2WW4A

A triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
283
Chain Sequence
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Triclinic Crystal Form of Escherichia Coli 4-Diphosphocytidyl-2C-Methyl-D-Erythritol Kinase and Reassessment of the Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 4-DIPHOSPHOCYTIDYL-2C-METHYL-D-ERYTHRITOL KINASE
total genus 90
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.7.1.148: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 2ww4A02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 2ww4A01
4DUZE 4JI6E 2A2DA 4DR5I 4JI2I 4HACB 2UXBI 4YHHE 1N34I 1HNWE 3PYDA 4DV2I 3HULA 5L3JA 4GKJI 4Z7CA 3LNUA 2V34A 1XNQI 4JI0E 1NHJA 2UXBE 1FKAE 1XNRE 4LFCE 1H74A 4JI0I 4NXNI 4DV3E 5GMDA 4FWDA 1ZM2A 5LL6R 4WUCA 1XMQE 1ELOA 4DR7I 2UUAE 2Q2EB 4B3TE 1A6FA 3JAMC 4EMDA 3ZKDA 4LF8I 4DR7E 3M6AA 5BR8I 4P7AA 4JI7I 2F4VI 3QT5A 4AQYI 2X36A 4HXZA 1KVKA 1KTVA 1MX0A 1XNRI 4JI2E 4AQYE 2F4VE 2ZITA 3F0NA 4DPXA 2WW4A 5FLXQ 1HR0I 1Z0TA 4DUYE 3QT7A 4XTJA 1H7SA 3B8HA 1FWLA 4DV2E 4NXME 3T1HI 2UUAI 2BM1A 2HK3A 1N0VC 3K17A 5LMUE 1UEKA 1NZ0A 1HR0E 2OI2A 3WU3A 4DV4I 2HHHI 4HY1A 4LFCI 3LTOA 3J7AG 4JV5E 4B3SI 1FI4A 1PIEA 4WUBA 1HNZE 1OJ4A 1MG7A 4M1KA 3ZM7A 4DR6I 1FNMA 2DEJA 3ZZTA 4GKJE 1PVGA 4LF7I 5IT9Q 4HYMA 2HKJA 4ED4A 1N34E 2V2ZA 4DR5E 1Z0BA 4JI1I 2VQEI 3CWVA 3QT8A 1FJGE 3JAMQ 4I3HA 2UUCI 4DR2E 4P52A 1N0UA 4LFBE 5FLXC 2ZM6I 2DEIA 2EFGA 1Z0WA 1IBKE 4UT4A 1S4EA 3ZKBA 4YY3I 4DV1I 2XEXA 1IBLE 4WUDA 4GKKE 1J5EI 1DARA 1K47A 4B3MI 4X66I 3QT6A 4DR1E 4DR3E 4USKA 1ZM4A 3T1YE 4LF4E 1U2RA 4B3RE 3D4JA 1H73A 5A2QQ 4DV0I 4X64I 4MYUA 4USMA 4LF5I 4K0KI 3PYGA 4MYTA 2VQFE 1H7UA 1I94I 2X7IA 2V8PA 1N36I 2UUBE 3WU6A 1BKNA 4LFAI 4LF9E 4DV6I 4PRVA 3J81C 3WU4A 1QZRA 1RR9A 2E5LE 3H4LA 4JI8E 4X65E 3ZZ0A 2UUCE 4JYAE 4JI3E 1D6TA 2ZBKB 4FW9A 1FWKA 3T1YI 2HK2A 2UU9I 4JYAI 4ZVIA 4OX9E 4JI8I 4KHPI 1IBMI 4DPTA 1Z0EA 5LMNE 4DV7E 3B82A 3Q1QA 5IWAE 3OTOI 3ZZUA 1ZXNA 4DV1E 5IWAI 4YY3E 2UXDI 2UXCE 4DPUA 4DR6E 4JI5I 4DV5E 2VQFI 1NHHA 1HNZI 1IBME 4KHPE 2BM0A 4JI4I 1HNXI 4LFBI 4DU8A 3V5RA 2A2CA 4Z7YA 1Z5CA 4FWGA 4JI3I 1N32E 1EA6A 2HFSA 1S16A 2UUBI 2HFUA 4DPWA 4FWHA 4JI1E 1ZM9A 4LF6E 2V2QA 2R42A 1ZXMA 4X62E 4DR4I 1I94E 1Z5AA 4X62I 1RREA 1Z0VA 4LF6I 4LFAE 4LF5E 2CZ9A 4HACA 2HKEA 1IBLI 3PYEA 1N32I 2VF3A 4B3RI 1N33E 4DXLA 1XMOE 4DUYI 4RPFA 1B62A 4X65I 1EI1A 1MU5A 4JI4E 4DU7A 3WU5A 2E5LI 4FN5A 3K1JA 4B3SE 5A2QC 1XMOI 1N33I 1PKPA 4DV6E 2V2VA 4DR3I 1KIJA 1J5EE 4X66E 3OTOE 5BR8E 4DR4E 4URLA 4DV7I 1ZM3A 5LMNI 4GKKI 4B3TI 1XMQI 4DV0E 5GMEA 2GS8A 1IBKI 1HNXE 2ZM6E 4NXNE 2VQEE 4DV5I 4JI5E 1WUUA 3J80Q 3GONA 2UXCI 2UXDE 4PU9A 4KQVA 1Z0GA 3B78A 4LF9I 2J7KA 1KKHA 4DPYA 1Z5BA 1NHIA 4PRXA 2R3VA 1Z0CA 4R1FA 4LF8E 4K0KE 3J80C 3V2UC 1HNWI 4DR2I 4OX9I 4YHHI 2UU9E 3LPSA 4LF4I 4DV4E 2LJPA 4DR1I 1FJGI 3J7AM 1VISA 2AJ4A 1Z59A 2E1RA 2HHHE 4B3ME 2NPFA 1XNQE 4NXMI 1N36E 4LF7E 5IT9C 1H72C 5LMUI 3PYFA 4JG4A 1B63A 3T1HE 4UTGA 3J81Q 4X64E 4JV5I 2BV3A 4JI6I 4DUZI 4JI7E 4DV3I 1XHKA
chains in the Genus database with same CATH superfamily
2VOOA 4DUYI 2MZQA 2ZDPA 4F4AA 1HBNA 3PW2A 4MK7A 1U6BA 1DLOA 2BA9A 2A2DA 1OS5A 1URRA 5M2UA 2VODA 4KSEB 2NCKL 3ZZYA 1HK7A 2QGFB 4QQBA 1UDSA 2O1WA 3MOZA 5ETPA 2QE5A 4RU2A 4NRUA 4NLDA 4QU7A 2CJ9A 1RWVB 2BKNA 2MZJA 1SKSA 2MQ8A 5F8MA 2E9ZA 3GCMA 2PO0B 1S1TB 1FTRA 4YR0A 4PYDA 1YJVA 2YNHA 3OTEA 2RHQB 1JJ2R 3DMJA 2ZJPQ 4IFYA 4DR3F 4GKJI 4E0DA 3MPYA 2GV1A 5CD4H 3M2UB 4PWDB 2DCUB 2JX2A 1SIWB 1WD6A 1FX4A 2BACA 3OW2R 4WP3A 1R8CA 1XMBA 2FUG9 2LU1A 3DLEA 1IKXB 3J80U 5HLFB 3CJ3A 2DR9A 4LFCF 1X5SA 2XSJB 3BQ0A 3PRVA 4H4OB 2LCWA 2MKKA 3GFHA 5DZ6A 3R7SB 2FVPA 3GMGA 1NHJA 1TQLA 1UDNA 1FKAE 2FY8A 3WX8A 4LFCE 4B3RF 3MCSA 2QC3A 2W01A 3MHYA 4KO0B 4JI0I 1HPZB 3QIPB 2C38B 1KEKA 3OR2B 1VRQC 2GAGC 1LWFA 1S1UA 2GHVC 4LR8A 4WP9A 2OH2A 4KFBB 1CJUB 1XN9A 3KK1A 1J2VA 1RT2A 1URNA 3SCIE 3QJPA 2BA0D 3PJXA 1RABB 1Q0NA 1UFLA 3TA2A 3OV7A 1JLFA 2ZDOA 4Q8FA 1ZM2A 2BYCA 2QZ8A 3AOCA 2Y9HA 3BGRB 2QA4S 5BR8J 2W4PA 4RNHA 2DHHA 3U7JA 3HVTB 4WUCA 1ELOA 4O4RA 1T05B 3HT3A 2YH1A 2VFUA 1RDRA 3ULHA 1GMWA 2GQQA 5KFMA 3BQ1A 3NMRA 4JYAF 4CYUA 4N8OA 3PS1A 2BEFA 2GQ0A 1T3NA 2ALYB 1UAWA 2FJXA 1GMVA 4WE1B 3SBMA 5ITHA 4K5RA 3OVSA 1HNVB 1WHYA 2XMTA 4U67Q 3EE3A 4IFDF 2MXYA 1U0HA 2Z0GA 1SIZA 3AHPA 3L95X 3RBZA 3W8PA 1UDOA 2V94A 3HD2A 4R0JA 4C8NA 5LSOA 1AT1B 2Y1JA 2FC9A 2W25A 4JP8A 1T3OA 1HPZA 2DGXA 3AT1B 3BM7A 3DNCA 2ATLA 2Q66A 4A8QA 2CG9A 2WP8A 4AQYI 1HQEA 1KTVA 3NBPB 4NLUA 1MX0A 3S1TA 2ZNYA 1IWAA 2FLLA 1V5VA 3ADAC 1GMWD 3B54A 4ED0A 4LFAF 1QSLA 2HVHA 2DRDA 2DRBA 4AQYE 2CNKB 4F4XA 1S6PB 2LEAA 1NLKL 1S59A 3F0NA 2OFGX 2WW4A 3LAKA 1UA0A 2Q6CA 4ZVHA 3UFCX 2UUCJ 3E2EA 5JEAE 5DG9A 4FS1A 3QT7A 5KT3A 1Q7LB 4U6PA 1UVLA 4F0MA 1Y4ZB 1NJYA 2ZZNA 5C0XA 4RW7B 1WWHA 4NPOA 1WHWA 3ITHA 4CLUA 4C9DA 2D9OA 1WKKA 2OAUA 3N5BA 4OX9J 4LF9E 3U1MA 4DJBA 1WDDA 3G87A 2AX1A 5BXIA 4GRSA 4NXME 2W7PA 1U24A 4ED8A 4DQQA 3P3EA 3KLFA 4B17A 2F9JA 1YI2S 3EPIA 2MZTA 3SSQA 3HSGA 5HO4A 3R7NB 2J9CA 4TU7A 1SL0A 2UVUA 4JV5J 4OO1E 1EB0A 2H5JB 2VG7B 4DUYJ 4DQPA 1NKCA 2QLBB 2VG6A 4RW8B 4HT5A 3O2IA 1MLAA 4CM2A 3OLAA 5IOLA 1NPRA 4W90B 1HR0E 3TAQA 3F44A 2QEXS 2HS0A 4ZN1A 4OKGA 2OD6A 2ZBQA 3KMSA 4F26A 4OIXA 1XXEA 3WU3A 3QO9B 2RU9A 3PZPA 3NXZA 4NA2A 2YNGB 3LWMA 3NCPA 1VHIA 5JEAD 2KG0A 3J7AG 2O1PA 1PYSB 4ED1A 2GJIA 2Y0BB 2LLZA 3HMJG 2J0XA 3MEEA 1UJ6A 1OYEA 3HFZB 4DV6F 3CJSA 2GO3A 4X2BA 1WACA 2XS2A 1ZBTA 1HNZE 1OJ4A 1MG7A 1NDKA 4M1KA 2ZBRA 4M5KA 1VIOA 3LP0A 1Q8IA 4AUKA 3V6DA 1YQHA 2OPPB 4DZDA 3JSYA 2QX0A 1FNMA 4ZVGA 2GMLA 4WIQA 4O3PA 5D4NA 2J5AA 3T5JA 1ROFA 3I5BA 2IM3A 3CE8A 2ZUAA 1RLCL 3CJRA 2CPFA 2B43A 1WELA 2WW8A 3KFWX 3W66A 4AFFA 1CJKB 3LQVA 2RE1A 4PCQA 3RRGA 5JJBA 1SC1B 1RT4A 1KRPA 2MLXA 4RW6A 2NQPA 3LH2S 4UOFA 1N34E 4GC7A 3JS9A 1HNZJ 4WZMA 1PC5A 5CYJA 2ZH5A 3P49B 3CJ5A 1LK5A 4TU8A 4ED3A 2FD2A 3KLGB 1SL2A 4ZPVR 4L76A 3KLHB 1SQEA 1Z0BA 1FKPB 1S9GB 3PXGa 3UPFA 1RHUB 4V1Ak 3GV7B 4ECRA 1XTZA 4QWAA 2HZVA 1B0VA 3CWVA 1WSVA 2NR0A 1K73T 3QT8A 5J2NB 4WWSA 4DUZJ 2PO2A 1FJGE 2UUBF 1TL1B 2BR0A 1OYPA 3JAMQ 5KFVA 4ZLNA 5KFKA 4DF8A 2R8IA 4I3HA 3HKWA 2G2ZA 3VV2B 1H6KX 1T9TA 3RRKA 2XYGB 1RHKB 4I6AA 1IBCB 5D0GA 1N0UA 4DR2E 4LFBE 1RU2A 2IYGA 3MWBA 5HQ8A 1HHSA 2HYIB 5FLXC 2YKQA 2C2RA 2I1RA 2K7KA 2ZM6I 3ISZA 2DEIA 3KLEB 2MKYA 2NLWA 1IJEB 2EFGA 1BWVA 4IKAA 1VC6A 1KWMA 2V63A 2VPXB 4EO6A 1FKAF 2XMJA 4UT4A 2ILYA 2FLPA 3K2YA 2DH9A 4NLTA 5D4LA 4YY3I 2UVWA 1VBKA 1HD0A 4KHMA 4ZDNA 3D67A 3DU5A 2CQGA 4I0WA 4PEOA 4ZP9A 3JAMU 2AT1B 3RR8A 4WUDA 4Q2MA 4K2JA 1N56A 1HQ2A 2G4BA 3IR7B 4OX7A 5A8KB 2ZHAA 2HFNA 1P1LA 2JVOA 3FSYA 3MM7A 5BR8F 4B3MI 2H3EB 3H0PA 4A8SA 2VB6A 2VOPA 4OHZA 1LV5A 1S1VB 2KJVA 4NRTA 2XS5A 4ZHRB 5J1EB 4BWMA 4Q0BA 5DLFA 2ROPA 1UEVA 2HFZA 1WTBA 3FBEA 3GSDA 4DR7F 2VJVA 1QM9A 2HNYA 2J76E 1F9FA 3DYAB 3IGVA 3K5PA 3NGSA 3NNCA 4MU0A 1KFDA 2DNGA 1A7GE 3T1YE 2QA1A 1B0PA 1DY3A 3D4JA 2FHMA 3THVA 4JI8F 1TVRA 1H73A 4HHJA 2UUBJ 3P3GA 1Q78A 4DV0I 3R5CA 2P2CB 3I31A 2R7WA 1HBUA 4Y3CA 3ENWA 4TY8B 2DIVA 4LVOP 4CT8A 5KG7A 1SKWA 4FW7A 1WSRA 1Y00A 4O23A 4DX7A 4USMA 1G1XA 3DDNA 2XULA 2VQFE 3V4MA 2F65A 4CLFA 3EGZA 1T7PA 1JLCB 2GQCA 3X1LB 5DRPA 3IS9A 3IP0A 4PAAA 4DSFA 1U8WA 1REVA 2LU2A 4MKVA 2OPSA 3VF0B 1KC8T 2MKCA 2CQPA 3CVKA 3VAIA 4DR3J 4CWBA 2X7IA 3JTNA 3RTVA 2V8PA 1LWEB 2OMOA 2G13A 1SC3B 4UY85 1BC6A 1NK9A 1Y0HA 3LOUA 2UUBE 2CKWA 1IXKA 2BJ8A 2CDRB 1S77D 3CO9A 2G1HA 3GMEA 3TJ9A 2HHXA 4LBIA 2HNDA 4FKXA 1VK8A 2MQQA 1KQSR 2WRMA 4RBUA 5DGBA 3R5DA 3U1YA 1LOUA 2Y0SD 3J81C 2HQ3A 2GO4A 5CABA 2CZVC 3W62A 5J2PB 2LFVA 4BC9A 1I94F 1QUVA 2AU0A 2JFKA 4FW6A 2M52A 4IFVA 3DHWC 2BANB 3H4LA 2LKZA 2VU5A 1FESA 2ASDA 3L7PA 3ZZ0A 2IJRA 4HL9A 3K58A 1XMQF 3EGVA 2YBVA 3TUPA 2ZBKB 1CULB 4DR5F 4ITSA 2UP1A 3R3TA 5AXNA 1D9AA 3GIJA 4IFDA 3C14B 5ETRA 2YWWA 4UQTA 1DTTA 2BANA 3UQSA 4OX9E 2K3KA 4WFBQ 2CXEA 3BZQA 3MPUB 5HMYA 2VBYA 2UVVA 4KHPI 4USJC 3A8KA 4AXJA 3Q22A 1SH2A 3C19A 1O8BA 1FK9B 3W5XA 4J90A 5A8WB 5DG8A 1Z0EA 1VFJA 2HWHA 2E5LJ 3TAPA 4K59A 2OLWA 4DV7E 4DFJA 2VFRA 2DD8S 1CJVA 2DHSA 3WC0A 1DBDA 2D3UA 3A8IA 1C0UA 1NDPA 1KQKA 3BB5A 3TZXA 2ZBCA 5KT2A 3BR8A 3CMQA 4ZKAA 3TI0A 1XNQJ 2B4OA 5CD4A 2AYMA 4F3QA 1S48A 4C11B 1IKWA 1N36J 4E98A 4ZPBA 2YNIB 4DSEA 2YWEA 3CCJS 5KOWA 2YVSA 4TNOA 4WFXA 4WTOB 1E6YB 1YTYA 2EK6A 2UXDI 5K36E 3EZUA 2YWGA 4DPUA 2E5LF 2B5JA 3W2WB 4NA3A 2GJFA 3HLUA 4O3NA 3TJ8A 2VZ9A 3UN2A 5FLXY 1PO6A 1WF0A 4ECVA 3DLGB 4F2RA 3M32B 5C0XD 4TY8A 1HIYA 4JI4I 3BO2A 3MOJB 1YRXA 1HNXI 1VK3A 2ZH1A 4DPOA 3RUBL 3V5RA 1Q5VA 1TVRB 5E33A 5JVGQ 3P45B 1YBUA 1FEHA 1YBAA 2QFIA 4QJVA 2ZJRQ 2M8HA 3NGUA 2EG1A 2QTWA 3PJWA 3ETMA 1PJ7A 2MJUA 4LQ9A 2IC3A 4M5MA 3CF5Q 3W60A 4NEYA 4OZJA 3JYTB 1N32E 2Y1IA 3KHLA 2R8HA 1LWXA 2CADA 1DZ5A 1C2PA 3M05A 1LK7A 3JQJA 1EP4B 2XMUA 3T6JA 4BA1A 1WNEA 2UUBI 1S1VA 1ZM9A 5T7LA 3AOBA 1FDAA 4F04B 3HZGA 2J6TA 2F7VA 2HGMA 2R42A 5ETTA 3MMCB 4O0IA 3Q6NA 1I94E 1Z5AA 4ZS6A 2L48A 2VC1A 4XPCA 1RREA 1JJCB 4NYZA 2KB2A 3I0RA 3TA0A 4ZLJA 4DL5A 4ZVTB 5D8HB 2FPHX 4P7TA 1QLNA 1S12A 1Y10A 1Q53A 4OZ1A 2RUSA 4MAKA 4HTIA 5KOXA 2YPYA 2D3O1 2FJVA 3PYEA 3DLBA 3HX9A 4B9UA 2DGVA 1KR4A 1RGVA 2DKOB 3ZXWA 5KFPA 1N48A 2G1DA 1EQ0A 4G3IA 3BN7A 4JI4E 1MNEA 2V68A 4CLLA 3WU5A 1NU4A 2BUNA 4FN5A 4NLOA 2DNPA 2BR2B 1XNQF 5DETA 2E5LI 4JV5E 1UETA 3SCLE 1F3FA 5FD1A 3CDBA 4QR1A 1XMOI 4ED7A 1EETA 2NUHA 2P6SA 3G8QA 2C28A 1L3VA 4BS2A 2HHVA 1PKPA 1YJTA 4DV6E 1N5QA 5JUMA 2CZ4A 4RLEA 4CIOA 2RQMA 3ENAA 4C8LA 1QE1B 3TZYA 1HWLA 1VRTB 3OUYB 1CG2A 2V0NA 3VTIA 2L9WA 3UDLA 3ENVA 4LSZB 5IT9U 2X3DA 1X7VA 2FTRA 2LA6A 1U09A 3GFXA 3MEKA 3NS7B 3DXBA 2VL1A 4QYRA 3KLHA 4X66E 2ZKTA 4YS2A 5CCMA 4WXWA 2MQLA 4PZVA 1RTJA 2CQIA 4E8UA 2EFOA 3BKTA 4A8YA 1J5OA 1MWQA 2PA3A 1RYRA 4GKKF 1HHQA 4KGVB 4GKKI 3FQLA 4CP5A 4KQZA 3FMWA 1JLBB 2CNLB 2HLTA 3LAMA 1UZHA 4PG5A 4XPEA 4EBDA 2C2EA 2IA6A 2QYCA 2YKPA 2J65A 3H1CA 1XMQI 2DHGA 1KBRA 3GG0A 3QAEA 1RYSA 2HBQB 4EEYA 2GS8A 3T1YJ 4YOEA 1IBKI 2GIRA 3EPGA 1N5SA 3BGUA 3IC1A 1ZZFA 2VDIA 1WKLA 2I6WA 2VDHA 4CO0A 2ZHBA 3I5CA 1HNXE 1FDNA 1H38A 1GAOA 3ISND 4IG0B 1VQ4S 2ZM6E 2GFFA 3HCXA 2E1PA 1XK8A 2J0WA 1RAFB 5DRKA 2ZEJA 3OFHA 3SDEB 5E3PA 2CYYA 2VQFJ 2PI5A 1Y5NB 3BGOP 3KUHA 2XHWA 2MKHA 2YTCA 3A3OB 3ENQA 4LRCA 3TVKA 5A76A 1N33F 3N9UC 3ELHA 4G1QA 3GJTB 4OZLA 3I6PA 2IRXA 1FRJA 3CD0A 4N47A 3PFEA 2CVIA 4DV0J 1JX4A 1CS4A 4LSNB 4MDTA 2AJFE 5L8RC 5JMNA 4Y65A 5D0RA 2EKYA 1NKEA 4IRKA 1YH8A 1G2EA 3AD9C 3UDEA 1P42A 2A3JA 3PY8A 2WNRB 4RW8A 2YPZA 3DRSB 3K89A 5HMWA 3Q6MA 5EKWA 2LMIA 1VJWA 5EX3A 4LF9J 1Z5BA 4DL3A 4PRXA 4CDIA 5KFJA 2PFFB 1PAEX 2PN6A 4OZ5A 3G96A 1MW7A 1KQFB 2JT2A 2ROGA 4ZVRB 1C1CA 3I0SA 3RB3A 2ASYA 4NYPA 5SUHA 3P3CA 5A8RB 5AJ3J 4LF8E 3J80C 3QJLA 1MU2A 4K0KE 3T3FA 2C2OB 1LNQA 2IFXA 3AA9A 3BKFA 3V2UC 3P6YC 2OJ3A 1NJWA 4UUXA 3HVAA 5E3QA 3HVRA 3ITHB 3WIUA 3AB4B 3LW5C 3E01B 1VQ6S 1S0MA 4DL7A 3U27A 4LF4I 4CH0S 3ZNUA 4QWEA 3CCES 1WJ9A 2AKWB 2UV8G 1M5PC 4JBCA 2Z58B 2FVSA 4F4YA 1RB0A 2AGOA 3K85A 3MMJA 1QAXA 4J37A 4OZ0A 2DPIA 4OHWA 2AP6A 2GC8A 2ZH2A 4B3MF 2NXNA 1SBRA 2X1FA 3CCUS 5EGYA 2OMLA 3MTKA 2EFVA 2RDJA 3J7AN 1JLBA 2LP4A 4P73A 1KD1T 3DKDA 1NB2A 2NS1B 3MDFA 2UV8A 5LSLA 2UU9J 4B3ME 2EC0A 1F3VA 1G7CB 4DX5A 2C2NA 3KRNA 2W7AA 1KFSA 3R2CJ 4NXMI 3GP9A 4F3OA 1U0HB 3UR0A 2UXDF 3KOAA 4LFBI 5HJYA 4OO1D 2IJFA 2BBEA 3BKUA 3WHIA 2GMJA 4C4WA 1WOPA 1NJXA 4TXSA 1TKZA 1TKXA 1KTQA 2K06A 5ETKA 2XNQA 3D0IE 4ELVA 3GLJA 4DEZA 5DZ7A 4HH0A 1BMQB 3PG9A 3Q8PB 2AWZA 4FDFA 1N6QA 3BSNA 1IKVA 5T14A 1VBYA 4KGZB 4QR2A 2ZE2B 1S9FA 3EVWA 3IM9A 4LBHA 4A4JA 3GG1A 2GO8A 4OLPA 4DN0A 2QSFA 3CC7S 2IOQA 4GKJE 1USVA 4OI3A 1N32J 4OO1F 2HHSA 2AHOB 3C15B 2V8HA 2EEYA 1Q8BA 4M5JA 3IAS9 2C38A 2OEKA 2V50A 2VASA 3DRRB 3GR0A 4HI2A 4V19X 5RUBA 4KT0C 4USIA 3ZTOA 4DR5I 1JKHB 3AXKA 4JI2I 3Q86A 4HACB 4KY3A 1RT7B 2FGCA 4H4OA 4OO1C 2UXBI 2QLFB 5G0RA 3L7OA 2XSJA 5D6GA 4YHHE 3VAMA 4WTYA 2MZSA 3A8EA 3BBFA 3PYDA 4UZCA 1ZOTA 1WC6A 2AF6A 2VFVA 3CJKB 2VICA 1E3PA 4RU9A 4DV2I 4WPAA 3D1QA 3MMCA 4U7UK 2DR6A 3SFUA 5L3JA 5J1PA 3NS5A 4PUOA 2OSQA 3M2UA 4C8ZA 4BA1B 1TAQA 3IR5B 1MN9A 3ZKDA 1I1GA 2QV6A 4ILRA 4Z7CA 5EHHA 1RT6B 4OHXA 4B3OA 4A8KA 5L38A 4OYAA 2DY9A 2LQ5A 1BLUA 2WONB 3P5TL 2AJ1A 5LL6d 4HVZA 3LNUA 2V34A 1YIJS 1HHTP 3BEGB 4I67A 3Q83A 2RUGA 3NOGA 3TEGA 4DFMA 2CPDA 3H5SA 4CM0A 2BA1D 5ELWA 4DX6A 1AA1B 2HBRB 4L72B 3FSIA 4DUYF 3LGNA 1R6LA 2IAJA 1PYOB 4MJKA 3RGIA 2NUUG 3M8RA 1DLOB 4TY9A 2F63A 1HBNB 4AXIA 3DRRA 1XERA 1UVNA 2B8PA 1U1LA 4IS9A 1YKWA 2ZWPA 2XSFA 2RD5C 4KRWA 5ETMA 5AXMA 5KFUA 2HVZA 2IHR1 2M70A 3ZTSA 4U9RA 4NXNI 3DOKA 4DV3E 3GIKA 5CQGA 5HROB 5IC4B 4X66J 1WKJA 4LF6F 4E2FB 2MY8A 3C8YA 3M8WA 1S72S 1EJ7L 2B9XA 1ZETA 1LKZA 2D69A 2I0XA 3DGPB 4RJVA 1FJGF 1Z0GA 5LL6R 1IKVB 1T95A 1XMQE 3OJSA 2AGPA 1IKYB 2Q2EB 2UUAE 4QOTA 2LEBA 1C0UB 5GAEI 2FLOA 4EMDA 2DY1A 1SUQB 3CGIA 4OQJA 2JLGA 4FXWA 2KH9A 2CJXB 1BD6A 1QJHA 1RT5B 2HWTA 5KFFA 2O67A 2P5VA 1RT1B 3KUEA 1HNWF 3J7A1 1TKZB 2CDQA 4MQYA 1FK9A 2JSXA 3EVMA 2CPXA 3LP1B 3S01A 1YWXA 2AZ1A 1S0NA 2IDEA 2BDPA 3OD2A 5BR8I 3FC9A 2PO1A 1HD1A 1KLNA 4USHA 2WB1D 1NNDA 2GJ2A 1LWCB 5HAOA 1USUA 2PD1A 2V4JA 5DDQC 1YJWS 1HNXJ 2PT0A 1FEEA 2QMUB 1OY9A 2F4VI 1IWGA 1S0OA 4HXZA 4L6V3 1AW0A 2PEHA 2VFSA 1N5TA 1LW2A 2A1BA 2M88A 3NMAA 5F8JA 3PS2A 3M7ND 2OIHA 4JI2E 1X4FA 1YZ7A 3RW7A 2IMWP 1OO0B 5HVFA 2KJWA 4RBVA 5FLXU 2B3TB 4M5DA 2ZJQQ 3SIPB 5A0YA 4U96A 5J2MA 1TELA 2HHQA 3PACA 2AX0A 4XAKA 3DLLQ 4OYMA 1Y3JA 4HHHA 3SV3A 3D54A 3DFEA 4M5IA 4UOCA 4RUBA 5U47A 4DHVA 2C39A 2HG4A 4XTJA 2KRBA 4DUYE 1E6VA 4YFUA 2BOAA 1FO1A 2ZHOA 4GVBB 3CO0P 1TKTA 3EWGA 2FB0A 4N5SA 4ECSA 2YKAA 1H2TZ 3MCNA 2P9CA 3D9BA 3M30A 1NK8A 1AZSB 1RTDA 3RJMB 2YKOA 4K7QA 2VJUA 4K0KJ 3A3NB 2OELA 5BYQA 2R2SA 1TK8A 2RDDA 3IS9B 2IY5B 4DQIA 2UUAI 2UXDE 4NI2B 4D3HA 2BM1A 2FZKB 2HS4A 5KG5A 4DSLA 4ERDA 2UXCE 2XMVA 2Y3YA 2GIFA 3H98A 2UU9F 1VC0A 1IR0A 3FGVA 1X0PA 1EKSA 2KL8A 3OJUA 1FWPA 1PAUB 4DV4J 3KMQA 1NZ0A 2WNRA 4UW2A 2F40A 3QATA 2PO0A 2MB0B 3J7YI 3UCUP 5D15A 5AXLA 1SCJB 4KJIA 2W2OP 2W1BA 2OI2A 5C5JA 4DV1J 1CS4B 4Q7AA 3UE2A 5DGAA 5C0XC 1P27B 4IG3A 4C6AA 2MZ1A 2R7VA 2MKJA 2PE8A 2HHHI 3QLHA 1IQTA 1T03A 3LTOA 4LFCI 4CLSA 2A6OA 1RTHB 2G2OA 1U47A 4CZCA 5KG4A 4B3SI 1F60B 2HQIA 4J5OA 3P06A 3KK2A 4FF1A 2PMWA 1FI4A 1N34J 3MEDA 4C98A 1IJFB 3G86A 4FYWB 1JXLA 1SB6A 3KLVA 1D8ZA 3ZM7A 1TUWA 1UVKA 1YJRA 5F3TA 2E5GA 5IZHA 3SYZA 1V3ZA 2R7TA 1AFJA 4ETZA 3ZZTA 3HD1A 4C8YA 4H4MB 3I55S 5JEAF 5E5NA 1U1MA 5C0XE 1IN0A 4DUTA 3ZZRA 2DBBA 6FD1A 2EFQA 2KKHA 3IBFB 1Q1KA 3M2VA 2MJNA 2GA7A 2VC0A 1B0TA 4X84A 4KB7A 4P71A 3LANA 3P3DA 1H3DA 2DGQA 3D7SB 4NLQA 2VHGA 4JI1J 3OL9A 4KYZA 2NXJA 4L75A 4FYVB 4UY8T 2DNMA 3M2VB 4OJ3A 5ETVA 1GNKA 4DBQA 1EX8A 4ZPDA 2FJEB 3PR5B 1SJRA 3CMAS 4DWIA 2CQ0A 4J9UE 3KJVA 4DUZF 4PQAA 3OVAA 4CNZA 2WB4A 4UZBA 2VIHA 4EBCA 1SJFA 1IVZA 5HMXA 2W2PP 3G6YA 4J3DA 3HHEA 2B9YA 1R3NA 2RMLA 3Q0AA 3PKMA 1QE1A 2FDNA 1R8HA 5IT9Y 2V69A 3W5ZA 3AQPA 1HMVA 1OWXA 4TLRA 3MEDB 4K4YA 2RF2B 2GGPA 4F4ZA 1XNRI 1HI0P 4KC5A 1CQNA 2JDJA 1ZAXA 2VPZB 4ZCKA 3VAGA 2R2RA 1S6QA 3BO3A 1I6JA 3AA8A 3HDSA 3H5YA 5C2GA 3KLGA 4EZ9A 1UW4A 2CQBA 3UCZP 2JL9A 2XYHB 3SFGA 1RAJA 9RUBA 4N41A 3QRPA 1RBLA 4C48A 2FVQA 2HIQA 1XNRF 2KRRA 2XG8A 3FMBA 3QPIA 1ZAWA 3K8WA 5KFRA 1Z0WA 1S4EA 4X4NA 1M5SA 1X4BA 3HHLC 2KN4A 4AQYF 1Y6ZA 3O6QA 1RI7A 3W2VA 4OO1A 2H4WB 2NN6F 4DV1I 2YH0A 5F8LA 1JLQB 1YJ7A 2MGZA 4J9RA 5CYQB 3TARA 3BN4A 4GKKE 2AV5A 7FD1A 2J9EA 1T9VA 5LT5A 1R8PA 4ZK7M 1H2VZ 3QWPA 3NOCA 3AQOA 4AE5A 3R5GA 2QFJA 1FD8A 4HI1A 4DR4J 2QYGA 2ZBIA 3KG0A 2NXUA 2FLNA 3KDNA 3JSBA 3RU0A 2ZUGA 4C2MA 4X66I 3OTDA 4DSIA 1UMJA 2P9EA 3MPDA 1RTHA 1BQXA 4G1IA 4YR2A 3SZ2A 2RVJA 4B9MA 3KWMA 3QLHB 1FKOB 3M8QB 3IRWP 3ISNC 2ZH9A 1IBLJ 3M1VA 2U2FA 3NGKA 3G82A 4DR3E 3K5OA 4OX9F 4USKA 2H65B 2F8MA 4LRAA 2QN6B 3ZFVA 2X1AA 3JTOA 1BQNA 5G4DA 1L3SA 1UWBB 3R6GB 1MROA 2VKZG 4MYUA 1FNOA 2RKIB 4OX8A 8ATCB 4TYAA 2HZCA 3DRPA 4URQU 2DGWA 2VG7A 5IS2A 4JV2A 4K0KI 4DSKA 5A2QY 3D28A 3W2WA 1TL7B 4J9SA 4ELTA 4PYAA 2HVEA 3MEGA 3CC2S 5ETLA 3SQGA 4WFZA 2BE9B 4IQMA 3J7ZT 1K0TA 5DM7Q 2G0CA 3OQ2A 2RHSB 1QSSA 1V6HA 4GMKA 3GJQB 1X4HA 3BGLA 3T9NA 1DQ9A 1FXLA 4NMLA 4O3RA 1TKTB 4PWWA 4RW7A 1SH0A 3HHDA 2VG5B 2JC1A 4GVBA 4OMFG 1BKNA 3PR4A 3KHRA 1J27A 3OFGA 2Z56B 1Q5YA 4DL4A 2IVYA 3MECA 4I4BA 4NCBA 1BQMA 3TAMB 4GKJF 5FWKA 1H98A 2CVEA 3HZEA 4N77A 2OPQB 2H48B 5LMNJ 2KU7A 3C6UA 4QPXA 1LW2B 5M2RA 4LF1A 4JI8E 2LDYA 4F2SA 3C14A 5KFDA 4LF5F 1D6TA 3HSJA 1V5IB 4MK8A 3T6BA 5C42B 3QSYB 3FCHA 2E5HA 3I4HX 2J9DA 5BYRA 3POTB 2V4JB 4MMOA 3AOAA 4RNNA 5ETOA 4A47A 2AYGA 4JV1A 2WHOA 1RA7A 2Y1LB 2R7XA 4D3GA 3R2DJ 3QRRA 1DTQA 3LP1A 4I64A 4DPTA 1CC8A 4IQXA 2KO1A 3BDPA 4XO0A 3CDAA 4JI8J 1SUQA 2DGUA 4OL8A 4JYAJ 2HFVA 1RAIB 4O4GB 3MXHP 1VQSA 2MQMA 4WFAQ 1PBUA 1SVDA 1RT6A 3CULA 4ALZA 3GCWP 2WVCA 3C66A 1NSQA 4DZ6A 1T9XA 1FFGB 4NWBA 3BGRA 5AT1B 1HR0F 4NEZA 1QSYA 1EQMA 4P10A 1SV5B 1W2BR 1U1KA 1ZXNA 3MCMA 4DCOB 4P2XA 2EPIA 1J5EF 5IWAI 2BE2B 1NM2A 1JIHA 2Z4PA 1RKIA 3DOKB 1VOMA 3BBBA 3ILLA 4LBPA 4KFBA 4YN3B 3KK1B 3A13A 5IXUA 1S1UB 4UOGA 4TQRA 3RAXA 1BY9A 2M8DB 3RAQA 4QNJA 4DR6E 4U3DA 4CRJA 4JI5I 2KG1A 2PGCA 4RZRA 5HP1B 3DLKB 3CMES 2VD3A 4NXMF 2DH7A 3U1NA 3W64A 3FK4A 1JKHA 2IAJB 1M0SA 2XCAA 3EX7B 3W3SA 3HKMA 4KHPE 1R7IA 2RRBA 2YWFA 4J9VA 3UW1A 4DU8A 1RWXB 4IDKA 4RNFA 1DQ8A 4Z37A 2A2CA 2VFTA 3VALA 4Z7YA 3IO1A 2HRTA 2QL9B 2U1AA 3LO3A 4V19J 3DLEB 1SJQA 2LXIA 1Z5CA 4RW4A 5K5MA 4YY3J 4LF5J 2DXFA 2O1TA 1EA6A 1M5KC 1WHVA 2UXCJ 1SV5A 1XR6A 2K7JA 4B3OB 1WC1A 1Q8LA 3BYRA 4OHVA 1JK9B 2HFUA 2NN6A 5J1EA 1OYDA 4J9QA 4JI1E 1IBMJ 5DNXA 5DQHA 4K4TA 2CQ2A 2Y8WA 5I3QA 4CLZA 1RHJB 1S1TA 3JQMA 3EYZA 1IR1A 3CJKA 4YHHF 2HW3A 5HL7Q 1RWWB 2Q79A 4X62I 3D66A 2KT3A 2CPHA 3D6MB 3FKBA 4B08A 3T9ZA 4LFAE 2UXCI 4CO1A 3PRYA 4JI3F 1S7HA 1RT7A 4YB7A 1R8BA 2HQFA 3LPYA 4HACA 3SCJE 3SV4A 1NK0A 4NXNF 1HW9A 2WK4A 2PEBA 1N32I 3MD1A 4MU3A 3CT9A 5D4PA 4DI6A 3NP5A 4ANCA 3JB9k 1VMBA 3CIMA 4DCPB 4LF6J 2BA0G 4DXLA 3IWLA 2EBGA 5C42A 1TTHB 3I5AA 5F8GA 2AMCB 1J5EJ 1HNZF 2VQFF 2DR5A 3RAMA 2R8GA 4X65I 4UQGA 5HJXA 2GHPA 4WYWA 3H40A 1DJ0A 3M8PA 3HT0A 4QW8A 4F4KA 1YHQS 2ZE2A 2Z2MA 3CUNA 4B3SE 4IFDD 5B09A 2VH7A 1S1XB 2EC2A 2CQHA 4O44A 2HHUA 1N6QB 1N33I 3P76A 3J80Y 1N8RT 1ZTTA 1GX6A 1NSPA 2V2VA 1NBEB 3D3BJ 1UEUA 3FCVA 3MECB 4OI2A 4PABA 2CWKA 4FZVA 3SEOA 2KFYA 3K5NA 1HWUA 1YLXA 2YNFA 4I6YA 2VG5A 5B0BA 1TKXB 3OTOF 1TL3A 3MUTP 4DV3J 3L4BC 1RAEB 3E01A 5H9EK 5KFHA 1J5EE 3CDJA 4GKKJ 4ZPCA 2CQCA 3OTOE 5IC6B 3V81B 1IBKF 1L3TA 3HHLD 4IR9A 4Y2MA 2Z8QA 5A2QU 4U3BA 2LDIA 5BR8E 1RBOB 5B0FA 3H59A 3CEDA 3I0SB 3VVTA 2HNZA 4DR4E 4URLA 2DGTA 4QW9A 1EHWA 1ZM3A 4IH7A 5LMNI 3M6UA 4ECTA 1P1TA 1S76D 3M2RA 3Q8SB 1U4BA 1O5JA 1CJKA 2B4UA 1FFWB 1Q4RA 1AB8A 3BDEA 4I69A 1Y5LB 4X4TA 1SI9A 2RKIA 3M4XA 4DV0E 4EFAC 4CLKA 1UWBA 5GMEA 2LA4A 1BHNA 5KFIA 3VR1A 3V6DB 3EDRB 2J6UA 2Z5BA 2I9SA 2MSTA 4J9OA 2MSSA 2KYXA 4LMZA 2X1GA 2NREA 5CCLA 3HSZA 3HHLA 3NS6A 4NXNE 3F41A 4QBUA 2OUGA 2AYBA 4DV5I 2AW0A 4M5NA 3MEEB 3JSMB 2XY5A 1QUPA 2VA2A 3GONA 3FCWA 3KJQB 2HQDA 1U1PA 3CCWA 3HHLB 1VI7A 2ZH7A 3GFYA 1RZMA 4PU9A 4B3TI 3ILJA 4NLYA 3QO9A 4WCEQ 4MIAA 5IFMA 3O3LA 1KQGB 1VJQA 5KT4A 1YK9A 2KFZA 1JWWA 1RK8A 2Z5BB 5L1JA 1RAAB 1NHUA 3DRXA 1WF1A 2FVRA 4PXBA 1X5OA 3MPWA 1VQ7S 2MTLA 3JTPA 4JI7F 4OO1B 1FFSB 3LF0A 4KH0B 3IXQA 4L74A 4LF2A 5CYMA 4CO3A 5IV4A 5DDRC 2R3VA 4CH7A 2H51B 1Z0CA 1DHMA 4OI4A 1U45A 3NZKA 1TV6A 1IBLF 1KDNA 2DXEA 4OX6A 2M3DA 1B4SA 1RTJB 3PW4A 4G1QB 2DHAA 5A8KA 4MU4A 3ET6B 2YWKA 3M6WA 3QJJA 1WDTA 4ZVFA 4DR2I 1R6VA 1NH7A 4X65J 4USVA 2E1AA 1GK8A 1NDCA 2DH8A 3ILIA 1NKBA 1HBOB 1TL3B 1UFKA 3Q8UA 1DQAA 2FJBB 2N7YA 2RQKA 1NDLA 2YNFB 3MPVA 4EI2A 3PJ9A 1HMVB 4X4QA 2WVEA 2B6AB 4DV4E 3NAIA 5KFXA 1VISA 2BW7A 1IR2A 4DR2F 1R31A 3K5LA 4RNMA 5CA5A 3PS3A 4MT1A 3MR2A 5KFBA 4B9LA 4ES1A 1DFDA 2D7SA 1KHVA 3O1LA 4BWJA 2HSEB 1U2FA 3VVUA 4JI4F 1HI8A 4P72A 1RWMB 5H9FJ 4NASA 1LXNA 2DNYA 2WTFA 4YEAA 4MIWA 2CPJA 4BHQA 2HWIA 1H72C 2OD4A 3E8OA 4KBIA 5LMUI 2C2MB 4JG4A 2L9DA 3FBBA 1D9FA 4WE1A 1YZ6A 4K5SA 1UP1A 2CNNB 2QIFA 3D68A 3H20A 5HATA 2CPZA 4FP9A 5LJ5Y 3CJQA 2UUCF 4X4UA 3T1HE 2KYZA 4JI6J 3DOMA 3PW0A 1T05A 2I8EA 4UTGA 2O66A 3KLIB 1NK7A 5B0DA 3HVTA 3T1YI 4X64E 4I2QB 2M7SA 3H2LA 2BV3A 4YHHJ 1VHFA 2BR2A 2KVIA 3QMQA 2YQ1A 3GCXP 4C0HA 2APOA 4P6QA 2KDOA 2IRYA 2RJZA 4IG3B 4EU0A 2CJKA 4QCLA 4RW4B 3W5YA 2A6MA 2JC0A 2B9WA 1JNRB 1FNXH 4B3TF 1XHKA 3R97A 4LCFA 2DNLA 3O8WA 5J2NA 2MPUA 1Q7YT 3M85D 4ICLB 1TFWA 4QPTA 4KO0A 1WTFA 4HTJA 3M32A 3W65A 3EXCX 3DLGA 4LF8J 3DLKA 5K36B 2JEBB 3BJYA 2X51A 1P9QC 1JLGB 5L1LA 2H1YA 1VQNS 4FW5A 1N34I 1HNWE 3DU6A 2PFDA 2DTJA 1BE4A 2GHWA 2BE2A 1EKRA 4A8XA 5EX0A 5KFEA 5L39A 3J7YU 1AZSA 2AEJA 3VWSA 2ASLA 4JB8B 3CCZA 1EP4A 3TWZA 2OTLS 2QRRA 1PYTA 4F25A 1AUDA 4AM3A 3KHGA 3TX8A 4C0BA 1E6VB 1F5AA 3CCRS 1R0AB 3HP6A 4N76A 2MZRA 2XBPA 1EARA 3CDUA 4ENOA 4W4MA 1XNQI 1FRXA 3M7VA 2OO4A 1HYSA 1QTNB 5I42A 1HBMA 2PO4A 3N79A 4FXVA 5E2QA 5A0YB 4DV4F 1GX5A 1OSDA 1RQ0A 1RU1A 2VONA 4ZP8A 3MFHA 1P6TA 3E3XA 2MQOA 2OGUA 3V6KA 2LECA 2UUAJ 2BABA 3KNGA 2MQNA 4DOZA 6AT1B 3RB0A 4ZITA 3H5XA 2DGOA 3CPWR 1IM4A 3BV8A 3GWCA 3POTA 4ECQA 1CULA 4ZJOA 4DR7J 4IZJB 1D09B 2C3UA 1HW8A 1B70B 4JI1I 4G1PA 1TMMA 5GMDA 3PCOB 4DR1J 3FQKA 2ZBPA 2VPWB 2Z5CB 2XQCA 1S1WA 1S57A 1T9UA 1X5TA 1F1BB 3FZBA 2D74B 3C6UB 4IFVB 4M8LA 4ECUA 1IKWB 3T1HF 4JI0J 3KJNB 3TRGA 4YDXA 4B9TA 1TAUA 4DR7I 2GIQA 1FJCA 4B3TE 4LIWA 1GQEA 1RT5A 1A6LA 3F56A 3FJ2A 3GIRA 3M6XA 3PRBA 1BQMB 1QD1A 4OV1A 4PXDA 3TAMA 3TNVA 1CJVB 4YB1P 3TZWA 4LF8I 4DR7E 3PO5A 2RT3A 2XGPA 4MH8A 4O3SA 4JV0A 1KN6A 1M1HA 2VBXA 5DDPC 5A8WA 3FRZA 3UD3P 1NK4A 2F4VJ 3RR7A 2M2BA 3R6LB 2GNKA 2M5YA 4C3KA 1S1WB 2D41A 3BH7B 3NNHA 1QDUB 1XQIA 2Z5CA 3B4TA 4WP8A 3MR7A 4ZIWA 3RB4A 2ADBA 2BQRA 2E7VA 2V5HG 3GJSB 3SQGB 2EBEA 1HNXF 3OTBA 4JI7I 3MEGB 4B3TJ 2XNRA 3DOLB 4RBTA 1KVJA 3QT5A 4QWDA 4ISAA 2KT5A 3ZTRA 4PRFA 1S79A 1WI8A 1A9NB 1A6FA 2V8VA 3DRPB 1OY6A 2WSCC 3NLCA 2M0GB 1IM6A 2WAQD 4KKOA 4ZP7A 5ETSA 2FHKA 2BXJA 3RZAA 3ZTPA 4CO4A 3Q8QB 3MMAB 5C24A 5GAGU 3MR5A 1T11A 2LQ8A 4F0KA 1RADB 2LEPA 4O0NA 1HBMB 4FVMA 4WFYA 3KYLA 4DPXA 9ATCB 3S8SA 3US5A 5FLXQ 2LYVA 4P9SA 3EMTA 1F9EB 4C3MA 4Z2XA 4DV5F 1S9EA 3FEXB 5IQ6A 1HR0I 3I82A 1R0AA 1F5BA 4FPIA 1I94J 1BGXT 2AJ2A 2L41A 4GC6A 1SH3A 2QT7A 4IR1A 1ACMB 1R6YA 1R6MA 3X3UA 1FWLA 4OZ2A 3MUMP 3D1HA 1PKUA 1U8SA 4IO9Q 2D1CA 4DV2E 2W9CB 2CQDA 1S4FA 4OJGA 4K4WA 4LF4F 3LGMA 4KHPF 1RWPB 2R4FA 1JLGA 3KG4A 5HN0A 2VQEI 3BREA 1N0VC 4F0HA 3K17A 5DQIA 5CYQA 5L9XA 3TOQA 4IFDC 2YKNA 4IH6A 4DV7F 2CG8A 1L5UA 4N7TA 1JJ4A 4P2SA 5L1KA 4QIFA 2K2PA 1XMOE 2RH3A 1MMDA 4Y2CA 3A12A 1RISA 2AE8A 5H1SV 1IBKE 3ETOA 1GH8A 2GW8A 2BW2A 3CW2C 2W4CA 1X4DA 1JLAB 2MLYA 2KI2A 2N4CA 3MM5B 4PR6A 2HHPA 3TYTA 1DURA 4B02A 4Y34A 3H25A 1FXRA 2I5JA 4KR0B 3EVOA 4B3MJ 4I2QA 4FF3A 3BYPA 1VGYA 1NMEB 3GE9A 3BR9A 5IT4A 5LMUJ 1UWAA 4ZPAA 3KLIA 2R7SA 2GGPB 1VQYA 2RF2A 1NUEA 4HR2A 2FGOA 4QR0A 3Q23A 5F8NA 3N6NA 2AGQA 2B7CB 2OTJS 4M95A 2MEWA 4DR6I 4FNIA 2DR8A 4PKDB 2XS7A 2QLWA 2DEJA 3RBDA 5DRRA 1S9GA 4LOMA 2ACMA 4LREA 2AEMA 3Q8RB 4ZLLA 1NPKA 2AZ3A 2HS3A 2WOMB 4NLXA 5DM6Q 4LF7I 5IT9Q 3MAAB 3ZC4A 3J81Y 3CJTA 3T5LA 4R0EA 1YSJA 4HYMA 2O1VA 1N32F 2YQ3A 4FF2A 3WIVA 4ED4A 2HKJA 4ZMMA 1UJ5A 4RW6B 1PBAA 3I9V9 2WVFA 8RUCA 3OLBA 2V4RA 4QYZJ 1NZAA 3HJVA 4PPDA 2DVIA 4LFAJ 1FVQA 1YDLA 2JFDA 4X62F 3CDIA 3HJCA 1KOHA 3RBXA 3A1YG 2ZH6A 4LR9A 3KDOA 2DJWA 5KG2A 4R8UB 1U1RA 2B8QA 2B6AA 3Q89A 2W24A 4B9VA 3FSXA 3LP2B 1N33J 2AYEA 2BJ7A 3KK2B 3OSNA 4WIIA 5HVGA 1WORA 1VS3A 4U7CA 5F9LA 4ED5A 1UDQA 2NZCA 3TJAA 1T03B 2Y8YA 2HHWA 3VZHA 5EDWA 1CLFA 1PJ6A 1Y11A 4RX6A 5CZXA 4UF4A 1C1CB 2V9KA 2HEKA 3AODA 3MR6A 1X4GA 2OEMA 1NEEA 2G0JA 4KH1B 4Y2KA 5F0WA 4QWBA 4YY3F 1U02A 1B7YB 2DYAA 4HDHA 4NCGB 5KFNA 1GTEA 2FZCB 1MN7A 1FERA 4QZVB 2H5EA 4WU2A 2GVZA 4ZJLA 1V9OA 5T41A 3GQCA 3V4IB 2H5IB 5F3ZA 3TA1A 4Q5VA 3K5MA 1V3RA 1VR6A 2XC9A 1D8YA 1UVJA 4QNKA 2OPPA 3OTOJ 1W25A 3QZ7A 1K47A 3KLFB 3EUNA 1KS2A 1X9WA 3VAKA 4JI7E 1N88A 3IM8A 4NLVA 5FIIA 2UZAA 2UXBJ 4AIMA 3L9ZA 1KLMA 2V8GA 4DLGA 3TVYA 2R9LA 2GO9A 4ZPWR 3UN5A 3OL6A 3JSMA 3PX0A 1R0CB 1TL5A 3TZZA 4DR1F 5KG0A 3UDVA 4WBFA 3UR3C 4QIWD 2QMWA 4R5PB 5C0XB 4NX9A 2ZH8A 2YNGA 3LALA 1UKUA 4DR1E 3G2XA 4ZCLA 4FVCA 1T02A 4B9NA 4NZ0A 1KONA 2G2YA 2FZGB 5AE3A 2PI4A 5A2QQ 3K59A 4X64I 4OI1A 4NCAA 2HPUA 1X9SA 4LQ3A 4Q2LA 2C42A 3GV8B 4QWCA 5H9EJ 3G6ES 4NXNJ 3VGVA 2E9RX 1FRLA 1HQEB 3GTYX 4LCHA 4RKUC 1M1GA 2C2KB 5F41A 1EIYB 4JI5J 5EN1A 2N3OA 3OR1B 4Y6IA 3UVJB 2EFPA 4ECWA 2CA9A 2DITA 1J5OB 4DCJB 2HNZB 4FKYA 2E1CA 1H7UA 3Q24A 4S0MA 4MKYA 1UTAA 2AEFA 1RWKB 4ATNA 3IFEA 3V81A 3OXLA 3I96A 4H4KA 1A0OB 3PO4A 3VGUA 3WU6A 1PC4A 1OSCA 2YXLA 5LJ3Y 2UXCF 3PX4A 4LFAI 3M9MB 1U2CA 1VRTA 4DSJA 3HSDA 3DLHA 3EGWB 5CH7B 5J2QA 1FTCA 4DV6I 5ETQA 3TUJC 1GXLA 3WU4A 2ZOFA 1NJIT 1S1XA 2EWHA 1QZRA 3R8YA 1RR9A 1FA0A 4YR3A 3H2VE 4ES2A 3BQ2A 5EWGA 3TW0A 1C4AA 3OFFA 5E3RA 2W9AA 2PMZD 1S97A 4MU1A 1CVJA 4KV8B 4TYBA 2HMIA 3OXFA 1NH8A 4X65E 2UUCE 4FYXB 3G9CA 4J7CA 2CGEA 2DO4A 2JHEA 4NA1A 3CWJA 1LWFB 3TUZC 1M5OC 4FW9A 2R7UA 3B4DA 4YDDB 2RS2A 1RP5A 4OYWA 2UU9I 2CIMA 2EI5A 2HMIB 3OVBA 3LA0A 2V9WA 4ZVIA 2OKQA 1T9YA 2IJNA 2PA8D 2ROEA 1X60A 3AXMA 3S6EA 5KFZA 3O44A 2CQ4A 4PPZA 4FF4A 1HNVA 3GYGA 4UOHA 4JI6F 3K0JA 1IBMI 5KFTA 5LMNE 2KXHA 2QA2A 3B82A 3R7BB 3KHHA 2XZTB 3I0RB 1RTIB 3QSIA 2QSWA 5J1NA 3THPA 5HLFA 4CYUB 2YQ0A 1VRUB 1WEZA 2ZOGA 4UUWA 3QGPA 3Q1QA 3HFKA 2DNKA 4X66F 2KHDA 5K14B 3VAHA 1VC5A 3OTOI 1HARA 4KHPJ 4ZVEA 5T7LB 1X4EA 1C1BB 3CJ0A 3OHBA 4M5GA 1VLOA 4XK8C 4KTQA 4F02A 3DMJB 5K8PA 2XO7A 4LF9I 1HLWA 4C8KA 2DB1A 4EYHB 2IC3B 2XCPA 3K57A 4Q44A 2NYIA 2IM0A 1CJUA 1WG5A 4M5HA 4X4VA 3TQ1A 1GTHA 1RCXB 4Q8EA 3BO4A 2VQFI 3B6BA 3NNAA 1HNZI 1IBME 5IWAJ 1GXTA 2C3OA 1U0SA 1ZPVA 3ZO7A 1B99A 1FJEB 3Q2SC 4BBYA 3R1HA 5I3UA 3VZIA 1RCOB 4O3QA 3WQPA 1RKJA 2B5JB 4J9PA 2BOPA 3C15A 1CEZA 2FIUA 2R2UA 1E6YA 3DN9A 4GKJJ 5FJ4A 3CD5A 2BMBA 2HFSA 2IVFB 3I32A 2E5JA 4DF4A 1VBXA 3CD6S 3BH6B 4JI0E 3A3PB 2LXUA 4DS4A 2IESA 1FDDA 4NBQA 3ZKBA 3QFHA 2J8AA 2MKIA 4FWHA 4OV6A 5L46A 1VQ9S 4FXDA 4LF6E 1AYEA 5BYSA 4X62E 4DR4I 5KG6A 1OPIA 2KZMA 4DDFA 1Z0VA 4WXOA 2ZD1A 3MCOA 1OYSA 4LF6I 2QJ3A 4PG6A 1NK5A 1NCLA 2KVQE 2D3OR 5EL9A 1U1NA 3OL7A 3OBIA 3FEZA 1XR7A 1GEHA 4A46A 3JQKA 4USWA 4LJMA 1HWIA 4OYZA 2GVZB 1DTTB 2ZZTA 2NN6B 4IFDB 1F5CA 1FVSA 4LFBF 2JOQA 2VF3A 5SZTA 1WEXA 4LF7F 1N33E 3W9JA 2ZKUA 3MGJA 4ZP6A 4RPFA 1B62A 2C37A 1EI1A 3QRQA 3IGNA 2IMOA 4JI5F 1MU5A 1KOOA 1VCTA 3AAWB 3MZIA 4ID5A 4LRFA 5IQQA 5CZVA 4DU7A 2ERRA 1SKRA 3HK2A 2W4DA 3HJFA 4DR6F 4RWXA 2BJ9A 1NO8A 3D1OA 2OPQA 5LM7E 2V8DA 3K1JA 5A2QC 3R5AA 4TVAB 1WOSA 2FJDB 2MHNA 2H9ZA 2Y1RI 2IBOA 2IM2A 1XIQA 4BC7A 4IO1A 4AL6A 2CWXA 2QO3A 3FFIB 3HHNB 1V3SA 2FC8A 4GO7X 2HNDB 3UD4P 2DCLA 1KIJA 2JEAA 2NN6E 4FNHA 2XGQA 4WKRA 1XMOJ 3GLLA 2Q1LA 4LCGA 1M5HA 1N4LA 1L3KA 1SJ3P 3MM9A 1RLDA 1SC6A 4K4SA 1NXIA 3SMZA 5D77A 4F36A 1TFYA 4YP3A 2XWXA 3VAFA 4ZN3A 1MU2B 2HGLA 5K9FA 3D0HE 5A8RA 3ZZPA 2UXBF 1TP7A 2V4QA 1XMQJ 1Q82T 1H7XA 3H42A 5D3GA 4QU6A 4DV7I 2OEJA 3M7NG 3ZZZA 3MAHA 3KK3B 3IWXA 2WOMA 2HIYA 3VGTA 3LGHA 3QGHA 4NZ7A 4WYLA 4DV3F 1HBUB 3D6HB 1QAYA 2BJ1A 2CJBA 3TR5A 4ZLPA 3PKYA 1M5VC 2R2TA 4M94A 5JEAB 5HSPA 5L1IA 1AXQA 1TKDA 5A6PA 2Q6BA 2WSFC 3G82B 4HKQA 3M1VB 2HNYB 2E1MC 2B4VA 1ITPA 2ZNZA 2NN6C 3TEHB 2RAQA 2WCXA 3E51A 1K8AT 1F2GA 1Z2ZA 2BJEA 2ALZA 1UPPA 2VQEE 2NN6D 3QFWA 1JLEB 1JMTA 2CJQA 2I5JB 3OTCA 3PTWA 4ZHRA 1Y5YA 2XB2D 3OXGA 4IG0A 4ZPTR 3W8GA 3JAMY 1K44A 2DT9A 1JLAA 1LW0B 2IIHA 3B78A 3MM5A 3OPKA 4NLRA 4ZVUB 2CPIA 5CAAA 4NLGA 2BRKA 2J7KA 2VKRA 4MKBA 1KKHA 4Y2IA 2DXDA 1OYRA 1Z2LA 1VQKS 3GU0A 4RW9B 3M9NB 1WG1A 2NSBA 4DX8H 4P75A 3GSIA 5B7WA 1CC7A 3H4BA 1JLQA 1P9YA 1X4CA 2MGZB 4K0KF 3R27A 2YX4A 3THTA 3T41A 3W2VB 4CO5A 4A8MP 1UA1A 1S5ZA 4DG1B 1Q95G 4RW9A 3PFOA 4C8OA 1RAHB 2E7WA 3UI3A 3OT9A 4OJHA 4Y00A 3TO8A 3WBZA 2AJQA 3KLEA 4X64F 1CQMA 1CSJA 3CCQS 3L7ZB 5IM0B 3RRHA 1LFPA 2AD9A 2IERA 4CH1A 2OPRA 2NYHA 1JNZB 2XZWA 4NLPA 3SCKE 8AT1B 2JJ4D 2RU3A 1C0TB 3FZ2A 3LPSA 2DO0A 4GO5X 5D4OA 2LJPA 1S9EB 4AYBD 3F73A 4DR1I 2PO2B 2M9KA 1YG0A 4OZ3A 3J7AM 5IT0A 1O6XA 4C97A 2W8KA 3TANA 1H7WA 3IG1B 3GYXB 1XJWB 2NXCA 1TZ0A 3QYYA 2W2QP 4KKOB 3RB6A 2ZZMA 3W63A 1Z59A 1FXDA 2YKMA 3IWNC 2HHHE 1WC3A 3BPDA 1YJUA 7AT1B 1QAJA 1Z1ZA 3DOLA 3LPEA 3NWRA 3R1LA 3I9ZA 4YB5A 2P8IA 5D3GB 5M2PA 2CG4A 4IOAQ 2R7QA 2NPFA 1YRUA 4HLBA 1S49A 4RL1A 3I4PA 3QGIA 4USUA 1TU0B 1KHWA 4ZIVA 1NHKL 2J8SA 4LRDA 4N56A 3MUVP 1Y60A 2O1UA 5IT9C 1N36E 2X1BA 3DI6A 1FT8A 1JXVA 3PYFA 4ZOSA 3GIMA 3UHMA 3G6VA 1PILA 4HT7A 1N5YA 2VESA 4JI7J 5MAOA 5C7PA 3C2PA 3LP0B 3ONQA 3D2WA 3RW6A 1B63A 4DR6J 4YUDA 2HHHJ 3FFIA 3KG1A 1XC9A 4M5LA 5C25A 3HPOA 4X4OA 2JE6A 3TUIC 1FDBA 4RUHA 3J81Q 4URSA 4F3MA 4DV2F 2EW9A 3G6XA 2GVDA 3M8YA 4LF7J 4K4ZA 4EK2A 5GAHU 3AJDA 2XLKA 3FNNA 3C46A 4IUFA 5I4MA 5KFAA 1DAXA 2JNJA 3MD3A 2Z30B 2BJDA 4WK1A 3OHAA 1ZA2B 2VQEF 4ED2A 1C4CA 4OHYA 4JI6I 3GJRB 3AH6A 1FRMA 1VBZA 4CLYA 1H0HB 4EWTA 2A10A 3VGSA 2COLA 3DGVA 4CLWA 1ICEB 2XLIA 4DLEA 4DUZE 4JI6E 5DJBA 1RE1B 2FJAB 2HZAA 3FRYA 2VG6B 3QAUA 4MIBA 1APSA 5KTQA 1R8AA 2XZDB 2HHTA 5K8MA 1OIAA 3Q8VA 3M8SA 1WI6A 1QVFR 3P5BP 1S0VA 2LQ9A 5E3CA 1VQOS 5KFQA 1TR0A 2DHXA 2KZZA 5B0AA 5HVHA 5I42B 1OMSA 2RILA 2QMXA 1VIXA 3FDSA 5KFOA 4I68A 1BUXA 5F8HA 1PJ5A 5F0UA 4IRCA 3HULA 1PCAA 4XIUA 1NB7A 1I3OB 2RQ4A 1X8DA 2Z2ZA 4WF9Q 5D78A 1X9MA 1K9MT 3GIIA 4BDPA 3BSAA 5D0HA 2DNZA 3H8YA 4C11A 4ECZA 3ICLA 1U26A 1R27B 2EVZA 4PXCA 3J81j 2EG2A 2C39B 3K8VA 1KP6A 3UWTA 2KT2A 4B9SA 4RWWA 1N36F 5HBMB 5DNLA 1S6PA 2HHHF 5K36A 4NE9C 5J2MB 4B3SJ 5DDOC 2MMYA 4QIGA 4CT9A 4J9LA 2CUYA 4H4KC 5GAHI 3V6HA 1YJ9S 1XNRE 5K36F 3D3CJ 1H74A 4W98A 3PIPQ 3NG8A 1ZTWA 2WP8B 1KVIA 2W9BA 3UCGA 1TL4A 2JEJA 2CPEA 1XBWA 3GFZA 1BXNA 3MTJA 4URGA 5GMKa 1LWCA 3CCVS 2O3DA 1JQGA 4FWDA 5KFWA 1Y5IB 4B3RJ 2PO1B 3L09A 4FPRA 2UUAF 3MMBA 4OFZA 2QG9B 3C16B 4C0OC 2KFNA 2J6SA 3MI7X 3BGFA 2L08A 1RT1A 2L3MA 4I1TA 4F8RA 2J7WA 2YY3A 3UO0A 4LFCJ 5K14A 3TQEA 1HL6A 2JE6B 4G65A 4FW3A 4I7FB 3JAMC 1VRUA 2VV5A 2CJAA 4ID8A 2Z2LA 2HGNA 1RTIA 2F1FA 3NKYA 1P8GA 1NPPA 1W26A 1M1KT 3D0GE 2VBZA 5AE2A 3AY0A 4AQYJ 4QIVA 4P7VA 4P74A 2JLFA 3H7HB 4CTAB 2KM8C 4K2XA 1GFWB 3DHXA 5JVHQ 1U1OA 4ILLA 2OHDA 1RTZA 2Z57B 1ZZNA 5HROA 2OPSB 4P7AA 5KG3A 1REVB 4ED6A 5E7OB 5MLCV 4HHUA 1JLCA 1K1QA 4KIAA 2J0QD 3VQSA 2VQEJ 1FD2A 2X36A 3NWGA 3DCAA 2B0GA 4LR7A 1TUGB 1KVKA 2WBRA 2F4VF 4IZKA 2RRAA 3H2UB 1HQUB 3IBWA 4G6VB 2EKNA 1T8EA 1HI1A 2XI3A 3IG1A 4DV2J 3PHTA 3UN3A 4LF9F 3CJ8A 4BA2B 4ZVOB 2F4VE 2ZITA 3DDIA 2DNOA 3PW5A 2Z2YB 3KTQA 5J2QB 5E3AA 2L9NA 1Z0TA 4LVNP 5H9FK 2WONA 3OFEA 2I38A 4L3KA 4IYQA 4PQUB 4WU3A 1H7SA 5K20B 4LF8F 2UVRA 2YX1A 2ZC4A 3B8HA 1HA1A 3H4DA 4BCAA 3BPSP 1Y9OA 2V2KA 2YNHB 3PM9A 4TLQA 4JI2J 4PUOB 4OYOA 4EYIB 1N5VA 1O0PA 2HQGA 3MM7B 3C6TB 4O3OA 4C3LA 3UDCA 5KG1A 3T1HI 1TV6B 3Q2TC 3DLJA 1U6FA 2MDAA 1LFWA 3NEKA 2HK3A 6FDRA 5G0RB 1CJTB 2PDAA 2XM3A 4ETXA 3J81U 3G71S 2PC6A 1VQMS 1U49A 2C2ZB 3QIDA 3T1YF 3DDKA 1G4CA 1UEKA 2E29A 5LMUE 5GAGI 4XDCA 4AL5A 3PX6A 1D0EA 5DO2A 5GADI 4J91A 2EK1A 5L9NA 5DLGA 2DNQA 3EZ5A 3SI8A 3QWUA 1U1QA 5DQGA 3QZ8A 2KHCA 4TKTA 4TU9A 3OL8A 5GAEU 3PNIA 1X4AA 1YHCA 2E44A 2I2YA 2D9PA 2ACYA 1K0VA 4ZVQB 4GQUA 4DV4I 2ILZA 3MM6B 3TP2A 3G8SA 1VQ8S 4DQSA 1Y7PA 3HVWA 4R5PA 4HY1A 2DNRA 2PNZB 3BBCA 5K36C 3M9OB 1S6UA 1JLEA 3MF5A 3BS9A 4I56A 1O51A 2R8JA 2RIJA 4IFDE 1S99A 1PIEA 1KLMB 5DROA 4WUBA 2JVRA 1XMOF 1TK5A 3DM2B 5AJ3F 4N8NA 2BKOA 2B51A 1FCAA 3L7UA 4K4UA 3IN5A 2R8KA 2BKPA 2HVDA 3HO1A 4PWUA 4PG8A 1TK0A 2M4MA 2QL7B 3C3LA 5C2CA 3W61A 2XMMA 3CJ4A 3NCQA 4CO2A 4X65F 1UCNA 2FHJA 5F8IA 4FBTA 4CI0B 1PVGA 3QGGA 2RS8A 4NZ6A 3SSSA 1MWZA 2XY6A 1ZA1B 3V4IA 4NCGA 2QLXA 3NRBA 4EUVA 4ZCMA 4Q45A 3NGRA 2HAIA 4JI2F 2YWHA 4X62J 1R43A 3N6MA 1RT4B 4TN2A 3CD7A 4DV0F 2V2ZA 4OYIA 3P8BB 2K8GA 3DRYA 4LFBJ 5GVQA 1VDHA 2VPYB 1AFIA 1E3HA 2IOPA 4DR5E 1NSKL 4IRDA 1Z4UA 2KTQA 1I51B 2HURA 4OZEA 4KHRA 2IBKA 3LP2A 2HBYB 3BSCA 2F5GA 3PDNA 2PSZA 2FYXA 3W1YC 3DM2A 3PIOQ 4OI6A 2SXLA 4HYKA 5DG7A 3IBCB 3IA0A 3FVYA 3EICA 2HFOA 4O44B 3T19A 2DR7A 1KNZA 2W2NP 2UUCI 4P52A 4NYOA 3M8PB 3H90A 3N28A 3CC4S 1XEZA 4A8WA 2PNZA 2J7UA 5KFCA 2XHCA 4CQ1A 2ZVIA 5KAKA 4DQRA 1HNIB 4KPYA 2C37B 5LMUF 1YGYA 2ZC3A 2CPYA 5E41A 3U1KA 3BF4A 1SKUB 3AFGA 1ZPWX 3NGTA 1T9WA 2GQ2A 4Y28C 5E0OA 1SQGA 3ZZOA 2WVDA 1RHMB 1JXEA 4DV6J 4DFPA 3QNWB 3AJ2A 2DIUA 1F9HA 3MAAA 5THWA 3U1LA 3DRSA 2XEXA 2MKSA 2JWNA 2JEIA 4ECYA 1IBLE 2HRYA 5KT6A 4U7UD 1Q79A 4J9NA 1CJTA 5IWAF 3PHEA 3RYLA 2H4YB 5F9NA 4DR2J 1B3TA 2AIRB 5FDLA 2ZD1B 1DARA 5AE1A 4QYZK 1UJ4A 4LSNA 1R89A 1RT3B 3D6TB 2ADCA 4J9MA 4DL6A 1UVMA 2B7BB 4DL2A 3EXYA 3Q8YA 2HVIA 1XNRJ 2A0FB 3HHKA 3CJ2A 1IBKJ 3MM8A 1UFWA 2BE7D 3J7Z5 2BQUA 2QLJB 2G9OA 1DRZA 3SDEA 5B0CA 1FJ7A 5IV3A 1NK6A 3QT6A 4PQUA 4GVLA 3D5MA 1SC4B 2F8EX 2K1RB 3LUYA 2POKA 1TUVA 3MM6A 2N7CA 4FYYB 5AXKA 4ECXA 4CNYA 4L3NA 1Q81T 1MMNA 1W7WA 1ZM4A 4WFNQ 4LF4E 1IQZA 1U2RA 3RG6A 2XYPB 5LOQA 1K1SA 2AJ0A 4B3RE 1RAGB 2JLEA 1VQPS 1Q86T 4OYBA 2LQBA 5I3UB 2XMWA 4IDKB 2NXEA 1MSWD 2UXBE 1KSPA 1EAYC 4F67A 4ILMA 4AT1B 2LXFA 4ZJQA 3NBPA 3HFVA 2Q43A 2ZH3A 5K8NA 2BA1G 3R9LA 5HP1A 3PYGA 4MYTA 1JB0C 3IRXB 3M6AA 4IZKB 4LF5I 4XDDA 2DK2A 4LSLA 1N52B 3JSRA 4MTPA 4ZVPB 2UXDJ 2C2DA 3C6TA 2W9CA 1WEYA 1GXUA 1SPBP 1PGZA 1D9DA 1I94I 1VYAA 1LQ9A 2FHOB 4CLPA 4LF4J 2NPIA 3NAHA 2W8LA 4K8RA 2NSCA 1N36I 5K36D 2O3ZA 2GX8A 3CDWA 4LT6A 3G8TA 4JI3J 1C1BA 2NZ4A 5EWFA 1Y3KA 2P6TA 3QBCA 2ASJA 5ETNA 3CSKA 3OUYA 3SXLA 4O4GA 4W92B 3SSRA 4IH5A 4PRVA 1XWLA 1RBAA 1EETB 4Y2AA 1QY7A 5LSRA 1NZ8A 1UPMB 1DTQB 4NMXA 2DRAA 4BA2A 4KGMA 1HQUA 2E5LE 1N34F 1NAQA 2OFHX 1JLFB 3EJMA 4U8YA 3UNGC 1WC4A 3EGNA 1JJHA 2XLJA 4K4XA 5KFSA 4JYAE 2G0IA 3CTRA 4JI3E 1RT2B 2CNOB 4A48A 4WZQA 4AIDA 3V6JA 1FHTA 1FWKA 3N0VA 3OR2A 3FEYB 3QIPA 4BLGA 2W2MP 4I2PA 2HK2A 3UNYA 2AQ4A 4FBUA 3T1AA 4LIRA 3N4WA 4KV8A 3A8JA 4X4PA 4YQWA 4JI8I 4JYAI 3AD8C 3U02A 4IZJD 4OLOA 4CTAA 3PEJA 1SXLA 3W7BA 4NXMJ 3NGDA 2GMHA 1VQ5S 2WSEC 2IPOB 1IKXA 2Q3PA 4OJ1A 3PV8A 2PNLA 1D1UA 2JH3A 2C3MA 2GAHC 2DPJA 1Y4SA 4I7FA 1RSCA 4KGKA 4QIEA 3AB2B 4JOUA 4KGXB 1RJJA 3MAQA 4PWDA 5IWAE 3ZZUA 1HWKA 3T5HA 3M8ZA 1OY8A 1FRKA 3C16A 3N6LA 3BSOA 4MK9A 4IFYB 1HR0J 3MMBB 5EWEA 1XR5A 4RR5A 2FVCA 4WJBA 5B0EA 5KFLA 4Q43A 3WC2A 2D3ZA 3JYTA 2LQJA 4N3OA 4DV1E 1FE0A 1FRHA 2BX6A 4YY3E 4KPCA 4DMZA 4M63A 4IZJA 5GADU 5D0EA 2C3YA 3R5JB 3VQTA 3UVJA 2W9BB 1TL7A 3OR1A 4RNOA 2QA4G 1CPZA 3DXSX 1OPZA 4DV5E 1RWNB 2WBMA 2MQPA 1NHHA 5EUHA 3UD5A 2F9DA 3D6FB 4ZA1A 2BM0A 3ZTQA 1REGX 2BVZA 3DD6A 4WK3A 1MROB 1YVFA 1X5PA 4PG4A 5JEAC 4F50A 1BQNB 1GMUA 3RBEA 4FS2A 4P2FA 1HYSB 5KT5A 2RDIA 2IDLA 4MFBA 5HBMA 1J5EI 4FWGA 1RHQB 2GZOA 4J9KA 2MHEA 2HAFA 4JI3I 2R7OA 3ILOA 1FKOA 3IMQJ 3M8QA 4JUZA 1ULRA 4DFKA 4ES3A 2YNIA 1S16A 3KUGA 1F6TA 1Q16B 3GB0A 4NL5A 3VCDA 3HXMA 5C0XF 1HWJA 1LEOA 1G3OA 4DPWA 1U48A 5HQLA 3GILA 1YITS 2CQ3A 4HDGA 1B64A 2DISA 2W7OA 2IM1A 2V2QA 2VA3A 1ZXMA 2P9GA 5BJRA 4FW4A 7FDRA 1FE4A 4XTTA 1U7LA 2JRSA 3NL0A 2EFNA 1HKAA 1RWOB 2IRUA 1HNWJ 4Y0FA 1VLYA 2JEBA 4LF5E 2VUGA 2C1EB 2CZ9A 4ZVSB 2H54B 3DI6B 3R5BA 2HKEA 4L73A 1S10A 2RRNA 1IBLI 3VAJA 2PIIA 3MURP 1I5OB 5LXRA 3P4UB 1QAIA 1RAOA 1FJGJ 2MYFA 4ICLA 4I2PB 2HBZB 4C7QA 4B3RI 3KXDA 1VQLS 2RSQA 1OQ6A 4ZCIA 1AROP 2BRLA 2J9DE 2O5DA 3CDEA 2EXUA 1RHYA 2KXNB 3TX0A 3CXCR 1FF2A 1S6QB 2GVDB 3PW7A 1LXJA 5KT7A 4K50A 2ABYA 2O01C 2FHJD 3CCLS 2KM8B 3VHQA 1PG5B 1S6OA 4USTA 4ANEA 5J2PA 3FBCA 4C8MA 1UVIA 5C25B 3DOMB 4OZNA 2WVBA 2XWYA 2JEFA 4B3SF 2V67A 4R8UA 5DRQA 4DR3I 4HH1A 2OP5A 1B7FA 3QQCD 4YMEA 2X3GA 3A4TA 1Y4UA 2XI2A 3T5KA 3EM1A 1C0TA 2CQ1A 3WX4A 1NJZA 1N5YB 2R7RA 4R25A 1YBTA 3HM9A 4PG7A 1D3WA 1EZZB 4JI4J 1RWUA 1SJ1A 1LWEA 5B08A 3I56S 2B9EA 1WC5A 1OQ3A 4EZ6A 3L7ZA 2XMKA 3PVXA 2OSRA 3B4MA 3AD7C 3ZNJ1 2E66A 4OYPA 3DC2A 5I3PA 5ADZA 1M90T 1Q8KA 4LSLB 3GV5B 1MMLA 2N3LA 3IRXA 4CLTA 2XO6A 4F7VA 4DG1A 4NLSA 2RB7A 2YKMB 4DL0C 5LMNF 5KFGA 4TQSA 2C3PA 3W9HA 3P96A 1FX2A 1R0BG 2BJ3A 4H4MA 3CCSS 3PEHA 2IA0A 4AL7A 2K3IA 4PXEA 2JZ5A 3KJFB 1CBKA 2FJWA 1AUSL 1UW9A 4JV5F 1F0XA 3MR3A 4U95A 1T0TV 1LW0A 3DYAA 1NRKA 2K1RA 1L3UA 2JEGA 4KE5A 2ZVSA 1RA6A 5JXSA 1HBOA 1ZH5A 1BWEA 2ZWOA 3IR6B 1QVGR 4LPFA 2E9TA 4JI5E 2KXFA 4Q0BB 3HKZD 2BZ2A 1WUUA 3GPAA 3MM8B 4RO0A 2OPRB 4H54A 4AD6A 3ET6A 3LWLA 1U6ZA 5IM0A 2IYIA 4OI0A 2QL5B 2YX7A 4IOCQ 4KQVA 3M6VA 5KFYA 4IOBA 3J80Q 1RT3A 4FYDA 2Z5EA 3KNAA 5FDLB 2DNHA 1W2IA 5HMZA 5JEAA 4DPYA 1X0FA 4ER8A 3K7RA 2ZM6F 1ZS6A 3CIZA 5CYMB 2CRLA 5HQMA 2ZM6J 2F8HA 3SQOP 2J0SD 2YKNB 2F4FA 3W9IA 2LVWA 5A6WA 3L3CA 1SL1A 1S7IA 2B56A 2N4DA 3KK3A 3OSPA 1NHIA 5CXTA 1RACB 5LXYA 2ZOMA 4NI2A 4R1FA 3CCMS 2PMHA 2BQ3A 1SJ4P 5CHCB 1YX2A 1HNIA 4I6WA 4RUAA 2GCFA 1GT8A 3JXOA 3G4SS 1T94A 5B0GA 2C22A 1RHRB 1HNWI 3M30B 2VBWA 2N82B 2RQCA 1RTDB 4OX9I 4YHHI 1U25A 2XTJP 4YB6A 2CFXA 2UU9E 3WZ0A 1ZYQA 1F2HA 4MKAA 2ZH4A 3GZ7A 3IAM9 4NOHA 1YJNS 4DR4F 4F4WA 2MY7A 2UUWA 1MWYA 2UUTA 1TL1A 3N01A 3KKFA 1FJGI 1UL3A 1WOOA 2B4PA 3CCTA 4A8FA 2RNEA 1WC0A 2HQCA 5DS7A 2AJ4A 2DGSA 3GYNA 2E7XA 3MMAA 3H5UA 4M5DB 1FKPA 3HI9A 5C24B 3KJVB 4ANDA 4KAIA 4X4SA 3MFIA 4DV7J 3M85G 1FRIA 1HFEL 2MLZA 2E1RA 3PRDA 3M2RB 4JI0F 3T1HJ 1TMJA 1NSAA 3FUYA 4A8OA 2HRUA 4P2MA 2DNNA 5HI7A 2FQQB 4DV1F 2F1DA 4EGLA 3GR1A 3CB4A 3FBFA 1XNQE 2E5IA 3CNQP 4X64J 3EDQB 3S7RA 2ZFHA 5HANA 4LF7E 2F3JA 1H2UX 5HK4A 3TVZA 4K4VA 1YRTA 3HF5A 4HEA9 3MM9B 2FY1A 3EZOA 4NLWA 3NCRA 5K8OA 1RUSA 2XMAA 2JEAB 3I87A 4LUBA 4DV5J 1SQFA 1ZAVA 1N54B 1RXOB 3AJ1A 1WG4A 4LRBA 4WKYA 1IUJA 1IKYA 4X4RA 4CCHA 1X31C 4OYXA 4DN9A 3O5TB 2IVMA 2XY7A 3WDOA 1QTMA 4ELUA 1PSDA 2WZ1A 3DGPA 4EO8A 4DS5A 4EBEA 4JV5I 1G6BA 1UZDA 4RUCA 1WHXA 2A18A 2ATCB 1NHVA 3NY0A 3N5FA 4ID5B 2CJYB 4DR5J 2PNMA 2HLUA 1WF2A 2V6AA 2CAJA 1IBMF 4MFBB 4JI1F 4DUZI 4U8VA 4DV3I
chains in the Genus database with same CATH topology
4DUZE 4JI6E 2A2DA 4DR5I 4JI2I 1HK7A 4HACB 2O1WA 2UXBI 4YHHE 1N34I 1HNWE 3PYDA 4DV2I 3HULA 5L3JA 4GKJI 4Z7CA 3LNUA 2V34A 1XNQI 4JI0E 1NHJA 2UXBE 1FKAE 1XNRE 4LFCE 1H74A 4JI0I 2PNLA 4IZJB 4NXNI 4DV3E 5GMDA 4FWDA 2Z5CB 1ZM2A 5LL6R 4WUCA 1XMQE 1ELOA 4DR7I 2UUAE 2Q2EB 4B3TE 1A6FA 3JAMC 4EMDA 3ZKDA 4LF8I 2GQ0A 4DR7E 3M6AA 5BR8I 2Z5CA 4P7AA 1USUA 4JI7I 2F4VI 3QT5A 2CG9A 2X36A 4HXZA 4AQYI 4IZKA 1KVKA 1KTVA 1MX0A 1XNRI 4JI2E 4AQYE 2F4VE 2ZITA 3F0NA 4DPXA 2WW4A 5FLXQ 1HR0I 1Z0TA 4DUYE 3QT7A 4XTJA 1H7SA 3B8HA 1FWLA 4DV2E 4NXME 3T1HI 2UUAI 2BM1A 2HK3A 1N0VC 3K17A 5LMUE 1UEKA 1NZ0A 1HR0E 2OI2A 3WU3A 4DV4I 2HHHI 4HY1A 4LFCI 3LTOA 3J7AG 4JV5E 4B3SI 3P06A 1FI4A 1PIEA 4WUBA 1HNZE 1OJ4A 1MG7A 4M1KA 3ZM7A 4DR6I 1FNMA 2DEJA 3ZZTA 4GKJE 1PVGA 4LF7I 5IT9Q 4HYMA 2O1VA 2HKJA 4ED4A 1N34E 2V2ZA 2IOPA 4DR5E 1Z0BA 4JI1I 3HJCA 2VQEI 3CWVA 3QT8A 1FJGE 3JAMQ 4I3HA 2UUCI 4DR2E 4P52A 1N0UA 4LFBE 5FLXC 2ZM6I 2DEIA 2EFGA 1Z0WA 1IBKE 4UT4A 1S4EA 3ZKBA 1Y6ZA 4YY3I 4DV1I 2XEXA 1IBLE 4WUDA 4GKKE 1J5EI 1DARA 1K47A 4B3MI 4X66I 3QT6A 4DR1E 4DR3E 4USKA 1ZM4A 3T1YE 4LF4E 1U2RA 4B3RE 3D4JA 1H73A 5A2QQ 4DV0I 4X64I 4MYUA 4USMA 4LF5I 4K0KI 3PYGA 4IZKB 4MYTA 2VQFE 1H7UA 1I94I 2X7IA 2V8PA 1N36I 2UUBE 3WU6A 1BKNA 4LFAI 4LF9E 4DV6I 5FWKA 4PRVA 3J81C 3WU4A 1QZRA 1RR9A 2E5LE 3H4LA 4JI8E 4X65E 3ZZ0A 2UUCE 4JYAE 4JI3E 1D6TA 2CGEA 2ZBKB 4FW9A 1FWKA 3T1YI 2HK2A 2UU9I 4JYAI 4ZVIA 4OX9E 4JI8I 4IZJD 4KHPI 1IBMI 4DPTA 1Z0EA 5LMNE 4DV7E 3B82A 1Y4SA 3Q1QA 5IWAE 3OTOI 3ZZUA 1ZXNA 4DV1E 4N3OA 5IWAI 4YY3E 2UXDI 4IZJA 2UXCE 4DPUA 4DR6E 4DV5E 4JI5I 2VQFI 1NHHA 1HNZI 1IBME 4KHPE 2BM0A 4JI4I 1HNXI 4LFBI 4DU8A 3V5RA 2A2CA 4Z7YA 1Z5CA 4FWGA 2O1TA 4JI3I 1N32E 1EA6A 2HFSA 1S16A 2UUBI 2HFUA 4DPWA 4FWHA 4JI1E 1ZM9A 4LF6E 2V2QA 2R42A 1ZXMA 4X62E 3Q6NA 4DR4I 1I94E 1Z5AA 4X62I 1RREA 1Z0VA 4LF6I 4LFAE 3PRYA 4LF5E 2CZ9A 4HACA 2HKEA 1IBLI 3PYEA 1N32I 2VF3A 4B3RI 1N33E 4DXLA 1XMOE 4DUYI 4RPFA 1B62A 4X65I 1EI1A 1MU5A 4JI4E 4DU7A 3WU5A 2E5LI 4FN5A 3K1JA 4B3SE 5A2QC 1XMOI 1N33I 1PKPA 4DV6E 2V2VA 4DR3I 1KIJA 1Y4UA 1J5EE 4X66E 3OTOE 5BR8E 4DR4E 4URLA 4DV7I 1ZM3A 5LMNI 4GKKI 4B3TI 1XMQI 4DV0E 5GMEA 2GS8A 2Z5BA 1IBKI 1HNXE 2ZM6E 4NXNE 2VQEE 4DV5I 4JI5E 1WUUA 3J80Q 3GONA 2UXCI 2UXDE 4PU9A 4KQVA 1Z0GA 3B78A 4LF9I 2Z5EA 2J7KA 1KKHA 2Z5BB 4DPYA 3Q6MA 1Z5BA 1NHIA 4PRXA 2R3VA 1Z0CA 4R1FA 4LF8E 4K0KE 3J80C 3V2UC 1HNWI 4DR2I 4OX9I 4YHHI 2UU9E 3LPSA 4LF4I 4DV4E 2LJPA 4DR1I 1FJGI 3J7AM 1VISA 3K85A 2AJ4A 1Z59A 2E1RA 2HHHE 4B3ME 2NPFA 1XNQE 4NXMI 2O1UA 1N36E 4LF7E 5IT9C 1H72C 5LMUI 3PYFA 4JG4A 1B63A 3T1HE 4UTGA 3J81Q 4X64E 4JV5I 2BV3A 2IOQA 2PNMA 4JI6I 1USVA 4DUZI 4JI7E 4DV3I 1XHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ E;  4JI6 E;  2A2D A;  4DR5 I;  4JI2 I;  4HAC B;  2UXB I;  4YHH E;  1N34 I;  1HNW E;  3PYD A;  4DV2 I;  3HUL A;  5L3J A;  4GKJ I;  4Z7C A;  3LNU A;  2V34 A;  1XNQ I;  4JI0 E;  1NHJ A;  2UXB E;  1FKA E;  1XNR E;  4LFC E;  1H74 A;  4JI0 I;  4NXN I;  4DV3 E;  5GMD A;  4FWD A;  1ZM2 A;  5LL6 R;  4WUC A;  1XMQ E;  1ELO A;  4DR7 I;  2UUA E;  2Q2E B;  4B3T E;  1A6F A;  3JAM C;  4EMD A;  3ZKD A;  4LF8 I;  4DR7 E;  3M6A A;  5BR8 I;  4P7A A;  4JI7 I;  2F4V I;  3QT5 A;  4AQY I;  2X36 A;  4HXZ A;  1KVK A;  1KTV A;  1MX0 A;  1XNR I;  4JI2 E;  4AQY E;  2F4V E;  2ZIT A;  3F0N A;  4DPX A;  2WW4 A;  5FLX Q;  1HR0 I;  1Z0T A;  4DUY E;  3QT7 A;  4XTJ A;  1H7S A;  3B8H A;  1FWL A;  4DV2 E;  4NXM E;  3T1H I;  2UUA I;  2BM1 A;  2HK3 A;  1N0V C;  3K17 A;  5LMU E;  1UEK A;  1NZ0 A;  1HR0 E;  2OI2 A;  3WU3 A;  4DV4 I;  2HHH I;  4HY1 A;  4LFC I;  3LTO A;  3J7A G;  4JV5 E;  4B3S I;  1FI4 A;  1PIE A;  4WUB A;  1HNZ E;  1OJ4 A;  1MG7 A;  4M1K A;  3ZM7 A;  4DR6 I;  1FNM A;  2DEJ A;  3ZZT A;  4GKJ E;  1PVG A;  4LF7 I;  5IT9 Q;  4HYM A;  2HKJ A;  4ED4 A;  1N34 E;  2V2Z A;  4DR5 E;  1Z0B A;  4JI1 I;  2VQE I;  3CWV A;  3QT8 A;  1FJG E;  3JAM Q;  4I3H A;  2UUC I;  4DR2 E;  4P52 A;  1N0U A;  4LFB E;  5FLX C;  2ZM6 I;  2DEI A;  2EFG A;  1Z0W A;  1IBK E;  4UT4 A;  1S4E A;  3ZKB A;  4YY3 I;  4DV1 I;  2XEX A;  1IBL E;  4WUD A;  4GKK E;  1J5E I;  1DAR A;  1K47 A;  4B3M I;  4X66 I;  3QT6 A;  4DR1 E;  4DR3 E;  4USK A;  1ZM4 A;  3T1Y E;  4LF4 E;  1U2R A;  4B3R E;  3D4J A;  1H73 A;  5A2Q Q;  4DV0 I;  4X64 I;  4MYU A;  4USM A;  4LF5 I;  4K0K I;  3PYG A;  4MYT A;  2VQF E;  1H7U A;  1I94 I;  2X7I A;  2V8P A;  1N36 I;  2UUB E;  3WU6 A;  1BKN A;  4LFA I;  4LF9 E;  4DV6 I;  4PRV A;  3J81 C;  3WU4 A;  1QZR A;  1RR9 A;  2E5L E;  3H4L A;  4JI8 E;  4X65 E;  3ZZ0 A;  2UUC E;  4JYA E;  4JI3 E;  1D6T A;  2ZBK B;  4FW9 A;  1FWK A;  3T1Y I;  2HK2 A;  2UU9 I;  4JYA I;  4ZVI A;  4OX9 E;  4JI8 I;  4KHP I;  1IBM I;  4DPT A;  1Z0E A;  5LMN E;  4DV7 E;  3B82 A;  3Q1Q A;  5IWA E;  3OTO I;  3ZZU A;  1ZXN A;  4DV1 E;  5IWA I;  4YY3 E;  2UXD I;  2UXC E;  4DPU A;  4DR6 E;  4JI5 I;  4DV5 E;  2VQF I;  1NHH A;  1HNZ I;  1IBM E;  4KHP E;  2BM0 A;  4JI4 I;  1HNX I;  4LFB I;  4DU8 A;  3V5R A;  2A2C A;  4Z7Y A;  1Z5C A;  4FWG A;  4JI3 I;  1N32 E;  1EA6 A;  2HFS A;  1S16 A;  2UUB I;  2HFU A;  4DPW A;  4FWH A;  4JI1 E;  1ZM9 A;  4LF6 E;  2V2Q A;  2R42 A;  1ZXM A;  4X62 E;  4DR4 I;  1I94 E;  1Z5A A;  4X62 I;  1RRE A;  1Z0V A;  4LF6 I;  4LFA E;  4LF5 E;  2CZ9 A;  4HAC A;  2HKE A;  1IBL I;  3PYE A;  1N32 I;  2VF3 A;  4B3R I;  1N33 E;  4DXL A;  1XMO E;  4DUY I;  4RPF A;  1B62 A;  4X65 I;  1EI1 A;  1MU5 A;  4JI4 E;  4DU7 A;  3WU5 A;  2E5L I;  4FN5 A;  3K1J A;  4B3S E;  5A2Q C;  1XMO I;  1N33 I;  1PKP A;  4DV6 E;  2V2V A;  4DR3 I;  1KIJ A;  1J5E E;  4X66 E;  3OTO E;  5BR8 E;  4DR4 E;  4URL A;  4DV7 I;  1ZM3 A;  5LMN I;  4GKK I;  4B3T I;  1XMQ I;  4DV0 E;  5GME A;  2GS8 A;  1IBK I;  1HNX E;  2ZM6 E;  4NXN E;  2VQE E;  4DV5 I;  4JI5 E;  1WUU A;  3J80 Q;  3GON A;  2UXC I;  2UXD E;  4PU9 A;  4KQV A;  1Z0G A;  3B78 A;  4LF9 I;  2J7K A;  1KKH A;  4DPY A;  1Z5B A;  1NHI A;  4PRX A;  2R3V A;  1Z0C A;  4R1F A;  4LF8 E;  4K0K E;  3J80 C;  3V2U C;  1HNW I;  4DR2 I;  4OX9 I;  4YHH I;  2UU9 E;  3LPS A;  4LF4 I;  4DV4 E;  2LJP A;  4DR1 I;  1FJG I;  3J7A M;  1VIS A;  2AJ4 A;  1Z59 A;  2E1R A;  2HHH E;  4B3M E;  2NPF A;  1XNQ E;  4NXM I;  1N36 E;  4LF7 E;  5IT9 C;  1H72 C;  5LMU I;  3PYF A;  4JG4 A;  1B63 A;  3T1H E;  4UTG A;  3J81 Q;  4X64 E;  4JV5 I;  2BV3 A;  4JI6 I;  4DUZ I;  4JI7 E;  4DV3 I;  1XHK A; 
#chains in the Genus database with same CATH topology
 2VOO A;  4DUY I;  2MZQ A;  2ZDP A;  4F4A A;  1HBN A;  3PW2 A;  4MK7 A;  1U6B A;  1DLO A;  2BA9 A;  2A2D A;  1OS5 A;  1URR A;  5M2U A;  2VOD A;  4KSE B;  2NCK L;  3ZZY A;  1HK7 A;  2QGF B;  4QQB A;  1UDS A;  2O1W A;  3MOZ A;  5ETP A;  2QE5 A;  4RU2 A;  4NRU A;  4NLD A;  4QU7 A;  2CJ9 A;  1RWV B;  2BKN A;  2MZJ A;  1SKS A;  2MQ8 A;  5F8M A;  2E9Z A;  3GCM A;  2PO0 B;  1S1T B;  1FTR A;  4YR0 A;  4PYD A;  1YJV A;  2YNH A;  3OTE A;  2RHQ B;  1JJ2 R;  3DMJ A;  2ZJP Q;  4IFY A;  4DR3 F;  4GKJ I;  4E0D A;  3MPY A;  2GV1 A;  5CD4 H;  3M2U B;  4PWD B;  2DCU B;  2JX2 A;  1SIW B;  1WD6 A;  1FX4 A;  2BAC A;  3OW2 R;  4WP3 A;  1R8C A;  1XMB A;  2FUG 9;  2LU1 A;  3DLE A;  1IKX B;  3J80 U;  5HLF B;  3CJ3 A;  2DR9 A;  4LFC F;  1X5S A;  2XSJ B;  3BQ0 A;  3PRV A;  4H4O B;  2LCW A;  2MKK A;  3GFH A;  5DZ6 A;  3R7S B;  2FVP A;  3GMG A;  1NHJ A;  1TQL A;  1UDN A;  1FKA E;  2FY8 A;  3WX8 A;  4LFC E;  4B3R F;  3MCS A;  2QC3 A;  2W01 A;  3MHY A;  4KO0 B;  4JI0 I;  1HPZ B;  3QIP B;  2C38 B;  1KEK A;  3OR2 B;  1VRQ C;  2GAG C;  1LWF A;  1S1U A;  2GHV C;  4LR8 A;  4WP9 A;  2OH2 A;  4KFB B;  1CJU B;  1XN9 A;  3KK1 A;  1J2V A;  1RT2 A;  1URN A;  3SCI E;  3QJP A;  2BA0 D;  3PJX A;  1RAB B;  1Q0N A;  1UFL A;  3TA2 A;  3OV7 A;  1JLF A;  2ZDO A;  4Q8F A;  1ZM2 A;  2BYC A;  2QZ8 A;  3AOC A;  2Y9H A;  3BGR B;  2QA4 S;  5BR8 J;  2W4P A;  4RNH A;  2DHH A;  3U7J A;  3HVT B;  4WUC A;  1ELO A;  4O4R A;  1T05 B;  3HT3 A;  2YH1 A;  2VFU A;  1RDR A;  3ULH A;  1GMW A;  2GQQ A;  5KFM A;  3BQ1 A;  3NMR A;  4JYA F;  4CYU A;  4N8O A;  3PS1 A;  2BEF A;  2GQ0 A;  1T3N A;  2ALY B;  1UAW A;  2FJX A;  1GMV A;  4WE1 B;  3SBM A;  5ITH A;  4K5R A;  3OVS A;  1HNV B;  1WHY A;  2XMT A;  4U67 Q;  3EE3 A;  4IFD F;  2MXY A;  1U0H A;  2Z0G A;  1SIZ A;  3AHP A;  3L95 X;  3RBZ A;  3W8P A;  1UDO A;  2V94 A;  3HD2 A;  4R0J A;  4C8N A;  5LSO A;  1AT1 B;  2Y1J A;  2FC9 A;  2W25 A;  4JP8 A;  1T3O A;  1HPZ A;  2DGX A;  3AT1 B;  3BM7 A;  3DNC A;  2ATL A;  2Q66 A;  4A8Q A;  2CG9 A;  2WP8 A;  4AQY I;  1HQE A;  1KTV A;  3NBP B;  4NLU A;  1MX0 A;  3S1T A;  2ZNY A;  1IWA A;  2FLL A;  1V5V A;  3ADA C;  1GMW D;  3B54 A;  4ED0 A;  4LFA F;  1QSL A;  2HVH A;  2DRD A;  2DRB A;  4AQY E;  2CNK B;  4F4X A;  1S6P B;  2LEA A;  1NLK L;  1S59 A;  3F0N A;  2OFG X;  2WW4 A;  3LAK A;  1UA0 A;  2Q6C A;  4ZVH A;  3UFC X;  2UUC J;  3E2E A;  5JEA E;  5DG9 A;  4FS1 A;  3QT7 A;  5KT3 A;  1Q7L B;  4U6P A;  1UVL A;  4F0M A;  1Y4Z B;  1NJY A;  2ZZN A;  5C0X A;  4RW7 B;  1WWH A;  4NPO A;  1WHW A;  3ITH A;  4CLU A;  4C9D A;  2D9O A;  1WKK A;  2OAU A;  3N5B A;  4OX9 J;  4LF9 E;  3U1M A;  4DJB A;  1WDD A;  3G87 A;  2AX1 A;  5BXI A;  4GRS A;  4NXM E;  2W7P A;  1U24 A;  4ED8 A;  4DQQ A;  3P3E A;  3KLF A;  4B17 A;  2F9J A;  1YI2 S;  3EPI A;  2MZT A;  3SSQ A;  3HSG A;  5HO4 A;  3R7N B;  2J9C A;  4TU7 A;  1SL0 A;  2UVU A;  4JV5 J;  4OO1 E;  1EB0 A;  2H5J B;  2VG7 B;  4DUY J;  4DQP A;  1NKC A;  2QLB B;  2VG6 A;  4RW8 B;  4HT5 A;  3O2I A;  1MLA A;  4CM2 A;  3OLA A;  5IOL A;  1NPR A;  4W90 B;  1HR0 E;  3TAQ A;  3F44 A;  2QEX S;  2HS0 A;  4ZN1 A;  4OKG A;  2OD6 A;  2ZBQ A;  3KMS A;  4F26 A;  4OIX A;  1XXE A;  3WU3 A;  3QO9 B;  2RU9 A;  3PZP A;  3NXZ A;  4NA2 A;  2YNG B;  3LWM A;  3NCP A;  1VHI A;  5JEA D;  2KG0 A;  3J7A G;  2O1P A;  1PYS B;  4ED1 A;  2GJI A;  2Y0B B;  2LLZ A;  3HMJ G;  2J0X A;  3MEE A;  1UJ6 A;  1OYE A;  3HFZ B;  4DV6 F;  3CJS A;  2GO3 A;  4X2B A;  1WAC A;  2XS2 A;  1ZBT A;  1HNZ E;  1OJ4 A;  1MG7 A;  1NDK A;  4M1K A;  2ZBR A;  4M5K A;  1VIO A;  3LP0 A;  1Q8I A;  4AUK A;  3V6D A;  1YQH A;  2OPP B;  4DZD A;  3JSY A;  2QX0 A;  1FNM A;  4ZVG A;  2GML A;  4WIQ A;  4O3P A;  5D4N A;  2J5A A;  3T5J A;  1ROF A;  3I5B A;  2IM3 A;  3CE8 A;  2ZUA A;  1RLC L;  3CJR A;  2CPF A;  2B43 A;  1WEL A;  2WW8 A;  3KFW X;  3W66 A;  4AFF A;  1CJK B;  3LQV A;  2RE1 A;  4PCQ A;  3RRG A;  5JJB A;  1SC1 B;  1RT4 A;  1KRP A;  2MLX A;  4RW6 A;  2NQP A;  3LH2 S;  4UOF A;  1N34 E;  4GC7 A;  3JS9 A;  1HNZ J;  4WZM A;  1PC5 A;  5CYJ A;  2ZH5 A;  3P49 B;  3CJ5 A;  1LK5 A;  4TU8 A;  4ED3 A;  2FD2 A;  3KLG B;  1SL2 A;  4ZPV R;  4L76 A;  3KLH B;  1SQE A;  1Z0B A;  1FKP B;  1S9G B;  3PXG a;  3UPF A;  1RHU B;  4V1A k;  3GV7 B;  4ECR A;  1XTZ A;  4QWA A;  2HZV A;  1B0V A;  3CWV A;  1WSV A;  2NR0 A;  1K73 T;  3QT8 A;  5J2N B;  4WWS A;  4DUZ J;  2PO2 A;  1FJG E;  2UUB F;  1TL1 B;  2BR0 A;  1OYP A;  3JAM Q;  5KFV A;  4ZLN A;  5KFK A;  4DF8 A;  2R8I A;  4I3H A;  3HKW A;  2G2Z A;  3VV2 B;  1H6K X;  1T9T A;  3RRK A;  2XYG B;  1RHK B;  4I6A A;  1IBC B;  5D0G A;  1N0U A;  4DR2 E;  4LFB E;  1RU2 A;  2IYG A;  3MWB A;  5HQ8 A;  1HHS A;  2HYI B;  5FLX C;  2YKQ A;  2C2R A;  2I1R A;  2K7K A;  2ZM6 I;  3ISZ A;  2DEI A;  3KLE B;  2MKY A;  2NLW A;  1IJE B;  2EFG A;  1BWV A;  4IKA A;  1VC6 A;  1KWM A;  2V63 A;  2VPX B;  4EO6 A;  1FKA F;  2XMJ A;  4UT4 A;  2ILY A;  2FLP A;  3K2Y A;  2DH9 A;  4NLT A;  5D4L A;  4YY3 I;  2UVW A;  1VBK A;  1HD0 A;  4KHM A;  4ZDN A;  3D67 A;  3DU5 A;  2CQG A;  4I0W A;  4PEO A;  4ZP9 A;  3JAM U;  2AT1 B;  3RR8 A;  4WUD A;  4Q2M A;  4K2J A;  1N56 A;  1HQ2 A;  2G4B A;  3IR7 B;  4OX7 A;  5A8K B;  2ZHA A;  2HFN A;  1P1L A;  2JVO A;  3FSY A;  3MM7 A;  5BR8 F;  4B3M I;  2H3E B;  3H0P A;  4A8S A;  2VB6 A;  2VOP A;  4OHZ A;  1LV5 A;  1S1V B;  2KJV A;  4NRT A;  2XS5 A;  4ZHR B;  5J1E B;  4BWM A;  4Q0B A;  5DLF A;  2ROP A;  1UEV A;  2HFZ A;  1WTB A;  3FBE A;  3GSD A;  4DR7 F;  2VJV A;  1QM9 A;  2HNY A;  2J76 E;  1F9F A;  3DYA B;  3IGV A;  3K5P A;  3NGS A;  3NNC A;  4MU0 A;  1KFD A;  2DNG A;  1A7G E;  3T1Y E;  2QA1 A;  1B0P A;  1DY3 A;  3D4J A;  2FHM A;  3THV A;  4JI8 F;  1TVR A;  1H73 A;  4HHJ A;  2UUB J;  3P3G A;  1Q78 A;  4DV0 I;  3R5C A;  2P2C B;  3I31 A;  2R7W A;  1HBU A;  4Y3C A;  3ENW A;  4TY8 B;  2DIV A;  4LVO P;  4CT8 A;  5KG7 A;  1SKW A;  4FW7 A;  1WSR A;  1Y00 A;  4O23 A;  4DX7 A;  4USM A;  1G1X A;  3DDN A;  2XUL A;  2VQF E;  3V4M A;  2F65 A;  4CLF A;  3EGZ A;  1T7P A;  1JLC B;  2GQC A;  3X1L B;  5DRP A;  3IS9 A;  3IP0 A;  4PAA A;  4DSF A;  1U8W A;  1REV A;  2LU2 A;  4MKV A;  2OPS A;  3VF0 B;  1KC8 T;  2MKC A;  2CQP A;  3CVK A;  3VAI A;  4DR3 J;  4CWB A;  2X7I A;  3JTN A;  3RTV A;  2V8P A;  1LWE B;  2OMO A;  2G13 A;  1SC3 B;  4UY8 5;  1BC6 A;  1NK9 A;  1Y0H A;  3LOU A;  2UUB E;  2CKW A;  1IXK A;  2BJ8 A;  2CDR B;  1S77 D;  3CO9 A;  2G1H A;  3GME A;  3TJ9 A;  2HHX A;  4LBI A;  2HND A;  4FKX A;  1VK8 A;  2MQQ A;  1KQS R;  2WRM A;  4RBU A;  5DGB A;  3R5D A;  3U1Y A;  1LOU A;  2Y0S D;  3J81 C;  2HQ3 A;  2GO4 A;  5CAB A;  2CZV C;  3W62 A;  5J2P B;  2LFV A;  4BC9 A;  1I94 F;  1QUV A;  2AU0 A;  2JFK A;  4FW6 A;  2M52 A;  4IFV A;  3DHW C;  2BAN B;  3H4L A;  2LKZ A;  2VU5 A;  1FES A;  2ASD A;  3L7P A;  3ZZ0 A;  2IJR A;  4HL9 A;  3K58 A;  1XMQ F;  3EGV A;  2YBV A;  3TUP A;  2ZBK B;  1CUL B;  4DR5 F;  4ITS A;  2UP1 A;  3R3T A;  5AXN A;  1D9A A;  3GIJ A;  4IFD A;  3C14 B;  5ETR A;  2YWW A;  4UQT A;  1DTT A;  2BAN A;  3UQS A;  4OX9 E;  2K3K A;  4WFB Q;  2CXE A;  3BZQ A;  3MPU B;  5HMY A;  2VBY A;  2UVV A;  4KHP I;  4USJ C;  3A8K A;  4AXJ A;  3Q22 A;  1SH2 A;  3C19 A;  1O8B A;  1FK9 B;  3W5X A;  4J90 A;  5A8W B;  5DG8 A;  1Z0E A;  1VFJ A;  2HWH A;  2E5L J;  3TAP A;  4K59 A;  2OLW A;  4DV7 E;  4DFJ A;  2VFR A;  2DD8 S;  1CJV A;  2DHS A;  3WC0 A;  1DBD A;  2D3U A;  3A8I A;  1C0U A;  1NDP A;  1KQK A;  3BB5 A;  3TZX A;  2ZBC A;  5KT2 A;  3BR8 A;  3CMQ A;  4ZKA A;  3TI0 A;  1XNQ J;  2B4O A;  5CD4 A;  2AYM A;  4F3Q A;  1S48 A;  4C11 B;  1IKW A;  1N36 J;  4E98 A;  4ZPB A;  2YNI B;  4DSE A;  2YWE A;  3CCJ S;  5KOW A;  2YVS A;  4TNO A;  4WFX A;  4WTO B;  1E6Y B;  1YTY A;  2EK6 A;  2UXD I;  5K36 E;  3EZU A;  2YWG A;  4DPU A;  2E5L F;  2B5J A;  3W2W B;  4NA3 A;  2GJF A;  3HLU A;  4O3N A;  3TJ8 A;  2VZ9 A;  3UN2 A;  5FLX Y;  1PO6 A;  1WF0 A;  4ECV A;  3DLG B;  4F2R A;  3M32 B;  5C0X D;  4TY8 A;  1HIY A;  4JI4 I;  3BO2 A;  3MOJ B;  1YRX A;  1HNX I;  1VK3 A;  2ZH1 A;  4DPO A;  3RUB L;  3V5R A;  1Q5V A;  1TVR B;  5E33 A;  5JVG Q;  3P45 B;  1YBU A;  1FEH A;  1YBA A;  2QFI A;  4QJV A;  2ZJR Q;  2M8H A;  3NGU A;  2EG1 A;  2QTW A;  3PJW A;  3ETM A;  1PJ7 A;  2MJU A;  4LQ9 A;  2IC3 A;  4M5M A;  3CF5 Q;  3W60 A;  4NEY A;  4OZJ A;  3JYT B;  1N32 E;  2Y1I A;  3KHL A;  2R8H A;  1LWX A;  2CAD A;  1DZ5 A;  1C2P A;  3M05 A;  1LK7 A;  3JQJ A;  1EP4 B;  2XMU A;  3T6J A;  4BA1 A;  1WNE A;  2UUB I;  1S1V A;  1ZM9 A;  5T7L A;  3AOB A;  1FDA A;  4F04 B;  3HZG A;  2J6T A;  2F7V A;  2HGM A;  2R42 A;  5ETT A;  3MMC B;  4O0I A;  3Q6N A;  1I94 E;  1Z5A A;  4ZS6 A;  2L48 A;  2VC1 A;  4XPC A;  1RRE A;  1JJC B;  4NYZ A;  2KB2 A;  3I0R A;  3TA0 A;  4ZLJ A;  4DL5 A;  4ZVT B;  5D8H B;  2FPH X;  4P7T A;  1QLN A;  1S12 A;  1Y10 A;  1Q53 A;  4OZ1 A;  2RUS A;  4MAK A;  4HTI A;  5KOX A;  2YPY A;  2D3O 1;  2FJV A;  3PYE A;  3DLB A;  3HX9 A;  4B9U A;  2DGV A;  1KR4 A;  1RGV A;  2DKO B;  3ZXW A;  5KFP A;  1N48 A;  2G1D A;  1EQ0 A;  4G3I A;  3BN7 A;  4JI4 E;  1MNE A;  2V68 A;  4CLL A;  3WU5 A;  1NU4 A;  2BUN A;  4FN5 A;  4NLO A;  2DNP A;  2BR2 B;  1XNQ F;  5DET A;  2E5L I;  4JV5 E;  1UET A;  3SCL E;  1F3F A