;  1BKN A;  2B9W A;  3ENQ A;  1S1W B;  4FKX A;  2AWZ A;  4S0M A;  2BAN A;  5A2Q Q;  1CS4 B;  4ZCI A;  3MUM P;  3NS6 A;  2D9P A;  2RHQ B;  1YJW S;  4N56 A;  3G96 A;  2KRB A;  1HD0 A;  2RAQ A;  1VI7 A;  2FVC A;  2ZH6 A;  4J5O A;  3PS3 A;  1R89 A;  3QID A;  2HHQ A;  3GYX B;  2IM0 A;  3A3P B;  3NGT A;  1IR0 A;  2OGU A;  3NOC A;  4YHH J;  4USW A;  4LF1 A;  1GAO A;  2HG4 A;  1H72 C;  2WCX A;  2E66 A;  3W8G A;  2DXF A;  2APO A;  5C42 B;  3NNC A;  3D6T B;  1ZZN A;  4A46 A;  5I3U A;  2UUC F;  1UFK A;  1UAW A;  2LXF A;  1IJE B;  1MX0 A;  1J5E J;  1Y7P A;  5LJ5 Y;  4LR7 A;  1FJG I;  3HHL C;  3TAP A;  2G0J A;  2CIM A;  1CJK B;  2V69 A;  4DR7 J;  5AT1 B;  1RZM A;  4YY3 I;  3GJS B;  2QA4 S;  5F8H A;  4DUZ I;  3FBC A;  4OHZ A;  4Q8F A;  2A6O A;  5KG6 A;  1PG5 B;  4O23 A;  1TKZ B;  4LF5 F;  3KG0 A;  2G2Z A;  2ACM A;  2PMZ D;  4KH1 B;  3THT A;  2BAN B;  1L3V A;  1JWW A;  3Q23 A;  1PGZ A;  1N33 J;  1PC5 A;  3RB0 A;  4B3R I;  4D3G A;  4LR9 A;  1SL0 A;  1VQS A;  4FW6 A;  5KT4 A;  1QTN B;  5HVG A;  4ILL A;  3U27 A;  4EBD A;  1IQZ A;  1SJR A;  2GVZ A;  3BO4 A;  3IMQ J;  2Y1J A;  4OI2 A;  3GFH A;  3LGM A;  2LP4 A;  2D9O A;  2JEJ A;  1EAY C;  4LF8 E;  2K8G A;  3QNW B;  3TA1 A;  4