2WW4A

A triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Triclinic Crystal Form of Escherichia Coli 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase and Reassessment of the Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 4-DIPHOSPHOCYTIDYL-2C-METHYL-D-ERYTHRITOL KINASE
total genus 90
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 2ww4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2ww4A01
4DV0I 4DR3I 1Z0BA 4WUDA 2UU9I 4LFCE 3PYGA 4DV6I 4DPYA 1MG7A 4X64E 1FWLA 1EI1A 1Z0CA 1N33E 3WU6A 1U2RA 3JAMC 4DV3I 4URLA 2UUAI 4B3RI 1FNMA 4PRXA 1PVGA 4DR7E 2V34A 1ZXMA 2Q2EB 1IBMI 3OTOE 2J7KA 1Z0WA 1HR0E 4HACA 1S16A 4LF7E 4DR1E 2HK3A 4NXNE 4LF6I 4ED4A 1KIJA 4DV5I 2GS8A 4JI3I 3PYEA 3V2UC 4JI8I 5LMNE 4GKJE 1HNXI 4XTJA 1ELOA 4FWHA 4WUBA 4WUCA 1ZM2A 4LFAI 1I94E 1NHHA 2HKJA 1XMOE 2VQEE 2F4VE 2V8PA 1KVKA 4JI6E 5IWAI 3QT8A 4JI2I 2DEIA 4KQVA 1Z5BA 1J5EI 1H74A 2A2DA 3J80Q 5BR8I 1N32E 4JI6I 2HKEA 1XMQI 3LNUA 4K0KI 1FWKA 4JI4I 4YHHE 4DR2I 4HYMA 2V2VA 4LF8E 1D6TA 1HNWE 2BM1A 2NPFA 1XNQI 1Z5CA 4DUZE 1ZM4A 4B3ME 3ZKDA 1HNXE 1WUUA 4YY3E 1XHKA 4JI0I 4X62I 4DPUA 4LFCI 4Z7CA 4R1FA 4USMA 2HHHE 2XEXA 4JI5E 4JI0E 1IBME 2VQFE 1N34I 4YY3I 1UEKA 4DPXA 4I3HA 2F4VI 4JG4A 3T1YI 2HFSA 2UXCE 3K1JA 2HFUA 4DV2E 2BV3A 1QZRA 4JV5E 4PRVA 2E5LE 4B3SI 2UXBE 3B78A 4DPTA 2ZBKB 5L3JA 4X62E 1HNWI 1RR9A 4X65E 5GMDA 4DUZI 4LFAE 1N0UA 1MU5A 3QT5A 3CWVA 5LMUI 3B8HA 1Z0VA 1B63A 1Z0EA 4DR7I 4JI8E 4DV2I 2VQFI 4X64I 3HULA 1NHIA 4FWDA 1K47A 3ZZ0A 4M1KA 3J7AM 5GMEA 4DR5I 2E5LI 1MX0A 1N34E 3WU4A 3OTOI 3ZM7A 4JI3E 4B3TI 3B82A 4X65I 2EFGA 2BM0A 4GKJI 4B3MI 4DU8A 4DR3E 4MYUA 5FLXC 1XNQE 5A2QQ 5BR8E 3T1HE 5LL6R 4HY1A 4YHHI 1Z59A 1XNRE 2ZITA 3ZZUA 4Z7YA 1FI4A 4LF8I 1NZ0A 1IBLE 4DR2E 3V5RA 2V2QA 2UU9E 4DXLA 4HXZA 1Z5AA 2UUAE 1I94I 4FN5A 5IWAE 4UT4A 3WU5A 5IT9C 1J5EE 1XMOI 1S4EA 1Z0TA 4B3TE 1Z0GA 4LFBE 1DARA 1N32I 1IBKE 2V2ZA 1VISA 2HHHI 4LF6E 3JAMQ 4B3SE 3Q1QA 3GONA 3F0NA 3PYDA 4JI2E 1HNZI 2UXCI 3T1YE 4OX9E 4JI4E 2UUCE 2R42A 1H72C 4LF9E 1H7SA 4FWGA 4JI5I 3LTOA 2AJ4A 4NXMI 4USKA 1BKNA 1FJGI 4LF9I 4JI1I 1N36I 4FW9A 2OI2A 4JYAE 1PKPA 4DU7A 2UXBI 4NXNI 4JV5I 4DV1E 4LF7I 4B3RE 4DV1I 1N33I 4AQYI 4DUYI 1EA6A 1FKAE 4DV3E 4LF5E 3ZZTA 4P52A 3J80C 1H73A 1XMQE 3J81C 4ZVIA 1H7UA 4X66E 4DUYE 4DR1I 3WU3A 4DV0E 5LMNI 1HR0I 1KKHA 2X7IA 4AQYE 1N36E 2CZ9A 2UUBI 4MYTA 1XNRI 1PIEA 3D4JA 4LF4E 4KHPI 1ZM3A 1KTVA 4DV4E 4K0KE 4JI1E 3M6AA 4DV4I 4DR6E 1FJGE 4OX9I 4LF5I 4DV5E 2WW4A 1NHJA 3H4LA 3ZKBA 2A2CA 2ZM6I 4DPWA 5IT9Q 5FLXQ 1IBLI 1RREA 2X36A 3J81Q 2VQEI 4DR4E 3QT6A 1B62A 4GKKE 5LMUE 3QT7A 4LF4I 4EMDA 3K17A 2E1RA 4RPFA 3PYFA 2ZM6E 3LPSA 4DR6I 4HACB 2HK2A 4DV7E 4DV6E 4P7AA 4DV7I 5A2QC 2VF3A 1HNZE 4PU9A 2UUBE 1ZM9A 4DR5E 4KHPE 2R3VA 4JI7I 2UXDE 4JYAI 3T1HI 1IBKI 1OJ4A 1ZXNA 4DR4I 4LFBI 1A6FA 1N0VC 2UUCI 2LJPA 2DEJA 3J7AG 4NXME 2UXDI 4X66I 4UTGA 4JI7E 4GKKI
chains in the Genus database with same CATH superfamily
5LT5A 4QYZK 4PAAA 1Q7LB 2CVEA 4YDDB 3P06A 3LGHA 5D0HA 4JP8A 4ELVA 1YG0A 3DOLA 1I3OB 1Y5NB 4YN3B 3M05A 3ISNC 3H2UB 2RJZA 2VBXA 4L3NA 2PI4A 3VWSA 1LQ9A 5E7OB 2YWKA 3ZZRA 2GMLA 3ZC4A 4X4QA 3M6UA 4A8QA 2JEBA 4Q0BB 3M4XA 2MLXA 4MU0A 2K2PA 1BXNA 2OLWA 1EI1A 4L72B 2DGXA 3D3CJ 3GCWP 3QLHB 2JEGA 3KLGB 4F2SA 2XS5A 1VJQA 1PGZA 5EDWA 2CFXA 3BGRB 1FJEB 1HBOB 5BXIA 1U2RA 4DQQA 1LNQA 1JQGA 2BX6A 1SKSA 5DROA 4H4OB 5CYMA 4UF4A 1UP1A 2XO6A 3KK2A 2L08A 1YHQS 4LIRA 2R7UA 1LK7A 5AXLA 1VYAA 4PXEA 3NGTA 2HNZA 4H4OA 5CYMB 4RW4B 2F8HA 2YWEA 2AJFE 3FZ2A 3SCKE 3M8SA 1NMEB 1TKXA 5F3TA 2RDDA 3CCJS 4OYZA 5HAOA 4OLOA 3PKYA 1LK5A 2V8GA 5LMNF 3ZTRA 2FHOB 2ABYA 2G0CA 5T7LA 2BA9A 1HWLA 2JFDA 2Q6BA 4HHJA 2IESA 2QMXA 2CNNB 1EARA 4I6WA 3MM9B 3OTOE 4OLPA 3UDEA 5D77A 2RRNA 2IVFB 1Z0WA 4MIBA 4NBQA 3J81j 2BE2A 1NPPA 1IM4A 2LEBA 2XZDB 4ED7A 1Y4SA 1RAGB 2A6MA 2J76E 1OQ3A 2DNMA 3ZZYA 4CLTA 1S9FA 5IWAJ 2X1GA 4DL0C 4TQSA 2ZZMA 3N28A 5K36B 2HSEB 4ED1A 3DLKB 4ED4A 1VRQC 4K7QA 3KJVB 4LR7A 5E41A 4GO5X 1XQIA 4FBUA 2V5HG 5E5NA 1RWMB 2ZE2B 3IM9A 1EQ0A 1QUPA 1AA1B 2E7XA 2B9YA 1TELA 4O4GA 4DEZA 4A8OA 3IN5A 2MKHA 3RTVA 5K8MA 3UD3P 1KLNA 2E5LF 3Q89A 1GXLA 1BQMA 3IAM9 1ELOA 1F2GA 5IM0A 3CJTA 3BDEA 3HVTA 2N3OA 3QSYB 4BDPA 2AX1A 4ECSA 2R7VA 3BS9A 4HT5A 2G9OA 3G8TA 2BJ7A 4IG3B 3UR0A 4CM2A 3LF0A 2W4PA 4O3SA 3I87A 1DLOB 5F8GA 5HQMA 1LW2B 3VGSA 2KG1A 4ED8A 3I55S 2CPJA 2XMMA 4ECXA 2HS3A 1IBMJ 2WBRA 3VAIA 1M5OC 2FDNA 3CNQP 4FNIA 4QPTA 1HQEA 1EHWA 1WKLA 2Q1LA 4TN2A 4JOUA 4CLKA 4R5PA 3PW4A 2ZJPQ 2YKMB 3DOKB 1SKWA 3OBIA 4FF4A 2DISA 1PYSB 3QT8A 2AGQA 3I5CA 2DEIA 1Q53A 4CLLA 4J91A 1RT7A 3CWJA 2ZUGA 4RR5A 2W7PA 1UDNA 2WVDA 1Y6ZA 1Z5BA 2ZBIA 5FDLB 4F7VA 5M2UA 1H74A 4ECRA 5C42A 3K59A 1Y3KA 4K59A 3VVUA 4OYMA 2DVIA 2D9PA 3I6PA 5HO4A 2DD8S 3GFHA 3J7A1 3TA0A 5KFKA 3R7BB 3JTOA 2WVFA 2LDYA 3HI9A 2HKEA 3MR7A 3PACA 4E98A 2C2OB 5IV4A 4JI6I 2OO4A 3LNUA 3IBCB 3QMQA 3N4WA 4NI2B 4ZJLA 1WC6A 2AV5A 3CJ3A 3H90A 4JI4I 4QZVB 2HQFA 5KTQA 4DR2I 2VFUA 2ZH3A 4C8NA 1TKDA 2KHCA 2P6SA 4Y2MA 2BM1A 2WB1D 4F0HA 2NQPA 3W66A 2JE6A 1XNQI 1NSPA 3FBCA 2VG6A 1Z5CA 1IR0A 2DO4A 4DUZE 1ZM4A 2AJ0A 3CMQA 4KO0A 3BQ1A 5HROA 4LVNP 2VC0A 3ITHB 4IOAQ 3VV2B 2OPPA 4F50A 3NGKA 4YY3E 1DTQB 2B4PA 3HSZA 2B8PA 3PX6A 1VLYA 4CYUA 3BJYA 2A3JA 4FYWB 4CO1A 4DR4F 4DPUA 3Q6MA 2KL8A 2RS2A 3H5SA 3T1AA 3UQSA 2V8HA 2CQGA 2WBMA 4PWWA 1TTHB 3DRSA 4USMA 3TZYA 4IOCQ 3X3UA 2QFIA 1RB0A 2XEXA 2O67A 1QVGR 3MM6B 1HNWF 4B3MJ 4ANDA 2PO1B 3DXBA 4IQXA 3PG9A 2H3EB 1TL7A 2IVYA 4LF2A 3W2WA 4R5PB 5KT7A 1KFDA 4RUAA 2XGQA 4CRJA 3G96A 2QL9B 5D6GA 5ITHA 1VS3A 1GK8A 4DPXA 4OHVA 4I3HA 3I4PA 2XC9A 4ELUA 1D8ZA 1S6OA 2A0FB 1F9HA 3TZWA 2ASJA 1AROP 1NK0A 2C39B 1NCLA 2O1VA 4IG3A 4ES3A 4LREA 5E3QA 2B9XA 3Q22A 3OSNA 3CUNA 5EHHA 3SI8A 1KVIA 3HSGA 1F3FA 4LF6J 4I0WA 3GP9A 1D9AA 4DSIA 1FFSB 1HBUA 2IC3B 3HHDA 2B5JA 3EXYA 3FUYA 2BA1D 2OPRA 1QSSA 1Q16B 3BO4A 5BYSA 4PRVA 2DIUA 2OD4A 5JEAC 3QIPA 4B3SI 4KC5A 3N5BA 4ED3A 5DRQA 1XBWA 1MMDA 2FC8A 4IDKB 2OPQB 4RLEA 4ECVA 2YNFB 3HHLB 2ZWOA 3QSIA 3AAWB 4QIWD 1HNWI 2PEBA 4DR7J 4PKDB 3U1MA 4TY8A 3KHRA 2WHOA 1X5OA 1XMQJ 4FYDA 2UP1A 2FC9A 3JSBA 4MAKA 1P9YA 3EVWA 1RT6A 2NN6F 2F8EX 3L7PA 2UUAF 1AZSA 3J7YI 3GU0A 2CADA 2HAIA 2VDHA 3AD9C 3GIMA 3M8QB 2MLZA 1UDSA 4LF7F 2HS4A 2IRYA 2GNKA 3OLAA 3UDLA 5B09A 3PX0A 3IBWA 3PTWA 3L7OA 1C1CB 2JLFA 3LA0A 3FQLA 2W01A 3OPKA 3NBPB 1RWUA 1MU5A 1Q86T 5G0RA 1RACB 4URQU 2ZHOA 1C2PA 4X4PA 1HPZA 2VPWB 1KQFB 2MQMA 4DFMA 3CJSA 4LRCA 5IC4B 2ZH5A 2QSFA 3T5KA 3W5XA 3H1CA 3B54A 3EE3A 4JI6J 2BJ8A 4OV6A 1DZ5A 3NNAA 2DGWA 2HGMA 2BJ1A 2HHPA 2XG8A 4UOFA 4K4YA 1K8AT 1BQXA 5D8HB 4FWDA 1R8PA 4NLWA 4KT0C 4DFKA 2LEPA 3ZZ0A 1R6LA 4CLWA 4WCEQ 3KLEB 4F4WA 1U25A 2GIRA 3AXMA 4M1KA 3M2UA 1C0UA 2NREA 1JLBB 4PR6A 3POTA 2E5LI 3LP1A 3GIRA 1MX0A 1VQ7S 2MKIA 4OX6A 1VGYA 2RUSA 4C8ZA 1N34E 2IDLA 4BBYA 1YZ7A 2MXYA 3QJJA 3IWLA 3M1VB 4FYXB 5HVFA 5A2QU 3U7JA 3C6UB 4KPYA 3ZM7A 4OZNA 4AIDA 1CQNA 3CJQA 3MUMP 2QC3A 2DGSA 1Y4UA 4MU4A 3OFGA 4B3TI 1VHIA 3R8YA 3G8QA 5AXMA 3KLFB 1BC6A 4LCHA 4GKJI 2W7AA 3GR1A 5CYQA 2LMIA 4JB8B 1N5VA 4DR3E 1T02A 1BWEA 2PMHA 3GFYA 1EZZB 2E66A 4M5NA 3SCIE 1RBOB 2CG9A 2IOQA 5BR8E 2AF6A 2DRAA 1P1LA 2Q3PA 3CCVS 4MU1A 5GVQA 4HY1A 1XC9A 3MPVA 1Z59A 2HIYA 2BZ2A 1F60B 3IRXA 4FP9A 1WC3A 3EVMA 1BQNB 4Q2MA 4JI0J 1N32J 4ILMA 2HVZA 1T9VA 4RW6B 3MR3A 3W62A 2IAJA 4N56A 2RU3A 1HBMB 4I56A 1SIWB 4KRWA 5A6PA 2R2TA 4OX9F 5EKWA 5EX0A 4ZMMA 4EZ6A 1EX8A 2IDEA 2KT2A 3V4IA 1SB6A 4K0KJ 4DR2E 3S7RA 3BKTA 3V5RA 1RJJA 5DNXA 4AL6A 5EL9A 1ZS6A 3QAEA 2H5IB 3C19A 4J9MA 2UVWA 1HNZJ 5GAEU 2R8HA 4ZCMA 2C28A 4M5KA 4OHZA 1WACA 1YLXA 2KYZA 4GC7A 2R8IA 2BQ3A 2W24A 4LF8J 4BA1B 1RAOA 3NG8A 3OXLA 5GAEI 4RNMA 2EFVA 4DLEA 3H59A 4PG4A 4RX6A 4ALZA 1UVKA 1PYTA 1DQ8A 1GMUA 3SXLA 5GADI 2NXNA 1SC4B 4RWWA 2MJNA 5A8WB 2VQEF 1R0AA 2Q66A 3P5TL 2V4QA 1QJHA 1S4EA 3MM7A 2VJVA 2OPSA 3PJWA 3W9HA 2ROGA 2YNHA 1YRTA 1IBKE 3OT9A 2KI2A 4OZ3A 1NK6A 2MQNA 2IHR1 4LF9J 1DTQA 4PUOB 4QR2A 1WDDA 4LF6E 3TOQA 1KOOA 1EETB 3PV8A 4KGZB 2Y1JA 1TV6A 4JI2E 1VDHA 2KVQE 4PXCA 5IXUA 1PO6A 2FYXA 4TLQA 2B9WA 5KG6A 4DV4J 1GAOA 1PC5A 1T9YA 1C1BA 2V8DA 3QGPA 1X31C 4A8WA 3THVA 2IJRA 2XSJA 3BGUA 1QTNB 4C3KA 4AQYJ 2NUUG 4J9SA 3EZOA 2OFHX 2VG5B 3JYTB 2R42A 1H72C 3DLEB 3FC9A 2UXCJ 1H7SA 4FYYB 3A4TA 3JSMB 2JEIA 4ITSA 2B4UA 1H3DA 4FWGA 2BUNA 2B4OA 1YJUA 2FHJD 2MTLA 4R8UB 3FEZA 3CO0P 1E6VA 1S1XB 1Z2LA 3BDPA 2ASLA 3BR8A 1JIHA 3Q2SC 1C0TB 1NHUA 1RT1B 2OSRA 5ETVA 2OEKA 1JLCA 2I0XA 5IQQA 5KFOA 1WOPA 3OJSA 1XERA 2EXUA 4CO4A 1N36I 3VGVA 3MDFA 2KM8B 4P7TA 2BYCA 4M5DB 3GJRB 1SXLA 4NA1A 2HVDA 2OI2A 4NXMJ 4LF4I 2H4YB 3M8YA 4Y2KA 2YWHA 5KG2A 3I4HX 4BWMA 1FVSA 4JYAE 1NO8A 2OUGA 4DU7A 4F67A 4HH0A 1RWWB 2PIIA 1WEXA 4IUFA 1U1KA 3R5CA 2G1DA 1HR0J 1UFKA 1RHKB 2KH9A 3EX7B 2B51A 3AA9A 4AXJA 1RKJA 2DIVA 4KGXB 2E1CA 1UVLA 4DV1E 2F8MA 2Y3YA 4JV5I 5HVHA 3BPDA 3KLIA 2DH9A 2X1AA 3CCRS 2XMAA 1N33I 3K58A 2L9DA 1OYEA 4XDDA 4F4ZA 1RWNB 2IERA 2ZJRQ 3FRZA 1FKAE 2PMWA 2QEXS 3R5JB 4LF5E 3NBPA 2ZH7A 4NEZA 3AB2B 2RHQB 1T3OA 5L46A 3TQEA 5KT3A 1UA0A 2JEJA 1Q7YT 2CQIA 2E29A 1IBLJ 1FJGF 3J80C 1XMQE 1SH3A 1GX5A 2UVVA 2DNGA 4RW9B 1S1UA 3CT9A 1U0SA 1N36F 5LMUJ 1AFIA 3LPEA 3KJQB 3OTBA 5G4DA 4O0IA 1KFSA 2ZHAA 1SJQA 1KNZA 1UPMB 4X64F 2R7WA 2FY8A 2H5EA 3WDOA 2DRBA 4X66E 2FQQB 5IC6B 3U1LA 5J2PA 2RU9A 2FVCA 2M2BA 1GMVA 3CD6S 1D9DA 4C8YA 4NLPA 1VBYA 3K85A 4DV0E 1HWKA 1MU2B 4OYXA 4XTTA 1QDUB 1BHNA 1T94A 3H40A 4DV4F 2CG4A 3M8ZA 3RR7A 2Z5EA 2PDAA 3DD6A 4ZPBA 3FEYB 4I7FB 4U3DA 3UR3C 3L95X 2JDJA 4D3HA 8ATCB 4RNNA 2DO0A 3TAPA 4JI3I 3M1VA 2PE8A 4DL7A 4DR2J 5F9LA 3I9V9 3M9MB 5AE3A 1Q82T 2C3YA 4OL8A 3A3OB 2FUG9 4IYQA 4K4SA 2VFSA 1IBKJ 2UUBI 3KLFA 2M8DB 2LU1A 1X4GA 2QV6A 3G82A 2XBPA 3D1OA 3KG0A 3M30B 2DNHA 2ZZTA 1M1GA 4QQBA 3VAFA 2D3O1 1PIEA 3D0GE 2OGUA 2Z8QA 3GILA 1RT4B 2ZHBA 2ZEJA 2GGPB 4DR1J 1YJTA 3PDNA 2C38B 4G1PA 5KFZA 1ZM3A 3MHYA 3BGRA 4M5MA 1UWAA 3MUVP 1S0VA 2O1WA 3D1QA 3WIVA 3KHHA 1RTJA 1HNXF 2VL1A 1KEKA 2IBKA 3CC4S 3M6AA 2IM3A 4DV4I 5KFEA 1TK0A 1BWVA 3ONQA 1QAYA 1UETA 3L3CA 1Q5YA 4OX9I 2YX4A 2HHTA 4LF5I 3MEDB 1K44A 3VAHA 5B0AA 3FSYA 4ATNA 1IVZA 2PEHA 2ZFHA 3DOMA 1NDLA 4TQRA 1RLDA 4J9NA 1VQYA 3FFIA 4DMZA 3P3CA 3G6XA 2BR0A 4PWUA 2WW8A 2K7KA 2ZKUA 2DNRA 4HR2A 3R9LA 4K4WA 2CZVC 3UN5A 1G1XA 4HKQA 4J90A 1UL3A 4QIVA 2KXNB 4YQWA 4IFDE 5G0RB 1XR7A 1RBAA 1WD6A 3IO1A 1KLMB 1K1SA 1RCXB 1NHKL 3C15B 2BA0G 1IKXB 3HF5A 1RREA 2CKWA 2N3LA 3CTRA 4AYBD 3SV4A 3TAQA 1RA6A 2VQEI 4F3QA 2F65A 1UA1A 3Q8VA 4NMXA 4QJVA 4DR4E 1S0OA 4C3MA 2POKA 2CWKA 2RAQA 1FFGB 2GIQA 1HNIA 3RBZA 2CJ9A 3PHTA 3CCES 1YZ6A 3WC0A 4A8YA 1GMWA 1TVRB 2E1RA 2YNHB 3BZQA 4KV8A 4PCQA 3SMZA 3ZZZA 4A8XA 4WFBQ 1PILA 3DYAA 3GIJA 3BQ0A 2Y1RI 4DX8H 3TANA 1JLEA 3IR7B 1RTHB 1S1VA 1RHUB 3HX9A 1NZAA 1IM6A 2E1PA 1S9GB 3DGPA 2OFGX 2XHCA 4HI1A 3RYLA 2MQQA 3DKDA 3PVXA 1SQFA 3C6TB 2N7CA 5AJ3J 4FS1A 5L1LA 3K8VA 4DV7E 2NN6D 1B7FA 2CNKB 1CJUA 3D68A 3DLJA 3AXKA 4RBUA 2EPIA 1G6BA 3O6QA 2YNIA 4O23A 4RL1A 5CQGA 5CZXA 3EYZA 2KVIA 3JQMA 4YFUA 3W8GA 1VQPS 4EWTA 1LWEB 1HNZE 2XTJP 3CJ2A 4U96A 4G6VB 4OZ2A 1NJZA 4PU9A 2UUBE 1KWMA 1WWHA 1YX2A 5EGYA 3ZTQA 2M4MA 3AJDA 1S99A 5DQHA 2XULA 1N6QB 1HNVA 5AE1A 2CGEA 1VRTB 4W4MA 4FYVB 3DRYA 1SH2A 4CO2A 1U1RA 1HNXJ 2ZWPA 3ISND 2PA8D 2YWFA 4EK2A 4DR4I 2FIUA 2EVZA 4DSFA 2O1TA 4TY9A 4C2MA 1GXUA 2AZ3A 2X36A 4RUBA 4GVBB 2IA0A 2QLWA 2DNKA 4DQPA 3QGHA 4RU9A 5KG4A 3OHAA 3IWXA 2W7OA 2RKIA 4ZP9A 3OLBA 2PO2A 5HQLA 5GAGI 3H5XA 1X4BA 3A12A 4GKKI 2DT9A 3PRVA 1KRPA 1FX2A 2RILA 3O2IA 4Q8FA 1OY6A 5L38A 4DR3I 2IYIA 3KNGA 4IO9Q 1X9MA 4NXNJ 4AL5A 1Z0BA 5JEAD 3T3FA 1FTCA 4B02A 1FX4A 2FB0A 2H9ZA 3GYXB 4DPYA 4ZPCA 1MG7A 3MPUB 5HK4A 2V8VA 5DQIA 1AUSL 1IBMF 4X64E 3QO9B 4IFVB 3POTB 2Y9HA 1S76D 2XI3A 2XMWA 4NX9A 3U02A 2PO1A 1JLQA 2Y1IA 4B3SF 4RWXA 1FD8A 1VI7A 1QUVA 4RNHA 4ZN3A 2OSQA 1WNEA 1GTEA 3WU6A 2ZDPA 5FWKA 1F0XA 2QN6B 1VQMS 1UDOA 4X62J 2UU9E 4DV5F 2P9GA 2W2NP 3H8YA 1XN9A 3HVWA 2KU7A 4BLGA 2DRDA 4ZS6A 3Q83A 2GMHA 4YDXA 3B6BA 4URLA 2YH0A 2UUAI 3RJMB 5J2MA 5DZ7A 4CTAA 1VQ6S 1FRMA 1RT2B 3AT1B 3CDEA 2MZJA 1ZPVA 2IPOB 3E51A 4KH1B 4RBTA 2ACMA 5T41A 3TVZA 4CDIA 3S8SA 4ZCIA 1OYSA 1R0AB 2VZ9A 4WFNQ 1AUDA 1HD0A 2V34A 1SUQA 2CPXA 4KGKA 4OYPA 2HQDA 2KFYA 3C2PA 5SZTA 1K0VA 2JL9A 1VC5A 1ZXMA 1OY8A 5KFQA 1IBMI 3AY0A 2XO7A 5E33A 3DOLB 3PS1A 1KDNA 1HR0E 1QD1A 5J1EB 4IOBA 5ETSA 2MZTA 2L9NA 2IM0A 3ILIA 4HT7A 4PXBA 4Y2IA 1EB0A 4IH7A 2FJWA 3M32B 4F4XA 2DGQA 1PJ6A 1S6QB 4UW2A 2B4VA 4U9RA 1EKSA 3BH7B 3TAMB 2ROEA 1GQEA 4Z2XA 5F8HA 1D0EA 4WIQA 4V19X 1KIJA 4DV5I 5IWAF 2UV8G 1OY9A 1RI7A 3DI6A 1MWYA 3TUJC 3PYEA 1RXOB 3QATA 1NNDA 2YXLA 4LF7E 3BN7A 4LF4J 3J7ZT 1RU1A 3PW2A 4KHPF 1VQKS 1V5VA 2WB4A 4JI8I 4RUCA 2LP4A 1HNXI 4XTJA 1HNVB 2W25A 3I5AA 1D3WA 4OI6A 1URRA 2EG2A 2ZH9A 2LDIA 1GT8A 1H0HB 4LBHA 4MMOA 3EZ5A 3PHEA 2UVUA 1S77D 1VRUB 4OQJA 4IFDF 3MPDA 5KFMA 1NB7A 3P49B 5GAHU 3OVAA 2ZBRA 1XIQA 2GQCA 1WC1A 1RE1B 2B6AA 3M7NG 2V9WA 5F0WA 2ZNZA 2HKJA 3L7ZA 1GH8A 5FLXU 1EQMA 3FCVA 3KLIB 4PG5A 2R2RA 2HZCA 2VQEE 2F4VE 2QT7A 4B3TJ 2K3KA 3IS9B 2BKOA 1KVKA 2BEFA 3J80U 3PX4A 2IA6A 2YKNA 5HSPA 4M5GA 2V67A 1RBLA 3C16A 3OHBA 1U1MA 1Q8LA 3R97A 4NA3A 4JI2I 5BR8J 2FZKB 2VH7A 3KLHA 2APOA 3HHLC 4O44A 3BO2A 2VICA 5C0XF 2OD6A 2HQGA 1YKWA 1RT2A 1TKZB 1JLAA 1KHVA 2Y1LB 2I5JA 1P8GA 1AFJA 1J5EI 3IGNA 1TL4A 1ZTTA 4GKKJ 4K5SA 4U7UD 2YKQA 5EN1A 1R8BA 1BGXT 3AQPA 5HLFB 5HL7Q 3M2VA 5ETLA 1TL3B 3N6MA 4P72A 5ETQA 4IS9A 4DR6F 2SXLA 2P5VA 2W2MP 3UD5A 1S0MA 2O3DA 3R5BA 1FWKA 3QGGA 2EFPA 1MMLA 1OSCA 4NZ7A 2DYAA 2HGNA 1MSWD 1WOSA 2H1YA 1LXJA 4I2PA 4NRTA 4HYMA 3VGUA 2RH3A 2V2VA 2VUGA 4H4KA 3TA1A 3M8RA 1ZETA 4DSLA 4K2JA 4ZVRB 4LF8E 1HNWE 3BR9A 3PEHA 1FDDA 1VQ9S 2KT3A 3LH2S 2FVPA 1P42A 2VA2A 4GVLA 5HANA 2WAQD 4NA2A 3ZKDA 1Z0CA 1WHWA 1PBUA 1NHVA 2KYXA 4CLFA 3QJLA 3LP2A 2PO2B 3MFIA 5DNLA 4M8LA 1R8CA 5C25A 4KR0B 1MNEA 3GR0A 5KFFA 1N32F 1XHKA 4LRDA 4IZKA 2GCFA 1CSJA 2OHDA 4OZ1A 3T1HF 4QW9A 2J0QD 2G2OA 4JI6F 1K9MT 3VTIA 1YJ7A 2LXIA 2QLFB 3CF5Q 4LFCI 2PT0A 3SDEB 1DFDA 4R1FA 2XCAA 1WEZA 1CJVB 2JZ5A 2KHDA 3BSAA 3MD3A 4O3QA 4X66J 4C3LA 3BREA 5L1IA 3G87A 1NK4A 3R5AA 4LRFA 4JI4F 3R2DJ 3NWRA 1ZZFA 4JI5E 4CH0S 3H4BA 3G8SA 4WP9A 2FHMA 3G82B 3M30A 4P75A 3W61A 3KLGA 3PKMA 1UDQA 5D3GA 4FW9A 3VZHA 2X3DA 1IBME 3BEGB 1XNQF 1UEKA 5K36C 3HFZB 4K2XA 4MKVA 3KDNA 1YJ9S 1KQGB 1VQ8S 5D3GB 1WKKA 5CYJA 2J0SD 1F3VA 3GCMA 3DMJB 4LPFA 4C0BA 4JG4A 5B0GA 4YMEA 1CULA 5EWEA 4C98A 2V50A 2UXCE 3I0RA 1I5OB 5CHCB 1T11A 2HFUA 3MM6A 2W9BB 4UQTA 1L3SA 1WF2A 4CNYA 3M7ND 4TKTA 3P6YC 2RNEA 2YX1A 3RAQA 2CPFA 1RLCL 1XNRJ 3HD1A 1QZRA 4ERDA 1EJ7L 1E6YB 1RWPB 2GVZA 2HZAA 2N4CA 3HHEA 4EFAC 4RZRA 4LF9F 4O3OA 3TWZA 2E5LE 2DB1A 1X4FA 4O4GB 1HI1A 2BABA 1NDCA 2KRBA 4RW9A 3TZZA 1KC8T 2M0GB 2ZVSA 4USHA 2EFQA 3VZIA 2VQFF 2RT3A 4WE1B 1YITS 1R6MA 1PJ5A 2C42A 1R7IA 3CB4A 5IOLA 4DSJA 4OX9J 2IRXA 2IC3A 1F1BB 1H7WA 1IKXA 3H42A 5KFCA 4A8MP 3TAMA 1IXKA 1YRUA 2ALZA 1NKBA 1Q81T 2KJVA 3DHXA 4P2XA 4NLYA 4H4MA 3LW5C 4JV0A 3D7SB 4NYOA 1N52B 2MQOA 4U6PA 4MKAA 4KE5A 3W65A 3PIPQ 1LW0A 1FERA 4C97A 2AU0A 4LF7J 1SJ3P 4JV5J 1IWAA 2PA3A 3GMGA 1BD6A 1I94J 3QT5A 1FRLA 3H20A 2M9KA 1PAEX 3NKYA 4RW8B 1C0UB 3I31A 1T9UA 1WF1A 2OMLA 5ETOA 3PXGa 1YJNS 3HJCA 1HQ2A 3IMQJ 3B8HA 3EJMA 3SDEA 1Z0VA 3TW0A 4MKYA 3GQCA 3SV3A 2BDPA 1T9TA 3KMQA 1B63A 1S9EB 2AP6A 4GKJJ 5K36F 3MURP 2VQFI 2YKPA 2AWZA 3G6YA 4FZVA 1C0TA 1RT1A 4X64I 3HULA 3P3EA 1NHIA 5E2QA 2BE9B 4LJMA 4DR7I 1GXTA 2YNGB 1JLCB 1NPRA 2J6UA 2GHPA 4KHMA 4NCGB 4USJC 4JI5J 1HPZB 2IMWP 4N77A 4O4RA 3ZNUA 4DJBA 4NYZA 4ZLPA 4MDTA 1KS2A 1MN9A 2CYYA 2FZGB 3AFGA 1LWEA 3IM8A 4Y00A 3W5ZA 4C48A 1FDAA 2IY5B 3GFZA 5E0OA 5KFLA 2QE5A 4KQZA 5CCLA 3PRYA 1S0NA 1UJ6A 3W60A 2ROPA 4LF1A 2DR9A 2QLJB 3FBEA 2UVRA 4ZDNA 2QTWA 4RUHA 3NXZA 2ZUAA 4X65I 4OZJA 3VAKA 2EFGA 1X4HA 1LWCB 2HRUA 5E3RA 2BM0A 4DOZA 3ENAA 2XLIA 3FFIB 5JUMA 2O1UA 4MYUA 5DRRA 3CO9A 1B0TA 2IBOA 3I0SA 2CAJA 2UUWA 3MEKA 4KFBB 2DK2A 1Z2ZA 3EWGA 2HQCA 3IXQA 4L76A 1U7LA 2UUBJ 1NRKA 1X5TA 4CH1A 1HD1A 2NZ4A 4YHHI 4JI2F 2GIFA 1O51A 4B3OB 2WSCC 2WK4A 3CPWR 4J9LA 4DL3A 3GYGA 3G9CA 3KLHB 2DTJA 4FPRA 3MMJA 2B56A 1UEVA 2E5GA 1TKZA 2BANB 4HEA9 3GFXA 4ILRA 4PYAA 5L9NA 3OL7A 4NZ0A 3O44A 4QR0A 1IBLE 3GTYX 2MGZA 2CPHA 5A8WA 2RD5C 4QOTA 2V2QA 3OXGA 2YQ3A 1RT4A 2AEMA 4UZCA 2ZBPA 3DDKA 4DXLA 4U7CA 3L9ZA 4QWEA 4K0KF 4X4OA 1U26A 4HL9A 3Q8YA 4PRFA 2VOPA 2BJ3A 3VAJA 3M2RB 1HNZF 3X1LB 5J2NB 1HQEB 4U8YA 4B9VA 4Q5VA 1M5PC 3Q23A 2LVWA 5DDOC 4FBTA 3JAMY 2JC0A 1S7IA 2CQ0A 1DAXA 1F9FA 1V5IB 1YRXA 2Q6CA 4KKOA 4PXDA 5C2GA 2DY1A 4UT4A 5J2NA 5IT9C 1J5EE 2JEAA 2ACYA 4OYAA 4WXWA 2RMLA 1XMOI 2QLXA 2J7UA 2J6TA 3AJ2A 2KM8C 2GO4A 2L41A 1Z0GA 4XAKA 4B3TE 2DHGA 4LFBE 1S1TA 4WF9Q 2PD1A 1CJKA 1N32I 2DHXA 3OSPA 4JI5F 4F04B 2V2ZA 3PCOB 3ULHA 1N36J 1UCNA 1AB8A 1BQNA 1UEUA 1TMJA 3FDSA 5HN0A 3P96A 2M70A 3UCGA 4ZVGA 1RP5A 2YY3A 5ADZA 4Q44A 4IZKB 3JAMQ 2HIQA 2MLYA 1U47A 1M5KC 1LOUA 1F2HA 2HNDA 2QA1A 3NGSA 3PYDA 2ZC4A 4UOCA 5J1EA 3V81A 4JI1F 1HYSB 5BYRA 4R8UA 1U1PA 1HHQA 3NP5A 4AXIA 1YJWS 2MKJA 1M90T 1VQNS 3W7BA 2F4VJ 1C1CA 3FGVA 5EWFA 4JI4E 2CPEA 3C66A 2DHHA 2OEJA 1Y9OA 5KG1A 2M88A 3FBBA 1WG1A 4ETXA 2NN6C 3PS2A 1NU4A 1H38A 1TK5A 1U2FA 4LF9E 1EETA 2X3GA 1YBUA 4DV1F 2H65B 5F8LA 4G65A 1RT6B 1Q8IA 1HBNA 2NXJA 3KWMA 4NE9C 5KFPA 3G6ES 3DLBA 3LTOA 4CTAB 4RJVA 4JI5I 2R7RA 2QX0A 1FKAF 1L3UA 2W2QP 2LQ5A 3BGOP 1VOMA 4USKA 1FEHA 2VFTA 3NAIA 1FXDA 3N0VA 4LF9I 1H2UX 1CC8A 2GVZB 1JLQB 1UJ5A 2CQ2A 5ELWA 4P74A 3UDVA 3U1KA 3PS3A 1TUWA 1VQSA 4MK7A 1PKPA 1RT7B 4IQMA 2LYVA 4RNOA 4IZJB 1RSCA 2YKNB 2MQPA 2RDIA 2CJKA 1KHWA 4U8VA 2UXBI 2UU9J 4OHXA 2KXFA 1GNKA 3C16B 2W9CA 4DR3F 1IKWB 3ZO7A 2XWYA 3ZTSA 4D3GA 3J80Y 1HR0F 2P9CA 2RQ4A 3GV8B 2NN6A 2Z2MA 4DV1I 3CW2C 4ED2A 1NJYA 1L3TA 2JEBB 4AQYI 4NLDA 2DNOA 4WYWA 3KG4A 2YNIB 2VJUA 4IZJA 5FLXY 3H98A 1JB0C 1CG2A 3F73A 4ZK7M 1FXLA 3J81U 1YBTA 2CQHA 1X5PA 1CS4B 4FVCA 4ZIVA 3CCLS 4PG8A 4DL6A 1RTHA 1S1VB 5KFUA 1YH8A 4C7QA 3MD1A 1R3NA 2ADCA 4FXWA 1RHJB 1R27B 4HI2A 5KT2A 2DR5A 1HHTP 3J81C 3HCXA 1FJGJ 2PO0A 4OKGA 1RABB 4YP3A 3MR5A 1W25A 3I9ZA 4DG1B 1FVQA 4DUTA 3IBFB 3P8BB 4DS4A 1JXVA 3DDIA 1K1QA 4R0JA 3ZTOA 1WJ9A 1NKEA 1J5EJ 4C4WA 2E5JA 2UXBF 4DUYE 5A76A 5DGBA 4B3RF 2QA2A 2HURA 4K4VA 5KOXA 1J5OA 4DR1I 4O3RA 1RISA 3I5BA 4DHVA 5HQ8A 3ETMA 3CC2S 2NCKL 3CD5A 1KKHA 2HAFA 4GC6A 1TK8A 1YHCA 4ID5B 2DNYA 2GJ2A 3A8KA 3N6LA 2AYEA 3CCWA 2HMIB 5DS7A 2FLLA 1SL0A 2XYPB 4J3DA 4RKUC 1FXRA 1A7GE 1JKHA 1UMJA 3KKFA 2Z58B 3UI3A 4EO8A 5RUBA 3FSXA 4X65F 2RRAA 1EIYB 2EC2A 3CCTA 2CZ9A 4RW4A 5B0EA 3TZXA 2X51A 3MF5A 4V19J 4AQYE 4YB1P 1VCTA 2HYIB 1EP4A 4Y6IA 2EKYA 4FVMA 5HMWA 2MKKA 5HJXA 5B0DA 4OHWA 2MGZB 2X1FA 3QAUA 1N48A 5K36E 1VJWA 4NASA 3ZZOA 4ES1A 1IBLF 4KHPI 1AYEA 1IJFB 1WC4A 4QNKA 2EBGA 1KTVA 2XZTB 3BGLA 4JI8F 2CRLA 4TU7A 4DR1F 2C2DA 4K0KE 1RAIB 2VOOA 4O44B 4B3OA 5EUHA 4EGLA 1X4CA 2E1MC 4Z37A 5GADU 4DR6E 1CQMA 4I69A 4RW7B 4TVAB 3C15A 1Q0NA 4OYBA 4ZJQA 5LXYA 4F2RA 4DFJA 2AE8A 3S01A 5I42B 4LFAF 3F56A 3NEKA 2C2RA 3MMCB 2FJVA 3PM9A 1S10A 1I1GA 2A2CA 1HMVA 5LSRA 4ED0A 4U95A 4Q45A 2PSZA 4H4MB 3H25A 1HYSA 5HP1B 2E7VA 5LJ3Y 3DLEA 3IRWP 1LW0B 3ENVA 3W63A 3CSKA 4M95A 4DLGA 2BW2A 3OL6A 4DV7F 4DDFA 1KSPA 3HVTB 4M63A 5FLXQ 4AM3A 1WOOA 1J27A 2HFZA 2R8KA 1FWPA 2V69A 1Z1ZA 4LSNB 4NPOA 1WTBA 2IMOA 2MY8A 1XMOF 4I4BA 4J37A 5DJBA 3Q24A 3QT6A 1X9WA 1J5EF 5LMUE 3QT7A 4L3KA 3P3DA 2OPQA 4AE5A 5IFMA 2ZH6A 3QRQA 4JYAF 3CDWA 1CJKB 2YQ1A 3PYFA 3HFKA 4P7VA 3CC7S 1S1TB 2XLKA 2ZM6E 4M94A 3PRBA 1X7VA 2I6WA 2YKMA 3OUYA 4LFBF 4DCOB 3L4BC 4F0MA 2CDQA 4DR6I 4FF3A 2LLZA 2IOPA 2F7VA 2PFDA 2LFVA 2VIHA 3R1LA 1NH8A 1RTIA 3I0RB 4LSLB 4M5IA 2N7YA 4KSEB 3CXCR 2KN4A 4DZDA 1L5UA 2MSSA 4F4KA 4Q7AA 5SUHA 5MLCV 3MR2A 4ECTA 4P7AA 3G71S 3HSDA 3H5UA 2K3IA 2B6AB 1NSQA 2N82B 3C8YA 2OTJS 1BY9A 2VBYA 3M6XA 2C2NA 5A2QC 1NDKA 3KXDA 1IBCB 2CWXA 1MROB 2DXEA 2ADBA 1C4AA 1RTDA 2XZWA 4DR5E 1SV5A 2WCXA 3LQVA 2AEJA 4B17A 2GO3A 3V6JA 2O3ZA 3MOJB 2C2ZB 1VK8A 4JYAI 1BQMB 3T1HI 3RB0A 3LGMA 4X84A 3BPSP 4DPOA 3UN2A 1NJWA 1A9NB 2ZDOA 1URNA 4OO1B 1ZXNA 3EICA 1PSDA 4LFBI 1RYRA 3CCUS 2BQUA 3DRSB 1YI2S 1HNIB 5A8RA 4Q43A 3PW0A 1FKPB 1VHFA 1A6FA 1E6YA 3DLKA 2HNYB 2XMTA 2BQRA 4JV1A 4P2MA 4OI3A 3OFFA 1TFWA 3IGVA 4U7UK 5LMNJ 2F9JA 4QYRA 4F0KA 4YEAA 2UXDI 3R6LB 4GQUA 5E3CA 1VRTA 4KFBA 4OV1A 4DQSA 4IR1A 5F8NA 2YPZA 2JC1A 4NYPA 3R7SB 4DV0I 4P10A 4ICLB 1X9SA 1FRIA 1HARA 4ZVTB 1SC6A 1UKUA 1WG5A 1PJ7A 3W8PA 5JVHQ 4ZITA 3HJFA 3OW2R 2EK1A 2EW9A 4W90B 4TYBA 3LPSA 5I42A 1TQLA 3MEDA 3MEEA 3N5FA 4OIXA 4A8KA 4LFCE 2VD3A 4KQVA 1ULRA 1B0PA 4Y3CA 3A8JA 1FWLA 1JJ4A 4HDGA 3EPIA 2FY1A 2HZVA 1TMMA 5IT9Y 4IDKA 1SJFA 2FLPA 1RK8A 3WHIA 2XSFA 1KQKA 3HXMA 2RRBA 2KTQA 4M5DA 5HBMA 4CLZA 2H4WB 4DR4J 4ZVHA 3T41A 2DY9A 4K50A 1RTJB 1Q5VA 4GO7X 4NL5A 5CAAA 3JAMC 2ZNYA 2I2YA 3WC2A 2AZ1A 3IWNC 2AT1B 2JX2A 4DBQA 2VDIA 1OO0B 3GG0A 2C3PA 4GKKF 1S57A 2GFFA 4U67Q 2UZAA 2AJQA 1RAEB 2OPSB 3WZ0A 3PIOQ 2VODA 1VIOA 4Y65A 1SJ4P 4B3RI 3RUBL 4DR7E 1EP4B 1Y5LB 1WORA 3A1YG 1USUA 2G2ZA 5E3AA 1RWKB 3DN9A 5JJBA 1XNQJ 3D67A 2MY7A 2Z4PA 3KMSA 3OFEA 4ZP8A 3MM8B 2ALYB 1FRXA 3N01A 2J65A 1R89A 2Q2EB 4CP5A 5LXRA 4Q8EA 4CO5A 2J7KA 2GO9A 3V6KA 2HMIA 5IT4A 4PUOA 1IWGA 1A0OB 2FPHX 3O1LA 3LP0B 4HACA 4ID5A 4ECQA 4WP8A 2FHKA 3C6TA 2BANA 4WP3A 4DR1E 2ZD1B 3SQGA 1IQTA 2E9ZA 4NXNE 4PG6A 4DF8A 4N3OA 4OJ3A 4ZP7A 3RB6A 3E8OA 3QQCD 4J9RA 4DV3F 4LF6I 5DLFA 3PRDA 3FKBA 2GQ2A 3CJ0A 2LEAA 1D9FA 1TVRA 4FPIA 1Y10A 3OTEA 1FEEA 2CZ4A 3V2UC 1CBKA 3J7Z5 3RAXA 1NDPA 2MMYA 3MI7X 1Y4ZB 5L1KA 1S4FA 3BKUA 2FTRA 4B3SJ 2BACA 2VASA 4DQRA 3T1HJ 1D1UA 3AOAA 2IJNA 2K06A 3GLJA 3ILLA 3R3TA 3K89A 4MIWA 4ZVFA 3OTOJ 4DV5J 3DRRA 5H9EJ 3DMJA 4OO1A 4WUBA 2UUTA 5C0XC 3E3XA 4OFZA 1I6JA 4OZ0A 2E5LJ 2JEAB 1X5SA 3LALA 5KFGA 1SKRA 4WUCA 4LSZB 1CULB 4J7CA 1G2EA 2V2KA 1ZM2A 4QBUA 3OL8A 4LFAI 3KYLA 3GJTB 2W9BA 2BMBA 3T1HE 1U6ZA 2DXFA 2W9CB 3VAGA 3NMRA 1SUQB 2CJXB 5FD1A 3HM9A 2R7SA 2F1DA 5ETNA 1XMOE 3U1NA 1N5QA 1OQ6A 4LIWA 3FMWA 4L74A 4P71A 5ETRA 1KP6A 2V8PA 3H2VE 3LPYA 4XK8C 1AXQA 1LW2A 1G7CB 4JI6E 5IWAI 2HQIA 1S9GA 4JBCA 2E5IA 4P73A 4DN9A 3TI0A 3IC1A 4HHHA 2RSQA 4JI3F 2NXCA 4ED5A 1UVNA 4OO1C 5DQGA 4FW5A 1XTZA 4OJGA 3JSYA 2HNZB 5KFWA 3OV7A 4KY3A 1S9EA 1RTIB 4LSLA 1FO1A 2V63A 3R1HA 3J7AN 4G1IA 1HBMA 1T9XA 4Y28C 4EZ9A 1O6XA 1ZA2B 2J9DE 1IKVB 3J80Q 4ZKAA 2C2MB 1KVJA 3D6MB 2DNQA 3WQPA 5BR8I 1KN6A 4XDCA 4DV2I 1S5ZA 1N32E 1KQSR 1U48A 4HYKA 3NCRA 2B8QA 2ZZNA 5DRKA 1XMQI 4K0KI 3QZ7A 4ELTA 4QCLA 5F8IA 4NCAA 1REGX 5D78A 1FHTA 1UTAA 3M7VA 4WFZA 4YHHE 3T9NA 1ZA1B 1KLMA 4NI2A 2J5AA 2KXHA 3MMAA 2KT5A 1D6TA 4E2FB 2NXUA 3D6TB 2J8AA 3OXFA 2JLGA 4LRBA 2ZBQA 4WZMA 3NAHA 2NPFA 3US5A 2ZH8A 2BOPA 4RU2A 1FKPA 4CCHA 2LCWA 4NEYA 4KJIA 1F5CA 1HL6A 5BJRA 2D69A 3QRRA 4OI4A 3WX4A 3K8WA 2V94A 3QJPA 4C11B 2W9AA 2RF2A 4QU7A 3MAHA 1FJ7A 1TZ0A 1JLBA 3MEGB 1WUUA 2WSFC 2QMUB 4ZPTR 1O0PA 3SIPB 3P76A 2I9SA 3M6WA 4DWIA 1KBRA 2B0GA 5D4PA 5JXSA 1K0TA 1OMSA 4X4VA 1NM2A 2H54B 2XYHB 3DLGA 4JI0I 1VLOA 5K8NA 4QWDA 1HWUA 4ECWA 1XMQF 1QAIA 4TLRA 3HVRA 2ZBKB 4OO1F 1CLFA 1RT3A 2D7SA 3Q8SB 2MPUA 4K8RA 2K8GA 1Y11A 3MM5A 2J0XA 1HFEL 2V9KA 2L9WA 3MM7B 3PNIA 4Y2CA 3QO9A 4IFVA 5L9XA 5B08A 5EWGA 4X66F 2QGFB 2VFRA 4JI0E 2JEFA 3RB3A 2VQFE 1OYPA 1N34I 1AW0A 4YY3I 4IFDD 3DC2A 3THPA 2MQ8A 5IZHA 1Q1KA 3NS7B 4ZPAA 4DV0F 1VC6A 1TL7B 2F4VI 1XR6A 5JMNA 4JI3J 3CD7A 2CQ4A 2VQEJ 1CJVA 2GVDB 4GRSA 4CM0A 1U1LA 3GSDA 4DX6A 1DHMA 2AEFA 3TJ9A 2E1AA 2V0NA 2O5DA 2GJFA 3MECA 5BYQA 1HLWA 3DFEA 4QIEA 4DL4A 2GC8A 3NY0A 2BV3A 1JXEA 5A8KA 4C8KA 1CVJA 4F36A 4YR0A 2RB7A 3MWBA 1FK9A 2HVEA 3AH6A 3NGUA 4LFCF 1NZ8A 2DHSA 3BN4A 3W64A 2HBQB 1JNRB 2PN6A 5CD4A 3B78A 4DR7F 1F6TA 1HW8A 2B5JB 2UXBE 1T03B 3M8WA 3RRGA 4YR2A 4DPTA 2XS7A 2VB6A 3CJ4A 1LFWA 4CNZA 2RQCA 3JSMA 5L3JA 4CWBA 4C9DA 5DG7A 1QTMA 4DSEA 4DG1A 5LSLA 5DM6Q 1N54B 1N6QA 2QL5B 3J7AM 1S6UA 2XLJA 2K7JA 1ACMB 1PC4A 2YWWA 4LT6A 5CCMA 2F4VF 2UUAJ 4X65E 5GMDA 5IT9U 4DUZI 2KDOA 1N5YB 1KR4A 2AJ1A 3NOCA 3HMJG 4AQYF 1LWCA 4F3OA 3J7AG 1TKXB 1CC7A 4NLGA 2L3MA 3AOBA 3A3NB 3Q8PB 4J9PA 4KBIA 4M5JA 1T05A 1QE1A 3A8EA 2BRLA 4I2QA 4N8OA 2RKIB 3MM8A 4CLYA 1S72S 5KFHA 2J0WA 4TU9A 3CD0A 5KT6A 5A2QY 2HHQA 1E3HA 2FJDB 3DRPA 3TO8A 4HTIA 3UVJB 4MH8A 5THWA 2XMKA 1RHQB 2U2FA 5DETA 3SZ2A 2CQCA 5A0YA 2FLNA 4LF6F 3U27A 2ATLA 3CDUA 2CXEA 3OJUA 2CIMA 2EK6A 4LQ9A 3TVKA 1R6YA 2JRSA 2Q43A 3HK2A 1K47A 2E9RX 3BQ2A 3ITHA 5B7WA 2ASYA 7FD1A 3E2EA 3PZPA 4DR5I 2OPPB 1OPIA 2HHVA 8RUCA 3D2WA 2CPIA 2CG8A 3G6VA 4FF1A 2PFFB 2OMOA 3GE9A 1CJTA 3ET6B 4ZPDA 4PZVA 2BA0D 3WU4A 2VC1A 3W1YC 4LF8F 3NNCA 2KFNA 3NOGA 2MKCA 1LEOA 2ASDA 5ETPA 4I68A 4JI3E 4EBCA 3B82A 3OFHA 3UDCA 2EBEA 1Q79A 5DG9A 2XQCA 3HKWA 4B3MI 1DLOA 1ZZNA 4K4ZA 1JLFA 4LQ3A 1IN0A 2GAHC 4A46A 2COLA 2JH3A 3FVYA 1Y5YA 4ES2A 4NLVA 2YNFA 3D28A 4EYIB 1VQOS 3VQTA 4DX7A 1NJXA 1HW9A 5LL6R 1UWBB 6FDRA 2XB2D 4YS2A 4U3BA 5C0XD 4ZN1A 2XS2A 1YK9A 4EUVA 4DUYJ 2R7OA 3R2CJ 1RHRB 1AT1B 2HBZB 1VC0A 1XNRE 3MMBA 2DNLA 2ZITA 3FCHA 4NLTA 3ZZUA 4TNOA 1FI4A 2FD2A 1A6LA 2QL7B 3OR2B 5C2CA 2MHNA 3ICLA 9ATCB 3HVAA 4JI2J 1VQLS 2A10A 4YY3J 2Z57B 3K7RA 3AQOA 3CIMA 5I3QA 1QVFR 2E7WA 5LJ5Y 3GB0A 3ISZA 4USWA 3H2LA 4DX5A 2R7QA 1KTQA 3MUTP 2UUCJ 5KG3A 2ZOMA 2XNRA 1SV5B 2VPYB 2IM2A 3S1TA 1HNWJ 3ZTPA 1T7PA 5AXKA 3H7HB 4JI8E 5F8MA 3DDNA 4X65J 3FQKA 2UUAE 5T7LB 5IS2A 1F5AA 1NXIA 2CPZA 4FN5A 4BA1A 3GZ7A 2BE7D 3TUIC 1NSKL 2CJYB 1W26A 2UXCF 1APSA 4IO1A 4DUZJ 1LFPA 1U02A 2YKAA 1V3SA 1SL2A 4YHHF 1N5TA 3C46A 3HSJA 1FRHA 3J81Y 4J9KA 3M2UB 3EXCX 1O5JA 3UN3A 1Z0TA 2VKRA 5DLGA 1ITPA 4OI1A 3DYAB 3TVYA 4JI8J 3VVTA 1G4CA 3DGPB 4OJHA 3GV7B 2CQBA 4CT9A 1JWWA 1JLEB 2MEWA 5KG0A 4JI0F 1VISA 1Q8BA 2IJFA 2RF2B 1E3PA 4LBIA 4B08A 3DLHA 3UHMA 4B3SE 3QFHA 3MEEB 1U1NA 2VPXB 4CLUA 4WZQA 3F0NA 5ETKA 3QZ8A 4Q0BA 1XMBA 1HNZI 1NLKL 4LSNA 5CYQB 1FA0A 4NCBA 2W4DA 1RDRA 2C22A 2XSJB 3LUYA 3UFCX 2B3TB 2FLOA 3ENQA 1N34F 1SQGA 1GEHA 3V6DA 1PKUA 5HP1A 4OJ1A 3RG6A 2HHHF 1N33J 3DI6B 1MU2A 2Z5BB 1C1BB 2Z0GA 1JNZB 1RTZA 4LVOP 1TL3A 2IYGA 2PMZD 1M5VC 1YVFA 3FZBA 2HFVA 3N79A 4WK3A 4XPEA 4DUYF 4G1QB 3CE8A 3HD2A 4HHUA 4RW7A 3FCWA 1TP7A 2AJ4A 4DR5J 2E9TA 4K5RA 2ZM6J 5LOQA 3EDQB 1NJIT 1BKNA 3CJ8A 2GO8A 2W8LA 3SCJE 3TEHB 2PNZB 5DZ6A 5KFYA 3LWMA 4NCGA 4JI1I 1DQAA 2V4JB 3R27A 1N56A 4J9VA 4LFBJ 2HRYA 2BOAA 5KFNA 2OTLS 8AT1B 4DQIA 3IAS9 1VBXA 2UXDF 2EEYA 3CDJA 4KB7A 2HVHA 4F25A 4OYIA 3GCXP 1RHYA 4DCJB 1S48A 2B43A 2Z2LA 4KHRA 4ZVEA 3C14B 4N7TA 1ZBTA 3DM2B 5DDRC 3RB4A 4DCPB 3DHWC 4ZCLA 5J2QA 4QYZJ 4MQYA 1U0HB 2K1RB 2M3DA 4AL7A 1WF0A 4B3RE 2LQBA 4DUZF 1AZSB 3CIZA 3MFHA 1FTRA 5K9FA 1SQEA 2UU9F 4PWDB 1JJHA 1FDNA 4P2SA 5HMYA 1JJ2R 1EA6A 4DUYI 1I51B 4H54A 4DV6F 4FKXA 1N5YA 2CJBA 2HEKA 2WZ1A 1X8DA 5D4OA 3ZZTA 4HVZA 1B7YB 4X4TA 1T05B 4DV3E 3KUEA 4IRCA 4KV8B 3DRRB 4P52A 1U8SA 2VKZG 2R8JA 5FJ4A 2LA6A 3TA2A 4IZJD 4YB6A 4ZVIA 4X4RA 2XM3A 1W7WA 5FIIA 3HHKA 5M2PA 4DV2F 3NRBA 3BB5A 1U2CA 5M2RA 3RBXA 5K14B 4EO6A 4IFDC 4WYLA 3O5TB 3T5HA 5C24A 1H7UA 1DY3A 3MZIA 2OEMA 1DBDA 5K14A 4ED6A 1K73T 3Q2TC 3G2XA 2V6AA 4BWJA 3LAKA 4K4UA 1T0TV 3JAMU 4AUKA 2DPJA 2F5GA 2QYCA 3CDBA 4CH7A 1WDTA 2WNRB 1ZAVA 3WU3A 4LF5J 1HR0I 2ZC3A 4UY8T 4BC7A 3K2YA 5JEAE 1DTTA 1UZHA 3OR1A 1HMVB 3D1HA 2BKNA 1YWXA 4KPCA 5DO2A 5H9FJ 3UNYA 1UWBA 2QLBB 2OJ3A 4UUWA 3THTA 3OVBA 2Z5CB 1S1WB 1VQ4S 2LXUA 3TR5A 2HWTA 2RVJA 4F8RA 1FNOA 4QNJA 4R0EA 3K5LA 4KGMA 4LUBA 3DLLQ 4K4XA 3MCMA 2NS1B 5KFTA 5DDQC 2DH8A 1XNRI 2ZM6F 3ILJA 1WC5A 4YUDA 4NZ6A 3VCDA 2RDJA 2AYGA 3D4JA 1ZTWA 4OMFG 3MM5B 4CQ1A 1D8YA 5ETTA 1RHMB 3D3BJ 2CQDA 2H51B 1ZH5A 4J5OA 2BBEA 1HQUB 4LCGA 5B0FA 3NZKA 5H1SV 1OWXA 3EUNA 5HBMB 4JI1E 1HBOA 4RW8A 2XHWA 1HQUA 4X64J 4BC9A 4E8UA 3HKMA 2DGOA 1IKYB 3A8IA 1Q8KA 2NYIA 3NCQA 4HH1A 4PPDA 2VG6B 1NK5A 5KFAA 1NHJA 3Q86A 1SJRA 3P3GA 1UFWA 3RBEA 3L7ZB 5AE2A 1OPZA 3QBCA 5DM7Q 2C2KB 2KZMA 2YH1A 1FT8A 2QFJA 4C0HA 1SCJB 3AD7C 3MAAA 5D0GA 3R7NB 2ZM6I 4ZVQB 2FVSA 3ELHA 4B9LA 3LO3A 3D66A 2F63A 1DRZA 4MTPA 1IBLI 5IM0B 3FJ2A 3J81Q 4OZLA 1QSLA 4ZVUB 4OZ5A 2R7XA 2WTFA 5C0XA 3V81B 3QWUA 3GJQB 3MMCA 1TAUA 4WBFA 3MAQA 2JVRA 1B62A 3KJVA 3VF0B 3MTKA 3BV8A 2ZE2A 3BSCA 2ZVIA 3M2VB 4EMDA 5GAGU 4NLRA 1NSAA 4WTYA 4N5SA 5HLFA 2KFZA 2OELA 2GQ0A 1CS4A 4OYOA 1FKOB 1DJ0A 4B9UA 4OZEA 1U09A 2VU5A 2WOMA 3ILOA 4FNHA 5AJ3F 1RT5B 2CQPA 1RWVB 1R43A 2HLUA 2I8EA 1RTDB 3QRPA 2RQKA 2J8SA 2OP5A 1XR5A 2QIFA 4C8LA 3BSNA 1IKWA 4A48A 2JHEA 1V3RA 2FJXA 3V4MA 2J9DA 2ZBCA 2M7SA 4KKOB 4JV2A 2FJBB 4WFAQ 4DV7I 3DGVA 4EEYA 1JJCB 4N47A 2AQ4A 2IM1A 1JMTA 5HJYA 1CJUB 2FZCB 2VF3A 3PJ9A 1XJWB 2GX8A 3HHLD 4C6AA 1SVDA 4X2BA 1WC0A 2MKSA 4ZLNA 4KHPE 1MWZA 2R3VA 2WONA 3E01A 1QLNA 2UXDE 2QO3A 2LA4A 3JXOA 2BVZA 1WG4A 2D1CA 5I3UB 4ECYA 1IBKI 1OJ4A 1REVB 4DV3J 3SFUA 3TUZC 2R2UA 1SL1A 1U8WA 3M32A 2DJWA 4J9QA 3OR2A 4FW6A 2IAJB 1UFLA 2PNZA 5HVGA 4YB7A 1N0VC 5H9EK 3SFGA 3W5YA 4IR9A 4JYAJ 2LJPA 2DGUA 1LKZA 3AA8A 1TL1B 4USUA 4EI2A 4DR6J 5F8JA 2D9OA 2ILYA 2QRRA 2BJEA 5KT4A 2G0JA 2ZH1A 4X66I 4NXME 1JLFB 4UTGA 3I82A 3CJKA 4DZ6A 4JI7E 1V3ZA 3MEGA 4I6AA 4WU3A 2HVIA 1UZDA 4F4AA 1R31A 3DU6A 4NXNF 3RR8A 1HK7A 3DCAA 3R6GB 1LV5A 4PABA 2LU2A 5K36A 3JTPA 3MPWA 4USIA 4WUDA 1N33E 2J9EA 2IFXA 2UU9I 3K5MA 3T1YF 3PYGA 1U0HA 2HWIA 2DHAA 2K1RA 3VQSA 2LQ8A 2AX0A 4F4YA 3ENWA 2WVCA 4XPCA 4PWDA 1Y60A 4DV6I 4B9TA 1IBKF 2EI5A 2QA4G 2Z2YB 3TARA 2C37B 3MPYA 3NGDA 1SI9A 3B4MA 4OX8A 5J1NA 3KK3B 5IT0A 4NRUA 3DRXA 1WI8A 2CJAA 4WK1A 1P6TA 3GV5B 1G3OA 1U45A 1U6BA 3VHQA 2BR2A 2HHHJ 3VR1A 2EFOA 4DN0A 2AKWB 5GMKa 1H2TZ 3G4SS 4USTA 1YJRA 3JSRA 4O3PA 2VBWA 3PY8A 4FXVA 1NPKA 2U1AA 2DKOB 1FNMA 2HBYB 3EVOA 3T5JA 4KAIA 1PG5B 4PRXA 3TRGA 1UAWA 3BSOA 1FRJA 1T3NA 2BJ9A 1FFWB 3T5LA 2JFKA 2WP8B 2JLEA 1EKRA 2ZH4A 5LL6d 1IQZA 4FKYA 3KFWX 1XWLA 3IR5B 4I7FA 4MFBB 3Q8RB 1UVIA 3WIUA 4KTQA 1WSRA 3IP0A 2Z5BA 3FNNA 3CEDA 5KFSA 5AT1B 4UOGA 1S16A 1U1OA 5JEAF 2C3MA 2GZOA 2HK3A 3JTNA 4CI0B 4ZVOB 4A47A 1B0VA 1HI8A 2F4FA 1PAUB 3ZZPA 5B0CA 2KG0A 2EWHA 3AD8C 4A8SA 1XNRF 3M8QA 2YPYA 5GAHI 1QY7A 3HLUA 5CABA 4OI0A 3PW5A 1TL1A 2GS8A 1SJ1A 2P6TA 2Z30B 3EM1A 5D15A 4ZVPB 4IFYB 1ZYQA 1HBUB 1VBZA 3W3SA 3FSIA 4S0MA 2VV5A 1GX6A 1H6KX 4L75A 2MZ1A 1FNXH 3EGWB 2GHWA 3QIPB 4NLOA 3Q0AA 2PNMA 5LMNE 2KKHA 3HHLA 4R25A 3E01B 5I3PA 5L39A 1YIJS 4GKJE 4ZHRA 5CH7B 2A6OA 3KK1A 2A18A 3CULA 2VPZB 1RYSA 4FWHA 1TKTA 3M9OB 3OTOF 4ZP6A 2DCUB 5K8PA 3MECB 2DBBA 1I94E 5ETMA 4CO0A 3BBCA 4WJBA 3HPOA 1NHHA 1F5BA 1RU2A 1FDBA 3DOMB 3TQ1A 4KGVB 3JS9A 4Y2AA 1QAJA 1HWJA 2JNJA 2BJDA 4DV3I 2DR8A 1B99A 4IH6A 1X4AA 2AYBA 3IG1A 3ZFVA 5D0EA 1UW4A 2EFNA 3AB4B 3PFEA 1U1QA 1V9OA 1U4BA 2B9EA 1SC1B 1NEEA 2XI2A 2V4JA 5D4NA 1HA1A 3EDRB 2WOMB 3MR6A 1Q4RA 4ZPWR 2P9EA 1M5SA 2Z2ZA 1B4SA 2Z56B 1NAQA 1RT5A 4BA2B 1X0FA 4FS2A 2EG1A 2VFVA 3SSSA 1NK7A 3CCMS 3HT3A 2FJAB 3SCLE 2XWXA 4EBEA 2A2DA 2HPUA 2JSXA 3CCQS 4LF4F 4F02A 4KHPJ 4PQUA 5A6WA 2XCPA 1U6FA 2PNLA 5KAKA 1P1TA 4KIAA 5F9NA 4PQAA 3ZXWA 5MAOA 2J6SA 3SSQA 3H0PA 4IFDB 2R9LA 3S6EA 4LR8A 2W4CA 4Y34A 3TUPA 4HTJA 4OO1E 2F3JA 3NNHA 3KDOA 1TU0B 2DR6A 2QMWA 2Y8WA 3C6UA 1WI6A 3I32A 3VALA 3T19A 1NKCA 1QAXA 3EMTA 1RUSA 2QG9B 4J9UE 4MT1A 2HNYA 5CZVA 4PPZA 1IR2A 3KJNB 1M5HA 4W98A 3V6DB 4P6QA 1ZAXA 5J2PB 2QA4S 1UVMA 2WP8A 4B3ME 4IKAA 1HNXE 4DSKA 3ZNJ1 1S7HA 1X4EA 1EAYC 3OTOI 2GGPA 2C38A 2CQ1A 4C8MA 5BR8F 3KHLA 1W2BR 1X0PA 3RRKA 4B9SA 2OH2A 2VONA 4X62I 4IFDA 3LOUA 4JI4J 2HS0A 2KJWA 1IKVA 4Z7CA 3AHPA 5C42B 3BO3A 2JE6B 2C39A 3CDIA 4TXSA 1JX4A 1VFJA 5KG7A 3NL0A 2UUCF 3JQJA 2I38A 4BCAA 2HHHE 3UCUP 5A8KB 2D41A 2V68A 4HDHA 4L6V3 1WKJA 2F9DA 2JWNA 5C0XB 2F1FA 1QM9A 5I4MA 3NWGA 3RW7A 4ANCA 2DR7A 4IRDA 3GG1A 3KUGA 1FJCA 2HFOA 3FEXB 3UPFA 5J2QB 3QWPA 4NWBA 2AHOB 3QPIA 4YHHJ 2KZZA 2FVQA 3QIDA 3T1YI 2JJ4D 1RKIA 4ZIWA 2NXEA 1FESA 2HFSA 1U49A 3NLCA 1RADB 2WVEA 2FHJA 1VQ5S 3BBBA 4UY85 1B64A 3K1JA 4DV2E 4OYWA 2H5JB 2ATCB 3MXHP 4URSA 3V4IB 1IR1A 3GJSB 5B0BA 3W9IA 4N41A 2HHUA 1WSVA 3TX8A 4JV5E 4FF2A 4QPXA 4LCFA 3Q8UA 1N88A 1UPPA 2VQFJ 3R5GA 2KO1A 2AW0A 3KK3A 3OQ2A 4LFCJ 3Q8QB 4ISAA 1MN7A 1MMNA 4EBDA 3DLGB 4QR1A 4WU2A 5U47A 3F44A 1Q78A 1FKOA 2C37A 7AT1B 4ZOSA 2MJUA 2BE2B 2IIHA 2PGCA 3W2VB 5CD4H 3M9NB 1RR9A 1MWQA 4GMKA 3BGFA 2ZD1A 1YJVA 2BW7A 3SQGB 4YY3F 5KFVA 2QJ3A 4F3MA 1WEYA 2NPIA 2BXJA 4LR9A 2HBRB 1JXLA 1S6QA 4ETZA 3KOAA 2AD9A 4AIMA 4YOEA 4WFXA 1WELA 1LWFB 3QGIA 2X1BA 1BE4A 2AMCB 4UUXA 3W2WB 3KNAA 1T8EA 4LFAE 1N0UA 4DV0J 3KLVA 1B3TA 2XMJA 1R8HA 4MK8A 4C8OA 2CA9A 3FRYA 1ZOTA 2LKZA 3KUHA 4B3TF 2G0IA 3CWVA 3U1YA 3HJVA 5KFIA 5LMUI 3GIIA 4G3IA 1JLGA 3NCPA 3O8WA 4OX7A 1SC3B 4GKJF 1NB2A 3DU5A 4NLQA 2AJ2A 4X62E 1PBAA 4DF4A 2DXDA 2KB2A 4PEOA 3BKFA 4CO3A 3C3LA 6FD1A 1Z0EA 4BS2A 3B4DA 1TUVA 2MKYA 1HIYA 2HWHA 5KFDA 3KK2B 3H5YA 2HFNA 3LGNA 3V6HA 2HHXA 2NN6E 5FDLA 2YKOA 1M1HA 1CPZA 2GA7A 2XNQA 3F41A 3RW6A 4E0DA 4KO0B 5HROB 3HO1A 5GMEA 3K5PA 4JUZA 2ZJQQ 3IS9A 1V6HA 3UWTA 1M1KT 3QLHA 2FJEB 2QYGA 2R7TA 2NUHA 4DL5A 4QU6A 5AXNA 1R0BG 3T9ZA 4OO1D 5H9FK 1S12A 1JKHB 2P8IA 2RS8A 2BKPA 3CJRA 4OI2A 5A0YB 2M8HA 3NS6A 4URGA 2XY6A 1HKAA 2HHSA 5L8RC 3SQOP 2DITA 4ECZA 1Y3JA 2ZOGA 1HBNB 7FDRA 3M85D 1P27B 1VRUA 2CNLB 2GW8A 3CGIA 3HDSA 3WBZA 4IG0A 1X4DA 1YQHA 2BRKA 2Y0BB 3P45B 1RGVA 3UNGC 2HRTA 4DU8A 5T14A 3OTCA 2O1PA 4WXOA 5J1PA 4ECUA 4W92B 4IRKA 5FLXC 4LBPA 3BM7A 2JOQA 3MGJA 4C0OC 3A13A 3MTJA 3HP6A 2W2OP 5KT5A 2NSCA 5A2QQ 2HQ3A 4N8NA 2HW3A 3MCSA 1P9QC 1WHXA 3BYPA 4WE1A 2G2YA 3KHGA 3BYRA 1PVGA 3W2VA 2CPYA 1S1UB 2EKNA 2DNPA 2M5YA 4USVA 4QWAA 4P2FA 1RWOB 4DR5F 2V4RA 4WTOB 1U24A 1Z4UA 4Z7YA 4CT8A 2OAUA 2G13A 4QIFA 5A8RB 1C4CA 4QWCA 5F3ZA 4EYHB 2UXBJ 2B7BB 1SBRA 2LQJA 3N6NA 1Y7PA 3BF4A 2HLTA 5K5MA 3RGIA 2FGOA 3FK4A 4ENOA 5KG5A 4LF8I 1NZ0A 2I5JB 1Q95G 4UOHA 1I94F 2C2EA 4WIIA 5DDPC 3RRHA 2VA3A 4FDFA 6AT1B 5HMZA 1FK9B 1N4LA 1CEZA 4PG7A 3R5DA 4ZLJA 1OYRA 3D0IE 4HXZA 1WHVA 1NK9A 2WONB 4QWBA 1TAQA 4KH0B 3TJAA 1JLGB 2LECA 4B3MF 1Z5AA 4NLSA 3PJXA 1XXEA 3PW7A 2DGVA 2O01C 1I94I 1H98A 2C3UA 4RO0A 2AGOA 5C7PA 1KD1T 2GVDA 1S1WA 2XYGB 4MFBA 4ZPVR 2FVRA 4DV1J 1H7XA 3D6FB 3MCNA 1UJ4A 3WU5A 3I96A 5IWAE 1NBEB 1HWIA 1RT3B 2YBVA 2ZOFA 4FW3A 2CVIA 3LAMA 2JT2A 3TJ8A 2KRRA 4DV6J 4ID8A 1T95A 2NN6B 1S79A 4YR3A 4NLXA 3AODA 3HT0A 1ZPWX 2RUGA 1S6PA 2G4BA 2JVOA 4NOHA 2YQ0A 1DARA 1LXNA 3D6HB 4DS5A 3OUYB 4IFYA 5CXTA 3O3LA 4QW8A 5C25B 3B4TA 3CMES 2HHHI 2NR0A 2XY5A 4NXMF 4DV2J 2I1RA 4I1TA 4RW6A 2VG5A 4MKBA 3RZAA 3JYTA 3UVJA 3GONA 4CZCA 4ER8A 4X4NA 3Q1QA 2D3OR 1B70B 4LFAJ 3HZGA 4IG0B 2PO0B 4HLBA 5KFRA 2WRMA 1R0CB 2UXCI 2DGTA 3TX0A 1VBKA 4JI1J 2DPIA 2MB0B 3T1YE 3M8PB 5HATA 1SPBP 4MIAA 5F41A 3NGRA 2UUCE 4OX9E 3PFOA 1GFWB 4X4SA 3HHNB 3LP1B 3EZUA 4UQGA 1NUEA 3M8PA 4TYAA 4DV7J 3EGVA 3MAAB 4UZBA 4JV5F 1BLUA 1CJTB 3ET6A 4TY8B 4RNFA 2MYFA 3K5NA 1N33F 4AFFA 2CDRB 4M5LA 4Q2LA 3L09A 2E44A 3AOCA 2XY7A 2YX7A 3JB9k 1N8RT 4MU3A 3BH6B 2CUYA 4CLSA 2NZCA 3H4DA 2H48B 5JEAB 4NXMI 2WSEC 4EU0A 4F26A 1BMQB 1FCAA 1FJGI 1JLAB 4AD6A 4NLUA 1RAAB 1OYDA 3KLEA 1JK9B 2R4FA 4CLPA 2VG7A 5IV3A 3PR4A 2D74B 2DNNA 2Q79A 3DOKA 3G86A 4P9SA 3OVSA 1NK8A 4PQUB 2GMJA 3HZEA 2DCLA 4NMLA 3NMAA 1Y5IB 1YDLA 4G1QA 3RBDA 1X60A 4KYZA 3UD4P 3DRPB 1VMBA 3VGTA 4NXNI 2Z5CA 4I67A 3P5BP 2E5HA 1R6VA 1SH0A 3SEOA 4LF7I 1FE0A 2ERRA 1S59A 1VIXA 1N34J 4LOMA 4O0NA 3D9BA 1RAJA 3MCOA 3AJ1A 1LWFA 1ROFA 2NSBA 2QSWA 4AT1B 2GV1A 2WNRA 3GIKA 2XGPA 3M2RA 5LMUF 1S97A 5LM7E 1H73A 1Y0HA 1OSDA 2UUBF 3UW1A 3KTQA 3OL9A 3MMBB 3CMAS 2AYMA 3QFWA 2HNDB 3K5OA 3IRXB 3WX8A 4ZCKA 2W8KA 5I3UA 1O8BA 4DL2A 4XIUA 3EPGA 4WPAA 2AIRB 1FE4A 1PYOB 4L73A 3K0JA 4GVBA 3GWCA 2CJQA 4Y0FA 4JI7J 3M85G 1XK8A 1S6PB 2D3UA 2IVMA 1RAHB 2LQ9A 3Q6NA 3NS5A 2R8GA 1TL5A 2RHSB 1LWXA 3HKZD 4YB5A 2EC0A 2UXDJ 4WKYA 5K8OA 1VR6A 5DRPA 5K20B 2MZSA 5LMNI 4LMZA 2OPRB 1GTHA 3GSIA 1SKUB 3EGZA 1Y00A 2A1BA 2AGPA 2Y8YA 2X7IA 4LF5F 3LANA 1HI0P 3DM2A 1XNQE 2YTCA 3BBFA 3MMAB 3TYTA 5D0RA 4H4KC 4XO0A 4MK9A 2MZRA 1ICEB 4FW7A 3GMEA 4B9MA 4O3NA 5CA5A 2GQQA 4OHYA 1N36E 5F0UA 3LWLA 1USVA 1IUJA 1MW7A 3ETOA 4MYTA 5J2MB 2VESA 1IKYA 3VAMA 1RZMA 2OKQA 2FGCA 4A4JA 3OTDA 2NYHA 3A3PB 5JVGQ 2HHWA 1R8AA 3CJ5A 2GAGC 1RQ0A 4LF4E 4J9OA 3IFEA 2RIJA 2QZ8A 1J2VA 3D5MA 3GYNA 4LRAA 3DXSX 4FXDA 3CCZA 1XEZA 3PO5A 3JQKA 4DV4E 5KFJA 3I56S 4A8FA 1L3KA 1M0SA 3GLLA 2GJIA 1VK3A 4WKRA 2J7WA 1QSYA 4ZA1A 1FJGE 5HI7A 1DQ9A 2C3OA 1MLAA 3TNVA 5E3PA 3PO4A 2LXFA 4DV5E 1E6VB 1S1XA 2WW4A 2XMUA 3QYYA 4PYDA 4N76A 4B3RJ 2CNOB 5KOWA 3EGNA 2BA1G 1FRKA 3H4LA 2F40A 3ZKBA 1FD2A 2VBZA 3CCSS 4B9NA 3LP2B 3P4UB 3KJFB 1IJEB 3W9JA 1TFYA 4DFPA 1UVJA 5C5JA 1RWXB 1WHYA 4ZLLA 1RCOB 1D09B 1H2VZ 2MHEA 4DPWA 1PCAA 3DNCA 4I2PB 2HGLA 1TUGB 3KK1B 2ZH2A 5IT9Q 1DURA 3UCZP 4ILLA 2M52A 3MOZA 2G1HA 2CQ3A 2O66A 4ICLA 3T1YJ 1TV6B 4ZJOA 1XMOJ 3QNWB 3RU0A 1W2IA 2VHGA 4X4UA 1BUXA 2WVBA 1REVA 3J7YU 3N9UC 3M6VA 4M5HA 1OIAA 2MSTA 4CIOA 1S49A 3PR5B 1J5OB 4FW4A 2L48A 4JI7F 2PO4A 1ZAWA 4GKKE 3SSRA 1KOHA 2N4DA 3K17A 4ANEA 1T03A 4MJKA 4DI6A 4RPFA 3RAMA 3IR6B 2MZQA 3SBMA 2YNGA 2D3ZA 2W1BA 3HFVA 3IG1B 3KG1A 1RAFB 3CDAA 3L7UA 4BHQA 3T6BA 1YBAA 2CPDA 1TR0A 2Y0SD 4WFYA 3UO0A 5L1JA 4ZVSB 3MM9A 2YVSA 1RA7A 2C1EB 4BA2A 2DH7A 3LP0A 4HACB 5IQ6A 5LSOA 5KFBA 2NLWA 1NH7A 2HK2A 4I64A 1KONA 4DR2F 2RQMA 4DV6E 2DNZA 1GMWD 4RBVA 2MDAA 3KRNA 1YGYA 4DR3J 1MROA 5EX3A 1F9EB 2PC6A 1QE1B 4I2QB 2XMVA 1YSJA 3IA0A 2VG7B 1ZM9A 1DTTB 1SIZA 2YWGA 3OR1B 2BR2B 5HMXA 4ZHRB 4CYUB 3ADAC 4JI7I 2B7CB 3C14A 2RE1A 3OD2A 3T6JA 9RUBA 3CJKB 4I6YA 1WTFA 1N5SA 1OS5A 1TKTB 2P2CB 2R2SA 5KFXA 2J9CA 4X62F 2ILZA 5D4LA 3CVKA 1L3VA 3TP2A 5C24B 4QIGA 5JEAA 4TU8A 1YTYA 3UE2A 5C0XE 5K36D 2IRUA 3D54A 3FBFA 2UUCI 1FF2A 2DEJA 3FMBA 3PEJA 3K57A 2W2PP 5DG8A 4K4TA 2MQLA 3TEGA 1HHSA 2UV8A 4C11A 4WWSA 2GHVC 4IH5A 1UW9A 2ZKTA 3I0SB 2OIHA 2PI5A 2HG4A 4V1Ak 3SYZA 3GPAA 3D0HE 5DGAA 1T9WA
chains in the Genus database with same CATH topology
3P06A 4DV0I 4DR3I 1Z0BA 4WUDA 2UU9I 4LFCE 3PYGA 3K85A 4DV6I 4DPYA 1MG7A 4X64E 1FWLA 1EI1A 1Z0CA 1N33E 3WU6A 5FWKA 1U2RA 3JAMC 4DV3I 4URLA 2UUAI 4B3RI 1FNMA 4PRXA 1PVGA 4DR7E 1USUA 2V34A 1ZXMA 2Q2EB 1IBMI 3OTOE 2J7KA 1Z0WA 1HR0E 2Z5BA 4HACA 1S16A 4LF7E 1Y4SA 4DR1E 2HK3A 1HK7A 4NXNE 4N3OA 4LF6I 4ED4A 1KIJA 4DV5I 2GS8A 4JI3I 3PYEA 3V2UC 4JI8I 2PNMA 5LMNE 4GKJE 1HNXI 4XTJA 1ELOA 4FWHA 4WUBA 4WUCA 1ZM2A 4LFAI 1I94E 1NHHA 2HKJA 1XMOE 2VQEE 2F4VE 2V8PA 1KVKA 4JI6E 5IWAI 3QT8A 4JI2I 2DEIA 4KQVA 1Y6ZA 1Z5BA 1J5EI 1H74A 2A2DA 3J80Q 2PNLA 5BR8I 1N32E 4JI6I 2HKEA 1XMQI 3LNUA 4K0KI 1FWKA 4JI4I 4YHHE 4DR2I 4HYMA 2V2VA 4LF8E 1D6TA 1HNWE 2BM1A 2NPFA 1XNQI 1Z5CA 4DUZE 1ZM4A 4B3ME 3ZKDA 1HNXE 1WUUA 4YY3E 1XHKA 4IZKA 4JI0I 4X62I 4DPUA 3Q6MA 4LFCI 4Z7CA 4R1FA 4USMA 2HHHE 2XEXA 4JI5E 4JI0E 1IBME 2VQFE 1N34I 4YY3I 1UEKA 4DPXA 4I3HA 2F4VI 4JG4A 3T1YI 2O1VA 2HFSA 2UXCE 3K1JA 2HFUA 4DV2E 2BV3A 1QZRA 4JV5E 4PRVA 2E5LE 4B3SI 2UXBE 3B78A 4DPTA 2ZBKB 5L3JA 4X62E 1HNWI 1RR9A 4X65E 5GMDA 4DUZI 4LFAE 1N0UA 1MU5A 3QT5A 3CWVA 3HJCA 5LMUI 3B8HA 1Z0VA 1B63A 1Z0EA 4IZJA 4DR7I 4JI8E 4DV2I 2VQFI 4X64I 3HULA 1NHIA 4FWDA 1K47A 3ZZ0A 4M1KA 3J7AM 5GMEA 4DR5I 2E5LI 1MX0A 1N34E 3WU4A 3PRYA 3OTOI 3ZM7A 4JI3E 4B3TI 1Y4UA 3B82A 4X65I 2EFGA 2BM0A 4GKJI 2O1UA 4DU8A 4B3MI 4DR3E 4MYUA 5FLXC 1XNQE 5A2QQ 2CG9A 2IOQA 5BR8E 3T1HE 5LL6R 4HY1A 4YHHI 1Z59A 1XNRE 2ZITA 3ZZUA 4Z7YA 1FI4A 4LF8I 1NZ0A 1IBLE 4DR2E 3V5RA 2V2QA 2UU9E 4DXLA 4HXZA 1Z5AA 2UUAE 1I94I 4FN5A 5IWAE 4UT4A 3WU5A 5IT9C 1J5EE 1XMOI 1S4EA 1Z0TA 4B3TE 1Z0GA 4LFBE 1DARA 1N32I 1IBKE 2V2ZA 1VISA 2HHHI 4LF6E 4IZKB 3JAMQ 4B3SE 3Q1QA 3GONA 3F0NA 3PYDA 4JI2E 1HNZI 2UXCI 3T1YE 4OX9E 4JI4E 2UUCE 2Z5BB 2GQ0A 2R42A 1H72C 4LF9E 1H7SA 4FWGA 4JI5I 3LTOA 2AJ4A 4NXMI 4USKA 1BKNA 1FJGI 4LF9I 4JI1I 1N36I 4FW9A 2OI2A 4JYAE 1PKPA 4DU7A 4IZJB 2UXBI 4NXNI 2Z5CA 4JV5I 4DV1E 4LF7I 4B3RE 4DV1I 1N33I 4AQYI 4DUYI 1EA6A 1FKAE 4DV3E 4LF5E 3ZZTA 4P52A 3J80C 4IZJD 1H73A 1XMQE 3J81C 4ZVIA 1H7UA 4X66E 4DUYE 3Q6NA 4DR1I 3WU3A 4DV0E 5LMNI 1HR0I 2Z5EA 1KKHA 2X7IA 2Z5CB 4AQYE 1N36E 2CZ9A 1USVA 2UUBI 4MYTA 1XNRI 1PIEA 3D4JA 4LF4E 4KHPI 1ZM3A 2O1WA 1KTVA 4DV4E 4K0KE 4JI1E 3M6AA 4DV4I 4DR6E 1FJGE 4OX9I 4LF5I 4DV5E 2WW4A 1NHJA 3H4LA 3ZKBA 2A2CA 2ZM6I 4DPWA 5IT9Q 5FLXQ 1IBLI 1RREA 2X36A 3J81Q 2VQEI 4DR4E 3QT6A 1B62A 4GKKE 5LMUE 3QT7A 4LF4I 4EMDA 3K17A 2E1RA 4RPFA 3PYFA 2ZM6E 3LPSA 4DR6I 2IOPA 4HACB 2HK2A 4DV7E 4DV6E 4P7AA 4DV7I 5A2QC 2VF3A 1HNZE 4PU9A 2UUBE 1ZM9A 4DR5E 4KHPE 2R3VA 4JI7I 2CGEA 2UXDE 4JYAI 3T1HI 1IBKI 1OJ4A 1ZXNA 4DR4I 4LFBI 2O1TA 1A6FA 1N0VC 2UUCI 2LJPA 2DEJA 3J7AG 4NXME 2UXDI 4X66I 4UTGA 4JI7E 4GKKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 I;  4DR3 I;  1Z0B A;  4WUD A;  2UU9 I;  4LFC E;  3PYG A;  4DV6 I;  4DPY A;  1MG7 A;  4X64 E;  1FWL A;  1EI1 A;  1Z0C A;  1N33 E;  3WU6 A;  1U2R A;  3JAM C;  4DV3 I;  4URL A;  2UUA I;  4B3R I;  1FNM A;  4PRX A;  1PVG A;  4DR7 E;  2V34 A;  1ZXM A;  2Q2E B;  1IBM I;  3OTO E;  2J7K A;  1Z0W A;  1HR0 E;  4HAC A;  1S16 A;  4LF7 E;  4DR1 E;  2HK3 A;  4NXN E;  4LF6 I;  4ED4 A;  1KIJ A;  4DV5 I;  2GS8 A;  4JI3 I;  3PYE A;  3V2U C;  4JI8 I;  5LMN E;  4GKJ E;  1HNX I;  4XTJ A;  1ELO A;  4FWH A;  4WUB A;  4WUC A;  1ZM2 A;  4LFA I;  1I94 E;  1NHH A;  2HKJ A;  1XMO E;  2VQE E;  2F4V E;  2V8P A;  1KVK A;  4JI6 E;  5IWA I;  3QT8 A;  4JI2 I;  2DEI A;  4KQV A;  1Z5B A;  1J5E I;  1H74 A;  2A2D A;  3J80 Q;  5BR8 I;  1N32 E;  4JI6 I;  2HKE A;  1XMQ I;  3LNU A;  4K0K I;  1FWK A;  4JI4 I;  4YHH E;  4DR2 I;  4HYM A;  2V2V A;  4LF8 E;  1D6T A;  1HNW E;  2BM1 A;  2NPF A;  1XNQ I;  1Z5C A;  4DUZ E;  1ZM4 A;  4B3M E;  3ZKD A;  1HNX E;  1WUU A;  4YY3 E;  1XHK A;  4JI0 I;  4X62 I;  4DPU A;  4LFC I;  4Z7C A;  4R1F A;  4USM A;  2HHH E;  2XEX A;  4JI5 E;  4JI0 E;  1IBM E;  2VQF E;  1N34 I;  4YY3 I;  1UEK A;  4DPX A;  4I3H A;  2F4V I;  4JG4 A;  3T1Y I;  2HFS A;  2UXC E;  3K1J A;  2HFU A;  4DV2 E;  2BV3 A;  1QZR A;  4JV5 E;  4PRV A;  2E5L E;  4B3S I;  2UXB E;  3B78 A;  4DPT A;  2ZBK B;  5L3J A;  4X62 E;  1HNW I;  1RR9 A;  4X65 E;  5GMD A;  4DUZ I;  4LFA E;  1N0U A;  1MU5 A;  3QT5 A;  3CWV A;  5LMU I;  3B8H A;  1Z0V A;  1B63 A;  1Z0E A;  4DR7 I;  4JI8 E;  4DV2 I;  2VQF I;  4X64 I;  3HUL A;  1NHI A;  4FWD A;  1K47 A;  3ZZ0 A;  4M1K A;  3J7A M;  5GME A;  4DR5 I;  2E5L I;  1MX0 A;  1N34 E;  3WU4 A;  3OTO I;  3ZM7 A;  4JI3 E;  4B3T I;  3B82 A;  4X65 I;  2EFG A;  2BM0 A;  4GKJ I;  4B3M I;  4DU8 A;  4DR3 E;  4MYU A;  5FLX C;  1XNQ E;  5A2Q Q;  5BR8 E;  3T1H E;  5LL6 R;  4HY1 A;  4YHH I;  1Z59 A;  1XNR E;  2ZIT A;  3ZZU A;  4Z7Y A;  1FI4 A;  4LF8 I;  1NZ0 A;  1IBL E;  4DR2 E;  3V5R A;  2V2Q A;  2UU9 E;  4DXL A;  4HXZ A;  1Z5A A;  2UUA E;  1I94 I;  4FN5 A;  5IWA E;  4UT4 A;  3WU5 A;  5IT9 C;  1J5E E;  1XMO I;  1S4E A;  1Z0T A;  4B3T E;  1Z0G A;  4LFB E;  1DAR A;  1N32 I;  1IBK E;  2V2Z A;  1VIS A;  2HHH I;  4LF6 E;  3JAM Q;  4B3S E;  3Q1Q A;  3GON A;  3F0N A;  3PYD A;  4JI2 E;  1HNZ I;  2UXC I;  3T1Y E;  4OX9 E;  4JI4 E;  2UUC E;  2R42 A;  1H72 C;  4LF9 E;  1H7S A;  4FWG A;  4JI5 I;  3LTO A;  2AJ4 A;  4NXM I;  4USK A;  1BKN A;  1FJG I;  4LF9 I;  4JI1 I;  1N36 I;  4FW9 A;  2OI2 A;  4JYA E;  1PKP A;  4DU7 A;  2UXB I;  4NXN I;  4JV5 I;  4DV1 E;  4LF7 I;  4B3R E;  4DV1 I;  1N33 I;  4AQY I;  4DUY I;  1EA6 A;  1FKA E;  4DV3 E;  4LF5 E;  3ZZT A;  4P52 A;  3J80 C;  1H73 A;  1XMQ E;  3J81 C;  4ZVI A;  1H7U A;  4X66 E;  4DUY E;  4DR1 I;  3WU3 A;  4DV0 E;  5LMN I;  1HR0 I;  1KKH A;  2X7I A;  4AQY E;  1N36 E;  2CZ9 A;  2UUB I;  4MYT A;  1XNR I;  1PIE A;  3D4J A;  4LF4 E;  4KHP I;  1ZM3 A;  1KTV A;  4DV4 E;  4K0K E;  4JI1 E;  3M6A A;  4DV4 I;  4DR6 E;  1FJG E;  4OX9 I;  4LF5 I;  4DV5 E;  2WW4 A;  1NHJ A;  3H4L A;  3ZKB A;  2A2C A;  2ZM6 I;  4DPW A;  5IT9 Q;  5FLX Q;  1IBL I;  1RRE A;  2X36 A;  3J81 Q;  2VQE I;  4DR4 E;  3QT6 A;  1B62 A;  4GKK E;  5LMU E;  3QT7 A;  4LF4 I;  4EMD A;  3K17 A;  2E1R A;  4RPF A;  3PYF A;  2ZM6 E;  3LPS A;  4DR6 I;  4HAC B;  2HK2 A;  4DV7 E;  4DV6 E;  4P7A A;  4DV7 I;  5A2Q C;  2VF3 A;  1HNZ E;  4PU9 A;  2UUB E;  1ZM9 A;  4DR5 E;  4KHP E;  2R3V A;  4JI7 I;  2UXD E;  4JYA I;  3T1H I;  1IBK I;  1OJ4 A;  1ZXN A;  4DR4 I;  4LFB I;  1A6F A;  1N0V C;  2UUC I;  2LJP A;  2DEJ A;  3J7A G;  4NXM E;  2UXD I;  4X66 I;  4UTG A;  4JI7 E;  4GKK I; 
#chains in the Genus database with same CATH topology
 5LT5 A;  4QYZ K;  4PAA A;  1Q7L B;  2CVE A;  4YDD B;  3P06 A;  3LGH A;  5D0H A;  4JP8 A;  4ELV A;  1YG0 A;  3DOL A;  1I3O B;  1Y5N B;  4YN3 B;  3M05 A;  3ISN C;  3H2U B;  2RJZ A;  2VBX A;  4L3N A;  2PI4 A;  3VWS A;  1LQ9 A;  5E7O B;  2YWK A;  3ZZR A;  2GML A;  3ZC4 A;  4X4Q A;  3M6U A;  4A8Q A;  2JEB A;  4Q0B B;  3M4X A;  2MLX A;  4MU0 A;  2K2P A;  1BXN A;  2OLW A;  1EI1 A;  4L72 B;  2DGX A;  3D3C J;  3GCW P;  3QLH B;  2JEG A;  3KLG B;  4F2S A;  2XS5 A;  1VJQ A;  1PGZ A;  5EDW A;  2CFX A;  3BGR B;  1FJE B;  1HBO B;  5BXI A;  1U2R A;  4DQQ A;  1LNQ A;  1JQG A;  2BX6 A;  1SKS A;  5DRO A;  4H4O B;  5CYM A;  4UF4 A;  1UP1 A;  2XO6 A;  3KK2 A;  2L08 A;  1YHQ S;  4LIR A;  2R7U A;  1LK7 A;  5AXL A;  1VYA A;  4PXE A;  3NGT A;  2HNZ A;  4H4O A;  5CYM B;  4RW4 B;  2F8H A;  2YWE A;  2AJF E;  3FZ2 A;  3SCK E;  3M8S A;  1NME B;  1TKX A;  5F3T A;  2RDD A;  3CCJ S;  4OYZ A;  5HAO A;  4OLO A;  3PKY A;  1LK5 A;  2V8G A;  5LMN F;  3ZTR A;  2FHO B;  2ABY A;  2G0C A;  5T7L A;  2BA9 A;  1HWL A;  2JFD A;  2Q6B A;  4HHJ A;  2IES A;  2QMX A;  2CNN B;  1EAR A;  4I6W A;  3MM9 B;  3OTO E;  4OLP A;  3UDE A;  5D77 A;  2RRN A;  2IVF B;  1Z0W A;  4MIB A;  4NBQ A;  3J81 j;  2BE2 A;  1NPP A;  1IM4 A;  2LEB A;  2XZD B;  4ED7 A;  1Y4S A;  1RAG B;  2A6M A;  2J76 E;  1OQ3 A;  2DNM A;  3ZZY A;  4CLT A;  1S9F A;  5IWA J;  2X1G A;  4DL0 C;  4TQS A;  2ZZM A;  3N28 A;  5K36 B;  2HSE B;  4ED1 A;  3DLK B;  4ED4 A;  1VRQ C;  4K7Q A;  3KJV B;  4LR7 A;  5E41 A;  4GO5 X;  1XQI A;  4FBU A;  2V5H G;  5E5N A;  1RWM B;  2ZE2 B;  3IM9 A;  1EQ0 A;  1QUP A;  1AA1 B;  2E7X A;  2B9Y A;  1TEL A;  4O4G A;  4DEZ A;  4A8O A;  3IN5 A;  2MKH A;  3RTV A;  5K8M A;  3UD3 P;  1KLN A;  2E5L F;  3Q89 A;  1GXL A;  1BQM A;  3IAM 9;  1ELO A;  1F2G A;  5IM0 A;  3CJT A;  3BDE A;  3HVT A;  2N3O A;  3QSY B;  4BDP A;  2AX1 A;  4ECS A;  2R7V A;  3BS9 A;  4HT5 A;  2G9O A;  3G8T A;  2BJ7 A;  4IG3 B;  3UR0 A;  4CM2 A;  3LF0 A;  2W4P A;  4O3S A;  3I87 A;  1DLO B;  5F8G A;  5HQM A;  1LW2 B;  3VGS A;  2KG1 A;  4ED8 A;  3I55 S;  2CPJ A;  2XMM A;  4ECX A;  2HS3 A;  1IBM J;  2WBR A;  3VAI A;  1M5O C;  2FDN A;  3CNQ P;  4FNI A;  4QPT A;  1HQE A;  1EHW A;  1WKL A;  2Q1L A;  4TN2 A;  4JOU A;  4CLK A;  4R5P A;  3PW4 A;  2ZJP Q;  2YKM B;  3DOK B;  1SKW A;  3OBI A;  4FF4 A;  2DIS A;  1PYS B;  3QT8 A;  2AGQ A;  3I5C A;  2DEI A;  1Q53 A;  4CLL A;  4J91 A;  1RT7 A;  3CWJ A;  2ZUG A;  4RR5 A;  2W7P A;  1UDN A;  2WVD A;  1Y6Z A;  1Z5B A;  2ZBI A;  5FDL B;  4F7V A;  5M2U A;  1H74 A;  4ECR A;  5C42 A;  3K59 A;  1Y3K A;  4K59 A;  3VVU A;  4OYM A;  2DVI A;  2D9P A;  3I6P A;  5HO4 A;  2DD8 S;  3GFH A;  3J7A 1;  3TA0 A;  5KFK A;  3R7B B;  3JTO A;  2WVF A;  2LDY A;  3HI9 A;  2HKE A;  3MR7 A;  3PAC A;  4E98 A;  2C2O B;  5IV4 A;  4JI6 I;  2OO4 A;  3LNU A;  3IBC B;  3QMQ A;  3N4W A;  4NI2 B;  4ZJL A;  1WC6 A;  2AV5 A;  3CJ3 A;  3H90 A;  4JI4 I;  4QZV B;  2HQF A;  5KTQ A;  4DR2 I;  2VFU A;  2ZH3 A;  4C8N A;  1TKD A;  2KHC A;  2P6S A;  4Y2M A;  2BM1 A;  2WB1 D;  4F0H A;  2NQP A;  3W66 A;  2JE6 A;  1XNQ I;  1NSP A;  3FBC A;  2VG6 A;  1Z5C A;  1IR0 A;  2DO4 A;  4DUZ E;  1ZM4 A;  2AJ0 A;  3CMQ A;  4KO0 A;  3BQ1 A;  5HRO A;  4LVN P;  2VC0 A;  3ITH B;  4IOA Q;  3VV2 B;  2OPP A;  4F50 A;  3NGK A;  4YY3 E;  1DTQ B;  2B4P A;  3HSZ A;  2B8P A;  3PX6 A;  1VLY A;  4CYU A;  3BJY A;  2A3J A;  4FYW B;  4CO1 A;  4DR4 F;  4DPU A;  3Q6M A;  2KL8 A;  2RS2 A;  3H5S A;  3T1A A;  3UQS A;  2V8H A;  2CQG A;  2WBM A;  4PWW A;  1TTH B;  3DRS A;  4USM A;  3TZY A;  4IOC Q;  3X3U A;  2QFI A;  1RB0 A;  2XEX A;  2O67 A;  1QVG R;  3MM6 B;  1HNW F;  4B3M J;  4AND A;  2PO1 B;  3DXB A;  4IQX A;  3PG9 A;  2H3E B;  1TL7 A;  2IVY A;  4LF2 A;  3W2W A;  4R5P B;  5KT7 A;  1KFD A;  4RUA A;  2XGQ A;  4CRJ A;  3G96 A;  2QL9 B;  5D6G A;  5ITH A;  1VS3 A;  1GK8 A;  4DPX A;  4OHV A;  4I3H A;  3I4P A;  2XC9 A;  4ELU A;  1D8Z A;  1S6O A;  2A0F B;  1F9H A;  3TZW A;  2ASJ A;  1ARO P;  1NK0 A;  2C39 B;  1NCL A;  2O1V A;  4IG3 A;  4ES3 A;  4LRE A;  5E3Q A;  2B9X A;  3Q22 A;  3OSN A;  3CUN A;  5EHH A;  3SI8 A;  1KVI A;  3HSG A;  1F3F A;  4LF6 J;  4I0W A;  3GP9 A;  1D9A A;  4DSI A;  1FFS B;  1HBU A;  2IC3 B;  3HHD A;  2B5J A;  3EXY A;  3FUY A;  2BA1 D;  2OPR A;  1QSS A;  1Q16 B;  3BO4 A;  5BYS A;  4PRV A;  2DIU A;  2OD4 A;  5JEA C;  3QIP A;  4B3S I;  4KC5 A;  3N5B A;  4ED3 A;  5DRQ A;  1XBW A;  1MMD A;  2FC8 A;  4IDK B;  2OPQ B;  4RLE A;  4ECV A;  2YNF B;  3HHL B;  2ZWO A;  3QSI A;  3AAW B;  4QIW D;  1HNW I;  2PEB A;  4DR7 J;  4PKD B;  3U1M A;  4TY8 A;  3KHR A;  2WHO A;  1X5O A;  1XMQ J;  4FYD A;  2UP1 A;  2FC9 A;  3JSB A;  4MAK A;  1P9Y A;  3EVW A;  1RT6 A;  2NN6 F;  2F8E X;  3L7P A;  2UUA F;  1AZS A;  3J7Y I;  3GU0 A;  2CAD A;  2HAI A;  2VDH A;  3AD9 C;  3GIM A;  3M8Q B;  2MLZ A;  1UDS A;  4LF7 F;  2HS4 A;  2IRY A;  2GNK A;  3OLA A;  3UDL A;  5B09 A;  3PX0 A;  3IBW A;  3PTW A;  3L7O A;  1C1C B;  2JLF A;  3LA0 A;  3FQL A;  2W01 A;  3OPK A;  3NBP B;  1RWU A;  1MU5 A;  1Q86 T;  5G0R A;  1RAC B;  4URQ U;  2ZHO A;  1C2P A;  4X4P A;  1HPZ A;  2VPW B;  1KQF B;  2MQM A;  4DFM A;  3CJS A;  4LRC A;  5IC4 B;  2ZH5 A;  2QSF A;  3T5K A;  3W5X A;  3H1C A;  3B54 A;  3EE3 A;  4JI6 J;  2BJ8 A;  4OV6 A;  1DZ5 A;  3NNA A;  2DGW A;  2HGM A;  2BJ1 A;  2HHP A;  2XG8 A;  4UOF A;  4K4Y A;  1K8A T;  1BQX A;  5D8H B;  4FWD A;  1R8P A;  4NLW A;  4KT0 C;  4DFK A;  2LEP A;  3ZZ0 A;  1R6L A;  4CLW A;  4WCE Q;  3KLE B;  4F4W A;  1U25 A;  2GIR A;  3AXM A;  4M1K A;  3M2U A;  1C0U A;  2NRE A;  1JLB B;  4PR6 A;  3POT A;  2E5L I;  3LP1 A;  3GIR A;  1MX0 A;  1VQ7 S;  2MKI A;  4OX6 A;  1VGY A;  2RUS A;  4C8Z A;  1N34 E;  2IDL A;  4BBY A;  1YZ7 A;  2MXY A;  3QJJ A;  3IWL A;  3M1V B;  4FYX B;  5HVF A;  5A2Q U;  3U7J A;  3C6U B;  4KPY A;  3ZM7 A;  4OZN A;  4AID A;  1CQN A;  3CJQ A;  3MUM P;  2QC3 A;  2DGS A;  1Y4U A;  4MU4 A;  3OFG A;  4B3T I;  1VHI A;  3R8Y A;  3G8Q A;  5AXM A;  3KLF B;  1BC6 A;  4LCH A;  4GKJ I;  2W7A A;  3GR1 A;  5CYQ A;  2LMI A;  4JB8 B;  1N5V A;  4DR3 E;  1T02 A;  1BWE A;  2PMH A;  3GFY A;  1EZZ B;  2E66 A;  4M5N A;  3SCI E;  1RBO B;  2CG9 A;  2IOQ A;  5BR8 E;  2AF6 A;  2DRA A;  1P1L A;  2Q3P A;  3CCV S;  4MU1 A;  5GVQ A;  4HY1 A;  1XC9 A;  3MPV A;  1Z59 A;  2HIY A;  2BZ2 A;  1F60 B;  3IRX A;  4FP9 A;  1WC3 A;  3EVM A;  1BQN B;  4Q2M A;  4JI0 J;  1N32 J;  4ILM A;  2HVZ A;  1T9V A;  4RW6 B;  3MR3 A;  3W62 A;  2IAJ A;  4N56 A;  2RU3 A;  1HBM B;  4I56 A;  1SIW B;  4KRW A;  5A6P A;  2R2T A;  4OX9 F;  5EKW A;  5EX0 A;  4ZMM A;  4EZ6 A;  1EX8 A;  2IDE A;  2KT2 A;  3V4I A;  1SB6 A;  4K0K J;  4DR2 E;  3S7R A;  3BKT A;  3V5R A;  1RJJ A;  5DNX A;  4AL6 A;  5EL9 A;  1ZS6 A;  3QAE A;  2H5I B;  3C19 A;  4J9M A;  2UVW A;  1HNZ J;  5GAE U;  2R8H A;  4ZCM A;  2C28 A;  4M5K A;  4OHZ A;  1WAC A;  1YLX A;  2KYZ A;  4GC7 A;  2R8I A;  2BQ3 A;  2W24 A;  4LF8 J;  4BA1 B;  1RAO A;  3NG8 A;  3OXL A;  5GAE I;  4RNM A;  2EFV A;  4DLE A;  3H59 A;  4PG4 A;  4RX6 A;  4ALZ A;  1UVK A;  1PYT A;  1DQ8 A;  1GMU A;  3SXL A;  5GAD I;  2NXN A;  1SC4 B;  4RWW A;  2MJN A;  5A8W B;  2VQE F;  1R0A A;  2Q66 A;  3P5T L;  2V4Q A;  1QJH A;  1S4E A;  3MM7 A;  2VJV A;  2OPS A;  3PJW A;  3W9H A;  2ROG A;  2YNH A;  1YRT A;  1IBK E;  3OT9 A;  2KI2 A;  4OZ3 A;  1NK6 A;  2MQN A;  2IHR 1;  4LF9 J;  1DTQ A;  4PUO B;  4QR2 A;  1WDD A;  4LF6 E;  3TOQ A;  1KOO A;  1EET B;  3PV8 A;  4KGZ B;  2Y1J A;  1TV6 A;  4JI2 E;  1VDH A;  2KVQ E;  4PXC A;  5IXU A;  1PO6 A;  2FYX A;  4TLQ A;  2B9W A;  5KG6 A;  4DV4 J;  1GAO A;  1PC5 A;  1T9Y A;  1C1B A;  2V8D A;  3QGP A;  1X31 C;  4A8W A;  3THV A;  2IJR A;  2XSJ A;  3BGU A;  1QTN B;  4C3K A;  4AQY J;  2NUU G;  4J9S A;  3EZO A;  2OFH X;  2VG5 B;  3JYT B;  2R42 A;  1H72 C;  3DLE B;  3FC9 A;  2UXC J;  1H7S A;  4FYY B;  3A4T A;  3JSM B;  2JEI A;  4ITS A;  2B4U A;  1H3D A;  4FWG A;  2BUN A;  2B4O A;  1YJU A;  2FHJ D;  2MTL A;  4R8U B;  3FEZ A;  3CO0 P;  1E6V A;  1S1X B;  1Z2L A;  3BDP A;  2ASL A;  3BR8 A;  1JIH A;  3Q2S C;  1C0T B;  1NHU A;  1RT1 B;  2OSR A;  5ETV A;  2OEK A;  1JLC A;  2I0X A;  5IQQ A;  5KFO A;  1WOP A;  3OJS A;  1XER A;  2EXU A;  4CO4 A;  1N36 I;  3VGV A;  3MDF A;  2KM8 B;  4P7T A;  2BYC A;  4M5D B;  3GJR B;  1SXL A;  4NA1 A;  2HVD A;  2OI2 A;  4NXM J;  4LF4 I;  2H4Y B;  3M8Y A;  4Y2K A;  2YWH A;  5KG2 A;  3I4H X;  4BWM A;  1FVS A;  4JYA E;  1NO8 A;  2OUG A;  4DU7 A;  4F67 A;  4HH0 A;  1RWW B;  2PII A;  1WEX A;  4IUF A;  1U1K A;  3R5C A;  2G1D A;  1HR0 J;  1UFK A;  1RHK B;  2KH9 A;  3EX7 B;  2B51 A;  3AA9 A;  4AXJ A;  1RKJ A;  2DIV A;  4KGX B;  2E1C A;  1UVL A;  4DV1 E;  2F8M A;  2Y3Y A;  4JV5 I;  5HVH A;  3BPD A;  3KLI A;  2DH9 A;  2X1A A;  3CCR S;  2XMA A;  1N33 I;  3K58 A;  2L9D A;  1OYE A;  4XDD A;  4F4Z A;  1RWN B;  2IER A;  2ZJR Q;  3FRZ A;  1FKA E;  2PMW A;  2QEX S;  3R5J B;  4LF5 E;  3NBP A;  2ZH7 A;  4NEZ A;  3AB2 B;  2RHQ B;  1T3O A;  5L46 A;  3TQE A;  5KT3 A;  1UA0 A;  2JEJ A;  1Q7Y T;  2CQI A;  2E29 A;  1IBL J;  1FJG F;  3J80 C;  1XMQ E;  1SH3 A;  1GX5 A;  2UVV A;  2DNG A;  4RW9 B;  1S1U A;  3CT9 A;  1U0S A;  1N36 F;  5LMU J;  1AFI A;  3LPE A;  3KJQ B;  3OTB A;  5G4D A;  4O0I A;  1KFS A