2WW4A

A triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
b'MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Triclinic Crystal Form of Escherichia Coli 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase and Reassessment of the Quaternary Structure.
pubmed doi rcsb
molecule keywords 4-DIPHOSPHOCYTIDYL-2C-METHYL-D-ERYTHRITOL KINASE
source organism Escherichia coli
molecule tags Transferase
total genus 90
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 2ww4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2ww4A01
5LMNE 2V2VA 4RPFA 1H74A 4LF9E 4JI0E 4LFBE 3ZZTA 4WUCA 2J7KA 2UUBE 1Z5BA 3PYEA 1KIJA 4DR7I 2LJPA 1HNXI 3OTOI 1N33I 4JI3E 4LFAE 4USKA 2UXDI 4YHHE 4EMDA 4DV4E 4KHPI 4DR2I 4X62I 1H73A 2XEXA 5FLXC 1FWKA 3WU3A 1Z0CA 5LMUE 1XNQI 1KKHA 2R3VA 1ZXNA 2UXCI 1B63A 4UTGA 4DV3I 4JI1I 3LNUA 4DPTA 4JV5E 1IBLE 4HYMA 2UXBI 4X64I 1HNZE 1N36E 4NXNE 4JI2I 1HNWI 1MU5A 1PVGA 2UXDE 2A2CA 4FN5A 4OX9E 1N0UA 3D4JA 1A6FA 4DV1I 3WU5A 2VQEE 3HULA 2BM1A 2VQFE 1N32I 4DUZI 4LF8I 4GKJI 4GKKI 3H4LA 1ZM9A 3F0NA 2V8PA 1Z5AA 1PKPA 4FWGA 3J81C 2F4VI 1S4EA 4LF4E 4DUYE 1Z0BA 2UUAI 4JI4E 2UUCI 4FWDA 4JI8I 1D6TA 5L3JA 4DV6E 4JI2E 2HHHI 2BM0A 4PU9A 1IBKE 4K0KE 1Z0WA 4P52A 3T1HI 1Z0VA 1BKNA 4LF8E 2HFUA 4DU7A 4X66I 4LF7E 1XNRI 3LPSA 4I3HA 4JI7I 1XMQI 2E1RA 3GONA 4B3MI 1NZ0A 1HR0I 4URLA 4MYUA 4X65I 4DV0E 2V2QA 3PYDA 4JI6I 3T1YE 3M6AA 4Z7YA 4JI5I 5A2QQ 2BV3A 4LFCI 4DR6E 1J5EE 2ZBKB 3PYFA 3J7AG 4R1FA 4DV2I 4X66E 1FKAE 4NXME 4YY3I 3QT8A 4PRXA 2WW4A 4DV7I 4AQYE 2HKEA 1ZM4A 1N34E 1NHJA 3V5RA 4B3SI 5GMEA 4B3TE 2AJ4A 4ED4A 1HR0E 1K47A 4PRVA 4JYAI 1I94E 3QT7A 4LF5I 4LFCE 1FJGI 3Q1QA 1EA6A 1MG7A 3JAMQ 4DR7E 1HNXE 3OTOE 2E5LI 1RR9A 1Z0TA 4DR4I 1N33E 3WU6A 3J80Q 4FW9A 4B3RI 1DARA 4KHPE 4DR2E 4X62E 1IBMI 1XNQE 4JYAE 1Z5CA 2ZM6I 4DR1I 3J7AM 2UXCE 4DPYA 2V2ZA 3B8HA 4DV3E 4JI1E 1KVKA 2UXBE 4X64E 1NHIA 4JG4A 4DPXA 4DR3I 1MX0A 2ZITA 4DV5I 5BR8I 4DXLA 1HNWE 1H7SA 5A2QC 2UU9I 4DR5I 1FWLA 3CWVA 1EI1A 4DV1E 2HFSA 4XTJA 2HK2A 2ZM6E 1N32E 4DUZE 1XMOI 4GKJE 4GKKE 4DU8A 2X7IA 1Z0EA 2F4VE 4LF9I 4KQVA 4JI0I 4LFBI 5IT9Q 4DR3E 1QZRA 1H7UA 3WU4A 2UUAE 2UUCE 2UUBI 4JI8E 3ZKDA 2HHHE 4JI3I 4LFAI 2OI2A 4YHHI 4DV4I 4DPUA 1N0VC 3T1HE 2DEIA 5IWAI 4LF6I 3V2UC 1S16A 1H72C 3JAMC 5LMUI 4DPWA 2NPFA 3J80C 1XNRE 3K1JA 4WUBA 1U2RA 3B82A 4JI7E 1XMQE 4JV5I 1IBLI 4MYTA 4B3ME 4X65E 3ZM7A 1XHKA 4JI6E 3PYGA 1HNZI 1N36I 4NXNI 1PIEA 4JI5E 2HK3A 4HACB 1ZXMA 1VISA 4OX9I 4Z7CA 2CZ9A 4USMA 5IWAE 4LF6E 4P7AA 3QT5A 2VQEI 1FNMA 2VQFI 3B78A 4DV2E 3QT6A 4YY3E 1KTVA 4DV7E 4WUDA 4B3SE 2DEJA 3LTOA 5GMDA 4LF4I 1Z0GA 2X36A 4DUYI 4JI4I 4HY1A 2HKJA 4DV6I 4LF5E 4ZVIA 1FJGE 1OJ4A 4M1KA 5LL6R 5IT9C 1IBKI 4K0KI 2V34A 5FLXQ 2E5LE 4DR4E 1FI4A 1WUUA 4B3RE 4HACA 4LF7I 1RREA 2R42A 2Q2EB 1IBME 4FWHA 1B62A 4DR1E 1UEKA 3K17A 4DV0I 2A2DA 1NHHA 3ZKBA 5LMNI 4UT4A 2GS8A 3T1YI 4HXZA 1ELOA 3ZZ0A 4DR6I 1J5EI 1Z59A 4DV5E 3ZZUA 5BR8E 4NXMI 2UU9E 4DR5E 2EFGA 4AQYI 1ZM2A 1N34I 3J81Q 1ZM3A 2VF3A 4B3TI 1XMOE 1I94I
chains in the Genus database with same CATH superfamily
3TW0A 3ZO7A 2DXDA 1H74A 2KYZA 3HK2A 3JSRA 2A3JA 3ZZTA 4H4OA 1HQEB 5C7PA 4KY3A 5L46A 3N5BA 4IZKB 1R8CA 2DNYA 3MUMP 4FW5A 2OPSB 1WD6A 1FDNA 1IKYA 4A8YA 4OX9J 1Z0CA 1KKHA 5DRQA 3MMJA 2MPUA 3RU0A 4UTGA 1DY3A 4CO4A 4RR5A 1YJTA 1S9GB 3OL6A 2ZZMA 3N0VA 4CQ1A 4X4OA 4EZ6A 4YS2A 2KI2A 1KQGB 1JXLA 3HKWA 1Q1KA 1RT3A 4TY8B 5CZVA 7AT1B 1B0TA 4L72B 4IOBA 1N5YB 2PN6A 5E3QA 3P76A 2VQEE 5BJRA 1X4AA 3MM5A 4DSIA 4DUZJ 3AODA 1R6YA 2MSTA 4EUVA 2VQEF 2FJBB 2GZOA 1SKWA 3OL9A 2RJZA 2HHHI 4EI2A 2BM0A 1M5VC 4CH7A 2DRDA 4WTOB 5DGBA 2VHGA 3SEOA 1RBOB 2P6SA 4IH5A 3CCSS 2GX8A 2HFUA 1Y9OA 4KC5A 3A3OB 5L1IA 4JOUA 1I1GA 1BY9A 2PEHA 2R7VA 4PEOA 5DRRA 1Q78A 2MY8A 2V2QA 1FK9B 2FQQB 2HVZA 4CCHA 3AA8A 1FT8A 1NLKL 5J2MB 3CF5Q 5AJ3F 5F41A 3GIMA 4PRXA 2MXYA 3OSPA 4DV7I 5CABA 2R7SA 3TWZA 4NEYA 1U1PA 1GMVA 3GPAA 1T9WA 1I94E 1CLFA 3MOZA 3CC7S 4OO1C 4AL6A 3M6UA 2ZH1A 2J7UA 2I38A 2VODA 2V67A 4WBFA 4FYVB 2EK1A 3FVYA 1F6TA 1JLBB 3KLFB 4L74A 3M9OB 4C8MA 1N8RT 4DR2E 4DFMA 5HVGA 5AE2A 4ER8A 3L7ZA 5SZTA 1Y5NB 3TZYA 1J2VA 2E5HA 1VYAA 2MKKA 4NMXA 2FYXA 2QSWA 4J5OA 3PJXA 2Z0GA 2JLEA 2WP8B 4ED7A 1JIHA 1YJRA 3MTKA 2KDOA 7FD1A 5DDRC 2AZ1A 1DTTA 1N32E 4O3QA 2R9LA 1KFDA 2NN6C 4OZJA 1R27B 1FRXA 1VQLS 4NMLA 5DRKA 5CYJA 4LF8F 3VAMA 2AJ0A 4LFBJ 2QC3A 3AQOA 1GFWB 2HQFA 5ETPA 3CJSA 1UW9A 1YX2A 2Y1JA 5GAEU 2W8LA 1EKSA 1TL4A 3C6UA 4LF6I 5KFWA 1C0UB 3MHYA 5K9FA 3QATA 2ZFHA 3L7PA 3GR1A 3QZ8A 1URRA 2ZKUA 2DT9A 2QA1A 3L7UA 4O0NA 3CJ8A 2N3OA 5T14A 5JJBA 2DHSA 1VISA 5D3GB 3DLEB 2ZEJA 1MNEA 4I2PA 3KNAA 4I0WA 2JEJA 4LF6E 2ASJA 4ITSA 2A10A 2QL5B 1UJ5A 2AT1B 4YY3E 1OMSA 4M5DA 3HI9A 2AGPA 1FKOB 3M85G 3SFGA 5KT2A 3KUHA 4XK8C 1QD1A 1YWXA 4DEZA 2RKIA 1IBMJ 3G6XA 1EETB 4LSNB 5ETOA 4LT6A 4ED1A 4DUYJ 4OYPA 2MZJA 1OJ4A 3Q86A 3IR5B 3KJQB 3SV3A 2IC3A 2RU3A 2CQDA 3V4IA 3HKZD 1XIQA 1ZA1B 1RWMB 3CIZA 2WBMA 2CQPA 3IGVA 4ZJOA 1KDNA 5BYRA 4FNHA 3N01A 3MECB 2VONA 1U7LA 1BGXT 1VQYA 2IMOA 2UUWA 5D4NA 2WOMA 4J9KA 5LMNJ 1LXJA 4L75A 4QIWD 1DQAA 2ZM6F 2XGQA 4FW4A 5E3CA 2DKOB 4ZIVA 3ZZUA 3KHGA 3QAUA 1N4LA 1SJQA 1RAGB 4ED3A 4YOEA 2C38A 1CJVA 2WBRA 2OJ3A 3GYXB 2CXEA 2EFGA 2KFZA 3EPGA 2CPJA 4X4SA 5AXMA 1RCOB 2R7WA 4WFYA 2L9WA 2JEBA 1Y00A 4RPFA 4OFZA 4IRCA 3P5BP 3DKDA 5HSPA 2HURA 5I3UB 1RWOB 4B9UA 2HGNA 1N33I 3OTOI 4F0HA 1D0EA 2QA4S 2AJ2A 4BA1A 2IPOB 2GQ0A 1N36J 1WHWA 2B9YA 7FDRA 5T41A 4U7UD 1BQNA 4JI6F 2LA6A 1BMQB 3LPYA 1ZXNA 2DNKA 3MM6B 2WRMA 4O4GB 3PEHA 1IBLE 2UXBI 5LJ5Y 4D3HA 3UDCA 1RWKB 2KXFA 1R3NA 3I5BA 5A8KB 3DU6A 3CJTA 2BE2B 3KG0A 4NXNE 1GT8A 5F8IA 1IBLF 3PCOB 1NPKA 2IJNA 1WEXA 3PX0A 1LWXA 1RT6B 1VR6A 1F5CA 2W9CA 1HYSB 1IUJA 3LP0A 2HMIA 2KVIA 3K89A 4I56A 2F4VI 1V9OA 3X1LB 4C11A 2DGOA 1QTMA 4ELUA 2V63A 3W5YA 5JMNA 4OQJA 2IJRA 5E3RA 4H4KA 2WK4A 2BE9B 4PU9A 1IBKE 2YNHA 4CLPA 4ANCA 2QJ3A 1PBUA 1C0TA 4DI6A 1IKVA 2VPWB 1SKUB 1UKUA 3VAJA 1IBKF 4RW4B 2HEKA 2BJ9A 2XM3A 3N5FA 2J0WA 3M7NG 1RXOB 3T1YE 3H2VE 1L3SA 4IFDA 2NUUG 1MSWD 4DN9A 3CPWR 3KJVB 4DR6E 3PYFA 4IO9Q 5C0XC 1XMBA 1MMLA 5EWFA 3EXYA 2EFNA 3GQCA 4AQYE 4DR6F 3DXSX 2YQ0A 5GMEA 1Y6ZA 1AZSB 1OS5A 3OW2R 2YKPA 3H20A 2K7JA 2YPZA 3D7SB 4Y2IA 1QSYA 4OZEA 2QA4G 1RZMA 3CJKA 2BA1G 4U6PA 4ZN1A 2MQNA 4OZLA 3CJ4A 1JLQB 2ZH3A 3CJRA 1QAJA 1HNIA 3I96A 3WU6A 4EBCA 2D3UA 4WZMA 4FZVA 3JYTB 3RYLA 3NMRA 2XLKA 5JEAD 4QNKA 4EBEA 1YITS 3LPEA 2D41A 5CA5A 4DV3E 4ZPBA 4ZPDA 1UA0A 3DRSA 4GKKJ 2EBEA 1NKBA 1MX0A 2ZITA 1LWCA 4DV3F 2M0GB 1SUQA 3PO5A 3DOLB 2IJFA 4XTJA 1BC6A 4ZITA 4NA1A 3QGGA 4ALZA 2BYCA 3PZPA 4ECSA 1KOOA 4PKDB 2AYGA 2XSJA 1SC3B 5C25A 2LA4A 3PEJA 2QYGA 3MAAB 3NNCA 1QZRA 1YJ9S 3L09A 1U4BA 4X4QA 4RBUA 4FDFA 5E41A 2V68A 3LALA 1EIYB 1VQ5S 2X1BA 2HGMA 1M5SA 2L3MA 1N0VC 2HNYB 2GV1A 1Q7LB 3Q6MA 5IWAJ 3DGPA 3HFZB 1S59A 3KHLA 1R8BA 4P2SA 4DUTA 4MQYA 3VGSA 5BYSA 4M5KA 4QBUA 2Q6BA 3MOJB 3MEDA 2Q1LA 2ZD1B 4ECWA 2CZ9A 1WDDA 3CJ0A 2A6MA 3TX8A 2GO3A 4KB7A 8AT1B 5DQHA 4WP8A 2MZQA 3LWMA 2LXUA 4B3SE 1I5OB 1ROFA 2E7XA 3TA2A 4CLKA 3LTOA 4QIVA 4DR7F 2J8AA 1BWEA 1TFWA 2YWHA 2RF2B 1SC6A 1E6VA 5DQIA 3CB4A 2PNZB 4LF4J 4RZRA 1LQ9A 4LRFA 4RW7B 1NJIT 2V9WA 4R5PB 4ZJLA 1Y11A 4KO0A 3SCLE 2XC9A 3IS9B 3P3DA 3H2UB 4NRUA 4TNOA 3HPOA 2JC1A 1IBCB 4M5LA 4DV5J 4Y3CA 5KG1A 3N6MA 4MIAA 4PPDA 3Q24A 3MM7A 2DNQA 5JEAE 4W92B 4TLQA 1NHHA 1RAFB 3M2RA 3OLBA 2GS8A 1VRTA 1FX2A 4ZP6A 5JEAF 4U7UK 2AE8A 1X5TA 4Q8FA 5GAGU 4H54A 4J9OA 3H90A 3CD7A 3IWXA 5D4LA 4ETXA 2DNNA 1VRUA 3SSSA 3BM7A 2B56A 4ENOA 3MFIA 1FFWB 3Q8UA 4ED0A 1JLGB 5LM7E 5T7LA 5FLXY 3NGDA 4P75A 3MEGA 3OTCA 4LSZB 2J7KA 2LCWA 1XQIA 2KRBA 2J0SD 1VQOS 2LJPA 4UUXA 4JI7F 4DMZA 3T3FA 1VCTA 3QLHA 3MM5B 2UXDI 5GVQA 2W2MP 5ETTA 2KRRA 1SJRA 4B02A 4X62I 5G0RA 1YVFA 2Y0SD 2F65A 3R2DJ 1NUEA 4JI5F 4P74A 2UXCI 2CA9A 1WF1A 2ZE2A 1GMWD 4TN2A 3KLGA 2ZH2A 3HHLC 4OJHA 4P2FA 2JFKA 2CPHA 2BJ3A 2HGLA 2ZDOA 3BV8A 2B4UA 2UXDE 3H5YA 3Q8PB 3G86A 3LGNA 3GYNA 4TKTA 3HULA 4ILMA 4MKAA 4N56A 2OSQA 1EZZB 4QWDA 3TUPA 4Q0BA 4C8OA 3MI7X 3J81C 4F36A 4IFVA 4RU9A 4FYYB 4DV6E 2VDHA 4QIEA 4RW8A 2M4MA 2PT0A 1FRHA 4DS4A 1JK9B 1Z0VA 4DV6F 3MD1A 3P6YC 3VVUA 3GILA 2ZC3A 3GONA 3OVSA 2V8VA 1WNEA 2ZBQA 1HR0J 2QL9B 3NS7B 1U24A 2ILZA 1YJUA 3NNHA 4Z37A 2G0JA 2KZMA 4FYWB 4LJMA 1D9AA 2CNOB 4CYUA 3MCMA 1CC8A 3BO2A 4NXME 3P49B 4R0JA 2J6TA 3L7ZB 4CP5A 1K47A 4PRVA 2FHJA 3OR2A 2E5GA 4NXMF 4GC6A 2X1GA 2OMLA 5ETKA 2NXEA 3H4BA 2CQGA 3RAXA 4PR6A 2R4FA 4FF1A 1B0PA 3BGRA 2MGZA 3E2EA 1IJEB 3VVTA 1UDQA 1X4HA 2W24A 1DTTB 2E5LI 1OY9A 4HHUA 3P96A 3LP1B 1XEZA 4HI1A 4NLRA 2O1TA 2OUGA 2VG6A 1SH0A 3NGKA 5CYMB 2LXFA 1NHIA 3K8WA 4LF1A 2R2SA 3C6UB 1WHVA 5KFJA 2HQCA 1H7SA 4A8MP 2UUAJ 4DR5I 3BDPA 1FWLA 4LVNP 5KG4A 3TA0A 3TUJC 2A18A 4HT5A 4NCBA 2MQMA 2YQ1A 2XY6A 5J2PA 3TARA 1JXVA 1T3OA 3TZWA 3CCQS 4WWSA 3H7HB 1RUSA 2QFJA 1U02A 5FJ4A 3UHMA 4BS2A 4M5DB 2QX0A 3UVJA 3NBPA 4DV4I 2UVWA 4FKXA 2B4OA 4AD6A 2DEIA 1I51B 4KGMA 1UTAA 1RTZA 3FUYA 3QO9B 3DHWC 2JEFA 4ZP8A 4JV5I 3CDBA 1U8SA 1Y7PA 2PMWA 2ZVIA 1R8AA 4B3ME 4YDXA 4CZCA 4X65E 2GA7A 5KFZA 2IC3B 3MR7A 1HHTP 3V4IB 1VI7A 1TU0B 1G6BA 4P71A 4X65F 2XSFA 2DTJA 1FNOA 5D78A 4P7AA 2DYAA 1VRQC 5AE3A 3G8SA 3W62A 2UVRA 2VQEJ 3O1LA 5IT9Y 2QZ8A 1U49A 2WOMB 1AB8A 4TQRA 2XZTB 1RTHA 4MU3A 2C38B 2MZTA 3RJMB 4LF5E 3MZIA 3Q2SC 5LL6R 1VBYA 4JYAF 2H4WB 4K0KI 3K5PA 4FXVA 1UZDA 2LQJA 3C66A 4PABA 1NMEB 4N47A 4LR7A 4MU0A 2LMIA 5DETA 4I6AA 1NSPA 3LO3A 1QY7A 2HHXA 4BA1B 4EFAC 4J9LA 5AJ3J 5SUHA 5M2RA 5J2NA 5C24B 1SJFA 2QV6A 4YEAA 1Z1ZA 3KHHA 3TANA 2QTWA 4C97A 1FE0A 3M7ND 2D9OA 2HHHF 2E5IA 3D0GE 4A8KA 3VAGA 5D0RA 4X84A 3H59A 2QA2A 2XS7A 3NCPA 3EGWB 1X4GA 2M5YA 2NLWA 3A1YG 2W9CB 3HVTB 2V8HA 4JI3E 3FKBA 3LP0B 3MGJA 2N3LA 1T0TV 4USKA 2HMIB 3HHDA 1K0TA 1Q8IA 4OV1A 3R9LA 3S1TA 2YXLA 3UD4P 2GMLA 2XHCA 3EXCX 4JI3F 1WF0A 1O5JA 3MD3A 4X64I 2BXJA 1LW2A 4M5GA 2OD4A 3D6HB 2YNHB 3Q8RB 1F0XA 1HNZE 1C0TB 1CULB 2EW9A 1UDOA 2J9EA 2XMAA 3K8VA 4OJ1A 1VQ9S 4DV1I 1HNZF 2VQFE 1FTCA 1KHVA 4GKJI 4G1QA 3LUYA 4GRSA 3VQSA 4LF8J 1TK0A 2VJVA 3IR6B 2HFZA 2V4JB 9ATCB 3MCSA 1HL6A 1FJEB 4C8KA 4O3PA 3BDEA 3JAMU 2CJBA 3IAM9 2LQBA 2CJKA 5GAHI 1RT2A 4K4SA 1S5ZA 3I87A 5KFFA 3K2YA 2GJFA 4C8ZA 3NOCA 2ZH4A 3KFWX 1Q8KA 4J9MA 2NQPA 4F4KA 3OXGA 2KN4A 3TAMA 4XPEA 2GIQA 2OPRA 1LK5A 2CPEA 1QSSA 2HHTA 2Q6CA 3ZTQA 1OQ6A 3BR8A 1TKXB 1P9QC 2LLZA 1QAYA 4OJGA 1UAWA 1HPZB 3DRSB 3LH2S 4IFYA 2H1YA 2AJ4A 2V50A 2Z4PA 5C2GA 4F7VA 2Q79A 4HHHA 1UFWA 4P6QA 2BEFA 1AROP 4MKVA 4O3NA 2OTLS 1X0PA 1FNXH 1SUQB 2XZDB 1S72S 1R0BG 4CO5A 3Q8SB 3JAMQ 1PAUB 5KFYA 1KSPA 3W66A 2XSJB 5D0GA 4J3DA 3KG4A 1HBMA 1M0SA 4EZ9A 4CIOA 3IFEA 1ITPA 3IR7B 5L1KA 4HYKA 2ZM6J 2BMBA 3KUGA 3BB5A 1OQ3A 2NS1B 1ZZNA 1S0OA 5K36D 3DRXA 2C22A 2PSZA 1PYOB 4JG4A 4L76A 4DDFA 3FMWA 6FD1A 1YJWS 3UNYA 4FVCA 3P3GA 3W2WA 3DGPB 1SQFA 1SBRA 1XMOI 2X1FA 4DL4A 2WSFC 1SV5A 2KT3A 2H5JB 1ZS6A 2XMKA 1GXLA 2IVMA 3WU4A 1H7UA 4GQUA 2BJDA 3ONQA 2UUBI 3EM1A 4JI8E 1T95A 2CGEA 2FVRA 4ZVTB 4LFAI 4JI6J 1HBNB 3R3TA 5IV3A 2C2MB 3KOAA 2YKMA 4CM0A 3HDSA 1E6VB 1QVFR 4R8UB 5C42A 1XNRE 3R5AA 3D0IE 2CZ4A 3MPWA 4KO0B 4NLDA 4XTTA 3ZM7A 3Q8VA 4M94A 4P2MA 3PHEA 3O8WA 4BA2B 3MM7B 1J27A 1S1XB 1FJ7A 2H4YB 4K5SA 4RNOA 4QWEA 2BKPA 3M2RB 4K4XA 1JLFA 1VRTB 1U26A 3D1QA 5HN0A 1DTQB 3TRGA 1Z0GA 3OTOF 2HHVA 1DQ8A 4O3SA 3CC2S 1UMJA 1CJUA 3U1YA 3EJMA 2ZUAA 3BREA 1YTYA 4J90A 4B9VA 3OJSA 3MUVP 1IKWA 2UXBF 4B3RE 1URNA 1HNVA 1U0SA 5T7LB 1VGYA 3GIIA 3MEGB 4PAAA 4FYDA 3PACA 2BJ1A 3PW0A 3I9ZA 2IHR1 4ZDNA 2KYXA 3D3CJ 4FXWA 1B3TA 1TKZB 1UWBA 5K36E 3RG6A 4DR6J 3M6WA 2ZE2B 4LR8A 2DGWA 2YWGA 3HX9A 4DR3F 4I7FA 1WC1A 1TL3A 5K36F 3DOMA 4MK7A 3ENQA 3OVAA 1FE4A 3S6EA 2GVZA 1T03B 2LECA 2XG8A 1U6ZA 4HKQA 2GMHA 3PFEA 5DM7Q 2ACYA 3G4SS 4O23A 1L3TA 1W25A 1RSCA 4Q0BB 4FS1A 2AGOA 2XEXA 4IFVB 5F8GA 1FWKA 1IM6A 1XNQI 2HWIA 2KM8B 4YUDA 4RW8B 4Q7AA 3FZBA 4LMZA 1T05B 4DV3J 4OX6A 3MMBB 1S6PA 3JS9A 4ECYA 1P1TA 1RBLA 4OX9E 1CG2A 2CPFA 3ICLA 5IM0B 2DBBA 2ZBIA 4GVBA 4DUZI 4CO1A 4TYAA 2XTJP 3M32A 1ZM9A 1NB2A 4DFJA 5CXTA 4DX7A 2ZH9A 3PDNA 2WNRB 2Y0BB 3RUBL 4OO1D 1RB0A 4CYUB 1GX5A 3OTBA 2VBYA 4C6AA 4TVAB 4K4YA 5GADI 1N56A 3FFIA 1TKTA 3KMQA 4G1IA 2AZ3A 1KTQA 3J80U 1HHQA 3UDEA 2HAIA 3OR2B 1FRKA 3T6JA 5KFXA 3KRNA 2R8JA 2GW8A 3BGRB 4ISAA 3AB2B 3O6QA 3OFEA 1SXLA 3VAIA 4URLA 2Y8WA 3QPIA 4CLLA 2OH2A 3LAKA 1R0CB 2BABA 3G71S 3AXKA 3TOQA 4DG1A 1EKRA 4OIXA 2VG6B 5HBMA 3RB4A 1GNKA 3EYZA 1GAOA 4DR7J 3DI6A 3CSKA 4OL8A 3IG1B 4O3RA 4WKYA 3M8YA 4OHXA 2C2DA 1FF2A 2HFVA 1R31A 3A13A 4N8NA 2V5HG 3RRGA 1FJGI 1WOPA 2XMJA 4F3MA 3DD6A 5B0GA 2D74B 4K7QA 1JLAA 3LAMA 4X4RA 3QRPA 3GG0A 3Q22A 2DISA 2E1CA 1RR9A 3J80Q 4FW9A 4LREA 2B0GA 2ROPA 2NCKL 3PR4A 3AJDA 4LF2A 3FSYA 3CCMS 1Z5CA 2E9ZA 4ZLJA 2CNNB 3W5XA 1M5HA 2AJFE 4JP8A 1LEOA 3UVJB 3NBPB 4I6YA 4P10A 1QAIA 4PXEA 4QR2A 1NK5A 4OI2A 5JEAA 5BR8I 3IM8A 1ACMB 1U1OA 1TP7A 2UZAA 2MQPA 2KFNA 2LEAA 2B4VA 1EI1A 4USIA 2VOPA 3MURP 3OVBA 3H4DA 1RHMB 3H0PA 4FKYA 2CPYA 2PMHA 1EX8A 4CO0A 4LFBI 2YNGA 4JI7J 4PUOA 5IC4B 2RRBA 2HLTA 4HDGA 2IOPA 3ZKDA 2BW7A 1KVJA 4OO1E 3KJFB 3HM9A 3F44A 1T3NA 2O1UA 3G82A 1MN7A 3EPIA 5KFAA 3BBCA 3JSMA 4JI5J 4M5JA 2KM8C 2R8IA 4N41A 2ERRA 1SC1B 1S7IA 2HQ3A 4OO1F 3KLIB 1AUSL 5IOLA 2MQOA 3RBZA 4I67A 3DDIA 2IMWP 2JVRA 3DYAA 1R8PA 2NR0A 3PYGA 2Z5CA 3AD9C 3VAKA 1IQZA 3LP2B 5LXRA 3CWJA 1CPZA 1SJ1A 5LSRA 3CCVS 3B78A 4X4VA 3QT6A 1W2BR 4N3OA 4LCFA 4NLSA 1TUGB 1PILA 4DUYI 4W98A 5J2NB 3BZQA 2HKJA 2NN6E 1HI1A 2RQCA 1FXRA 4J37A 4U8YA 3VZIA 4IRKA 4DV6J 2HW3A 1Q5YA 2ZH6A 1S12A 3KKFA 3CVKA 5KG2A 3TA1A 2NN6F 3R8YA 3TUZC 3ZTOA 2BE7D 4ZS6A 3TAPA 1IBME 2PIIA 3LQVA 4IG0B 1WKKA 4DV0I 2BANA 1YQHA 5LMNI 5KFHA 1NDLA 1WI8A 3CDEA 1X8DA 2RS8A 1MROA 1NJXA 1N6QB 2RUGA 1SH3A 3WC2A 3A8EA 4KHMA 4F25A 1YHCA 3HJFA 4Y28C 2JC0A 3AT1B 4ZVEA 3C15A 3LW5C 1WG1A 5DG7A 5LMNE 2FB0A 2MHNA 4JI0E 3TYTA 2XMMA 1RISA 3K5NA 3PW4A 2FLLA 3F41A 3GFXA 3ET6B 5L9XA 1VMBA 4KFBA 3MPYA 4G1QB 4C9DA 1FTRA 4JI0F 3UR0A 4ECZA 1FRLA 2HFNA 1S4FA 1L3UA 4FF2A 2DR6A 1NNDA 4EK2A 3G87A 4OV6A 3SQGA 2R3VA 1S79A 4WK3A 1VQMS 1T9XA 3JTPA 4GC7A 3BYPA 1NHKL 1HQ2A 1RT2B 3US5A 2QLJB 4EO8A 2CQ3A 2DNPA 2VD3A 1N36E 1MU5A 2OMOA 5E3PA 4NZ0A 3S01A 5C0XD 2Q43A 2C2EA 3RGIA 1V5VA 3KK3A 2BR0A 2IVFB 2QLFB 4NWBA 4USJC 3HSDA 2V4QA 1GMWA 4JV0A 1N48A 4K4ZA 3V6DA 2AJQA 2OPRB 3LF0A 2AKWB 1U2FA 3KK1A 1S4EA 2VG7B 2E5LF 1Q5VA 2ZHAA 3BR9A 3AD8C 4OZNA 2LQ5A 4OZ3A 2KG1A 3M8PA 5H1SV 1YZ6A 4QW8A 1ZZFA 3PX4A 5HMZA 2OIHA 3NCQA 3K5MA 4DR5F 3GSIA 4KAIA 2PDAA 4X65J 5KFPA 2RILA 1S9EA 3P45B 4L73A 4AL5A 1HBMB 2LDIA 3MXHP 4HH1A 5FIIA 5KOWA 3I31A 4R0EA 4IFDE 2IM3A 2EFOA 1PC4A 3DRPA 5DG9A 2BA0G 4F4AA 2EKNA 4ID5A 4C2MA 3MCNA 2KHCA 4G65A 1RADB 1SB6A 1UDSA 2G0IA 2MEWA 1Y0HA 4RBTA 3EX7B 1MN9A 2IAJA 4JYAJ 4DV4F 2Z57B 2P9EA 1R7IA 5A6WA 4DBQA 3DLBA 4KRWA 1GTEA 3RBDA 4NZ6A 1RKJA 2QG9B 2DGXA 1RK8A 4ECTA 1DARA 2IM1A 1UP1A 1SV5B 3E51A 3D5MA 4PG8A 4WIIA 1RACB 5A2QY 2ZJRQ 4YB6A 2YNFA 1KVKA 2G1DA 5E7OB 4MU4A 4JBCA 2YKMB 1YBUA 4RUAA 2GC8A 2C3UA 3CCWA 2KFYA 2YBVA 5C42B 3RAQA 5JVGQ 4ED6A 5KFNA 2H3EB 3GIJA 2HHHJ 3EZOA 1SL0A 1TQLA 2LQ9A 3G8QA 5C0XE 3OTDA 1H98A 4GKKE 4OYMA 1X4EA 3C3LA 2XBPA 4LF9I 3HJCA 5C0XF 3PW5A 4C8NA 1X4DA 1JLFB 1D8YA 4YHHI 2YKNB 2FVCA 2CNKB 4P7VA 4JI3J 4DHVA 2YY3A 3DHXA 4GVLA 3AFGA 5IWAI 1GQEA 4J9UE 3JAMC 5LMUI 3HVWA 3K1JA 1CJUB 1W26A 2APOA 2AX0A 2NXNA 3RB6A 2DNLA 3BYRA 4DV7J 2J0XA 3OFHA 4IQXA 4X66F 5F3TA 2E7VA 1IKWB 1JXEA 1PIEA 3CC4S 1ZXMA 1BD6A 4RW9A 1HNZJ 3HFKA 3JSYA 5IWAE 4NRTA 1A7GE 3O2IA 4DV2E 4LFCF 4KYZA 5E3AA 1S6QB 4DF8A 4LF4I 3I0RA 1KVIA 4DV2F 3CCES 5FDLB 2BJEA 4MH8A 4KPYA 3CCZA 2CPZA 2CG8A 1SL1A 4M1KA 4O44B 4N76A 1RHYA 1IKXA 2FZKB 2GVZB 4HACA 3M8ZA 4X2BA 5HVFA 5KFEA 1SVDA 4BC7A 1Q7YT 4WXOA 3ZKBA 3TAQA 1TZ0A 5A76A 4HXZA 4NYOA 3JXOA 3R97A 1REVB 4Y2AA 3TR5A 4DV5E 3DRRA 4TLRA 5LJ3Y 1H38A 1TKDA 2QMXA 4LRDA 3POTB 2VL1A 4KTQA 3NCRA 5EDWA 5IV4A 4DV5F 4A8OA 3W63A 3GLJA 3L9ZA 5GAHU 3TNVA 3IGNA 4HTIA 4KGKA 5KFDA 3M1VB 2B43A 3E01A 3MAQA 4WUCA 1NK9A 3SZ2A 4GVBB 1Z5BA 3M32B 4OMFG 4LBPA 3ZZRA 2D1CA 1TL7B 4YQWA 1NK7A 1RYSA 2MY7A 2NXJA 2AYMA 2PD1A 2AMCB 3ENWA 3LANA 2W4CA 2AGQA 4JI1I 3LNUA 2W9AA 6FDRA 4PXBA 3FFIB 5HP1A 3TJAA 1TKTB 3JTOA 3C14A 3UCGA 1KQFB 3HHNB 1PKUA 1P1LA 5K5MA 3JSBA 3QJPA 1XR7A 5D77A 2GFFA 2EI5A 1QVGR 4ECRA 2YVSA 1LWEB 4I64A 3BO4A 5F9LA 4OLPA 1GXUA 3FK4A 3W2VA 1HWIA 1TK5A 3QYYA 3R7NB 4HTJA 2F1DA 4AL7A 2VBZA 3NZKA 1OSDA 1OPZA 3Q8YA 3CCTA 2W7PA 1C1CB 1PC5A 2B6AA 4UF4A 3DGVA 2D3ZA 5HBMB 4RJVA 4QU6A 4KH1B 4FW6A 3DI6B 3OL7A 1LW0A 3ENVA 4F26A 3D68A 3CXCR 5L1LA 3T1HI 2V94A 4AYBD 2LKZA 4QWAA 5D4PA 2IM2A 1XMQI 1SPBP 1RWNB 1TK8A 1HR0I 3IO1A 2RD5C 2J6UA 5D0HA 1X9SA 2VG5B 1U1NA 4KV8A 4A47A 3QJJA 2VA3A 4NBQA 2G2OA 2CQ1A 5HQMA 1G7CB 1J5EE 3HZEA 1NCLA 2L48A 3HMJG 4RL1A 4OYZA 3OTOJ 2FVQA 1J5EF 1N34E 1S6OA 2UUBF 1RAHB 2VC1A 1HR0E 5KFVA 1FA0A 1F1BB 4LFAF 1F5AA 5DS7A 5JEAB 2M70A 3QJLA 2J9CA 2QLWA 1N34F 2C2KB 2AHOB 2CPXA 3KXDA 4ZCKA 4B17A 1RQ0A 4PG4A 4OZ1A 2UXBJ 2MZRA 4IH6A 1Z4UA 3C46A 4IRDA 2EKYA 3EDRB 4DR4I 2W2NP 1K9MT 2FZCB 3W65A 1S1WB 4MFBB 4K50A 1VLYA 4KH0B 2R7UA 2HHPA 2PO0B 1ZAWA 5EN1A 2EBGA 1HBOA 2F5GA 2CVIA 2C37A 1BHNA 1UJ4A 2V2ZA 1Y10A 3MMAA 3G82B 3JSMB 1KLMA 1LV5A 2RQMA 2DIVA 3B4MA 2WVFA 1M1KT 3QWPA 2PNMA 1Y5YA 2KU7A 3WX8A 4DR3J 1HNWE 1VOMA 1JQGA 5K14A 4NI2A 2ASDA 3CWVA 1ULRA 3NS5A 4OI0A 3V6JA 2BR2A 4DL6A 2C2OB 4NYPA 1HNWF 2HS0A 5K36A 2Z5CB 4I68A 3NGTA 3SI8A 1R0AB 4BC9A 2XWYA 4B9NA 2C28A 2UUAE 1RI7A 3DLLQ 4QU7A 2YTCA 4PQUA 2QFIA 1RABB 3THPA 4XIUA 1RAIB 2K7KA 3QRRA 1RWPB 1WDTA 3TVYA 5CD4A 5HMWA 1KHWA 2VC0A 3BSCA 4LQ3A 1S0VA 1E3HA 3J80C 1CC7A 1EARA 4CNYA 5KTQA 1UVNA 3ELHA 2CPDA 1QAXA 2JL9A 1FKAF 1CJTB 4U9RA 1YKWA 2FIUA 2PGCA 1AW0A 5ADZA 2FJAB 3AD7C 1DHMA 1NH7A 4USUA 3GG1A 2VQEI 4KT0C 2IYIA 3LGHA 1L5UA 2ZNZA 1RTJA 2XHWA 3GTYX 3JQKA 3FCWA 2DEJA 2PO2B 1MROB 1FHTA 4B3OA 4Z2XA 2GMJA 3GMEA 1N88A 1OSCA 1VQ6S 1XNQF 3OV7A 3CTRA 2O1VA 2IDLA 3C15B 3VF0B 4CM2A 2NXCA 2WONA 4TXSA 3PR5B 2W9BB 3MR6A 1A9NB 4J9VA 3QIDA 1T7PA 3GFYA 3DM2A 2AU0A 2R7QA 2ZNYA 1VQ8S 4FNIA 3JB9k 4E98A 3NOGA 1XJWB 1Z2LA 3A12A 3OQ2A 2A6OA 1P42A 2V69A 1Y4ZB 5HK4A 3VWSA 1HHSA 3HHEA 5ETQA 4CLUA 5GADU 2VESA 2F8EX 1MMNA 4DSKA 1NK8A 3NWRA 1I94I 3CMES 4IR9A 4DL2A 4F0KA 2HZVA 3DNCA 4MJKA 1VQKS 2DNOA 1E6YA 2XCAA 3KK3B 3T5HA 3FNNA 1HARA 1M5OC 2QT7A 2BA0D 3V6DB 4S0MA 4EMDA 3P3EA 4CI0B 3CNQP 2O66A 4DR2I 4DSLA 3IA0A 4P2XA 5B08A 2HAFA 1RHQB 2CQIA 4DQIA 3GB0A 4H4MA 5EWEA 2E9TA 3HXMA 4X4NA 3FBEA 5HATA 1OYRA 4YR0A 3O3LA 4IO1A 4ZOSA 1WC0A 3RR8A 1RU1A 2FPHX 3QGHA 1VC5A 2WB4A 3R5DA 5DNXA 3GV5B 5K8PA 2C1EB 2CZVC 2BQUA 3I0SA 1N32I 3GIKA 4LF8I 4V1Ak 5KFGA 1FJGF 4XO0A 2HHQA 2FJWA 1S9EB 2JVOA 5D15A 1PKPA 3DOKA 1JJ4A 1T11A 2YQ3A 5JUMA 2B7CB 4CT9A 5L3JA 2CWXA 3CW2C 3IWNC 2LQ8A 2MYFA 5KT3A 2I5JA 1G4CA 1HBUA 5HQLA 3WC0A 3BSOA 3ILLA 2NUHA 3A3PB 4LF8E 4KIAA 2FGOA 4LF7E 4QCLA 4I3HA 1OO0B 2C3OA 3H40A 4OO1A 1U6BA 1IXKA 2MSSA 5DO2A 3H8YA 5BR8F 1AUDA 2RS2A 4ZLPA 4LF7F 2MJNA 3B54A 4CH1A 1F3VA 3MM8A 4N5SA 2BJ8A 3AOCA 1JKHA 2VFVA 3I56S 4YY3I 2YNFB 1FDDA 1EHWA 2KT2A 4LIWA 1N52B 1RAAB 3KMSA 3V5RA 2OEKA 4B3TE 4UOFA 5K20B 4AE5A 3HSJA 3QBCA 2DNZA 5GMKa 1G1XA 1DLOA 3VV2B 3QT7A 1X9WA 2DCUB 4B3TF 2UXCJ 3U1LA 2XNRA 3FBBA 1RA7A 2V6AA 3EGZA 3VAFA 1WOSA 5LSLA 4RUCA 4OYXA 1RKIA 1WEZA 2NN6A 4F50A 4EGLA 1D8ZA 4NA2A 4RO0A 5KFTA 1HQEA 2ZM6I 4IKAA 3N28A 1Q86T 4JV2A 4DPYA 4IZKA 2B3TB 1S57A 3M4XA 4ILRA 3EGVA 4AIMA 2J8SA 2H54B 5K8MA 5J1EA 4FW3A 3KG1A 4PXCA 3PIOQ 4OYIA 4DXLA 5ELWA 5DROA 2JJ4D 1S0MA 1DURA 3KK2B 4B9TA 2ZDPA 4ZKAA 2HFSA 5EX0A 3PO4A 3M2UA 2E1MC 2ZM6E 4JI2F 2AW0A 4TY8A 3K59A 3BSNA 1N5YA 1FD2A 1WC6A 1RHRB 5HVHA 4NLWA 3UN2A 2JNJA 4JI0J 2O1WA 3PG9A 4C3KA 1WACA 4HHJA 4M5HA 1WSVA 1UZHA 1AYEA 5FLXU 2HSEB 3C6TA 1JJCB 4RNNA 2HNZB 2P5VA 4QNJA 4DPUA 2C39A 2YNIA 2G4BA 1T94A 4DPWA 5IS2A 2M8HA 3QRQA 3W1YC 1XR6A 2M2BA 1H2TZ 1SJ4P 3N4WA 4A8XA 1IBLI 1T02A 4ELTA 1OWXA 3VALA 1Y4SA 2Z2MA 2XQCA 4I69A 5D6GA 4J9NA 2Y1RI 1KQSR 4JI6E 3CD6S 4NXNI 3H2LA 1R6LA 4HACB 3M8SA 1O8BA 1AA1B 1EAYC 3QGIA 2OSRA 5ETLA 5A8WA 4U96A 3DMJB 3QMQA 3PRDA 3R5GA 3Q6NA 2E5LJ 4LPFA 1VIOA 2IERA 5H9EK 1RT7A 4CH0S 1ZPVA 4TU7A 3D1OA 5CZXA 4N77A 1IBKI 2K3IA 3H98A 3ENAA 5FLXQ 1RHKB 4X4TA 4ZPCA 3QAEA 1K8AT 1FI4A 3H1CA 4DL3A 1X0FA 2QMWA 1QSLA 2G9OA 3JQJA 4DR5J 1DFDA 1SL2A 3UFCX 2ZWPA 4K8RA 2XO7A 2WVBA 4MKYA 3D6TB 2YH1A 2DB1A 3BO3A 3KLFA 1IWGA 3T1YI 3GE9A 4WPAA 2J5AA 3O5TB 4DR6I 2JWNA 4ZCIA 1NO8A 4LSLA 2VICA 5D4OA 5HP1B 4AQYI 3IRWP 1ZM3A 1LXNA 3DCAA 2EWHA 4DV4J 4NE9C 2CIMA 1ZH5A 1AFIA 1C1BB 3OFGA 1VQ4S 5DDPC 2C2NA 2W8KA 4K4WA 3DLJA 1LOUA 1M5KC 3RB0A 3J7Z5 1OPIA 2HBZB 3AHPA 4WP9A 1WTFA 1U6FA 4MK8A 2UP1A 3L4BC 3HHKA 3T19A 2B6AB 2KT5A 2IRXA 3CDIA 1H2VZ 4DV3I 5KFUA 2OGUA 1FFSB 1REGX 2Z56B 2ZBRA 3ETOA 1Q81T 3OTEA 1T9UA 4PPZA 2VFTA 3M2VA 2RIJA 4ZLLA 3P3CA 2R7TA 3M6XA 2G2ZA 5IXUA 3ZZPA 3D4JA 3TVZA 3NRBA 2XS2A 1P8GA 3F0NA 2H5EA 1Z5AA 1TUVA 4DL7A 3AJ1A 2RRNA 1TMJA 2OEMA 2E66A 4E0DA 2DXEA 2PFDA 2IA6A 2P6TA 3HD1A 1C2PA 4LRBA 2BACA 5C0XA 3U7JA 3PW7A 2HLUA 2VKRA 4FP9A 1FKOA 5L9NA 2GHWA 2M8DB 1LFWA 3J7AN 2CQHA 3D6MB 3H5UA 3AB4B 3PW2A 4YFUA 3LGMA 4LSNA 3DU5A 2ZJPQ 3OFFA 3LPSA 4A8FA 2VASA 3U02A 2R7XA 5HQ8A 2X3DA 2NYIA 4X66J 2RVJA 2W25A 2MLXA 2Y9HA 1MU2A 2LDYA 8RUCA 2HG4A 3F73A 3TX0A 1HWJA 4MTPA 2KJVA 3MECA 4RLEA 3SYZA 4LFCJ 3HVAA 1HBOB 5DDOC 3IN5A 3PVXA 1X5OA 4LF9F 4W90B 5J2QA 4WTYA 2MLZA 3MMAB 4DV2J 2M3DA 1NHJA 2HS3A 4B3SI 1KLMB 3TJ9A 1CBKA 2CQBA 2BX6A 3T5JA 2JE6B 2VBWA 4ED5A 5IT9U 2N4DA 5LT5A 5K14B 4NI2B 2K1RB 3CJ5A 5LMUF 2Q3PA 2J0QD 4U8VA 4X64J 3UI3A 3N6NA 2BR2B 3DN9A 5HANA 2IBKA 4DR7E 1HNXE 1RT5A 2HPUA 2W4PA 4KHPE 2VZ9A 3AOAA 4UQTA 2B5JB 2B9WA 3S8SA 3EUNA 1K1SA 3GJRB 5I3UA 1HNXF 1OY8A 3W9JA 4PQUB 4KHPF 1PYTA 4HDHA 2B8QA 4ZHRB 4ZCMA 2J9DA 4EBDA 1NKEA 4F2RA 3OXLA 4C98A 4ELVA 1QDUB 1RAEB 1XN9A 2JX2A 4NL5A 4FBTA 4B9SA 2BE2A 4H4OB 2MMYA 1EQ0A 4J91A 1QUPA 2ZBCA 1SI9A 2XYHB 1USVA 1NZAA 3R1HA 1SC4B 4M63A 1IKYB 2BZ2A 1RT6A 3D28A 5IT9Q 1O51A 5IT0A 2FY8A 3M7VA 2UUCE 1WJ9A 2F1FA 5KG3A 2FHJD 2R2UA 1RTJB 3PV8A 2POKA 5B0FA 5KT6A 2ZOMA 4KGZB 5U47A 2UUCF 3TQ1A 4B3OB 1H7XA 3H42A 2NPIA 2RQ4A 1S16A 4WFXA 4NOHA 2NPFA 1Y3KA 1RT3B 1U2RA 4NLYA 4JI7E 3LWLA 2EG1A 2AIRB 1DAXA 2DGQA 4B9LA 3TI0A 2HBRB 2MQLA 2ZH5A 2VA2A 5FD1A 4JI5E 4CLYA 1U09A 4RW4A 1K0VA 2WONB 4B08A 3NL0A 1D3WA 1IR1A 3QT5A 1NB7A 4USWA 2ASLA 2ZUGA 5AXLA 5L38A 1UCNA 1KTVA 3DM2B 1V5IB 5DQGA 5HMYA 2O1PA 4USTA 4OJ3A 4DV6I 2PO1A 4BBYA 2ACMA 4WE1A 2JEAA 3J81j 4ZLNA 3K58A 1HK7A 4UOHA 5KOXA 1X5PA 1RREA 3TEGA 1JNZB 4L3NA 2IOQA 1E6YB 4ZPAA 4DR1E 2HHWA 1K73T 2FC9A 2BA9A 2FGCA 4DQSA 1JJHA 3BQ2A 2F3JA 1PO6A 4DR1F 2L9NA 2ZZTA 1J5EJ 4H4MB 4NXMI 2UUBJ 2CJYB 1T8EA 2UU9E 2RRAA 4LFAJ 2K06A 2GIRA 2VF3A 2ZJQQ 3HHLA 1N34J 3EICA 2V4RA 1FD8A 3DXBA 2UU9F 3PY8A 5RUBA 5K8OA 4EO6A 4Q45A 4JUZA 3T1HF 2MDAA 1GEHA 3I0SB 4DX8H 3T41A 2KZZA 1F2HA 2IFXA 4A4JA 3MUTP 3PS1A 4FPIA 1UFLA 3DOKB 1RHJB 3BF4A 2E1PA 5E0OA 4GMKA 5ITHA 1CJKA 3MPUB 1YJVA 1QM9A 3CD0A 4OI6A 1U8WA 4JB8B 2GIFA 4TYBA 4RNFA 4IG3A 2I5JB 1YJ7A 4ES2A 2GQCA 4LQ9A 1HBUB 3I4PA 2CDQA 2DR5A 1Z2ZA 4QIGA 3K5LA 5EL9A 5HJYA 2HIQA 3KLHA 1NJYA 1HNWJ 4DS5A 3FCVA 2BDPA 3MM8B 4A46A 3IM9A 3MR2A 3RZAA 1VFJA 4ZPWR 4C3LA 3BKFA 1JKHB 1V3SA 4JI4E 4FWDA 1RWUA 1D09B 1IQTA 2HWTA 1NXIA 3QSYB 4KQZA 4JI4F 2RF2A 2PNZA 1WC4A 4RW7A 3KLVA 4R5PA 1DLOB 2V0NA 1FKPA 1BXNA 1Y60A 3GJTB 2E1RA 5F3ZA 3IS9A 4I2PB 3GSDA 4B3MI 4X65I 2FVPA 4DCOB 3PNIA 2AYEA 5KFQA 3MF5A 1A6LA 4CTAA 1MW7A 2NN6B 1KNZA 3UN3A 3OUYA 4UUWA 2RKIB 4QWBA 1X60A 1USUA 2WW4A 4NLTA 6AT1B 2L41A 5J1EB 4OHWA 4NLGA 4JYAI 1M5PC 1FXLA 3BS9A 3HVRA 3TP2A 4K2XA 1XNQJ 4DWIA 4WK1A 4LF5I 2CRLA 1YZ7A 4OLOA 3KDOA 3M2UB 3DLGA 2XULA 2E7WA 3OXFA 4PRFA 1FDBA 1UPMB 1JLGA 1UEVA 1EJ7L 1WI6A 2HZAA 4FW7A 3UCUP 3NS6A 3JTNA 3VZHA 4JYAE 1RTIA 4L3KA 4HT7A 4C8YA 1CJVB 3C6TB 1ZPWX 3ILIA 1HWKA 5F8LA 4CLFA 4A8SA 5IFMA 2C39B 2K3KA 2YNIB 2Y1IA 2ADBA 2MQQA 2PI4A 2JEBB 1LKZA 4KHRA 1RWWB 1BQMA 4M5IA 8ATCB 2OELA 3QZ7A 3WX4A 4YB1P 1VQPS 5L1JA 1YLXA 5F9NA 3GLLA 1BQNB 4QPXA 3K85A 5A8WB 2GAGC 2RU9A 2HHHE 4JI3I 3QFWA 2HZCA 4G1PA 4QZVB 3AA9A 2OHDA 2CWKA 4URQU 1RT7B 2MJUA 2VOOA 3H5XA 5HJXA 1JLEA 1K44A 3I55S 2KXNB 2EXUA 2R8GA 2BRKA 1XHKA 1RCXB 1HNZI 3I4HX 2AEFA 2Z5BA 2QYCA 3SXLA 4B9MA 1JLCA 1Y3JA 1I94F 4C11B 5AT1B 1FJGJ 2DXFA 2VQFI 3SMZA 2B51A 4DV7E 2ZHOA 4AXIA 5EUHA 1W7WA 3MWBA 4DV7F 2WW8A 3PJWA 1IKVB 2OPQA 4LSLB 1NK4A 4C8LA 4DR2F 4ZVIA 4IZJD 2XMWA 2EFQA 1C4CA 2DY1A 1IR2A 2C3PA 4E8UA 4UY85 2COLA 2PA3A 3ZFVA 1R6VA 4IFDB 2V9KA 5BR8J 5D8HB 1UL3A 2Q2EB 4AFFA 2CKWA 4LF7J 2N7YA 4Y2MA 2ILYA 2MKCA 4M5NA 2YKQA 3Q83A 1YI2S 3LP1A 2ASYA 1RT1A 1KRPA 4YMEA 2JRSA 1UVJA 3W61A 3SBMA 1N32F 3ZZ0A 3GFHA 1U25A 2CQ0A 4ZVSB 3KWMA 5CYMA 4NZ7A 1MMDA 2CQ2A 3PKYA 2PMZD 2VFRA 5I3PA 5H9EJ 3CJKB 2PI5A 4BDPA 3ZNUA 2UUTA 2RT3A 3OT9A 2D9PA 2DVIA 4B3TJ 2F8HA 1H2UX 3M2VB 1HNIB 2OFGX 3QQCD 5F0UA 2HVHA 4IUFA 4CWBA 3W9HA 4IDKA 2P9CA 1TVRA 4NX9A 1TUWA 1RHUB 2AD9A 2G13A 1Q82T 1NBEB 2IBOA 3AJ2A 3CCJS 5J1PA 4RX6A 3NMAA 2W01A 3FSXA 2KB2A 1CQMA 4I1TA 2I9SA 1P9YA 5FLXC 3R2CJ 3CCUS 1LWCB 3HKMA 1WELA 5C0XB 4MKBA 1U45A 1F60B 4LF6F 4KPCA 3UN5A 4YY3F 4DQQA 1DBDA 1R8HA 5L8RC 3PX6A 3J81Y 2CG9A 3QO9A 4FN5A 5C25B 2GHVC 4JI2J 1ICEB 1N0UA 1A6FA 3WU5A 1MU2B 3I32A 3AOBA 2C2RA 2JOQA 3NWGA 3M9MB 3B4TA 2FJDB 4LVOP 2V8PA 2FDNA 1L3VA 4OYAA 3ZNJ1 2OD6A 1R6MA 2HRTA 3PM9A 4JI8I 1D6TA 3DFEA 3W64A 4DV0J 5J2QB 5J1NA 1Z0WA 4P52A 3J7A1 4PQAA 3TO8A 1XNRI 4WFZA 3MEDB 2VPXB 4Y34A 2GQ2A 3UDVA 4LR9A 1B99A 1NZ0A 3IRXA 2MZ1A 1QLNA 2LP4A 1KP6A 4LBIA 4NCGA 1RT5B 2XLJA 1L3KA 4DZDA 2KXHA 4WYLA 4H4KC 4R1FA 2VJUA 4PZVA 4NLXA 4CLWA 5CCLA 1SJ3P 2AP6A 4DSFA 4A48A 4P72A 4ED4A 3CCLS 4TY9A 4PWUA 5C24A 2RB7A 2BRLA 2Z58B 5KFBA 2RDIA 2BKOA 1MG7A 5KAKA 4IFDC 1N33E 3OTOE 3NKYA 1QUVA 1Z0TA 4B3RI 4FVMA 1MLAA 3EZ5A 1DRZA 2KL8A 2X51A 1N33F 4NXNF 3HVTA 1H6KX 5BYQA 3NAHA 1PYSB 2UXBE 1Y5LB 1LWFA 4ZCLA 5EKWA 1VRUB 3KLEA 2W7OA 4ECVA 3EVOA 1Y4UA 4DR3I 2NZ4A 4PYDA 4X4PA 2WVEA 3IBCB 3ADAC 2U2FA 5DZ7A 4NCAA 2MHEA 2XCPA 2HK2A 2ZHBA 3D54A 1CULA 4DU8A 3QLHB 4ERDA 2X7IA 2PO4A 2WSCC 3T5LA 2JEGA 2F4VE 4ZPTR 2JEIA 3GIRA 5G0RB 4DR3E 1B4SA 3CMQA 1JJ2R 1C4AA 5MAOA 2F4VF 4URGA 4OYOA 4AM3A 3D1HA 3KLGB 5H9FK 2V4JA 1YRUA 1OY6A 2V2KA 3T1YF 4WYWA 4FYXB 2KKHA 2PO1B 5DNLA 2MTLA 2EEYA 2MQ8A 4WE1B 1I3OB 2JEAB 3FEZA 1AXQA 4AQYF 3FDSA 1YRXA 1MWQA 2HK3A 2PE8A 2WB1D 1FX4A 4OX9I 4PG6A 1HI0P 2HYIB 4BCAA 4O3OA 5AE1A 1S1TA 2GGPA 1BE4A 3OSNA 1HW8A 4A8WA 1TKXA 3RB3A 2DR8A 4IR1A 5G4DA 2FJEB 1HPZA 1N5TA 5IT9C 2IA0A 2LXIA 2QEXS 4ZVUB 2DO4A 3HHLB 2B9XA 1EQMA 3V4MA 1WUUA 3W3SA 1S48A 3MMCA 2RMLA 2YX4A 4FWHA 3T5KA 1HD0A 5I4MA 1RBAA 1NH8A 1VC6A 4RU2A 1FEEA 3VQTA 1ZTWA 4J9QA 1S7HA 1CJKB 4LF9J 4MDTA 4ZVFA 5KFMA 4IOAQ 3GYGA 4MMOA 1HLWA 5B0DA 5LXYA 1LFPA 4YB5A 4IG3B 1ZM2A 2MGZB 4RKUC 3KHRA 1KEKA 4YHHJ 1WC5A 2Z30B 5MLCV 3VCDA 3E8OA 1NSQA 5LMUJ 5HI7A 3GCXP 3KLHB 4RWXA 3T6BA 1VC0A 4UOCA 3A4TA 1X4FA 2Z8QA 4IOCQ 2OEJA 4YP3A 3PYEA 5CHCB 3KUEA 3ISZA 2WAQD 3BJYA 4AT1B 4Q8EA 1HNXJ 3UCZP 1X4BA 3K0JA 4KHPJ 1JX4A 3NXZA 3U27A 1HBNA 4HYMA 1WEYA 4WU2A 3D66A 2NREA 3G2XA 5A2QU 2CJ9A 4R8UA 2AQ4A 3SCKE 3DLKA 4B3SF 5J2PB 4DSJA 1FKPB 3CJ3A 3GJSB 4O0IA 3MPVA 4UW2A 4P9SA 2HVEA 1WOOA 2BM1A 3D67A 4F3QA 2XY7A 2OLWA 4OI3A 4CTAB 3QWUA 4BA2A 3OJUA 4BHQA 1S1XA 1Z0BA 3OUYB 1PJ6A 4IQMA 2GHPA 1WWHA 1A0OB 2WCXA 1PSDA 2UUCJ 1RYRA 2QSFA 1DTQA 4DF4A 1BKNA 5ETNA 1TV6A 4QQBA 3R7SB 4WKRA 3CE8A 1TMMA 4HI2A 1NHVA 3DLGB 1HMVA 5E2QA 2QMUB 1TL1A 2CPIA 3M6AA 3HZGA 5A2QQ 1VK3A 2EG2A 2JZ5A 4ZVOB 2XO6A 2C2ZB 2VDIA 1KWMA 1RTHB 4TU8A 3F56A 2FHOB 1RTIB 4C7QA 2WTFA 2PEBA 4F8RA 4RNMA 4U67Q 1TKZA 2E29A 1N5SA 2HFOA 3T1AA 3CJQA 2PFFB 3U1MA 2RSQA 2CFXA 3G9CA 3GU0A 1BQMB 3MEKA 3CT9A 4JI1J 4ZPVR 2DO0A 1UA1A 2AX1A 5LOQA 3IWLA 5KT4A 1T03A 3OR1A 1PJ7A 1ZOTA 3FEXB 2W4DA 2IM0A 2XMVA 1KR4A 4X62E 2RHQB 1SQGA 1IBMI 4WFBQ 3MFHA 5L39A 2UXDF 2UXCE 2NXUA 2DHXA 3A3NB 2DGSA 5M2UA 4DR1J 4X62F 3LOUA 3K5OA 4YDDB 2UVUA 2UXCF 2IESA 4AXJA 1SQEA 3FBCA 1U0HA 2AF6A 1KFSA 1TAUA 4EU0A 1T05A 1JLEB 3QIPA 4WCEQ 3MR3A 1BQXA 4DFPA 2UU9J 3J7YI 2H9ZA 2HVDA 3MMBA 3CJ2A 2N82B 2GVDA 3GFZA 3T1HJ 2GJIA 2Z5BB 1X4CA 1IVZA 1UEUA 2DCLA 2HBYB 1LK7A 4JI0I 5IM0A 1JLCB 4OYWA 1XMQJ 2CADA 4UOGA 3THTA 2DHGA 4NLOA 4NA3A 5HROA 2SXLA 5ETSA 1ZAXA 2WNRA 1LW2B 4J9RA 3R5CA 1H72C 2G0CA 1FRIA 1VS3A 4DOZA 4FXDA 4QR1A 3SDEA 2OPQB 1GMUA 3M8QA 1DJ0A 3ZTPA 1FESA 2K2PA 1F5BA 3VTIA 5DZ6A 3NGUA 3PRYA 1N36I 2RHSB 1NU4A 4LBHA 1KOHA 2RDJA 3MEEA 1RLCL 3QSIA 3SCIE 2NYHA 3SSRA 5C5JA 1KC8T 3M85D 1YSJA 1NSAA 2D7SA 4WUDA 4DR4J 1RT1B 3WDOA 2VPZB 3QNWB 3DC2A 3ZTSA 4ZMMA 1D1UA 1Q53A 4JI4J 3IG1A 2GO9A 4CNZA 3KYLA 4DLGA 2F40A 1FEHA 2DH8A 2DGVA 4C3MA 2E5LE 1RLDA 3PXGa 3TAMB 2CYYA 3BGFA 1FERA 4IDKB 1TVRB 3UO0A 2HS4A 4DL5A 1WG5A 5FWKA 2EPIA 4Y6IA 3W8GA 3TJ8A 2N4CA 4ZVGA 4NASA 4IFYB 1SH2A 1OYDA 4KGVB 3ITHA 3B6BA 1U47A 2DD8S 4F3OA 2JHEA 3HF5A 4DR5E 3SIPB 2FHKA 4PYAA 4J7CA 2AYBA 2ABYA 2MKIA 4OHZA 3HT0A 3OHAA 4Q43A 1WORA 1H3DA 4CO3A 1VJWA 3VAHA 2Z5EA 3CULA 1YK9A 1NRKA 4WZQA 1ZTTA 1NJZA 2WVDA 4CLZA 4B3MF 1HQUA 2BUNA 4DV4E 4OZ0A 3MTJA 1X5SA 4KGXB 2J76E 3GMGA 3R1LA 3ZTRA 4M8LA 3M6VA 1R43A 3V81A 3CDUA 3H5SA 1B63A 3W2WB 4EEYA 4JV5E 2AWZA 2DK2A 5HO4A 2HRUA 2E44A 4O4RA 4DQRA 1N54B 4XPCA 2BW2A 1UFKA 3KLIA 4JV5F 4HVZA 2EC2A 1PVGA 2EC0A 2H51B 4USHA 4F4WA 2NSBA 1NSKL 3IRXB 1UVKA 5I42A 4LF5F 5KFRA 2R8HA 3VGTA 4DFKA 4GKKI 3H4LA 5CYQA 3LP2A 4NCGB 3UPFA 4PXDA 3WHIA 4CDIA 4K4UA 2VKZG 2C3YA 4BLGA 2BOPA 1WKJA 2GQQA 3D2WA 2ZOGA 1GTHA 2W2PP 4K0KE 1TFYA 4I2QA 1HKAA 4XDDA 4K4TA 4X66I 1KONA 1IM4A 3I5CA 5IZHA 4K0KF 1VBXA 2GO4A 2JSXA 2E1AA 4AIDA 1PJ5A 1YGYA 1VDHA 1HA1A 1I94J 2FJXA 4LFCI 5A0YA 3KTQA 2CJAA 2ZBKB 4IG0A 3UW1A 4Q2LA 3P8BB 3CMAS 4DV2I 4X66E 1VK8A 2DITA 1F9EB 1W2IA 5JVHQ 5KG0A 1LWFB 3PTWA 2OAUA 3KLEB 1FVQA 2VFUA 1N6QA 3T9NA 3QFHA 2YWFA 3RAMA 4DR2J 1Q0NA 5DM6Q 2R8KA 2IRYA 2KVQE 3W60A 2BA1D 1HNVB 4LFCE 4HEA9 4DLEA 1EA6A 5HMXA 4RWWA 3TZXA 2DRBA 3V6KA 2P2CB 2XLIA 1UVIA 3NLCA 4ED8A 3ET6A 1UWBB 4OYBA 4F4YA 1N32J 4ZA1A 4X4UA 3EGNA 4X64E 4I7FB 5HL7Q 1KN6A 1TL3B 2VQFF 3EZUA 4QW9A 3DOMB 5ETMA 4DV5I 4U3DA 4X64F 2BVZA 1Q79A 2OO4A 4DCPB 1PAEX 5F8HA 2DHAA 3MPDA 2J9DE 2C42A 4DV1E 3ZZZA 5B0AA 1XBWA 1X9MA 3HO1A 2QN6B 3VGVA 4EYIB 4GKJE 3DDKA 1J5OA 3R7BB 4KSEB 1VBZA 1Z0EA 2LEBA 2P9GA 1D9DA 4C4WA 1RAOA 4DV1F 3CDAA 4D3GA 4QWCA 2WVCA 4GKJF 4ECUA 1S1TB 2GGPB 2XS5A 2DNGA 2VG7A 2CQCA 3TZZA 1UVLA 3FSIA 3Q0AA 2DPIA 3RBEA 1S6PB 4GO5X 4LF6J 4WUBA 1U1QA 1OYSA 3TUIC 1U1LA 3SFUA 2CAJA 1Q16B 4YY3J 4JV1A 4PCQA 1S1UA 1WHYA 3W5ZA 1CQNA 1QTNB 2DIUA 3A8JA 3U1KA 5KG7A 3GCMA 2RQKA 4ZVRB 3MMCB 4QYRA 1FXDA 5D0EA 4NLUA 3PS3A 4Q2MA 3IP0A 2RDDA 4ZP9A 2KG0A 2I0XA 1FRJA 2QRRA 1RTDA 1NPRA 4FF4A 4NLQA 5H9FJ 2CG4A 5CQGA 2OFHX 1KD1T 2JLFA 3I6PA 1B7YB 1NEEA 2WSEC 1ZBTA 1FRMA 1RE1B 2VUGA 1M90T 2OP5A 4DG1B 5DLGA 2CVEA 3TVKA 2Z2YB 2FLOA 4U95A 3K17A 2MKYA 1B0VA 2A2DA 3ISND 2RUSA 2MKHA 2BQ3A 4IZJA 3C16A 2O01C 3EMTA 3I5AA 4RW6A 3M30A 2ALYB 3OHBA 4LCGA 1J5EI 3BKUA 1Z59A 3PRBA 3G8TA 1VQ7S 3BGUA 1EP4A 3SSQA 1RWVB 2DR7A 4ES3A 4QYZK 1N34I 2OKQA 2O3ZA 2UVVA 4ICLA 4KE5A 4JI8F 2YWEA 3BN4A 1JLAB 1XMOE 4MIBA 1NKCA 4MIWA 2GCFA 3HLUA 2V2VA 3DLKB 1RWXB 3RRKA 3PFOA 4FPRA 3HCXA 4XAKA 3LA0A 3DRYA 1CEZA 1P6TA 1XMOF 1IBLJ 2UUBE 1XNRF 3GJQB 4IYQA 5C2CA 4LFAE 5KFIA 3Q2TC 5AXKA 1N33J 4NXNJ 4DX5A 1H73A 4ZJQA 3W8PA 4MK9A 3HJVA 2ZVSA 3CO0P 1QE1A 3RW7A 4DPTA 2YKNA 1R89A 5EX3A 4YR2A 2R2TA 5DDQC 1N5QA 1UETA 4ANEA 2DNHA 3CO9A 1YH8A 1K1QA 2DH7A 4F04B 1TV6B 3ZC4A 2YPYA 1NK6A 4I6WA 1HNWI 1VHFA 2DPJA 1G2EA 2YNGB 4CRJA 4PUOB 3FRYA 1IBKJ 2E9RX 4OHYA 1HMVB 1TL1B 3FGVA 5A8RA 1S77D 3JQMA 4EYHB 4F67A 5DLFA 1S49A 1VBKA 1WTBA 2UUAI 2F4VJ 4PWDA 4B3RF 2X1AA 3M05A 1WHXA 3ZZYA 2FLNA 3Q23A 3MM9A 4Y0FA 3QGPA 4R25A 4IH7A 3T1YJ 1S6QA 2L08A 3RBXA 2MKSA 4USVA 1TL5A 2DNRA 3DYAB 3C19A 5FDLA 5IQ6A 2HQDA 1T9YA 2FD2A 3PS2A 4O44A 4ZP7A 4AQYJ 3NP5A 1KLNA 3WQPA 1Y5IB 2O67A 3OR1B 4PG7A 3TQEA 2BJ7A 2IDEA 4FF3A 4RBVA 2H65B 1UW4A 3J7AG 3THVA 3UE2A 1FKAE 2AJ1A 2DGUA 1NHUA 3HSZA 2YX1A 1V3RA 1REVA 2XI2A 5ETRA 1U48A 1TR0A 2J65A 1S1VA 2JH3A 2D3OR 2BQRA 5B0CA 4LCHA 5M2PA 1U0HB 1PGZA 3POTA 2RNEA 2OPPA 4WIQA 4UZBA 3QIPB 3BEGB 4OZ5A 3W9IA 3RW6A 2WZ1A 3D3BJ 2LU1A 3IXQA 3AXMA 2GVDB 2BANB 1XWLA 3D0HE 3FEYB 4LUBA 3M1VA 2FVSA 1NK0A 1IWAA 1OIAA 2O5DA 3P5TL 3G96A 4PWWA 2GJ2A 5JXSA 3WIVA 1XNQE 4Q44A 4NEZA 1YDLA 3B8HA 3MDFA 4OX9F 1Q95G 1MWYA 1TL7A 5HROB 2HHSA 1M1HA 1S0NA 3EWGA 3RTVA 2HWHA 1XC9A 3MR5A 5IQQA 2PA8D 4DPXA 3HP6A 5HLFA 3SDEB 3M8QB 5A2QC 3UDLA 3TEHB 1PBAA 4DQPA 1GK8A 1ZA2B 4DUZE 4KFBB 2V8DA 1HI8A 4C48A 4WU3A 2D3O1 2HRYA 1LWEA 2HNDA 3UWTA 3JAMY 1CVJA 3AH6A 4DUZF 4J9SA 2VH7A 3O44A 4ES1A 3MEEB 3SQGB 3B4DA 1T9TA 1Q8LA 5F8MA 4HL9A 1CSJA 2OI2A 1C1CA 5JEAC 3V2UC 4ID8A 1U1KA 2O3DA 3B82A 4E2FB 1FO1A 5KG6A 2NN6D 4B3SJ 2QE5A 1B70B 1BLUA 4MT1A 3C8YA 3J7ZT 1JNRB 4ZIWA 1NDKA 4GO7X 2IRUA 3ILJA 4USMA 3KK1B 3PRVA 3PHTA 4U7CA 2CUYA 2VG5A 2FUG9 5ETVA 2ZKTA 4UQGA 3WBZA 3M8PB 5GMDA 3ITHB 1SIZA 5DJBA 4F4ZA 3IBWA 2RE1A 4C0BA 1U1RA 1FJGE 4KKOA 2LYVA 4OKGA 1HD1A 3NGRA 1GH8A 1HW9A 4LF7I 4DZ6A 3BH6B 2J7WA 2Y3YA 3CEDA 1B62A 3NY0A 1CS4A 2KTQA 1U1MA 5LSOA 5GAEI 1KQKA 4K4VA 1OYPA 3CDJA 4UT4A 3DRPB 1S1WA 4MFBA 1HQUB 1VHIA 1RT4A 1S10A 4ID5B 2PO0A 2RH3A 3R27A 3RR7A 4K2JA 4F4XA 3KNGA 4ZVQB 3V81B 5BR8E 1B7FA 3CUNA 4HH0A 4WFNQ 2FZGB 2IAJB 1DZ5A 2U1AA 3P06A 2Z2LA 2NSCA 2IIHA 2DRAA 4B3TI 1XXEA 2AV5A 3IBFB 3PIPQ 2ATCB 1S97A 2B9EA 2UV8A 4L6V3 2D69A 1KS2A 2LEPA 4WP3A 1VQSA 3NGSA 4ATNA 4LFBE 2B4PA 3Q89A 4ETZA 2XNQA 3OD2A 5I42B 1F9HA 5CYQB 4LFBF 2VFSA 4DCJB 3BQ0A 1R0AA 1T9VA 2UXDJ 3AAWB 3WU3A 4QPTA 4FBUA 2VU5A 2G1HA 4X62J 2JT2A 2QLXA 5AXNA 3HSGA 1N5VA 2DR9A 2FTRA 2K8GA 5E33A 4I2QB 1E3PA 3L7OA 4ZK7M 5A6PA 2BKNA 4JI2I 2A2CA 2QGFB 4HLBA 2W2OP 1IN0A 3DLHA 3CCRS 1YBAA 1CJTA 2JFDA 3VR1A 2ROEA 4PG5A 4V19X 2BOAA 2OPSA 4FWGA 1APSA 3S7RA 5A0YB 2F9DA 4DUYE 4OI1A 2GAHC 1EB0A 1PCAA 4JI2E 4URSA 4EWTA 1IBMF 1S9GA 1HWLA 2PO2A 4DUYF 2YWWA 4IFDD 1FVSA 4N8OA 1WC3A 5BXIA 1G3OA 2F63A 4DU7A 2ZOFA 1IJFB 2DY9A 1RDRA 4RW9B 4NXMJ 3IMQJ 1IR0A 2VBXA 4MYUA 4LRCA 3BPSP 4DV0E 2LFVA 4JI6I 1RA6A 3J7YU 2B7BB 2BV3A 2KJWA 2Z2ZA 2W9BA 1P27B 4DV0F 5I3QA 2ZBPA 1TAQA 3I0RB 5LMNF 1AT1B 3FJ2A 1ZAVA 3QT8A 4NLPA 4W4MA 1XTZA 1AFJA 1ZM4A 4DX6A 3G6ES 1FCAA 4K5RA 5DGAA 1VLOA 2Q66A 1IKXB 1B64A 4YN3B 2L9DA 4LOMA 3BGOP 3FC9A 2HHUA 2DHHA 3R6LB 3EVMA 4DPOA 1FK9A 1J5OB 1WSRA 1SKSA 1VQNS 2ADCA 2FJVA 2YX7A 3EE3A 4TU9A 5B09A 3G6VA 3A8KA 1N36F 3UD5A 2RAQA 3DRRB 5DRPA 5J2MA 3T9ZA 4ANDA 1FDAA 3NAIA 4XDCA 2M7SA 1PG5B 2ROGA 3N9UC 4BWMA 3FMBA 2XB2D 3R5JB 1I6JA 5KG5A 1H7WA 3E01B 3FZ2A 4NPOA 1JMTA 5LL6d 1S1UB 1YRTA 2QLBB 5KT5A 1JLBA 2QIFA 3AY0A 2FY1A 4OHVA 4YB7A 4KQVA 2VPYB 4MAKA 1UPPA 3J80Y 2WHOA 3CIMA 1RGVA 2XMUA 4B3MJ 3PKMA 1NPPA 2AEMA 2W1BA 2XYPB 3C14B 3RRHA 1MWZA 2YKOA 2DNMA 3D9BA 1RTDB 2WP8A 3IC1A 3K7RA 2CQ4A 4IS9A 2MZSA 3BH7B 2LU2A 2G2YA 2MLYA 4JV5J 4IFDF 3W2VB 3OL8A 5KFOA 2ZH7A 4U3BA 1YIJS 4Z7CA 4MU1A 4LF5J 2GO8A 1FNMA 4C0OC 2EFVA 4M95A 4IZJB 3C16B 1NJWA 3P4UB 1QJHA 4RW6B 1ZETA 3M30B 1LW0B 4ECXA 4RUBA 4NLVA 3GZ7A 1YG0A 1UWAA 2I2YA 2JLGA 1C0UA 5DG8A 3U1NA 4HY1A 1EP4B 4ED2A 3CGIA 2QO3A 5CH7B 2XGPA 1S99A 3BGLA 1GXTA 4ICLB 2CJXB 3GP9A 2N7CA 2ATLA 4K0KJ 4WJBA 4KV8B 2OTJS 3BQ1A 1DQ9A 3Q8QB 3DLEA 5D3GA 2J6SA 2R42A 5F0WA 1SCJB 2A0FB 1XK8A 1TELA 3ZZOA 2XZWA 3G6YA 4CLSA 3AQPA 3GWCA 4QOTA 3R5BA 3GV7B 1ELOA 3R6GB 4Y2CA 5KFLA 4GKKF 2H48B 4OZ2A 2HBQB 4G3IA 3E3XA 1EETA 2NZCA 1QE1B 4Y2KA 3OBIA 2IY5B 2HVIA 2M88A 4CO2A 4M5MA 3SQOP 5CD4H 4AUKA 1NDCA 3GV8B 5K8NA 4C0HA 2FLPA 4LF9E 3KK2A 3D6FB 2C3MA 1KIJA 4P73A 4DR7I 3I82A 1HNXI 4KJIA 1S76D 2C37B 1WG4A 5A8RB 2P8IA 4YHHE 3UR3C 3OPKA 3BN7A 4KHPI 1RJJA 1D9FA 1FWPA 2GNKA 2ZWOA 5LMUE 2IYGA 4PWDB 1X31C 3MAHA 4Y00A 4N7TA 2AEJA 3HFVA 4YHHF 2Y1LB 2VQFJ 5KFCA 2KH9A 3MM9B 2HNZA 1S6UA 3BBBA 4DL0C 5IWAF 2F7VA 4DJBA 3N6LA 1VJQA 5K36B 2ZZNA 4QYZJ 5CAAA 1ZYQA 1XR5A 1U2CA 1O0PA 2R7OA 4I4BA 2HQGA 2A1BA 2I6WA 5IT4A 4DV1J 1FJCA 3EVWA 4Q5VA 3L95X 5GAGI 4GKJJ 2PC6A 4LF4E 3PJ9A 3DMJA 4NYZA 3HD2A 2UUCI 2YKAA 4ILLA 4FS2A 1V3ZA 4QJVA 3HHLD 3MM6A 1YJNS 4O4GA 1KBRA 3BPDA 2EVZA 3FQLA 4LF4F 3M9NB 5EGYA 2I8EA 5A8KA 1NAQA 1S1VB 4ZVHA 2PNLA 2KHDA 4TQSA 3BBFA 4JI7I 2OPPB 3CD5A 1SIWB 4J9PA 5F8NA 4DN0A 3FQKA 1UVMA 1HYSA 3PYDA 1LNQA 1SKRA 4Z7YA 3CDWA 4JI5I 3OLAA 1S9FA 4QR0A 4WFAQ 4ECQA 5B0BA 4K59A 1V6HA 1H0HB 4BWJA 2V8GA 1WF2A 1NM2A 4A8QA 2HKEA 3M8WA 5IC6B 3V6HA 2EFPA 3SCJE 2IVYA 2MKJA 5KFKA 5HLFB 2XMTA 3FBFA 4F02A 2R7RA 5E5NA 9RUBA 3Q1QA 5THWA 2CDRB 4KBIA 1RAJA 4HR2A 4P7TA 1C1BA 2HIYA 4OI4A 5KFSA 4OX7A 3I9V9 4F2SA 3KJVA 2HNDB 4DR1I 3J7AM 3NNAA 2E5JA 4JI1E 4Y65A 3NEKA 4CLTA 4DSEA 2BBEA 1Q4RA 3IAS9 1AZSA 3UQSA 1YHQS 1JB0C 4JI1F 4G6VB 4UZCA 1NDPA 4UY8T 2UU9I 4JI8J 4RUHA 1RP5A 3FCHA 1HFEL 4YR3A 4LRAA 2MB0B 3KJNB 1JLQA 3MCOA 2FC8A 3ZXWA 1JWWA 3GCWP 1UDNA 3JYTA 2ALZA 3C2PA 5KT7A 3W7BA 1XMOJ 1NZ8A 3A8IA 1XNRJ 1O6XA 2F9JA 1VIXA 1GX6A 4LIRA 1HIYA 1F9FA 3ETMA 2XWXA 5EHHA 2DH9A 3HT3A 2M9KA 3FRZA 3K57A 2FHMA 1M1GA 3UNGC 3T1HE 2H5IB 1HWUA 2XI3A 1RU2A 2W2QP 2F4FA 1XMQE 4WF9Q 5B0EA 4MYTA 4KKOB 3DOLA 2EK6A 1OYEA 5K36C 1YBTA 2QL7B 4CT8A 2R2RA 2ZC4A 4V19J 2M52A 3H25A 1XMQF 3MAAA 1HR0F 2LVWA 2JDJA 1CS4B 3VHQA 2I1RA 3M8RA 1BWVA 2F8MA 1F2GA 3J81U 3VGUA 2DGTA 2CNLB 3ILOA 3ISNC 1RT4B 4B3RJ 2HNYA 2X36A 4JI4I 1UJ6A 3BSAA 1BUXA 3ULHA 3WIUA 2VIHA 4OO1B 1XERA 5EWGA 1TTHB 2DJWA 2V34A 1F3FA 4OX8A 4DR4E 2JE6A 5B7WA 3KDNA 3DDNA 2CJQA 2ZH8A 2YWKA 2ZD1A 4QIFA 2HQIA 2XYGB 2K1RA 3GR0A 3NG8A 2XY5A 4DR4F 3SV4A 1UEKA 2W7AA 4ZVPB 2KO1A 1Q8BA 2VB6A 4F0MA 4WXWA 3L3CA 3UD3P 2VV5A 5HAOA 2B5JA 4KR0B 2YH0A 3N79A 2UV8G 2Y8YA 1WKLA 3BKTA 3WZ0A 3X3UA 4ZN3A 1FFGB 5CCMA 3EDQB 2B8PA 4RNHA 2X3GA 3J81Q 2UUAF 4ZHRA 1X7VA 5F8JA
chains in the Genus database with same CATH topology
5LMNE 2V2VA 4RPFA 1H74A 4LF9E 4JI0E 4LFBE 3ZZTA 4WUCA 2Z5EA 2J7KA 2UUBE 1Z5BA 3PYEA 1KIJA 4DR7I 2LJPA 1HNXI 3OTOI 1N33I 4JI3E 4IZKB 4LFAE 4USKA 2UXDI 2GQ0A 4YHHE 4EMDA 4DV4E 4KHPI 4DR2I 4X62I 1H73A 2XEXA 5FLXC 1FWKA 3WU3A 1Z0CA 5LMUE 1XNQI 1KKHA 2R3VA 1ZXNA 2UXCI 1B63A 4UTGA 4DV3I 4JI1I 3LNUA 4DPTA 4JV5E 1IBLE 4HYMA 2UXBI 4X64I 1HNZE 1N36E 4NXNE 4JI2I 1HNWI 2CG9A 1MU5A 1PVGA 2UXDE 2A2CA 4FN5A 4OX9E 1N0UA 3D4JA 1A6FA 4DV1I 3WU5A 2VQEE 3HULA 2BM1A 2VQFE 1N32I 4DUZI 4LF8I 4GKJI 4GKKI 3H4LA 1ZM9A 3F0NA 2V8PA 1Z5AA 1PKPA 4FWGA 3J81C 2F4VI 1S4EA 4LF4E 4DUYE 1Z0BA 2UUAI 4JI4E 2UUCI 4FWDA 4JI8I 1D6TA 5L3JA 4DV6E 4JI2E 2HHHI 2BM0A 4PU9A 1IBKE 4K0KE 1Z0WA 4P52A 3T1HI 1Z0VA 1BKNA 4LF8E 2HFUA 4DU7A 2PNLA 4X66I 4LF7E 1XNRI 3LPSA 4I3HA 4JI7I 1XMQI 2E1RA 3GONA 4B3MI 1NZ0A 1HR0I 4URLA 4MYUA 4X65I 4DV0E 2V2QA 3PYDA 4JI6I 3T1YE 3M6AA 4Z7YA 4JI5I 5A2QQ 2BV3A 4LFCI 4DR6E 1J5EE 2ZBKB 3PYFA 3J7AG 4R1FA 4DV2I 4X66E 1FKAE 4NXME 4YY3I 3QT8A 4PRXA 1USUA 2WW4A 4DV7I 4AQYE 2HKEA 1ZM4A 1N34E 1NHJA 3V5RA 4B3SI 5GMEA 4B3TE 1Y6ZA 2AJ4A 4ED4A 1HR0E 1K47A 4PRVA 4JYAI 1I94E 3QT7A 4LF5I 4LFCE 1FJGI 3Q1QA 1EA6A 1MG7A 3JAMQ 4DR7E 1HNXE 3OTOE 2E5LI 1RR9A 1Z0TA 4DR4I 1N33E 3WU6A 3J80Q 4FW9A 4B3RI 1DARA 4KHPE 4DR2E 4X62E 1IBMI 2O1TA 1XNQE 4JYAE 1Z5CA 2ZM6I 4DR1I 3J7AM 2UXCE 4DPYA 2V2ZA 3B8HA 4IZKA 4DV3E 4JI1E 1KVKA 2UXBE 4X64E 1NHIA 4JG4A 1Y4UA 4DPXA 4DR3I 1MX0A 2ZITA 4DV5I 2PNMA 5BR8I 4DXLA 1HNWE 1H7SA 5A2QC 2UU9I 4DR5I 1FWLA 3CWVA 1EI1A 4DV1E 2HFSA 4XTJA 2HK2A 2ZM6E 1N32E 4DUZE 1XMOI 4GKJE 4GKKE 2Z5CB 4DU8A 1USVA 2Z5BB 2X7IA 1Z0EA 2F4VE 4LF9I 4KQVA 4JI0I 4LFBI 5IT9Q 3K85A 4DR3E 1QZRA 1H7UA 3HJCA 3WU4A 2UUAE 2UUCE 2O1WA 2UUBI 4JI8E 2IOPA 3ZKDA 2CGEA 2HHHE 4JI3I 4LFAI 2O1UA 2OI2A 4YHHI 4DV4I 4DPUA 1N0VC 3T1HE 2DEIA 5IWAI 4LF6I 3V2UC 1S16A 1H72C 3JAMC 5LMUI 4DPWA 2NPFA 3J80C 3Q6MA 1XNRE 3K1JA 4WUBA 1U2RA 3B82A 4JI7E 1XMQE 4JV5I 1IBLI 4MYTA 4B3ME 1Y4SA 4X65E 3ZM7A 3PRYA 1XHKA 4JI6E 3PYGA 1HNZI 1N36I 4NXNI 1PIEA 2Z5CA 4JI5E 2Z5BA 2HK3A 4HACB 1ZXMA 1VISA 4OX9I 4Z7CA 2CZ9A 4USMA 5IWAE 4LF6E 4P7AA 3QT5A 2VQEI 1FNMA 2VQFI 3B78A 4DV2E 3QT6A 4YY3E 4IZJB 1KTVA 3Q6NA 4DV7E 4WUDA 4N3OA 4B3SE 2DEJA 3LTOA 5GMDA 4LF4I 1Z0GA 2X36A 4DUYI 4JI4I 4HY1A 2HKJA 4DV6I 4LF5E 4ZVIA 1FJGE 1OJ4A 4IZJD 4M1KA 5LL6R 5IT9C 1IBKI 4K0KI 2O1VA 2V34A 5FLXQ 2E5LE 4DR4E 1HK7A 1FI4A 1WUUA 4B3RE 4HACA 4LF7I 1RREA 2R42A 2Q2EB 1IBME 4FWHA 1B62A 2IOQA 5FWKA 4DR1E 1UEKA 3K17A 4DV0I 2A2DA 1NHHA 3ZKBA 4IZJA 5LMNI 4UT4A 2GS8A 3T1YI 4HXZA 1ELOA 3ZZ0A 4DR6I 1J5EI 1Z59A 4DV5E 3ZZUA 5BR8E 4NXMI 2UU9E 3P06A 4DR5E 2EFGA 4AQYI 1ZM2A 1N34I 3J81Q 1ZM3A 2VF3A 4B3TI 1XMOE 1I94I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN E;  2V2V A;  4RPF A;  1H74 A;  4LF9 E;  4JI0 E;  4LFB E;  3ZZT A;  4WUC A;  2J7K A;  2UUB E;  1Z5B A;  3PYE A;  1KIJ A;  4DR7 I;  2LJP A;  1HNX I;  3OTO I;  1N33 I;  4JI3 E;  4LFA E;  4USK A;  2UXD I;  4YHH E;  4EMD A;  4DV4 E;  4KHP I;  4DR2 I;  4X62 I;  1H73 A;  2XEX A;  5FLX C;  1FWK A;  3WU3 A;  1Z0C A;  5LMU E;  1XNQ I;  1KKH A;  2R3V A;  1ZXN A;  2UXC I;  1B63 A;  4UTG A;  4DV3 I;  4JI1 I;  3LNU A;  4DPT A;  4JV5 E;  1IBL E;  4HYM A;  2UXB I;  4X64 I;  1HNZ E;  1N36 E;  4NXN E;  4JI2 I;  1HNW I;  1MU5 A;  1PVG A;  2UXD E;  2A2C A;  4FN5 A;  4OX9 E;  1N0U A;  3D4J A;  1A6F A;  4DV1 I;  3WU5 A;  2VQE E;  3HUL A;  2BM1 A;  2VQF E;  1N32 I;  4DUZ I;  4LF8 I;  4GKJ I;  4GKK I;  3H4L A;  1ZM9 A;  3F0N A;  2V8P A;  1Z5A A;  1PKP A;  4FWG A;  3J81 C;  2F4V I;  1S4E A;  4LF4 E;  4DUY E;  1Z0B A;  2UUA I;  4JI4 E;  2UUC I;  4FWD A;  4JI8 I;  1D6T A;  5L3J A;  4DV6 E;  4JI2 E;  2HHH I;  2BM0 A;  4PU9 A;  1IBK E;  4K0K E;  1Z0W A;  4P52 A;  3T1H I;  1Z0V A;  1BKN A;  4LF8 E;  2HFU A;  4DU7 A;  4X66 I;  4LF7 E;  1XNR I;  3LPS A;  4I3H A;  4JI7 I;  1XMQ I;  2E1R A;  3GON A;  4B3M I;  1NZ0 A;  1HR0 I;  4URL A;  4MYU A;  4X65 I;  4DV0 E;  2V2Q A;  3PYD A;  4JI6 I;  3T1Y E;  3M6A A;  4Z7Y A;  4JI5 I;  5A2Q Q;  2BV3 A;  4LFC I;  4DR6 E;  1J5E E;  2ZBK B;  3PYF A;  3J7A G;  4R1F A;  4DV2 I;  4X66 E;  1FKA E;  4NXM E;  4YY3 I;  3QT8 A;  4PRX A;  2WW4 A;  4DV7 I;  4AQY E;  2HKE A;  1ZM4 A;  1N34 E;  1NHJ A;  3V5R A;  4B3S I;  5GME A;  4B3T E;  2AJ4 A;  4ED4 A;  1HR0 E;  1K47 A;  4PRV A;  4JYA I;  1I94 E;  3QT7 A;  4LF5 I;  4LFC E;  1FJG I;  3Q1Q A;  1EA6 A;  1MG7 A;  3JAM Q;  4DR7 E;  1HNX E;  3OTO E;  2E5L I;  1RR9 A;  1Z0T A;  4DR4 I;  1N33 E;  3WU6 A;  3J80 Q;  4FW9 A;  4B3R I;  1DAR A;  4KHP E;  4DR2 E;  4X62 E;  1IBM I;  1XNQ E;  4JYA E;  1Z5C A;  2ZM6 I;  4DR1 I;  3J7A M;  2UXC E;  4DPY A;  2V2Z A;  3B8H A;  4DV3 E;  4JI1 E;  1KVK A;  2UXB E;  4X64 E;  1NHI A;  4JG4 A;  4DPX A;  4DR3 I;  1MX0 A;  2ZIT A;  4DV5 I;  5BR8 I;  4DXL A;  1HNW E;  1H7S A;  5A2Q C;  2UU9 I;  4DR5 I;  1FWL A;  3CWV A;  1EI1 A;  4DV1 E;  2HFS A;  4XTJ A;  2HK2 A;  2ZM6 E;  1N32 E;  4DUZ E;  1XMO I;  4GKJ E;  4GKK E;  4DU8 A;  2X7I A;  1Z0E A;  2F4V E;  4LF9 I;  4KQV A;  4JI0 I;  4LFB I;  5IT9 Q;  4DR3 E;  1QZR A;  1H7U A;  3WU4 A;  2UUA E;  2UUC E;  2UUB I;  4JI8 E;  3ZKD A;  2HHH E;  4JI3 I;  4LFA I;  2OI2 A;  4YHH I;  4DV4 I;  4DPU A;  1N0V C;  3T1H E;  2DEI A;  5IWA I;  4LF6 I;  3V2U C;  1S16 A;  1H72 C;  3JAM C;  5LMU I;  4DPW A;  2NPF A;  3J80 C;  1XNR E;  3K1J A;  4WUB A;  1U2R A;  3B82 A;  4JI7 E;  1XMQ E;  4JV5 I;  1IBL I;  4MYT A;  4B3M E;  4X65 E;  3ZM7 A;  1XHK A;  4JI6 E;  3PYG A;  1HNZ I;  1N36 I;  4NXN I;  1PIE A;  4JI5 E;  2HK3 A;  4HAC B;  1ZXM A;  1VIS A;  4OX9 I;  4Z7C A;  2CZ9 A;  4USM A;  5IWA E;  4LF6 E;  4P7A A;  3QT5 A;  2VQE I;  1FNM A;  2VQF I;  3B78 A;  4DV2 E;  3QT6 A;  4YY3 E;  1KTV A;  4DV7 E;  4WUD A;  4B3S E;  2DEJ A;  3LTO A;  5GMD A;  4LF4 I;  1Z0G A;  2X36 A;  4DUY I;  4JI4 I;  4HY1 A;  2HKJ A;  4DV6 I;  4LF5 E;  4ZVI A;  1FJG E;  1OJ4 A;  4M1K A;  5LL6 R;  5IT9 C;  1IBK I;  4K0K I;  2V34 A;  5FLX Q;  2E5L E;  4DR4 E;  1FI4 A;  1WUU A;  4B3R E;  4HAC A;  4LF7 I;  1RRE A;  2R42 A;  2Q2E B;  1IBM E;  4FWH A;  1B62 A;  4DR1 E;  1UEK A;  3K17 A;  4DV0 I;  2A2D A;  1NHH A;  3ZKB A;  5LMN I;  4UT4 A;  2GS8 A;  3T1Y I;  4HXZ A;  1ELO A;  3ZZ0 A;  4DR6 I;  1J5E I;  1Z59 A;  4DV5 E;  3ZZU A;  5BR8 E;  4NXM I;  2UU9 E;  4DR5 E;  2EFG A;  4AQY I;  1ZM2 A;  1N34 I;  3J81 Q;  1ZM3 A;  2VF3 A;  4B3T I;  1XMO E;  1I94 I; 
#chains in the Genus database with same CATH topology
 3TW0 A;  3ZO7 A;  2DXD A;  1H74 A;  2KYZ A;  3HK2 A;  3JSR A;  2A3J A;  3ZZT A;  4H4O A;  1HQE B;  5C7P A;  4KY3 A;  5L46 A;  3N5B A;  4IZK B;  1R8C A;  2DNY A;  3MUM P;  4FW5 A;  2OPS B;  1WD6 A;  1FDN A;  1IKY A;  4A8Y A;  4OX9 J;  1Z0C A;  1KKH A;  5DRQ A;  3MMJ A;  2MPU A;  3RU0 A;  4UTG A;  1DY3 A;  4CO4 A;  4RR5 A;  1YJT A;  1S9G B;  3OL6 A;  2ZZM A;  3N0V A;  4CQ1 A;  4X4O A;  4EZ6 A;  4YS2 A;  2KI2 A;  1KQG B;  1JXL A;  3HKW A;  1Q1K A;  1RT3 A;  4TY8 B;  5CZV A;  7AT1 B;  1B0T A;  4L72 B;  4IOB A;  1N5Y B;  2PN6 A;  5E3Q A;  3P76 A;  2VQE E;  5BJR A;  1X4A A;  3MM5 A;  4DSI A;  4DUZ J;  3AOD A;  1R6Y A;  2MST A;  4EUV A;  2VQE F;  2FJB B;  2GZO A;  1SKW A;  3OL9 A;  2RJZ A;  2HHH I;  4EI2 A;  2BM0 A;  1M5V C;  4CH7 A;  2DRD A;  4WTO B;  5DGB A;  2VHG A;  3SEO A;  1RBO B;  2P6S A;  4IH5 A;  3CCS S;  2GX8 A;  2HFU A;  1Y9O A;  4KC5 A;  3A3O B;  5L1I A;  4JOU A;  1I1G A;  1BY9 A;  2PEH A;  2R7V A;  4PEO A;  5DRR A;  1Q78 A;  2MY8 A;  2V2Q A;  1FK9 B;  2FQQ B;  2HVZ A;  4CCH A;  3AA8 A;  1FT8 A;  1NLK L;  5J2M B;  3CF5 Q;  5AJ3 F;  5F41 A;  3GIM A;  4PRX A;  2MXY A;  3OSP A;  4DV7 I;  5CAB A;  2R7S A;  3TWZ A;  4NEY A;  1U1P A;  1GMV A;  3GPA A;  1T9W A;  1I94 E;  1CLF A;  3MOZ A;  3CC7 S;  4OO1 C;  4AL6 A;  3M6U A;  2ZH1 A;  2J7U A;  2I38 A;  2VOD A;  2V67 A;  4WBF A;  4FYV B;  2EK1 A;  3FVY A;  1F6T A;  1JLB B;  3KLF B;  4L74 A;  3M9O B;  4C8M A;  1N8R T;  4DR2 E;  4DFM A;  5HVG A;  5AE2 A;  4ER8 A;  3L7Z A;  5SZT A;  1Y5N B;  3TZY A;  1J2V A;  2E5H A;  1VYA A;  2MKK A;  4NMX A;  2FYX A;  2QSW A;  4J5O A;  3PJX A;  2Z0G A;  2JLE A;  2WP8 B;  4ED7 A;  1JIH A;  1YJR A;  3MTK A;  2KDO A;  7FD1 A;  5DDR C;  2AZ1 A;  1DTT A;  1N32 E;  4O3Q A;  2R9L A;  1KFD A;  2NN6 C;  4OZJ A;  1R27 B;  1FRX A;  1VQL S;  4NML A;  5DRK A;  5CYJ A;  4LF8 F;  3VAM A;  2AJ0 A;  4LFB J;  2QC3 A;  3AQO A;  1GFW B;  2HQF A;  5ETP A;  3CJS A;  1UW9 A;  1YX2 A;  2Y1J A;  5GAE U;  2W8L A;  1EKS A;  1TL4 A;  3C6U A;  4LF6 I;  5KFW A;  1C0U B;  3MHY A;  5K9F A;  3QAT A;  2ZFH A;  3L7P A;  3GR1 A;  3QZ8 A;  1URR A;  2ZKU A;  2DT9 A;  2QA1 A;  3L7U A;  4O0N A;  3CJ8 A;  2N3O A;  5T14 A;  5JJB A;  2DHS A;  1VIS A;  5D3G B;  3DLE B;  2ZEJ A;  1MNE A;  4I2P A;  3KNA A;  4I0W A;  2JEJ A;  4LF6 E;  2ASJ A;  4ITS A;  2A10 A;  2QL5 B;  1UJ5 A;  2AT1 B;  4YY3 E;  1OMS A;  4M5D A;  3HI9 A;  2AGP A;  1FKO B;  3M85 G;  3SFG A;  5KT2 A;  3KUH A;  4XK8 C;  1QD1 A;  1YWX A;  4DEZ A;  2RKI A;  1IBM J;  3G6X A;  1EET B;  4LSN B;  5ETO A;  4LT6 A;  4ED1 A;  4DUY J;  4OYP A;  2MZJ A;  1OJ4 A;  3Q86 A;  3IR5 B;  3KJQ B;  3SV3 A;  2IC3 A;  2RU3 A;  2CQD A;  3V4I A;  3HKZ D;  1XIQ A;  1ZA1 B;  1RWM B;  3CIZ A;  2WBM A;  2CQP A;  3IGV A;  4ZJO A;  1KDN A;  5BYR A;  4FNH A;  3N01 A;  3MEC B;  2VON A;  1U7L A;  1BGX T;  1VQY A;  2IMO A;  2UUW A;  5D4N A;  2WOM A;  4J9K A;  5LMN J;  1LXJ A;  4L75 A;  4QIW D;  1DQA A;  2ZM6 F;  2XGQ A;  4FW4 A;  5E3C A;  2DKO B;  4ZIV A;  3ZZU A;  3KHG A;  3QAU A;  1N4L A;  1SJQ A;  1RAG B;  4ED3 A;  4YOE A;  2C38 A;  1CJV A;  2WBR A;  2OJ3 A;  3GYX B;  2CXE A;  2EFG A;  2KFZ A;  3EPG A;  2CPJ A;  4X4S A;  5AXM A;  1RCO B;  2R7W A;  4WFY A;  2L9W A;  2JEB A;  1Y00 A;  4RPF A;  4OFZ A;  4IRC A;  3P5B P;  3DKD A;  5HSP A;  2HUR A;  5I3U B;  1RWO B;  4B9U A;  2HGN A;  1N33 I;  3OTO I;  4F0H A;  1D0E A;  2QA4 S;  2AJ2 A;  4BA1 A;  2IPO B;  2GQ0 A;  1N36 J;  1WHW A;  2B9Y A;  7FDR A;  5T41 A;  4U7U D;  1BQN A;  4JI6 F;  2LA6 A;  1BMQ B;  3LPY A;  1ZXN A;  2DNK A;  3MM6 B;  2WRM A;  4O4G B;  3PEH A;  1IBL E;  2UXB I;  5LJ5 Y;  4D3H A;  3UDC A;  1RWK B;  2KXF A;  1R3N A;  3I5B A;  5A8K B;  3DU6 A;  3CJT A;  2BE2 B;  3KG0 A;  4NXN E;  1GT8 A;  5F8I A;  1IBL F;  3PCO B;  1NPK A;  2IJN A;  1WEX A;  3PX0 A;  1LWX A;  1RT6 B;  1VR6 A;  1F5C A;  2W9C A;  1HYS B;  1IUJ A;  3LP0 A;  2HMI A;  2KVI A;  3K89 A;  4I56 A;  2F4V I;  1V9O A;  3X1L B;  4C11 A;  2DGO A;  1QTM A;  4ELU A;  2V63 A;  3W5Y A;  5JMN A;  4OQJ A;  2IJR A;  5E3R A;  4H4K A;  2WK4 A;  2BE9 B;  4PU9 A;  1IBK E;  2YNH A;  4CLP A;  4ANC A;  2QJ3 A;  1PBU A;  1C0T A;  4DI6 A;  1IKV A;  2VPW B;  1SKU B;  1UKU A;  3VAJ A;  1IBK F;  4RW4 B;  2HEK A;  2BJ9 A;  2XM3 A;  3N5F A;  2J0W A;  3M7N G;  1RXO B;  3T1Y E;  3H2V E;  1L3S A;  4IFD A;  2NUU G;  1MSW D;  4DN9 A;  3CPW R;  3KJV B;  4DR6 E;  3PYF A;  4IO9 Q;  5C0X C;  1XMB A;  1MML A;  5EWF A;  3EXY A;  2EFN A;  3GQC A;  4AQY E;  4DR6 F;  3DXS X;  2YQ0 A;  5GME A;  1Y6Z A;  1AZS B;  1OS5 A;  3OW2 R;  2YKP A;  3H20 A;  2K7J A;  2YPZ A;  3D7S B;  4Y2I A;  1QSY A;  4OZE A;  2QA4 G;  1RZM A;  3CJK A;  2BA1 G;  4U6P A;  4ZN1 A;  2MQN A;  4OZL A;  3CJ4 A;  1JLQ B;  2ZH3 A;  3CJR A;  1QAJ A;  1HNI A;  3I96 A;  3WU6 A;  4EBC A;  2D3U A;  4WZM A;  4FZV A;  3JYT B;  3RYL A;  3NMR A;  2XLK A;  5JEA D;  4QNK A;  4EBE A;  1YIT S;  3LPE A;  2D41 A;  5CA5 A;  4DV3 E;  4ZPB A;  4ZPD A;  1UA0 A;  3DRS A;  4GKK J;  2EBE A;  1NKB A;  1MX0 A;  2ZIT A;  1LWC A;  4DV3 F;  2M0G B;  1SUQ A;  3PO5 A;  3DOL B;  2IJF A;  4XTJ A;  1BC6 A;  4ZIT A;  4NA1 A;  3QGG A;  4ALZ A;  2BYC A;  3PZP A;  4ECS A;  1KOO A;  4PKD B;  2AYG A;  2XSJ A;  1SC3 B;  5C25 A;  2LA4 A;  3PEJ A;  2QYG A;  3MAA B;  3NNC A;  1QZR A;  1YJ9 S;  3L09 A;  1U4B A;  4X4Q A;  4RBU A;  4FDF A;  5E41 A;  2V68 A;  3LAL A;  1EIY B;  1VQ5 S;  2X1B A;  2HGM A;  1M5S A;  2L3M A;  1N0V C;  2HNY B;  2GV1 A;  1Q7L B;  3Q6M A;  5IWA J;  3DGP A;  3HFZ B;  1S59 A;  3KHL A;  1R8B A;  4P2S A;  4DUT A;  4MQY A;  3VGS A;  5BYS A;  4M5K A;  4QBU A;  2Q6B A;  3MOJ B;  3MED A;  2Q1L A;  2ZD1 B;  4ECW A;  2CZ9 A;  1WDD A;  3CJ0 A;  2A6M A;  3TX8 A;  2GO3 A;  4KB7 A;  8AT1 B;  5DQH A;  4WP8 A;  2MZQ A;  3LWM A;  2LXU A;  4B3S E;  1I5O B;  1ROF A;  2E7X A;  3TA2 A;  4CLK A;  3LTO A;  4QIV A;  4DR7 F;  2J8A A;  1BWE A;  1TFW A;  2YWH A;  2RF2 B;  1SC6 A;  1E6V A;  5DQI A;  3CB4 A;  2PNZ B;  4LF4 J;  4RZR A;  1LQ9 A;  4LRF A;  4RW7 B;  1NJI T;  2V9W A;  4R5P B;  4ZJL A;  1Y11 A;  4KO0 A;  3SCL E;  2XC9 A;  3IS9 B;  3P3D A;  3H2U B;  4NRU A;  4TNO A;  3HPO A;  2JC1 A;  1IBC B;  4M5L A;  4DV5 J;  4Y3C A;  5KG1 A;  3N6M A;  4MIA A;  4PPD A;  3Q24 A;  3MM7 A;  2DNQ A;  5JEA E;  4W92 B;  4TLQ A;  1NHH A;  1RAF B;  3M2R A;  3OLB A;  2GS8 A;  1VRT A;  1FX2 A;  4ZP6 A;  5JEA F;  4U7U K;  2AE8 A;  1X5T A;  4Q8F A;  5GAG U;  4H54 A;  4J9O A;  3H90 A;  3CD7 A;  3IWX A;  5D4L A;  4ETX A;  2DNN A;  1VRU A;  3SSS A;  3BM7 A;  2B56 A;  4ENO A;  3MFI A;  1FFW B;  3Q8U A;  4ED0 A;  1JLG B;  5LM7 E;  5T7L A;  5FLX Y;  3NGD A;  4P75 A;  3MEG A;  3OTC A;  4LSZ B;  2J7K A;  2LCW A;  1XQI A;  2KRB A;  2J0S D;  1VQO S;  2LJP A;  4UUX A;  4JI7 F;  4DMZ A;  3T3F A;  1VCT A;  3QLH A;  3MM5 B;  2UXD I;  5GVQ A;  2W2M P;  5ETT A;  2KRR A;  1SJR A;  4B02 A;  4X62 I;  5G0R A;  1YVF A;  2Y0S D;  2F65 A;  3R2D J;  1NUE A;  4JI5 F;  4P74 A;  2UXC I;  2CA9 A;  1WF1 A;  2ZE2 A;  1GMW D;  4TN2 A;  3KLG A;  2ZH2 A;  3HHL C;  4OJH A;  4P2F A;  2JFK A;  2CPH A;  2BJ3 A;  2HGL A;  2ZDO A;  3BV8 A;  2B4U A;  2UXD E;  3H5Y A;  3Q8P B;  3G86 A;  3LGN A;  3GYN A;  4TKT A;  3HUL A;  4ILM A;  4MKA A;  4N56 A;  2OSQ A;  1EZZ B;  4QWD A;  3TUP A;  4Q0B A;  4C8O A;  3MI7 X;  3J81 C;  4F36 A;  4IFV A;  4RU9 A;  4FYY B;  4DV6 E;  2VDH A;  4QIE A;  4RW8 A;  2M4M A;  2PT0 A;  1FRH A;  4DS4 A;  1JK9 B;  1Z0V A;  4DV6 F;  3MD1 A;  3P6Y C;  3VVU A;  3GIL A;  2ZC3 A;  3GON A;  3OVS A;  2V8V A;  1WNE A;  2ZBQ A;  1HR0 J;  2QL9 B;  3NS7 B;  1U24 A;  2ILZ A;  1YJU A;  3NNH A;  4Z37 A;  2G0J A;  2KZM A;  4FYW B;  4LJM A;  1D9A A;  2CNO B;  4CYU A;  3MCM A;  1CC8 A;  3BO2 A;  4NXM E;  3P49 B;  4R0J A;  2J6T A;  3L7Z B;  4CP5 A;  1K47 A;  4PRV A;  2FHJ A;  3OR2 A;  2E5G A;  4NXM F;  4GC6 A;  2X1G A;  2OML A;  5ETK A;  2NXE A;  3H4B A;  2CQG A;  3RAX A;  4PR6 A;  2R4F A;  4FF1 A;  1B0P A;  3BGR A;  2MGZ A;  3E2E A;  1IJE B;  3VVT A;  1UDQ A;  1X4H A;  2W24 A;  1DTT B;  2E5L I;  1OY9 A;  4HHU A;  3P96 A;  3LP1 B;  1XEZ A;  4HI1 A;  4NLR A;  2O1T A;  2OUG A;  2VG6 A;  1SH0 A;  3NGK A;  5CYM B;  2LXF A;  1NHI A;  3K8W A;  4LF1 A;  2R2S A;  3C6U B;  1WHV A;  5KFJ A;  2HQC A;  1H7S A;  4A8M P;  2UUA J;  4DR5 I;  3BDP A;  1FWL A;  4LVN P;  5KG4 A;  3TA0 A;  3TUJ C;  2A18 A;  4HT5 A;  4NCB A;  2MQM A;  2YQ1 A;  2XY6 A;  5J2P A;  3TAR A;  1JXV A;  1T3O A;  3TZW A;  3CCQ S;  4WWS A;  3H7H B;  1RUS A;  2QFJ A;  1U02 A;  5FJ4 A;  3UHM A;  4BS2 A;  4M5D B;  2QX0 A;  3UVJ A;  3NBP A;  4DV4 I;  2UVW A;  4FKX A;  2B4O A;  4AD6 A;  2DEI A;  1I51 B;  4KGM A;  1UTA A;  1RTZ A;  3FUY A;  3QO9 B;  3DHW C;  2JEF A;  4ZP8 A;  4JV5 I;  3CDB A;  1U8S A;  1Y7P A;  2PMW A;  2ZVI A;  1R8A A;  4B3M E;  4YDX A;  4CZC A;  4X65 E;  2GA7 A;  5KFZ A;  2IC3 B;  3MR7 A;  1HHT P;  3V4I B;  1VI7 A;  1TU0 B;  1G6B A;  4P71 A;  4X65 F;  2XSF A;  2DTJ A;  1FNO A;  5D78 A;  4P7A A;  2DYA A;  1VRQ C;  5AE3 A;  3G8S A;  3W62 A;  2UVR A;  2VQE J;  3O1L A;  5IT9 Y;  2QZ8 A;  1U49 A;  2WOM B;  1AB8 A;  4TQR A;  2XZT B;  1RTH A;  4MU3 A;  2C38 B;  2MZT A;  3RJM B;  4LF5 E;  3