2WW5A

3d-structure of the modular autolysin lytc from streptococcus pneumoniae at 1.6 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
431
structure length
431
Chain Sequence
b'AAAYWDGDYYVKDDGSKAQSEWIFDNYYKAWFYINSDGRYSQNEWHGNYYLKSGGYMAQNEWIYDSNYKSWFYLKSDGAYAHQEWQLIGNKWYYFKKWGYMAKSQWQGSYFLNGQGAMIQNEWLYDPAYSAYFYLKSDGTYANQEWQKVGGKWYYFKKWGYMARNEWQGNYYLTGSGAMATDEVIMDGARYIFAASGELKEKKDLNVGWVHRDGKRYFFNNREEQVGTEHAKKIIDISEHNGRINDWKKVIDENEVDGVIVRLGYSGKEDKELAHNIKELNRLGIPYGVYLYTYAENETDAENDAKQTIELIKKYNMNLSYPIYYDVENWEYVNKSKRAPSDTDTWVKIINKYMDTMKQAGYQNVYVYSYRSLLQTRLKHPDILKHVNWVAAYTNALEWENPYYSGEKGWQYTSSEYMKGIQGRVDVSVWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1,4-BETA-N-ACETYLMURAMIDASE
publication title Insights Into Pneumococcal Fratricide from the Crystal Structures of the Modular Killing Factor Lytc.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 132
structure length 431
sequence length 431
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
A PF01473 CW_binding_1 Putative cell wall binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ww5A02
1VBUA 2J77A 3VD9A 1BYCA 2ZUUA 1ECEA 3PZGA 1UWQA 3VMNA 5HDRA 3ZMRA 3CZ8A 3L2MA 3UG5A 4GZIA 5DF0A 4M82A 1CXLA 1CLVA 3L4VA 1BG9A 3FAWA 1V6WA 4HP5A 3JUGA 4MADA 4PMRA 3BAKA 1E15A 1E9LA 3BAIA 1H4PA 1C3FA 4FLRA 3W53A 4AW7A 1Q6EA 3IAQA 2ZX7A 2WVUA 3VPLA 1W9BM 7TAAA 2D0HA 2X0YA 4PMVA 3DYOA 4P7OA 1CWYA 4PYSA 1CLXA 4AIEA 1JAEA 4DM1A 4F8XA 2ZE0A 3BSHA 1EA9C 3CLWA 1R87A 1F4HA 1UD8A 4Z2IA 3QGVA 3TONA 1XHGA 5EB8A 1UHVA 2GJPA 2O9RA 1MFUA 1LLOA 3OLEA 4D1IA 1ZU8A 1UKQA 5I77A 1FP9A 1QNSA 1J0IA 1EO5A 4AZGA 3CHDA 3VMPA 2VX7A 3A4AA 3AMKA 2YKKA 3AHYA 3HN3A 3WQVA 3WUBA 2XWDA 3N12A 1J0ZA 1FP8A 2WSKA 1B90A 5CPSA 1XC6A 3OBAA 2D2OA 2GSJA 5A6JA 3GH7A 3EMZA 1W1VA 5JUVA 2XYLA 4YN5A 2WZIA 2W4XA 4LYRA 3A4XA 3UG3A 1OIFA 2F61A 4M8UA 4AZIA 4QDMA 3VU2A 4Q7NA 1GONA 2GJXB 4PMUA 4MJ4A 3POCA 1NOUA 1SMAA 2E3ZA 2BY1A 3WQWA 4HOXA 1V0KA 3ECQA 1WZLA 3WKZA 2WVSA 1OGSA 1X6LA 1TUXA 4ZXLA 4IUGA 4BCEA 4ATLA 1BG4A 5M5DA 1W9PA 1KXQA 1GHRA 4CVWA 3AXHA 4ZFMA 2V3FA 3L2LA 1JYNA 3MSDA 3WUEA 1JZ4A 2BFGA 2QV4A 4HA4A 1HKJA 2V38A 3WNOA 3OLGA 5CGTA 1EQCA 5A8OA 4J7RA 5D9NA 1QI4A 2DT3A 1VIWA 4CD6A 2J78A 3N1AA 4E8CA 3AYSA 1PBGA 2ZX5A 4GI8A 3VIFA 4OKDA 2TAAA 4R5EA 5BXPA 5E70A 3O9NA 1DEDA 3LMYA 1BGAA 4FMVA 4BQ3A 3WIJA 4AEFA 3CZGA 2ZXBA 4OBRA 2BXZA 4MB1A 3SCVA 3QOMA 3WNLA 1QNOA 2XPKA 3IAPA 2XSBA 1G01A 4HA3A 2XGIA 2BVDA 3POHA 4PMQA 2FH6A 4U2ZA 1H0GA 5I3DA 3TTOA 3U5YA 2WZHA 4D6EA 2YIHA 3TP4A 1BHGA 2AAAA 2W61A 1BF2A 2XVGA 3TTYA 3CUFA 3WDHA 2E9MA 1UD2A 1AVAA 4P7NA 5FL0A 4OJYA 2XVLA 5AYIA 1QOXA 4AD2A 3CO4A 4UCFA 2F2HA 3NCOA 2FGLA 5JBDA 4GKLA 3VIPA 4HU8A 1O7AA 1XSKA 5HNNA 4JFWA 4HOZA 3QOKA 5C70A 5GNXA 3WNKA 5D8ZA 1MW2A 1B9ZA 3PTMA 4JFSA 2FHCA 2WVVA 2VJXA 3F5LA 3I3DA 2UY3A 4HPGA 5ABGA 4Y7EA 2YDRA 1KWKA 4FK9A 5KZ6A 1B30A 4W7VA 2EO7A 3NJ3A 4J3XA 4EKJA 2PWHA 1UA7A 5CZKA 3I3EA 3SUSA 1G0CA 1GCYA 2JIWA 5I5RA 4AZBA 1W1PA 4GQRA 4U31A 4UQCA 2PWGA 2ZXAA 1L0PA 4AEEA 5ECUA 4Q22A 1VF8A 1YHTA 1H5VA 2WC4A 3CZEA 4AD3A 4OBSA 3ARXA 4W8BA 3PZUA 3TTSA 1LQ0A 2V3DA 4U5KA 1NM9A 1Q6DA 1UKOA 2ZIDA 1QPKA 1E6PA 1KQYA 1W9DM 3UR8A 3ZJKA 1C93A 1TG7A 1NP0A 2D0GA 4W5UA 1TR1A 3ZT6A 3WH8A 2GVYA 2ZICA 2ZX8A 3PZVA 1LWHA 1ZBWA 4GZJA 1UR0A 3AISA 3FY1A 5FIPA 4CD4A 1H2JA 1QBAA 2VUYA 3WDPP 4P7RA 3K8MA 1JI2A 4GIAA 2OWCA 3AZSA 2DEPA 1JXJA 3ARQA 4D6CA 3NDZA 3VO0A 3BCDA 1FA2A 3DYPA 5D8WA 1MFVA 2ZWYA 3FW6A 2DSZA 4MJ2A 4X0NA 3WN6A 4QFUA 3ARPA 3CUJA 4AIOA 1V03A 1U33A 2J25A 5FKYA 2V5CA 1JI1A 2XIBA 3BLPX 1JZ5A 3OLIA 1AQ0A 1B0IA 1XD0A 2BXYA 3VGGA 2WNWA 3J7HA 4YHGA 1UA3A 2WBKA 1J0KA 1QVBA 3VMOA 3VUPA 1GQLA 2X0HA 1DWJM 2VRKA 1K9TA 5CJ5A 5JIPA 2FGZA 5AC5A 4AD1A 8CGTA 4UFMA 3WY1A 3S6TA 1K9FA 4AZHA 4CD5A 5A94A 3OGRA 2VQUA 3BGAA 1ISVA 1VFUA 1QI0A 2WM0A 3O2LA 5A3HA 1DWGM 2GDUA 1HX0A 1C7SA 2CKRA 2EBNA 1WB0A 2ZUVA 3EDEA 1GVYA 3KL5A 5FL1A 1UQYA 2WVVB 3W24A 1GOMA 5EFDA 4H7VA 3SCPA 3RILA 1EGZA 1QI5A 2Y8KA 2CHNA 2WHJA 2VL4A 4KWUA 2EQDA 2Y5EA 3T2PA 1D7FA 1EQPA 2DH3A 2PWDA 3BC9A 1S46A 1Q6GA 2VURA 3GBEA 4U3CA 3APGA 2WHLA 1Q6CA 3LPOA 4AYSA 3AHXA 4N42A 4PBGA 5A6KA 3VIKA 1OIMA 3W82A 4WJXA 2VX6A 1JYVA 1N82A 2J8GA 2CBVA 2ZWZA 4GI6A 1PEZA 1BVNP 4WKFA 5A2CA 1CECA 2CBIA 2A3AA 2VT0A 1TVPA 1V3HA 3CTTA 2DSUA 5I23A 1VJZA 1W3HA 3A47A 3WF0A 1V6VA 4C7DA 2D0FA 1JL8A 1M04A 2G8ZA 4BQ4A 4CN6A 2VZTA 1C8XA 1CYGA 2Z1KA 2BHZA 3W38A 4DUXA 1SFSA 1CNVA 1UQZA 1TVNA 2FH8A 2OSWA 3M07A 5A69A 1VFOA 3WD0A 4LXFA 3AXXA 4WF7A 4H8HA 1HJUA 1GZJA 3WF4A 3L4WA 1RPKA 3VKKA 4AC1X 3NSNA 3WNMA 4L4OA 3SEPA 2E0PA 4D72A 1B2YA 4CUCA 4W93A 3TOPA 3BMWA 4RL3A 1VRXA 3UERA 1V3IA 4W7WA 3VILA 2Q8XA 4MB5A 1UUQA 4OIFA 4U2YA 2WHKA 2NT0A 5A2AA 2A3EA 3VIIA 2YA2A 2EPKX 1MQPA 1HJSA 4HZ8A 1CGYA 3VM5A 4EANA 3CPUA 1I75A 2BHYA 2FHFA 3B9AA 3O6AA 3WDIA 3G6LA 2JIEA 1LF1A 2D23A 3KL3A 3T0BA 1D2KA 5E6ZA 2W67A 1KBKA 4Z2KA 1OM0A 2DGAA 2X09A 1BFNA 1IZJA 3ARWA 1W2PA 4W8AA 7A3HA 1KGWA 3N9KA 1B3XA 4PMDA 3MUIA 4TTGA 1E73M 4A3HA 5C71A 1GQIA 2XIIA 5I24A 4QLLA 4B9ZA 5EFFA 1W9UA 3AHTA 3VTRA 1JD9A 3AIUA 2J7FA 4W87A 2WBGA 4GO8A 2ZX9A 5E9AA 1HJXA 1UR9A 1W3JA 4GXPA 3RDKA 4W7UA 3VIMA 3CUGA 2G3NA 3W4RA 4AMCA 3KEHA 1VENA 2MANA 5D4YA 2QMJA 4PCSA 2BY2A 4EE9A 1QHPA 3VNZA 4RE3A 3VDBA 4HMCA 1FH8A 4IPNB 4IISA 3CHCA 4J27A 4H8UA 4V2XA 5CSYA 3WDJA 2IUZA 3SCSA 3GNPA 4HU0A 2VX5A 1PX8A 2E40A 2J62A 3EBVA 1KB3A 5M03A 3THCA 2W5FA 1C91A 2EPOA 1ODUA 5AY7A 2JE8A 4LYPA 1V02E 5CPTA 1E70M 4QCFA 1G94A 4RE4A 4J3WA 4PSRA 3AS1A 3ZT5A 3CUHA 3KE0A 2CEQA 2G3JA 1XRVA 3AFBA 4WKAA 2WVTA 4D1JA 4QAWA 4Z2GA 1LL6A 1UR1A 2BV9A 2UY2A 2W62A 5JBEA 3B9DA 4CCDA 4HOWA 1D3CA 1JF6A 3AROA 2X1IA 3M6DA 3ARVA 4P8XA 2ESCA 4LQ1A 1IV8A 5BRPA 2HVMA 1EDTA 1K6AA 4CU8A 1ISXA 1MQRA 3IANA 2D22A 1CDGA 2ZUTA 2J8FA 3OGVA 4MTVA 2AMGA 1TMQA 1Q4NX 3F5JA 4LYQA 3ZIZA 2WZEA 1JYWA 1NWSA 2WAGA 3WL0A 5GNZA 2WCSA 2DT0A 1QW9A 5I78A 2ZUMA 1C8YA 4PMXA 1DWIM 3LPFA 4D6IA 5IFPA 1GOKA 1RP8A 4UOJA 2VCBA 4EK7A 5KEZA 1KXHA 1PAMA 6A3HA 1HXJA 2BNJA 2VZUA 4JCLA 4CCEA 1OB0A 3AHVA 5DFAA 2BHUA 5A6MA 2DH2A 3K4DA 4ATDA 4CGTA 3AZRA 4JKKA 4P8WA 1HIZA 2VO5A 3AICA 3CZLA 4QP0A 1H41A 1HL8A 4FLQA 2VRJA 1B3ZA 4JKLA 1W91A 3RMEA 1QW8A 3U57A 3EDKA 2YL6A 1MXDA 3ZJ8A 3WQ8A 1FHDA 1HN1A 2WPGA 3AQUA 5CQ1A 4KRTA 1B1YA 3WNNA 5A6BD 3VD4A 4LX4A 2J7DA 3ZSTA 5A95A 3WSUA 5ABEA 2B31A 2Z1SA 2VTFA 1E5NA 4M1RA 1K9EA 2WB5A 4WSKA 1BYBA 1E55A 3GH5A 2EXOA 3I3BA 2C0HA 4PUEA 3RM4A 3WD1A 4PCTA 1CXHA 3EMCA 1R85A 3T2OA 1CTNA 3W6MA 4Z2JA 4TX6A 4P8UA 1QHZA 2BY0A 3GDBA 3UEQA 5LA2A 1BSIA 1LL7A 3T0AA 4J3UA 4U33A 1R8LA 1CGUA 1W3LA 4FF5A 3EDJA 4UQEA 3VM7A 5A8NA 3N11A 1UH2A 1UD4A 1OBAA 3MU7A 1DHKA 4GI9A 3WH7A 4CU6A 1JZ6A 3GYCA 1DTUA 2PF0A 3ZJ7A 2ZUNA 1NH6A 3L4ZA 1VBRA 1QHOA 4BZYA 5E6YA 3MMDA 1H0IA 2YL8A 5DT7A 2BY3A 1HKKA 1XGZA 3GBDA 1C92A 4JKMA 2JF6A 1CPUA 5LA0A 3AZTA 5A2BA 1H49A 4PTMA 1OINA 1RP9A 5E09A 8A3HA 3ARZA 2J7BA 3UETA 5BXTA 3K46A 3PZMA 5I6SA 1A3HA 3K8LA 4K68A 4ATWA 1PPIA 3BCFA 2OYLA 2VVSA 4U3AA 4IM4A 3M7SA 1R7OA 2V3EA 5I2UA 3PZ9A 3A6OA 1EOKA 1OT2A 5LYRA 1UKTA 1WDQA 1KCLA 2PB1A 3ARYA 1GHSA 2C7FA 4UQBA 4S3KA 2AOSA 1NWRA 1JNDA 1F4AA 2E8ZA 3BAJA 3AIRA 2WWDA 3DHPA 4MNJA 1VFFA 3SCUA 3WFZA 1KXTA 2OWXA 4TXEA 2XVPA 4NF7A 1CEOA 5IDIA 4M24A 1UR2A 2XSAA 3OZOA 1XH2A 2WMFA 6CGTA 3WF3A 2O9PA 4W89A 4JAWA 4D6JA 3IJ9A 4WSJA 3RCNA 1CBGA 3GXMA 1CGWA 2OSYA 4PN2A 3OB8A 3EMQA 1WPCA 3AS0A 1HJWA 1FH7A 3SURA 3AIQA 1JZ7A 2YDQA 3CZJA 3GTNA 1G9HA 2YL5A 5CLWA 4UFIA 5HOSA 5GQBA 1UKSA 2IXUA 5BXSA 1BYAA 2XG9A 5AC4A 1E6SM 3WNPA 3WUGA 1VEPA 3SUUA 4XB3A 4UFKA 2QPUA 4AZ6A 2OWWA 1HP4A 2CPUA 2ZOXA 3DECA 4ACYA 1X6NA 5A6BA 1KGXA 2V3GA 1JFHA 4B3KA 4PRWA 1CIUA 4JHOA 3ZOAA 1B3VA 1TE1A 3QHMA 1WE5A 4XV0A 5HBFA 1E4NA 1ZBVA 2BVYA 4A3YA 2X8RA 1E5JA 1LG2A 3ARRA 1Q6FA 2WC7A 4W86A 1UWTA 1J11A 3QR3A 1E3XA 1SYTA 4WLCA 2VVNA 2Y8VA 2WKLA 3B9EA 1TA3A 1VAHA 2VNCA 4DWSD 1WCGA 4MDPA 2ZXDA 3HMCA 3QHOA 4EAMA 4KGLA 3E1F1 3ALFA 1JDAA 1E56A 1FFQA 2UY4A 4NZCA 1PX4A 1IZKA 1E0XA 2YA1A 2VQTA 4IPLA 1EOMA 4J3VA 4GINA 4QLKA 1BVZA 3GM8A 1US2A 5BCAA 3VDHA 4TTUA 2JF7A 4PSPA 3RO8A 4MAZA 3MUY1 4B9YA 1JG9A 3NSMA 3N04A 5ABFA 2DSWA 1XCWA 2JEPA 1QBBA 1ISWA 1JZ3A 1E3ZA 4M80A 4PMYA 4N0RA 3VIOA 5I79A 2WW5A 1NWTA 1AQMA 1X1NA 1TCMA 4QCEA 4ZENA 1HL9A 3W28A 5FOOA 1ISYA 1LG1A 2WKGA 1BGGA 1AQHA 2W66A 1KBBA 3WQ6A 4OUEA 3VD5A 5D9MA 1W3KA 1C90A 3ZR6A 1J0YA 1ESWA 2EPLX 1V02A 2D24A 2E4TA 4JFTA 2ZUWA 1QI3A 2CYGA 1NARA 3CZKA 3FXYA 1BTCA 1CENA 3FHQA 4UQDA 4CKQA 1AMYA 1KR1A 3WMSA 3VNYA 5BROA 3CH9A 3EYPA 4MB4A 3MKKA 5CSUA 4R27A 3SCTA 1EDQA 2DPEA 3VOCA 4LPCA 1EHAA 3W27A 4CU7A 3CIVA 1GUVA 3ZO9A 3GNOA 1NP2A 4PTXA 3BH4A 3AI0A 4M56A 3VVGA 3FAXA 3RJXA 2CBUA 3K4AA 4AY1A 3WENA 4FLOA 2XWEA 5CPQA 3PTQA 3FN9A 1VEOA 3WBAA 1UYQA 4J3SA 4C7GA 4QLJA 1B31A 4M29A 1IT0A 1M01A 4BS0A 3AS3A 1E0VA 1V0LA 2ZX6A 4PTWA 2VZOA 1HJQA 1XYZA 2WHMA 4OOZA 4YPJA 1E72M 3WQ4A 4BA0A 2HISA 2DDXA 5BRQA 4RE2A 1W1YA 1PX3A 1OSEA 1BPLB 1MXGA 1SMDA 2J7GA 4CN4A 1CXFA 5A6AA 1TA3B 1B3YA 1FOBA 2BVTA 3VDCA 2V5DA 1MW0A 4GO9A 1PJ9A 3ARUA 2VI0A 1JD7A 1EDGA 1V0MA 1JDCA 1V3JA 7CGTA 2E9BA 6TAAA 1OD0A 2QLYA 4ACZA 1E6ZA 2UWFA 4P7LA 4W88A 5A6SA 1HVXA 1M53A 3WFLA 1QNQA 2G3IA 1NQ6A 1M7XA 5IHSA 2UY5A 2VMFA 4FLSA 3UG4A 3ZR5A 1GOQA 5FD0A 3VIGA 5ABFB 1Z32X 1E43A 2ZXQA 1FFRA 4H2CA 1VJSA 2XHYA 2VX4A 3WEMA 2DSKA 3UR7A 2W63A 4ZXOA 1XH0A 4AD5A 4S3JA 4X0VA 2WMIA 3GXDA 2WMKA 3U7BA 1ITCA 4UFLA 4DWSA 3GZAA 3T2QA 3G6MA 1MVYA 4CD7A 2QHAA 4H41A 4E4PA 2BS9A 3CHEA 2O9TA 3WEZA 2CIPA 3SCNA 3BAYA 4ZE5A 3U7VA 2XFYA 2CETA 3F4VA 2XM2A 3WDRA 1H09A 2J7HA 3AIEA 1UH3A 3AIBA 5CGMA 5M3WA 5IHRA 1KFWA 3F5KA 3WD4A 3BLKA 1TFVA 3MMUA 2OSXA 1JF5A 3SUVA 4HPHA 2IXVA 5TD4A 3OG2A 1BQCA 1V3MA 3IJ7A 1UWRA 3D5HA 3MANA 3N13A 2FHBA 1EHNA 1GORA 1W32A 1JGIA 1BLIA 1GOWA 4W5ZA 3BSGA 1DWHM 1J0JA 1WAWA 4B16A 5D9PA 1H11A 4F79A 1EO7A 3SCRA 2J7CA 3HU7A 4NRSA 4JIEA 2G4FA 1QNPA 2CHOA 4ZEPA 4DWSC 5BYWA 1CXIA 1LJYA 1HJVA 1DWFM 4KGJA 1JFXA 1TZ7A 3OZPA 2DSVA 1MQQA 4UQAA 3MUAA 1WP6A 3RJYA 4AZCA 1R86A 4JL2A 2OLHA 2PC8A 2YJQA 4H04A 4OOUA 1W2VA 3VD7A 4E2OA 2Y24A 3AMLA 4AXNA 3WELA 1GJUA 3SCQA 1A47A 4KH2A 3B8SA 1UZ1A 1WDRA 5DEZA 3K1DA 2W92A 4XZBA 5CLTA 1UD3A 1J01A 2A3HA 4UTFA 1GVIA 4YHEA 2WANA 4D6HA 3BMVA 3EDDA 4F9JA 3SUTA 2CKSA 4F9DA 1UWIA 1KWGA 1MW1A 1WZMA 3WEOA 5CXPA 3OGSA 4TOQA 3AMDA 1JZ2A 4V27A 3MO4A 3VGEA 1ZL1A 4PTVA 4CCCA 2VZVA 3MSGA 2JALA 1C8QA 2VC9A 1G1YA 2E9LA 3VGHA 3VIHA 2WC3A 2QPSA 4ACZB 4AZ7A 3EDFA 1XSJA 1DWAM 1H1NA 4Z2HA 4U5IA 5DO8A 1XSIA 2PWEA 4CD8A 4E8DA 1GQKA 3AOFA 5AYBA 2YBUA 3MMWA 4V28A 1W9XA 5D9OA 4MB3A 4P7QA 2VRQA 2QF8A 1CGVA 1OD8A 2DT1A 2J4GA 1QI2A 4W85A 5A8QA 3HJEA 3MV11 4PMOA 2D3LA 3THDA 2WMIB 4D6GA 1NOFA 2WYSA 2X05A 5A8PA 2ZUSA 4DWSB 2XFRA 2DIEA 1KGUA 3KZSA 5E0FA 5GPRA 3VX0A 1WZAA 4P8VA 5I0DA 2WMJA 1UKPA 2XFFA 2WXDM 1HP5A 1LWJA 3VGFA 1V6UA 3SCOA 2CXGA 2D20A 2GJRA 1OT1A 2A3BA 5A8MA 1WNOA 1I1WA 2YLLA 3SIMA 3VGBA 4OZOA 3WD3A 3VGDA 4DUWA 3VDAA 4MNMA 5FCZA 1J18A 2E8YA 3W81A 3RIKA 4MNLA 1E4LA 2CCRA 3W29A 1G5AA 2O92A 1ZJAA 2YA0A 1ZBCA 2VOTA 4UOQA 1UR4A 4B3LA 4CN1A 4UZSA 1JNEA 3KL0A 1UR8A 1U2YA 1H3GA 2WSPA 4PEEA 1EXPA 3AIWA 1BYDA 4LGXA 3WBEA 2J47A 5EMYA 1HNYA 2WMGA 3UESA 3W37A 3L4YA 5BXRA 4AZCB 2J79A 3L4UA 2DQXA 5BWFA 2OYMA 3WUFA 1J10A 1EIBA 3AMCA 2X2YA 2DT2A 3PBGA 1VB9A 4AD0A 4J3TA 1MW3A 3WF1A 1KCKA 1HF6A 4PUDA 3WF2A 2A3CA 1CZ1A 1E6XM 3BAWA 4D6FA 2RGLA 1UWUA 3ZM8A 3GXIA 3WMCA 1JIBA 1QNRA 3VX1A 5IXEA 1ITXA 4JL1A 2QMKA 5LA1A 1VEMA 1XV8A 3NUKA 2F8QA 2GFTA 4W84A 4DUVA 3NYDA 1E6RA 4KMQA 2PBGA 3A3HA 3AJ7A 1HKIA 2C8NA 2XUCA 2XVNA 2YLAA 3WH6A 1E4IA 4XZWA 4W8LA 4XUYA 4J28A 3ZSSA 3A4WA 1UH4A 1W9VA 2XVKA 1E6NA 3MUZ1 3MS8A 4NI3A 4HZ6A 2WLYA 1GOIA 3CMJA 3DHUA 1XCXA 1I1XA 4HA1A 2PI6A 1ODZA 2YDSA 1HKMA 4UQ9A 2J74A 3D3AA 3WD2A 4AWEA 2D3NA 1OCQA 1Y7VA 3NIYA 3DC0A 3L4XA 4F66A 3LPGA 3RM9A 2WMHA 4GQQA 2VR4A 1ZBKA 4HZ7A 4UFJA 3II1A 3CHFA 1V0NA 2VCAA 4X9YA 1XH1A 3PHAA 3VIJA 3W26A 2CESA 1HT6A 3IK2A 2GDVA 1GOOA 3T0DA 2W91A 5ABHA 1JYXA 1V08A 3FNDA 3GH4A 3TA9A 4BQ5A 1J9YA 3N15A 3OIHA 1WKYA 3L4TA 2YL9A 5A1AA 2O9OA 1E6QM 3AYRA 3S2CA 5HPOA 2XTKA 2RGMA 1ZJBA 2EEXA 4AIUA 1UOKA 3ALGA 1LL4A 3SUWA 4AD4A 1VFMA 1MYRA 4TX8A 4URIA 1WDSA 4WK9A 1J12A 4H8VA 1UZ4A 3PZQA 3PTKA 2EPNA 2CITA 2DIJA 1GQJA 4NRRA 1C7TA 2JEQA 3T09A 4Z2LA 4TVCA 2J75A 3W25A 3BXWA 3CUIA 4A4AA 4D6DA 1E40A 2XM1A 1DP0A 1V3KA 2YBTA 1KXVA 5DT5A 4PMZA 1M03A 3OA5A 5C8BB 1PIFA 3GNRA 4TUFA 1FHLA 2VZSA 3UCQA 4PMNA 1P6WA 1RD6A 1NWUA 1B3WA 2G3MA 5GNYA 3ZJ6A 3U5UA 2EPMX 3SCWA 3AXIA 5JBFA 1JZ8A 3PN8A 4ML4A 1U30A 3N17A 3AS2A 2GK1A 4WKHA 2G41A 1O6IA 1ZB5A 4JFVA 2WWCA 1UD6A 2Y2WA 1WZKA 2D1ZA 1RH9A 1V6YA 3N18A 2NSXA 4L4PA 3VINA 3DYMA 3TTQA 2CNCA 5HXMA 1UD5A 4JCMA 5DMYA 1OWQA 3M46A 5E0CA 4B15A 4UFHA 2WLZA 1XD1A 1BAGA 3WDQA 5EBAA 2GUYA 2CERA 1JAKA 3PZOA 2J7EA 2OYKA 3OLDA 3W0KA 2PBOA 1FH9A 2XJ7A 2Y4SA 3NDYA 3ARTA 3WH5A 5IFTA 1EH9A 1WDPA 1GPFA 3RPMA 1CXEA 3RM8A 1L8NA 4D71A 1R7AA 1US3A 5A6LA 3LPPA 1JDDA 3NSXA 4CVUA 5JIWA 1SR0A 3IJ8A 1E1FA 1MWOA 2EJ1A 4C7FA 2VCCA 4ZE4A 1W1TA 4UNIA 3CGTA 2XGBA 1JXKA 3MV01 1WO2A 4TVDA 3VD3A 2VR5A 4UZUA 1CGXA 3ZQ9A 2CBJA 1XYFA 2NW0A 1ZS2A 4AISA 4MDOA 1V6XA 3WMBA 3PZTA 1GJWA 5CG0A 1YQ2A 3WQ5A 4TVUA 4JHZA 1K9DA 1CGTA 3CMGA 1E0WA 3BAXA 4M81A 2JFEX 5F7UA 3T08A 2WCAA 1CXKA 3FHAA 1E4MM 1GW1A 1PZ2A 4WIWA 3ARSA 2NT1A 2FDMA 1OGGA 4JZ5A 1UWSA 4NSBA 4DM2A 4HTYA 4HMDA 1UG6A 1KQZA 4MNKA 5HPCA 3PZNA 3ZT7A 1NOWA 4MAVA 5M17A 3QHNA 9CGTA 3CBWA 2GJXA 4JFUA 1ISZA 2WK2A 1PIGA 4UOZA 2PWFA 1J0HA 3GXFA 4KRUA 4MPKA 1HVQA 2YOCA 3AMGA 1KR0A 3KWXA 1E1EA 3PZIA 3AIVA 1GNXA 4UR9A 4AZ5A 3WH9A 4GPNA 4XX6A 2GK1B 2WCGA 3K8KA 1V3LA 3AHZA 4HMEA 3W6LA 4BQ2A 1OGBA 3WL1A 4BF7A 4GZEA 1PZ3A 1E71M
chains in the Genus database with same CATH superfamily
3VD9A 6REQA 1A5SA 1BYCA 3PZGA 1UWQA 3I10A 3QTGA 4HNUA 3URAA 3CQHA 1RJQA 3Q65A 3RF9A 4GZIA 3PPFA 3SDOA 4GK8A 4M82A 1MDLA 3IACA 1BG9A 3W7MA 1JR1A 3JUGA 3ITVA 3FXGA 3FYOA 2PC4A 3HG2A 4ZOCA 1W1IE 1TYGA 1IT7A 1H4PA 3FVDA 4L9XA 3MZ2A 1C3FA 4FLRA 2R1NA 2X7WA 4CNNA 4I8YA 4JTCA 3WFAA 3QW4B 1W9BM 5EMJA 5JH2A 1PUDA 2D0HA 3C0LA 2X0YA 4PMVA 4P7OA 4L1XA 3S8HA 4L1GA 1MRQA 1OK4A 2Q02A 2RDWA 3M16A 1FWGC 1YTDA 4DM1A 1DQXA 2C3ZA 1EA9C 5F4SA 1R87A 4N2YA 4DJED 4C6QA 1D7KA 2CZVA 5C6MA 3QGVA 5MKGB 2WO5A 1XHGA 1GVSA 3MVTA 3OZYA 2O9RA 1MFUA 4NJKA 1EA0A 1UKQA 1J0IA 4AZGA 3CHDA 2AQWA 3A4AA 3NO3A 1Q5MA 2C1IA 3AMKA 3WUBA 2CWNA 1O1HA 2GSJA 5A6JA 3GH7A 3NM3A 1W1VA 2ATMA 1Q8AA 1R3SA 4LYRA 1N2VA 2CLHA 3GUGA 1T41A 3QMRA 2FVLA 4OT7A 4YTRA 3VU2A 4NASA 1GONA 2HBXA 3UPWA 1FKWA 3P5ZA 3TYUA 4BWLA 4A3QA 3LRKA 1GYLA 3ECQA 2HK1A 2WVSA 1OGSA 1TUXA 3B03A 3V5OA 1EIXA 4ZB2A 2X41A 1W9PA 1KXQA 1GHRA 3UA4A 4XISA 4ZFMA 4O13A 3L2LA 1A0CA 3B04A 1V6TA 3MCOA 1JZ4A 2BFGA 5FSDC 1M5WA 4MWAE 3GK0A 5BMWA 3OLGA 5CGTA 5FJTA 4Q8QA 2DZAA 4EPDC 3C0SA 4FI4A 1GG1A 3VIFA 1UC4A 2I14A 3R8GA 1XLDA 3MYOA 4FMVA 3TNBA 4BQ3A 1SW3A 3CZGA 4UBPC 3GUWA 4OBRA 3SCVA 3UWQA 3QOMA 4MF4A 2OT0A 2HRWA 2BVDA 3GC2A 5D2VA 4PMQA 2FH6A 4RPPA 1CLKA 1H0GA 2YIHA 3EX1A 3LS9A 2AAAA 3XIMA 4RNJA 1TJ2A 1F2JA 2FJKA 4Y2WA 3C2YA 5AYIA 4AD2A 3CO4A 3EOOA 1IXNA 1HKVA 1IIGA 3R12A 3VIPA 3KBVA 1XSKA 3CYJA 2GOKA 1MW2A 3EWZA 2FHCA 2WVVA 2I16A 4FXFA 4HPGA 4GYPA 4W7VA 2EO7A 4B5VA 2HXTA 1QK2A 4IF2A 3OO2A 1G0CA 1PXGA 3GVWA 4FP1A 4UQCA 4R9XA 4R85A 2PWGA 3AWOA 1X98A 5AHLA 4AEEA 3ITLA 4XIMA 2I56A 3EPOA 1VF8A 3GU2A 2W27A 4AD3A 3P14A 2HSAA 3PZUA 2ACQA 1LQ0A 4LTSA 1Q6DA 1QR7A 3UJFA 1KQYA 1FRBA 3DERA 4UTMA 3FIGA 4GY0A 1H1ZA 3UT0A 4PUKA 2PCQA 1DKWA 3CL6A 2ZX8A 3PZVA 1W1B1 3G1AA 3R58A 5HJXA 2OKTA 1OF6A 2E7FA 3KBJA 3N3MA 3WQFA 2REQA 1XLEA 4GIAA 4Q4QA 2OWCA 3AZSA 1TV8A 3NOYA 4D6CA 1QPOA 3VO0A 4DJEC 2H3DA 3KP1A 2ZWYA 3FGCA 3I68A 4O8AA 1RSCA 3BTNA 3B4YA 4ALDA 2O0TA 1D8WA 4NZ5A 4AIOA 3ARPA 4RV3A 5FKYA 2V5CA 3G1RA 3GE7A 5K9XA 1EPXA 1OC6A 4MPQA 5C9ZA 1XD0A 3QBUA 4Z08A 3VGGA 3AALA 3J7HA 1FWJC 3EX2A 1ZFJA 2WBKA 4TX9A 2E6FA 1QVBA 3VUPA 3PANA 2VRKA 5MHBA 2FGZA 5AC5A 1EJTC 1ZHAA 1VR6A 4KWSA 3KTCA 3W71A 8CGTA 1SVDA 1UMLA 2I17A 1ISVA 1XCFA 3O6YX 1QI0A 2WM0A 3R8RA 2ABAA 4GCAA 3ABSA 3RX2A 1UQYA 2QCDB 3SW6A 3KVMA 5DXXA 1QI5A 1QPQA 1FWAC 2CHNA 2VL4A 4KWUA 3OVRA 4HHMA 1D7FA 2PWDA 3RYSA 4JBRA 3SY8A 1UC5A 5A6KA 4PBGA 4CLMA 3QGAC 3VIKA 1O66A 4WJXA 1JYVA 1N82A 2J8GA 2CBVA 2POTA 1MI3A 4FNTA 4PUNA 1CECA 4O4WA 4R33A 1RK5A 1TVPA 4EP8C 3RUBL 3L0NA 1XIFA 5HMFA 1W3HA 3WF0A 2EG6A 3W2MA 2ZA2A 2VWTA 4CN6A 2VZTA 3UP8A 2ZRVA 3K2GA 1SZFA 2BHZA 3W38A 1SFSA 2NXHA 2AKMA 1W5QA 3MVIA 2FH8A 3OHIA 3PAJA 2OSWA 3M07A 1EC7A 1VFOA 1QO5A 2P8CA 3CQIA 3BL3A 2WOQA 4H8HA 3WO8A 3WF4A 4DWDA 1ADOA 3EEZA 3WNMA 2QUNA 1EX5A 1AQFA 1B2YA 3DX5A 1FWTA 3ABXA 3TC7A 4UTWC 4WOZA 1XIDA 3V36A 4W7WA 2Q8XA 4N6EA 2QDGA 4OIFA 4H8NA 1TMLA 1FXQA 1KTNA 1J4EA 2YA2A 1MQPA 3RLUA 1HJSA 4HZ8A 3VZYA 3M6YA 3O6AA 2MNRA 4XBSA 3EAUA 4C6KA 3CB8A 1EL3A 3TMQA 3UCCA 3VI2A 2I7GA 5K2ZA 5U7SA 1B5TA 1W2PA 1AH4A 1LT7A 3N9KA 1B3XA 3MUIA 4B9ZA 5EFFA 4DPQA 2DVUA 3BJFA 3VTRA 1M7PA 1PO9A 1YPFA 3LHTA 3SQSA 3VZZA 1UR9A 2YXGA 1IEXA 2G3NA 1F3TA 3AXMA 3RO6A 3KEHA 1JCJA 5D4YA 4PCSA 2G5WA 1VHNA 3KXQA 4RE3A 1GK8A 3WJXA 1XG3A 2PRMA 4IISA 3CHCA 3GNPA 3EBVA 4FB7A 4A35A 2VGFA 3F4WA 5AY7A 1ZJHA 2JE8A 4LYPA 5CPTA 1E70M 4DLFA 3UU0A 1G94A 4F0MA 4PSRA 3AS1A 1FX6A 1OX4B 5D02A 2CEQA 2Z1WA 4PZVA 3LX9A 4D1JA 3MHGA 2KX9A 2XIJA 4NJJA 4QAWA 4O53A 1FWFC 1A5BA 2W62A 3SRKA 4CCDA 3UZXA 4S38A 2J6VA 3M44A 1D3CA 3AROA 1S5WA 3OQ8A 4R7OA 1KCZA 2QDEA 2R1KA 4MHBA 3RU8X 4OWGA 1V77A 3LGDA 3IANA 1CDGA 1JPMA 2ZUTA 4NIRA 3OGVA 2A7RA 3N2OA 2YYTA 5HNTA 3WMLA 3G1SA 1D9EA 3SRHA 3F5JA 4GJJA 1EBHA 5DXYA 2Z27A 4KCTA 5JU6A 2IPWA 5LHFA 5G5IA 4HT3A 5DN1A 3LPFA 2OGYA 5KEZA 2BMBA 1KXHA 2PRHA 3TH6A 3DFNA 3NVTA 4HB7A 1HXJA 2NUXA 1OC5A 4ROQA 2BNJA 4CCEA 4NILA 1WAUA 2JQXA 2BHUA 5E1QA 4MIMA 2VO5A 3AICA 2BG5A 1H1YA 3P67A 4WR3A 2VEMA 4H9MA 3L21A 3W7LA 4DBDA 1H63A 3RMEA 1QW8A 2P8BA 2YL6A 3SIZA 3ZJ8A 1VFHA 5MF5A 3SZ8A 1ZSXA 3ANVA 3H2MA 1YBQB 2OFJA 3TK7A 3VD4A 4V15A 1ZRQA 1KBJA 2J7DA 5ABEA 2VTFA 1E5NA 3QYQA 4M1RA 4F0LA 2WB5A 4JYFA 1E55A 3NQCA 4GVFA 3GKFA 3LCLA 4PUEA 3WD1A 4PCTA 3IIOA 3C8FA 3FDGA 1CTNA 3W6MA 4Z2JA 3HPZA 2PEVA 3GDRA 1TE6A 4TX6A 4DBSA 2H3BA 2BY0A 3LNPA 4O12A 2FFIA 4K37A 1XGEA 3B8DA 2Y63A 3FEQA 2QUTA 5IBXA 2OOFA 5DQPA 4J3UA 1CGUA 4S3AA 4FF5A 1AZ1A 3VM7A 3E0WA 3QFWA 2XIQA 3UWYA 3B8IA 1SZEA 4GI9A 3OOQA 4CU6A 3S2LA 1OZMA 3GYCA 1FWDC 1SQ7A 1A5MC 3QMTA 3LRMA 3L4ZA 1XIEA 3HPXA 3EOEA 3VZXA 4BZYA 3VE7A 4A8LA 3BV4A 2X1SA 3QSRA 1RZMA 1SZGA 3NQAA 5DT7A 5EPDA 3TSBA 1C92A 3BCJA 3VKCA 2JF6A 1TKKA 3EWXA 5E93A 1H49A 4FX7A 1EP3A 3UETA 4IMFA 3HFYA 2C1HA 1OYCA 5K4ZA 1A3HA 4ATWA 2ZYFA 1TRIA 3M9YA 4IM4A 4JTHA 2V3EA 3P82A 5I2UA 2QCNA 1US0A 2A21A 4Y9NA 3HGOA 2IKIA 4K6AA 1KCLA 3DHDA 5J8LA 3LA4A 1NWRA 1JNDA 2E8ZA 3RHGA 1MUCA 1W6TA 3AIRA 6ENLA 2I5QA 3USZA 1VFFA 5LGXA 5I3FA 1EJXC 2ZZ5A 2XVPA 1LUCA 3HGJA 3LQLA 3O7UA 5IDIA 2OO6A 4M24A 3T42A 1UR2A 4O8RA 3JVAA 6CGTA 1W5PA 4LNCA 3NQEA 4V33A 4D6JA 3RCNA 1YDYA 3OVQA 3Q94A 3OB8A 3AS0A 5XIMA 1LROA 3U48A 2WSQA 3IRDA 1F3EA 3CZJA 2VWSA 1G9HA 2FKPA 3K4WA 4PC8A 5HOSA 1UKSA 5BXSA 3G5EA 3GW3A 2XG9A 1VFSA 5AC4A 5XINA 3WUGA 2E09A 2ZDSA 1KFCA 4XB3A 4UFKA 3BANA 1AFSA 4HGXA 4ACYA 3CJPA 2YSWA 4B3KA 1DHPA 1CIUA 1YKWA 4JHOA 3S1UA 1B3VA 1Q8JA 1EJVC 4LFYA 1WE5A 2CZEA 4XV0A 3CPRA 3QYSA 1DQUA 4C91A 4LB3A 5C54A 3A23A 1E5JA 1LLWA 3KW3A 4X22A 2BVWA 2WC7A 1J11A 3ZVHB 1KLZA 3QR3A 2H8XA 4WLCA 2Y8VA 2WKLA 1M7JA 4H00A 2RH9A 3CT2A 2DQWA 5AECA 2H9AA 3EOLA 1IZKA 3OU8A 2XINA 2VQTA 4IPLA 5LIXX 3N9RA 4J3VA 2PLMA 4GINA 1JCMP 5LNSA 2JF7A 3RO8A 3E3HA 3NQ8A 3KX6A 4HSOA 1JG9A 4J35A 4QIUA 3LHVA 2O4MA 1G67A 3BG9A 3UR5A 4M80A 2ODOA 4QBXA 2ZZ4A 3VIOA 5I79A 2WW5A 5HUPA 2NX9A 3CAWA 4QCEA 4ZENA 2GWGA 1OF8A 4TV5A 5FOOA 1LG1A 2WKGA 1BGGA 2CZFA 1KBBA 1EWDA 4JICA 4PCNA 2YZRA 4HKPA 4JQ1A 1P5BA 2SFPA 2EPLX 3VKAA 6XIMA 2E4TA 4G9PA 4WQ6A 1QI3A 3CZKA 2IQ0A 4UQDA 1FVPA 3EKGA 3WX7A 3ZS4A 3DUGA 5BROA 3E2SA 4I6VA 3EYPA 4MB4A 4S3EA 2J88A 3PC0A 4GXWA 1EC8A 2NSOA 2PDGA 3SBFA 4LVFA 3W27A 3PWIA 3N4AA 4Q33A 1Q7QA 2VDGA 1NP2A 4C1KA 4M56A 4JQ3A 2CBUA 1EUAA 1YTKA 4FLOA 1JVNA 2XWEA 3PTQA 4J3SA 3C56A 3GKAA 3JS3A 1XBXA 1B31A 4M29A 3BQ5A 2FIQA 4H9UA 3HJZA 2HDJA 1TTIA 3CAVA 4BS0A 1PL9A 1V0LA 4PTWA 3ABRA 2PF8A 1JPDX 2VZOA 5T9BG 4YPJA 4IFKB 2VEGA 1E72M 4N6FA 1Q6LA 2DDXA 5TAOA 3VNKA 1ME9A 5E5CA 2OVLA 1SMDA 1MXSA 1MXGA 2J7GA 1A49A 3NZ1A 1NQKA 4C5ZA 4UTHA 1CXFA 5KINA 3A5VA 3GY1A 4HA0A 3VDCA 1UIOA 1GPWA 1PTAA 4EWND 5EMLA 3ARUA 2QCEA 3H2EA 1BVWA 2C71A 5CPNA 2XH4A 1JDCA 3AAMA 1QO2A 1QW7A 4G1KA 1OD0A 2UWFA 3EX4A 4P7LA 4BJHA 5A6SA 4DXXA 4C60A 4C1NA 4Q8OA 2VMFA 2JKPA 3ZR5A 1L6GA 2ZXQA 1FFRA 4O11A 2XHYA 2VX4A 2DSKA 2PZ0A 4PR4A 2WMIA 3GXDA 2WMKA 5C7VA 3KRUA 3WLIA 4UFLA 4XZHA 3G6MA 1LWIA 1MVYA 2QHAA 2VFFA 1H51A 3DAQA 1A0DA 2B0MA 2CETA 3F4VA 2XM2A 1PTGA 3A3XA 4C6OA 1H09A 3AIEA 3AIBA 3CL7A 3WD4A 3BLKA 2OSXA 2XDFA 1ZAHA 2VC7A 2A7PA 5ENLA 4ZOAA 3EX3A 2CWXA 2NZLA 3HFTA 4GVGA 1EHNA 1GORA 1W32A 1JGIA 3QTPA 3EA2A 4W5ZA 1WAWA 4XZNX 4YWIA 4F79A 4TIMA 5TIMA 4JIEA 1WXZA 3UJ2A 2H90A 3NTYA 4ZQPA 3GNXA 4GACA 4JNZA 3TR2A 2P76A 1IQ8A 1DWFM 4M5PA 2PTYA 3RG6A 3M0HA 1WV2A 4JIPA 3MB9A 3MUAA 1OABA 3LERA 4WY0A 1DYSA 1M68A 3VD7A 4AXNA 5AB3A 1XIJA 3WELA 3F4CA 2F6KA 4FR6A 4KH2A 5HMEA 4Z1AA 5L9FA 4TQTA 2DU2A 1XFCA 1CX9A 4XZBA 4D2JA 1UD3A 2VGGA 2RJHA 4PRTA 3OEXA 4I9MA 4YHEA 1LRNA 3SUTA 1MW1A 2F9RA 5KTLA 4HK6A 2BB0A 2PGEA 3I6RA 4O1CA 2IPGA 3W87A 4AX7A 4LWWA 4E4UA 3VGEA 4OGZA 3ATYA 1WOBA 3MJMA 3MSGA 4B2DD 4GH3A 1C8QA 3ABZA 2QPSA 1VH7A 3HMJG 1DWAM 2OCZA 4GJIA 3UYCA 3C4UA 1LLZA 3A4JA 2PWEA 3V0UA 4E8DA 1GQKA 1VBGA 2X2GA 5AYBA 3MMWA 4YJ5A 4V28A 1W9XA 3TYEA 2Z2AA 3RMJA 7REQB 4DAIA 1OD8A 4W85A 3HJEA 4JQ2A 1SM9A 3MV11 3DU0A 4G7EB 5D37A 3THDA 2BTMA 1IWAA 3UJSA 4JIHA 1G4TA 4YTSA 3KZSA 3VX0A 1R3RA 1R2RA 4P8VA 3W7PA 1KC7A 1UMYA 1UCWA 4M0XA 1V6UA 1ONWA 2CXGA 2QPXA 3G3MA 2A3BA 3URBA 4GQGA 4O17A 3UWZA 2QGHA 2TMDA 1LP6A 2HK0A 3UZYA 3VGBA 5HQEA 3U6WA 4OZOA 3WD3A 2Y5JA 1KM3A 3MWCA 3CIWA 1Y5XA 1E9IA 4O57A 3RIKA 3W81A 3WJZA 1TPC1 3W29A 1OFPA 1UZHA 3LCWA 2VOTA 3EWBX 4JTJA 4CN1A 4ZCWA 1JNEA 1FKXA 1TJRA 1H3GA 3AWNA 3P2VA 4LGXA 3RR1A 4NKCA 3TYBA 5EMYA 1XLIA 3UESA 3B06A 4GCXA 4AZCB 2G0WA 2QF7A 2J79A 2J8TA 2F84A 1SW0A 1FQ0A 3LOTA 2X2YA 1ICPA 2DT2A 2R1MA 1VB9A 4J3TA 3U2OA 3TFXA 1S39A 4PUDA 3A5FA 3N3TA 4KCVA 1CZ1A 4GUHA 2B7QA 1G4PA 1RXOB 3LCXA 4RZ5A 1AZ2A 3GXIA 2AL1A 1JIBA 1QNRA 2IMRA 4JL1A 2VUNA 4I6KA 1VEMA 4HK5A 1XV8A 4ZTYA 5LA1A 3S1WA 3NUKA 4W84A 2GFTA 3NYDA 3A3HA 1S2VA 2XZ9A 2Y7EA 1HKIA 4FS9A 3UGRA 3W76A 4ROPA 4XZWA 4ZO6A 4J28A 1AG1O 1YXDA 3OP2A 2ISVA 2GGHA 5D05A 3MS8A 1YPXA 1I1XA 2RUSA 1ODZA 1A5OC 4DYEA 3IVTA 2UBPC 4KFOA 1HKMA 2J74A 1LTDA 4L4LA 4J2PA 3LCFA 1R47A 4BF9A 2JBMA 2D3NA 5C5YA 1OCQA 4C6PA 4F66A 2WMHA 4IG2B 2VR4A 1ZBKA 3SJNA 3FYPA 4REQA 1BD0A 4J3ZA 1Y5VA 4X9YA 1ELSA 4ICMA 1B57A 1YW1A 3H54A 3U4FA 2QW5A 4W9TA 1JYXA 4GYKA 3WJWA 4AYGA 2ZCGA 3FNDA 4N4PA 3L67A 2O55A 4MY8A 4XTDA 3SI9A 4YMZA 1MEHA 2V8ZA 1WKYA 5FJRA 2YL9A 3S2CA 1XF0A 1MUWA 4AD4A 4ZQOA 3TVAA 1WX0A 5AYZA 1WDSA 4H8VA 1ONEA 3GFXA 5EYWA 3PZQA 5B7YA 4MFEA 1ICSA 5H2ZA 3ONBA 4NRRA 2C18A 4HNTA 5F2IA 2JEQA 1ZY9A 1Q4WA 1WQ5A 1K7XA 4AWTA 4O0ZA 2J75A 3BXWA 4A4AA 4ZQNA 2HVOA 2QVHA 1EYWA 4JTRA 4UB9A 2YBTA 4DQWA 3DXIA 4DBUA 4PMZA 1M03A 1PIFA 1FHLA 3QGKC 1P6WA 3O15A 2HVNA 2PDWA 2FMNA 1B3WA 2G3MA 4LUTB 1JZ8A 1TR9A 2AQOA 4HU3A 5AC7A 2GK1A 3TW9A 5HNUA 1XDJA 4DJFD 2GQ3A 3D6NA 1ZB5A 2Y2WA 2NSXA 3W01A 3LY0A 1BXBA 2X16A 3PBWA 4O19A 1DPMA 4PFHA 5E0CA 2GGGA 4B15A 3G24A 4I8DA 5DBTA 1XD1A 3I6EA 3VE9A 3WDQA 1UASA 5EBAA 3I4KA 2J13A 3PZOA 2J7EA 3CTLA 3EA1A 4XAFA 4UTKA 3GAYA 2VFDA 2YCJA 4NXKA 5IFTA 1GPFA 3RPMA 3W7DA 1J8VA 4LJ3A 4MGGA 2XISA 1L8NA 3OPSA 4Q8WA 4N02A 4D71A 2KAUC 1EYEA 3WLMA 4ZGYA 5JIWA 1LRTA 4NZ1A 2W79A 1W1ZA 4LY4A 4PE8A 3V5CA 4ZE4A 4UNIA 3HQOA 1FHVA 1O68A 1WO2A 3JR2A 1XLBA 2O4QA 4UZUA 1EJ7L 1MZRA 4IMEA 4ILSA 4AISA 4MDOA 5MKGA 3PZTA 3NQDA 1ZUAX 2J24A 1F7BA 4JHZA 1G4SA 2BZNA 3B40A 3VA8A 4EIVA 2PGFA 3H21A 2ACSA 1B54A 1DJNA 2FLIA 3T08A 3GC4A 1CXKA 3FHAA 4LCSA 2XH2A 4LV9A 2E5BA 3LXAA 4QGCA 4WIWA 1BEUA 1B9BA 4TO8A 5CH9A 3N14A 3P3BA 4H2HA 2G96A 4HMDA 1OEPA 2G3FA 4MYAA 2FTPA 3LV5A 1U1UA 2PD9A 3WQOA 4H1ZA 4NX5A 3EWDA 3KRBA 1ISZA 1POKA 1F6YA 3GXFA 4MPKA 5F4WA 1K8ZA 4H6QA 1FDYA 2DZUA 1GNXA 4UR9A 5LGZA 2WCGA 3W6LA 4WSHA 3LCGA 2QCHA 3ENLA 1T99A 3LGEA 2C14A 1P0BA 4RK8A 3TXVA 3ZMRA 5LKYA 4NI8A 5DF0A 1CXLA 2V2CA 2B7NA 3M1ZA 1CLVA 4HP5A 1V6WA 4ZQCA 1YNQA 3ZR4A 1LCOA 3PAOA 3PY2A 4G1NA 4DF2A 4B91A 3KOXA 3BAIA 1S2CA 4Q7BA 4C6FA 1TMHA 3WLTA 3GWQA 4AW7A 3SRDA 4E2DA 2PLJA 4O14A 3W1PA 4JR5A 1F73A 3N2BA 5FJIA 4PYSA 4M3PA 2DUZA 5BU9A 3M0LA 1JAEA 2WQDA 5LNVA 2BSLA 3MA8A 4EF9A 4S3CA 3BSHA 3H2CA 4JHMA 2Y70A 3CLWA 1F4HA 1FBAA 1LZOA 4ZZ9A 4NUWA 4RDWA 5KITA 1KRAC 1XXXA 5AFDA 4QDPA 3OBKA 4N9BA 2BP1A 4L64A 2OQLA 1EO5A 2VEIA 4DBEA 3FJLA 4PUJA 2QAPA 4DJFC 2OODA 2YKKA 3AHYA 4NVTA 3N12A 1JGMA 1OFRA 1BF6A 3S2MA 1QPNA 1UB3A 1GTHA 5CPSA 1U22A 1V79A 3W88A 4EPKA 2EG8A 1U5VA 3EB2A 5LHEA 2WZIA 4ZO8A 3B4UA 3A4XA 4AZIA 1TV5A 4PMJA 4Q7NA 1XRFA 3TEVA 5FF7A 1NOUA 2E1DA 1V0KA 3LN3A 3WKZA 1X6LA 3QY7A 3OVGA 3TCSA 4TR9A 1BG4A 5M5DA 4L56A 3KCJA 4OE7A 4QM1A 4CVWA 4AFYA 1Z42A 5C9XA 2C13A 4DNMA 2DORA 1OX6A 4MLJA 5D2XA 2R9RA 5CBBA 1TJPA 3RLHA 4Q4MA 3W7RA 4BK9A 4HA4A 3EOSA 2V38A 1EQCA 2EG7A 2X7VA 4G7FA 2Z28A 3S5ZA 3PG9A 1QI4A 3CWHA 4GA8A 4CD6A 1VIWA 4FAMA 2J78A 1GKPA 2TAAA 5BXPA 2AQVA 3LMYA 3WIJA 3WLLA 3FLUA 4WXZA 3IJLA 1P4CA 3FFSA 4H4IA 5GJMA 1AK5A 2XPKA 3IAPA 4PGLA 2QJGA 2ZA1A 3MY9A 1M1BA 2PZNA 3PF3A 2A3LA 3TTOA 2WZHA 2PAJA 3TP4A 2W61A 1BF2A 1YE4A 3GDLA 3TTEA 2E9MA 3PNUA 4P7NA 4OJYA 2XVLA 2NLIA 3B97A 4O18A 2PP1A 2F2HA 3NCOA 1AJZA 1O7AA 5HNNA 4L1WA 4MKNA 5C70A 3WNKA 1B9ZA 4D8AA 2QCDA 2QJMA 3MHFA 1JPIA 3IGXA 1YEYA 4PB4A 5ABGA 3W75A 4Y7EA 1TTQA 2YDRA 3W7NA 4ZR8A 2PDLA 4EKJA 3TUUA 3GAKA 3LDVA 5H6HA 1LOSA 4AZBA 2CLIA 2HMCA 4U31A 1E1CA 5DX7A 4RNIA 4FOUA 1YIXA 1L0PA 1FCQA 4OHQA 3NZQA 4OECA 4XWUA 4Q22A 3FJ6A 3EOUA 1F3WA 4UTTC 4OBSA 3ARXA 2V3DA 1UR3M 4FSAA 3LLFA 1E6PA 4PODA 1TZ9A 1NP0A 3PFRA 4W5UA 3U2ZA 3VCRA 3UZ5A 3WK1A 2GVYA 3MP5A 1UR0A 1VBJA 4AVOA 3FY1A 4V1YA 2TODA 4I7UA 3WDPP 4P7RA 1JI2A 2DEPA 3KBNA 2NVDA 4E8GA 1JXJA 3ARQA 4IPJA 2VGIA 1X6UA 3BCDA 1P7TA 1MFVA 4KERA 2FPVA 3E0IA 3LCHA 3V18A 4LUJA 2DSZA 3VUSA 3KRSA 2GGEA 3KS6A 4CQAA 1JI1A 4GX9A 2VEKA 3BLPX 2Y89A 1B0IA 1GEHA 2OGJA 1EF2A 2WNWA 3BV7A 3H70A 1SZNA 4Q8NA 4JX4A 1OCJA 4RDVA 3VMOA 5K7JA 1S2UA 1K9TA 3OG3A 3QZ6A 4J5NA 2ZC8A 5I3KA 8TIMA 3LXBA 4UFMA 3W7HA 3WY1A 2JK2A 4AZHA 5A94A 4FR1A 4I7VA 1A50A 3WCZA 5FEWA 3GS6A 1QU4A 3MBDA 3O2LA 4L7ZA 1HX0A 1NTHA 2CKRA 1NDVA 2F2KA 1BXCA 3REQB 1WB0A 2ZUVA 3EDEA 4FNQA 1BKHA 3KL5A 1KW1A 5GVJA 4DI9A 3TQVA 5I3GA 3SCPA 3RILA 1EGZA 4PL2A 3GC5A 2EQDA 3T2PA 3BC9A 2VURA 3EWUA 3LPOA 4AYSA 1XG4A 1RA0A 3GR7A 2ZWZA 3E2VA 2X40A 4WKFA 3S47A 5A2CA 3QLLA 2CBIA 2A3AA 1X8FA 1OX4A 3CTTA 4IGSA 5I23A 2QAFA 3Q45A 1YDOA 3HV8A 3T7VA 1RBOB 3B0PA 2D0FA 1JL8A 1M04A 2G8ZA 3NQGA 3GSMA 3LHYA 2YB4A 4Z1CA 4JEQA 2CZ5A 5AC8A 1I9CB 3M7WA 1ML1A 2ACUA 1P1XA 4BI7A 3UY8A 1XLAA 3AYTA 4LXFA 4ZQRA 4OTKA 1KM6A 2F38A 3PBUA 1R30A 4HHLA 3D0CA 3CQ0A 3GRIA 2OO0A 2C1GA 1H7OA 3NSNA 2E0PA 1Q3NA 3CL8A 1B4KA 1JCXA 4W93A 3SJ3A 3TOPA 1JRBA 1PYFA 3N6HA 1Z48A 4I5RA 3AC0A 4RL3A 4IZGA 3EX6A 4N9DA 3VILA 4MB5A 3UXKA 5JMUA 2NT0A 2HXUA 5A2AA 2A3EA 3O1NA 5I07A 1L6SA 1UP0A 3N4EA 4AU0A 1CGYA 4EVZA 4L6OA 1I75A 4TMCA 2FHFA 2JIEA 2FZ8A 4FNRA 5E6ZA 4HPJA 1KBKA 2CLPA 2PTWA 4JEJA 1XIIA 5G4HC 2X09A 3M0ZA 4IQLA 4UNLA 3ARWA 3WBWA 4XD3A 4LUYA 4AWUA 5AHNA 4PMDA 4A3HA 2IPJA 2XIIA 3QPZA 5D32A 3LM3A 5LXXA 3AIUA 2J7FA 3VOFA 5AHEA 2WBGA 1FWIC 2ZX9A 3L2IA 2NQZA 4GXPA 3VIMA 3W7QA 3K13A 5RUBA 1YBQA 2X0SA 4AMCA 2QJJA 4AX6A 2OEKA 4RDZA 3GU1A 5BU6A 3QH2A 2BY2A 1YE6A 3VDBA 3R2GA 1FH8A 4IPNB 5D30A 5AKQA 4J27A 4V2XA 5DBUA 3DI1A 3P7YA 1R38A 3WDJA 2J62A 3RX4A 1L9WA 4E2VA 1KB3A 4C90A 4JD4A 3M5XA 2CXEA 1C91A 2EPOA 1ODUA 4B90A 1BSLA 3GFZA 4GUGA 1V02E 3V4BA 4QCFA 5AYXA 4J3WA 4C6BA 3ZT5A 2FTWA 2RDXA 3LI1A 1H7NA 1XRVA 1M6JA 2BOEX 4LBUA 4C6IA 2FYMA 3IIZA 2E5CA 3T05A 2ZRYA 5CBIA 3I7RA 4J1OA 1JF6A 3I7QA 5DCEA 2X1IA 1P6BA 4P8XA 2ESCA 1T96A 3L66A 3THUA 3TAKA 3W6YA 4RCXA 1MQRA 2A4AA 3W2JA 3DFOA 1XINA 4RE0A 4H01A 4MTVA 2GSEA 1TMQA 3KCOA 2Q3OA 3W83A 2V5LA 1XJBA 1F3XA 2WZEA 2V69A 2UV8G 4WUIA 2WAGA 5GNZA 2DT0A 4O28A 5I78A 2NQ9A 1JPKA 3BOFA 2J66A 5IFPA 3PPGA 4HTBA 1W5MA 2VCBA 1VPYA 3FA4A 2R24A 1PAMA 5CZTA 3GIQA 2HROA 1OFOA 3AHVA 2YCLB 2DP3A 2DH2A 3K4DA 1R3VA 3BWWA 3VABA 3AZRA 2C15A 3I7SA 5HK4A 1HL8A 3GR8A 2VRJA 2O56A 4NX0A 4A8RA 5FEXA 4MZ1A 3QVQA 4ZO9A 2ALRA 5PTDA 4OVXA 3S1VA 1M9HA 3DENA 3H6OA 4NXSA 4C6EA 4CNTA 1VKFA 2VEPA 5A6BD 2AMXA 2PODA 4LVDA 2FDSA 3S1XA 1JJKA 2B31A 3STPA 3G0XA 3ABOA 3BE7A 1MNZA 5I00A 2YZ5A 1BYBA 4XZ9A 5AN7A 4M6VA 1XLCA 3CYVA 4E0CA 5CPLA 2C0HA 4IXHA 1THFD 4GBUA 3HG4A 4HNLA 1R85A 1ZZMA 4US6A 4FO4A 4LS1A 3W23A 4HSNA 1KRMA 3PB0A 1ITUA 1QHZA 3MKVA 3WBXA 5HQLA 3UEQA 3QV9A 1J6PA 3T0AA 3VNIA 4KPLA 3LB0A 4U33A 1KRBC 1VRDA 1SGJA 3NO5A 3H4GA 4M1BA 1WA3A 5A8NA 4Z1YA 5HMDA 3PULA 3N11A 4BWLC 1UD4A 1OBAA 5BZAA 4ORIA 1EZ2A 2PDPA 3CM4A 3MSRA 2HBVA 1VBRA 4MWAB 1IHIA 5E6YA 1L2QA 1VFTA 3ANUA 2Y62A 1RCOB 4IWWA 2ON3A 3QY8A 1HKKA 3ZVHA 3G18A 3QSTA 1UUMA 3N29A 1CPUA 2FTYA 4F2UA 4IJRA 1V7YA 5LA0A 3AZTA 3HG3A 1DXIA 3NA8A 1RP9A 3DN5A 8A3HA 1QT1A 3ARZA 5BXTA 4M6QA 1ZQ5A 4IIEA 1LORA 3BCFA 4B5SA 3QZAA 4U3AA 1R7OA 3PZ9A 3S9ZA 3BGJA 1M7OA 2PB1A 3CS2A 2QVNA 4Q7IA 1F4AA 1KM0A 3ZYZA 3KHDA 3G1XA 1IYXA 2RKXA 4GBDA 5CSSA 5T91A 5IRPA 3WFZA 1KXTA 3B9OA 2OWXA 1I8JA 4TXEA 4QJ1A 4DO6A 4B5NA 2XIOA 4OBTA 1FWEC 2YCEA 2XSAA 3OZOA 2WMFA 2O9PA 4A2RA 4JAWA 3BW4A 3L0KA 4O15A 1Q45A 4LEFA 4FNSA 4WSJA 1CBGA 1BWKA 2OSYA 4PN2A 4GXMA 1OG6A 3EMQA 3JZUA 4YTUA 1E51A 1HJWA 4AWSA 5K9CA 1VQTA 1TWZA 4JPGA 3IVUA 1YNPA 1RQHA 2YL5A 4ZODA 5K3VA 5CLWA 2ZRXA 1A4LA 2G95A 2IXUA 1BYAA 2RFGA 4Q6XA 4JTFA 3WNPA 1Z41A 2VYOA 4BKNA 3HGRA 3KBMA 3LXCA 2ZQ0A 2CPUA 1RVGA 1YDNA 4IT1A 1X6NA 4FHAA 3W1QA 1DIDA 4HYVA 1YXCA 3B8WA 5EA9A 1H7RA 1DVJA 1KKRA 3KCLA 1E4NA 3ELFA 5DCBA 3O05A 5DMLA 3LSBA 4IFKA 4A3YA 3W1UA 2X8RA 1F8IA 3U3HA 3ONCA 4DZ5A 3XINA 3IGHX 1LYXA 1UWTA 5FJUA 3P6LA 1E3XA 2VVNA 3G8EA 2BODX 4GYFA 1U83A 4DWSD 3MMTA 4MDPA 3FOKA 4IX2A 3QHOA 4EAMA 1IEVA 2VM8A 4KGLA 3ALFA 4OV4A 4GG9A 3PWAA 4ZSTA 3NXFA 2UY4A 1H62A 3N2CA 1PSCA 4UIOA 3B8VA 1E0XA 2ZZ6A 3QV6A 4QQUA 4HVXA 3IUHA 3PUGA 3VDHA 4LRTA 2OZ8A 2VD8A 3VXGA 4RNHA 1T5AA 3MUY1 1GYMA 3TJLA 3AO0A 4NAFA 4YTQA 4PCFA 3WLOA 1XCWA 1QBBA 1DORA 1ISWA 2W0UA 4RKAA 3N34A 1K4HA 1FWNA 4LF2A 2PUZA 2ASHA 1NWTA 5CG7A 1TCMA 1W8SA 4Q3MA 3PR2A 2W66A 3NQMA 2FPTA 3OZMA 3V7PA 2PGWA 3STEA 3WQ6A 4GIYA 3VD5A 2PA6A 4QE5A 4D8ZA 2FPYA 2D24A 1IR2A 2C6QA 3ZFHA 4JFTA 4R53A 2ZUWA 1NARA 1BTCA 3EB3A 4O1EA 3NURA 4JIIX 5I3JA 1KR1A 3VNYA 2NV2A 1ZCCA 3CH9A 3FKKA 5CSUA 4R27A 3VOCA 4LPCA 1EHAA 2NUYA 2CLKA 4OFCA 3VVGA 3M43A 1BQGA 1S5TA 3K4AA 2C0AA 2LLEA 2Y85A 3KVLA 4GVIA 3WENA 4MKVA 1VEOA 4A05A 3S3GA 4C7GA 4QLJA 3CU2A 2QCMA 1VHCA 2C19A 2ZX6A 3BSMA 1LRQA 3LTPA 4WJ8A 1XYZA 2WHMA 4HYRA 3H24A 4BA0A 4YLWA 2VDHA 2QYGA 5AC6A 3BLLA 4I9JA 4RE2A 1W1YA 2WZTA 1PX3A 1OSEA 4CN4A 5DELA 4YVPA 3R5EA 1TA3B 1B3YA 3BURA 3TN3A 2CU0A 4GO9A 2FFCA 2E6YA 1P0KA 1JD7A 1OFBA 3W1TA 5D2TA 1EDGA 1N55A 1TPWA 1V3JA 2E9BA 1ZGDA 1J93A 2QLYA 3L5AA 4XZLX 2YCKX 1HVXA 4XAPA 3WFLA 2G3IA 4MUPA 1BKSA 4WD0A 4G6CA 5IHSA 2A6LA 2UY5A 5EMUA 3NVDA 1Z32X 3LV6A 1VJSA 4GHRA 3UR7A 4ZXOA 7REQA 3RCYA 4IIHA 3WK3A 1XDLA 4G7EA 1VLIA 5D2WA 3U7BA 3CASA 1ITCA 4CD7A 3T2QA 4E4PA 1EEPA 4H41A 3UW6A 2BS9A 3WK0A 3G8RA 3SCNA 3BAYA 4DF0A 1GYNA 4ZE5A 3PSVA 3KS5A 1UH3A 4UCGA 5IHRA 1KFWA 2WNNA 3GG7A 4FNUA 4FX8A 5HJLA 1JF5A 4HPHA 4DYKA 4Z0JA 5TD4A 3NGJA 3OG2A 4S3GA 2G37A 3IJ7A 2A1YA 3MANA 3N13A 3KUMA 5FEZA 3GHUA 1GOWA 3BSGA 1CB7B 1DWHM 4B16A 5D9PA 1H11A 2PU1A 3H12A 4Y90A 2E25A 3RPDA 4UXDA 4BI5A 4DWSC 1GT8A 3HQPA 4H19A 1P43A 1RLCL 5DCDA 1LJYA 5C7HA 3UVAA 2I9EA 4KGJA 1XC4A 5I3HA 2Q8LA 3OVPA 3R79A 2FVKA 4EAYA 4E2BA 3P93A 3UWEA 4AZCA 1TPDA 3C5QA 2OLHA 4H04A 3L65A 4OOUA 1W2VA 4E2OA 3AMLA 1GJUA 1A47A 1K8CA 3T55A 3B8SA 4K38A 3F2BA 1UZ1A 5DEZA 4LS2A 3K1DA 1Q66A 1GVQA 2X1UA 5D2YA 2C16A 4RLIA 4D6HA 3EDDA 1EUNA 2RJGA 4QHRA 3MC5A 3WEOA 5CXPA 3OGSA 3DEQA 5HULA 3AMDA 4GI4A 4V27A 3HBLA 2F6XA 4K8EA 1NFBA 4B4HA 2JALA 3CC1A 2VC9A 1O5KA 4ACZB 3R0DA 2E77A 4WDWA 5HATA 2PDYA 3SADA 5DO8A 1DJIA 4CD8A 1O95A 3LM7A 1X39A 2YBUA 2Q71A 4P7QA 4BHYA 3DFHA 2J27A 2J4GA 2PDIA 4PMOA 4GVHA 2Y61A 4IG2A 2WYSA 5A8PA 4L9ZA 2ZUSA 1OVDA 2XU2A 4DWSB 1WKEA 1VPXA 2DIEA 3S0CA 1KGUA 5GPRA 2QZRA 1Q2RA 1T8XA 1UKPA 1S38A 1HP5A 1LWJA 3K1GA 1TWWA 4HPNA 2RDUA 4LVGA 2NWSA 3ID7A 4RZ6A 1S5NA 1K8YA 4UTJA 1WNOA 3T0TA 3M4HA 4PULA 3P61A 1Q2SA 3VGDA 2XN1A 1UZDA 3CO8A 2XH7A 2E8YA 4MNLA 1G5AA 1SSGA 2O92A 5HQMA 2YA0A 3FA5A 1ZBCA 3NGFA 4LH8A 5IBXC 4UZSA 2ZZ7A 5TNVA 1W3TA 1JUKA 1QDSA 4GKTA 1OJXA 1EXPA 5ECVA 1RLDA 1F07A 4WDUA 3BZJA 2J47A 1HNYA 3L4YA 3BO9A 2NX3A 3MZNA 3HTWA 3O3RA 2OYMA 1TPB1 2Q09A 1FWRA 3AMCA 3IS4A 3WLHA 3UWWA 5F1UA 4AD0A 5IM51 3TJ4A 1KCKA 5FAJA 2WJZA 3HOJA 2ICSA 4GMEA 3FSUA 1E6XM 3D46A 3R10A 4DLMA 5I7GA 4LUTA 2XH0A 3A9BA 9XIMA 3LG3A 4LVAA 3ZM8A 3LHZA 1BWVA 3PJTA 3UXIA 2GVGA 4KMQA 2PU0A 5FF4A 2XUCA 1E4IA 4XUYA 1KD0A 3ZSSA 3SY5A 1UH4A 2DZVA 2XVKA 1E6NA 1SFTA 3GHSA 3MUZ1 4A6GA 4NI3A 5GJNA 2NQLA 3VOGA 1GOIA 3G1FA 4HA1A 1XCXA 3S5SA 2PI6A 3GIYA 2TYSA 1LBMA 4IX0A 4XD5A 4UQ9A 3D3AA 4GNJA 4JS3A 2PE4A 3EXSA 3LD5A 7XIMA 1SO3A 3FV9A 1FCVA 1NAL1 4L5ZA 1OZQA 1Y7VA 3NIYA 3OTRA 1V5XA 3LPGA 2ZZ3A 3S1GA 3BW2A 1NF7A 2FB3A 3IVSA 5KZDA 3RK8A 4Z1DA 2Z1XA 4B5XA 4UFJA 1V0NA 3KFTA 1S2WA 5T8GA 1RBAA 2FZMA 3MSYA 1XPYA 3PHAA 1HKWA 2GJNA 4NYUA 1GOOA 1MMFA 1TCDA 5ABHA 5LNUA 5G1MA 1V08A 2WNQA 1UW9A 1UROA 1Q7MA 5BOEA 1XBYA 5A1AA 2O9OA 4MLRA 1AH0A 3M0XA 3F4DA 2WZMA 1HTIA 3LYEA 4AAJA 3LZ3A 1Y65A 1NEYA 2XZ7A 1LL4A 1XLMA 4FIRA 4QR6A 5BOFA 1MYRA 1JDEA 4TX8A 2QCFA 2DW7A 2Y1HA 3PTKA 2W3ZA 3GDKA 4V1XA 1M41A 2CITA 1VS1A 1Q85A 1SO5A 1G69A 1PIIA 2EKGA 3NQFA 3T09A 1XP3A 4NL1A 4H9XA 4Z2LA 3IJQA 3W25A 1WDDA 3IV8A 1S1RA 5C55A 4Q4KA 1RJRA 3BK0A 5DT5A 4HNVA 1Z6KA 3OA5A 5C8BB 3GNRA 1XLKA 1K1DA 2X30A 2VZSA 3UCQA 4FNPA 4KBXA 1RD6A 3NDOA 2GVLA 5C2XA 5GNYA 3ZJ6A 1OK6A 3SY1A 2BGNE 5CSRA 2EPMX 3AXIA 5JBFA 5C9WA 2PTZA 5HUOA 5D33A 4LUSB 2QV5A 3I4EA 3R0KA 2G41A 5LZLA 3STCA 1IEIA 1UD6A 4A29A 4I3GA 1WZKA 2D1ZA 1V6YA 1N8FA 4L4PA 3VINA 4ICCX 1FCUA 4NQ1A 1XR2A 2CNCA 4K8HA 4H6RA 4QSHA 3G22A 5HR7A 2GLKA 1OWQA 1RVKA 2WLZA 2ZRWA 2RHGA 3W1XA 7ENLA 2Y7DA 1PB0A 3L9CA 3E0VA 1R3QA 3OLDA 1E0TA 2PBOA 3QEZA 1EJUC 2Y4SA 3NDYA 3WH5A 3APTA 1EH9A 4UTUA 2WJFA 1CXEA 3TQPA 4YCPA 1R7AA 3LPPA 4Y6GA 4JIRA 4A22A 4CVUA 3H55A 4PA8A 1MWOA 3VFLA 4C7FA 4J2MA 2A7NA 1W1TA 3T9PA 3LHWA 4ENLA 1JXKA 4XKYB 4XVEA 2ZTJA 4TVDA 3TN5A 1KM4A 1CGXA 3ZQ9A 2NW0A 1ME8A 4JTGA 2Z7GA 3TX9A 3N25A 3GO2A 1YQ2A 1CGTA 3CMGA 4IIDA 5LIYX 4M81A 3DBNA 4RJEA 4X63A 1GW1A 3EWCA 3PTDA 1PZ2A 1F8MA 1OGGA 3CUZA 3NM1A 1PCKA 4NZJA 1XL9A 4DM2A 4FX6M 4TU1A 4IH3A 3OHMB 4HIBA 5HPCA 3EB4A 1AMKA 3ZT7A 3H4XA 2D69A 2QCGA 3MUCA 4H9VA 4A2SA 3NO1A 2PDQA 1NDWA 3CBWA 4JFUA 1PIGA 3CV2A 5D09A 2PWFA 1J0HA 3O0FA 4KRUA 5FI8A 1X8CA 3JRKA 4NZ3A 3PZIA 3AIVA 4DEFA 2DJLA 2AKZA 4GPNA 3VC6A 2NVCA 3R94A 1V3LA 3AHZA 4HMEA 5AZ1A 3C52A 1OCBA 4BQ2A 4ZA0A 3PM6A 2YB1A 2F7FA 1X96A 3XISA 1E71M 1TPUA 1VBUA 2PDJA 3PUOA 3VMNA 4LCQA 4L6DA 5HDRA 2OJPA 2PTXA 3CZ8A 3L2MA 3W7KA 4YWSA 1KFEA 3L4VA 1ZAIA 4M6PA 3HQ1A 3G2GA 3FX4A 2PP3A 3H2OA 4GWEA 3RRAA 2V68A 4PCPA 1C8VA 1V7AA 2FVMA 2ISSA 2OPJA 1Q6EA 3IAQA 2ZX7A 7TAAA 4NAEB 2WSRA 1VCVA 2BXVA 3TWAA 2J9YA 2PDFA 2R14A 3IIPA 3R1ZA 4FPSA 2OR2A 3UXLA 5F2GA 4B5TA 3R11A 3EZ4A 1QAPA 1J5SA 1UD8A 4ZO7A 3TA6A 1UHVA 2GJPA 3BLOA 4D1IA 1QNSA 1A3XA 2CLLA 5EKYA 1T6MA 3VMPA 2VX7A 2ISDA 3Q37A 1EKOA 1L2UA 1B90A 4J40A 2X42A 1HO1A 3T40A 3OBAA 2HZGA 3EMZA 3DFYA 4A8IA 3LGGA 3PUEA 2XYLA 2W4XA 2V2DA 1H5YA 3KOFA 4LANA 1OIFA 2EJAA 2Z29A 3JU2A 4QDMA 8XIMA 3QRHA 3VOHA 1PKNA 3G3DA 2E3ZA 2BY1A 4HOXA 3IIXA 4DO5A 1WZLA 4KWOA 3WZ0E 4KETA 4BCEA 3SSZA 4ZFCA 3UVIA 2BASA 4O0QA 2DUXA 2V3FA 3C2RA 1JYNA 1EP2A 3DHFA 1TELA 3MSDA 3WUEA 2D2GA 3MYPA 3R25A 4XAGA 3GYEA 4AY7A 1HKJA 1VGAA 5A8OA 3UR2A 2P53A 3RR4A 4J7RA 5D9NA 3INPA 5KETA 5GJPA 3RAOA 2EF9A 3N1AA 4H7ZA 4E8CA 3AYSA 1PBGA 2ZX5A 4GI8A 4Q8UA 4OKDA 4R5EA 3UWVA 5E70A 4JX5A 4R7JA 4C6NA 1QCWA 2ZXBA 1C29A 1KFLA 5I09A 4G8TA 3MCNA 3VAVA 1IEWA 2QS8A 2QXWA 4IGMA 4LBSA 1QNOA 3KOYA 4PEKA 2XSBA 3QFEA 4HA3A 4C1LA 3BGGA 1RA5A 4U2ZA 3CAQA 1A5UA 3K30A 1BHGA 1G7UA 3WDHA 2OLAA 4Z42C 3TTYA 4ORMA 2PURA 4O1DA 5DRIA 1AVAA 4IUOA 3V5FA 4RNFA 1QOXA 3BW3A 3PK7A 4UCFA 4LAOA 5JBDA 4GKLA 4HU8A 3W84A 4JFWA 3W85A 4Y9MA 3QOKA 3URQA 3REQA 5GNXA 1MEIA 1QASA 2NQHA 3F5LA 3IK4A 2ZFAA 3I3DA 2I9UA 1H50A 4A8NA 3ICJA 1B30A 2PWHA 1GCYA 1RQBA 2JIWA 5I5RA 3C2VA 3PWGA 3TW6A 2XN2A 1W1PA 3F4NA 2V67A 1I60A 4DYJA 4DHGA 3H2NA 2ZXAA 3CV6A 2CHRA 1XWYA 3KTSA 2YXXA 4G5DA 1SSDA 1B3OA 1K4GA 1HG3A 4DJDA 1YHTA 1QJWA 1NDZA 5FA5A 4Q8MA 4U5KA 4IPIA 3C6CA 1UKOA 4WJEA 2ZIDA 1KM1A 1QPKA 2PSNA 1W9DM 3UR8A 4YVVA 4IHCA 1TJ1A 3ZJKA 2AGKA 1C93A 1TG7A 2D0GA 4JNYA 3ZT6A 3WH8A 4R34A 1XYMA 4Q8TA 1LWHA 1ZBWA 4GZJA 2OMAA 3DGBA 4FIQA 1KO0A 3NNTA 1F61A 3E2QA 2YCIX 1V4YA 4L9YA 2IQTA 3NQBA 1H2JA 4Z0SA 3S6OA 3G0UA 1KM2A 3T07A 3NDZA 2Z00A 4INFA 4K2SA 3DYPA 4Y9AA 4B3ZA 1TJ0A 2OQHA 4MJ2A 2V9DA 3EWWA 3V0SA 4IICA 3SN0A 2GDQA 3QY6A 3CUJA 2PD5A 4JYDA 1V03A 2WPBA 3DG7A 4XD4A 1U33A 3GZ3A 2H6RA 1IEQA 5M2FX 2XIBA 1JZ5A 2JKEA 3LNMA 1AQ0A 1JDFA 3DZ1A 2BXYA 5CPOA 4GJ1A 3OJGA 2VFEA 3RGTA 4YHGA 1UA3A 3SGZA 4QNWA 1VFLA 1GQLA 2X0HA 2VEFA 4DIAA 4Q32A 1R3WA 4R88A 3VOIA 4JTQA 2OX4A 3HPFA 3S6TA 1K9FA 4CD5A 3OGRA 3BGAA 1DOSA 1XLFA 1VFUA 5A3HA 3QQWA 4IXXA 1ENUA 2GDUA 1C7SA 1UUOA 1ONXA 5DY2A 3EWYA 4X2PA 1GOMA 4IJCA 1PCWA 1REQB 4HCHA 4H7VA 4AF0B 3U0HA 4XZMX 2PFHA 1FUYA 3IUIA 1XIMA 2WHJA 4XBJA 1EQPA 2DH3A 5H8UA 1FWWA 1Q6GA 3GBEA 4IMDA 3APGA 2WHLA 4LW7A 1Q6CA 3LTYA 3WLSA 3B0XA 4N42A 1EWEA 5FAGA 4NNCA 5DRCA 2QCLA 4GI6A 4AVFA 5XIAA 1IGWA 1PDYA 1V3HA 1VLWA 2Q8ZA 2DSUA 4US5A 3LLXA 4GUIA 4IOTA 1ZPTA 3GLCA 3MDUA 1XICA 4BQ4A 4NYYA 4XSLA 1C8XA 2O7SA 2OLSA 3O63A 2Z1KA 4AXKA 1YMYA 2WNZA 4BY3A 4AY8A 4DUXA 1TVNA 3W7CA 2DZBA 3WQEA 3HQNA 2PDCA 4TV6A 3SRFA 3WD0A 3AXXA 4WF7A 4KESA 1HJUA 1GZJA 4WDXA 3VKKA 4AC1X 1TIWA 4L4OA 2Y6ZA 5FACA 3SEPA 3BLDA 4IQEA 5F4XA 1SJAA 3BMWA 3TAOA 1SJCA 3RRXA 3UERA 1UWAA 1V3IA 3C3NA 4IMCA 3E02A 3C61A 4U2YA 4DI8A 1I2PA 2MUCA 1KFBA 5HAOA 5G2WA 1EC9A 3O6CA 2EPKX 1Q6QA 4Z17A 4EANA 4UMAA 1GVEA 2A5HA 2BHYA 3B9AA 2PDXA 3WDIA 3H7UA 2OEMA 1LF1A 2D23A 3T0BA 2E68A 3ME3A 2OELA 2W67A 3QZEA 4Z2KA 2YCLA 1GTEA 5JQ9A 4DVOA 1OM0A 2DGAA 1BFNA 1X7IA 4KKXA 1M65A 3IPWA 3WJSA 5BWAA 1Q7ZA 1KGWA 2X1TA 4TTGA 5I24A 5C71A 1GQIA 3TZNA 3FCPA 3IWPA 1W9UA 4KWWA 4PBEA 2QQ6A 2R6OA 4PB3A 2IKGA 1HJXA 1W3JA 4F0SA 3RCMA 1O12A 1DIEA 4W7UA 3WBYA 2OB3A 3W4RA 3NPVA 1DJYA 4CQ9A 2QDHA 6TIMA 2MANA 4JQ4A 2VP8A 1KV5A 4XTIA 4LY8A 4YYCA 2VOMA 3DFPA 2DZTA 1QHPA 1DJGA 3VNZA 1QWKA 3CV7A 1KCXA 2DW6A 3GW0A 3PPCA 4H8UA 3MCMA 2QJNA 4K8GA 2IUZA 3SCSA 5M03A 3THCA 1K03A 2W5FA 4S23A 1RCQA 5HWMA 4JTLA 3P0WA 2V0TA 3A13A 1TTPA 4PBFA 2INFA 3TWBA 3AFBA 2WVTA 1U5JA 4I9TA 2OZ0A 4R9OA 1LL6A 3MI3A 1AJ2A 1ECQA 3UY7A 3B9DA 1Z44A 4DRSA 1QTWA 4HOWA 3TLLA 4GYJA 4NJHA 1S3TC 3L0GA 1IV8A 1CW2A 1P48A 2Z24A 2HVMA 1EDTA 4MWAA 4CU8A 4HD5A 3K5XA 1PHWA 4G56A 2D22A 1CT5A 1RUSA 1NVMA 2AMGA 4IFRA 3UZJA 3VCCA 2R82A 1JCYA 3CAKA 4GD0A 1Q4NX 3HG5A 1O4UA 4NG3A 3ZIZA 1JYWA 4JTTA 4M7TA 3WL0A 4WEVX 2WCSA 1DE5A 3NR0A 1QW9A 2VDIA 5KSWA 1DWIM 3SFWA 2WKJA 4D6IA 1GOKA 3BLIA 3BDKA 2YDAA 3NPUA 6XIAA 1QFEA 2VZUA 3GDTA 3UNTA 3PB2A 4MFDA 5DFAA 5KMYA 2NQJA 4UWMA 1VC4A 3KLLA 5A6MA 4GE8A 4P61A 3VNLA 4CGTA 2BX7A 4P8WA 1A80A 3E74A 1EJWC 3CZLA 5TQLA 1H41A 3ES8A 3UQNA 3OW1A 1ZALA 1B3ZA 4JKLA 3WLQA 1UJPA 5F2MA 1R5YA 5EMMA 3EDKA 1RQEA 3F03K 3WQ8A 1FHDA 2WPGA 3AQUA 1X1ZA 1QRQA 3IGUA 5CQ1A 4KRZA 3NPXA 4LX4A 3ZSTA 5A95A 3WSUA 3AUJA 3KP0A 3GH5A 3P60A 3UPMA 3RM4A 3EMCA 4QE4A 3N4FA 1V93A 3CEUA 5CBJA 3S5OA 4AIBA 5LA2A 1BSIA 5G2HA 4LU0A 1J5TA 4JXCA 3S46A 3S9IA 3H2AA 4L4MA 1W3LA 1PE1A 4UMCA 3DKJA 1G6CA 1K02A 3ES7A 1UH2A 4XSMA 3MW7A 3UJEA 5LXEA 1DIKA 2PF0A 2PWUA 4ZL1A 4NT0A 1HZYA 3ZLHA 1PZ1A 1QHOA 2QT3A 1SJBA 3MMDA 4F48A 2Y8UA 2HNHA 3UJRA 2XIMA 4JKMA 3W02A 1IXQA 3E0LA 1LOQA 4ZB0A 5A2BA 4WOQA 1OINA 3CIXA 4M51A 2J7BA 4I5XA 3B0UX 3LUTA 4EXQA 2NUWA 2ZVRA 4L80A 3PZMA 3HA1A 1K3UA 3K8LA 4K68A 1PPIA 4B5WA 2OYLA 3M7SA 1MSSA 1XUUA 2XSXA 1TO3A 1OYBA 3DI0A 4GIRA 1WDQA 2DVXA 2PDHA 2C7FA 4AUBA 3UF9A 3IV3A 4QISA 4DXKA 3N2XA 2DFAA 4O10A 2WWDA 2EPHA 3DC8A 4MNJA 5B80A 2V5KA 1RAKA 1SFLA 1AD4A 5H91A 1CEOA 1W56A 4KEUA 3UXDA 4HNCA 4UMBA 1XH2A 1GWJA 4H3DA 4GY7A 3WF3A 3IJIA 3IJ9A 1CGWA 4RXFA 1KM5A 1FH7A 3AYVA 3AIQA 2PDNA 4B5UA 3GTNA 1EGVA 1XKJA 3W7EA 1XYCA 4XQ6A 3MT1A 4UFIA 4AH7A 8RUCA 5GQBA 2EAWA 3TCEA 1E6SM 1DBTA 3SUUA 3CMFA 1X38A 2QPUA 3QKZA 5AHIA 3GR4A 4AZ6A 2OWWA 4AB4A 3H26A 2ZOXA 1ALDA 1QXLA 5A6BA 4PRWA 3N2TA 3DG6A 3AJXA 3ZOAA 3QHMA 1UBSA 1R6WA 2YBVA 1I2OA 3PBMA 3EKLA 3CUXA 4K36A 5TF0A 1TWSA 3BOXA 3R13A 2BVYA 2P88A 4DZAA 1F05A 3ARRA 1SYTA 3WG6A 4RR4A 2Z6IA 3B9EA 1TA3A 1W54A 1FDJA 1DXFA 1NFGA 4CCZA 3TYCA 4HU4A 4QX4A 1FFQA 2V81A 1PX4A 4EX4A 2YA1A 1EOMA 4M7SA 3GM8A 1US2A 3CB3A 5BCAA 3D3FA 3L5LA 4PSPA 5H1WA 4MAZA 3EPNA 4XK2A 4O1FA 3N04A 2FZDA 2DSWA 2IKHA 4GGHA 4JX6A 2A79A 2JEPA 4F4RA 5T9CE 3TYZA 3DBPA 1E1CB 1MRAA 4JOMA 1ZP4A 1X1NA 1RD5A 4WGHA 2VFHA 5HANA 3W28A 1ISYA 1AQHA 2JGYA 4DN1A