2WW5A

3d-structure of the modular autolysin lytc from streptococcus pneumoniae at 1.6 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
431
structure length
431
Chain Sequence
AAAYWDGDYYVKDDGSKAQSEWIFDNYYKAWFYINSDGRYSQNEWHGNYYLKSGGYMAQNEWIYDSNYKSWFYLKSDGAYAHQEWQLIGNKWYYFKKWGYMAKSQWQGSYFLNGQGAMIQNEWLYDPAYSAYFYLKSDGTYANQEWQKVGGKWYYFKKWGYMARNEWQGNYYLTGSGAMATDEVIMDGARYIFAASGELKEKKDLNVGWVHRDGKRYFFNNREEQVGTEHAKKIIDISEHNGRINDWKKVIDENEVDGVIVRLGYSGKEDKELAHNIKELNRLGIPYGVYLYTYAENETDAENDAKQTIELIKKYNMNLSYPIYYDVENWEYVNKSKRAPSDTDTWVKIINKYMDTMKQAGYQNVYVYSYRSLLQTRLKHPDILKHVNWVAAYTNALEWENPYYSGEKGWQYTSSEYMKGIQGRVDVSVWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights Into Pneumococcal Fratricide from the Crystal Structures of the Modular Killing Factor Lytc.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords 1,4-BETA-N-ACETYLMURAMIDASE
total genus 132
structure length 431
sequence length 431
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
A PF01473 CW_binding_1 Putative cell wall binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2ww5A02
5HPCA 1QI2A 2WZIA 4MNMA 2X09A 1E6NA 2GDVA 1NOFA 1ITXA 3VU2A 4CD6A 2WANA 4PMXA 3BAIA 4AEEA 1UR2A 5JUVA 2D3LA 1I1WA 1PAMA 1KQZA 2VQTA 1GONA 2E4TA 3L2MA 5A6BD 3TTSA 1FOBA 3VX0A 4WKAA 2V3EA 2OYMA 1KWKA 2XIBA 1X6LA 5D9PA 3WDPP 4PSRA 3DHPA 4JL1A 4CD5A 2FGLA 5E70A 1R87A 2DQXA 1J11A 5A6BA 1R7OA 4CCEA 3AHZA 1MW0A 2CITA 2WVVA 1BFNA 5TD4A 4PMOA 3EYPA 1ZBVA 3ECQA 4GXPA 3GZAA 3M7SA 4AD3A 1LLOA 4A4AA 2BHZA 1LJYA 1ODUA 3ZO9A 1OINA 3ZJ6A 1CEOA 3VIIA 3W4RA 1EQCA 3CTTA 2A3HA 1CXIA 4UQEA 4AD2A 1X1NA 1HKJA 3NUKA 3MV01 3L4WA 4OUEA 4AISA 1C90A 2PWDA 1GQJA 2OSXA 5A6MA 4PTWA 1E1EA 1VEMA 1F4HA 3K46A 2VT0A 3PTMA 2PF0A 3CZEA 4JHOA 3II1A 3QHOA 4BA0A 4KGLA 1L8NA 3WEZA 4GI8A 1GHRA 1LF1A 3VD9A 1BGAA 4RE4A 2E0PA 3ZR6A 3JUGA 3TOPA 4AD5A 2CETA 3GH4A 1C3FA 2A3BA 1QI3A 3GXMA 1JF6A 3NJ3A 3VGBA 2XFYA 3MMDA 3W6LA 3SURA 2GFTA 4MJ4A 4NF7A 1U33A 2WSKA 3A4XA 3L4VA 4AZHA 1W1PA 3WUBA 2OLHA 2J78A 1EO5A 4OJYA 1EDQA 4W7UA 2JIWA 1V0NA 1VFFA 5M03A 1QW8A 3BXWA 3AOFA 2CKSA 4B9YA 1C92A 5E0CA 1D7FA 4N0RA 1H49A 3UETA 4FLOA 4XUYA 2Q8XA 1GOQA 3ZIZA 2JEQA 4X9YA 1VFOA 4P8VA 3POCA 4HOWA 3ZT7A 5AC4A 1ISYA 1NWTA 5D8ZA 3M46A 4W87A 1QNSA 1E5JA 4CD7A 5C70A 5IDIA 4DUVA 4TX8A 3VIGA 1WB0A 4JKKA 5A3HA 1PIFA 1PX8A 4JAWA 2YDRA 1RH9A 4D6CA 3AQUA 1HJUA 4RL3A 5FD0A 4EANA 1DWJM 1C8QA 1J18A 1CECA 1KR1A 3UG5A 3THCA 3QHMA 1BYDA 4M80A 3TA9A 5BXTA 4QFUA 2HVMA 2YJQA 3CUJA 3MUIA 1TMQA 2WCAA 3W27A 1CGUA 4CVUA 1ZBCA 3VD7A 1GOOA 3CBWA 2VMFA 3W26A 2VR5A 3BLKA 3BAWA 3N15A 1W9BM 3PZOA 4NRRA 2PWEA 3NCOA 2F8QA 3SUVA 5JIPA 1MW2A 1E6SM 4D71A 5A8NA 3L2LA 1L0PA 1TCMA 4HOXA 1PPIA 4MPKA 4P8UA 1CGYA 4J28A 2EJ1A 3CUGA 4PMZA 2YA1A 5CZKA 1R85A 1W9PA 3OZOA 4IISA 1RP9A 2GSJA 3VIJA 2YDQA 4ACZB 3ARVA 3K4DA 5GNYA 5IHSA 1JDCA 3AIQA 2YL9A 4OOZA 4GI6A 2W92A 3N17A 1UZ4A 2VOTA 1W2VA 5DF0A 4B9ZA 4UZUA 2VL4A 4HA4A 1I1XA 1B9ZA 2EEXA 1J01A 2CPUA 2UY3A 4Z2HA 4JCLA 3AS3A 1NP0A 3EMZA 5CGMA 1JZ7A 1H4PA 2VVNA 1OGBA 3WBAA 2Y4SA 3M6DA 3MMUA 4CGTA 1MVYA 2E9MA 4JFSA 3BMWA 1UWSA 3PBGA 2XVNA 5CJ5A 3QHNA 3UG4A 2W66A 4JFVA 3W82A 3WD4A 3S6TA 1EQPA 1OT1A 1TVNA 4C7DA 4IPLA 1LG2A 3A6OA 1H1NA 1W2PA 1E71M 1G5AA 2AMGA 1OD0A 3BSGA 4HTYA 4ACYA 1OIFA 1HIZA 4KRUA 1MXGA 3RIKA 1E0VA 5EMYA 1W91A 1JXKA 4AW7A 3N12A 3WD3A 1U30A 3KE0A 2J8FA 1DWAM 2X0YA 1QPKA 1PX3A 2D3NA 4TUFA 1H0GA 2JIEA 3RM4A 3AMDA 2W67A 1Q4NX 2YA0A 4DWSD 1HKIA 1OGGA 4TVDA 1B2YA 4YPJA 3WDHA 1G94A 1XGZA 2OSWA 3AZSA 3ARYA 2WLZA 4L4OA 3WQ6A 3CZKA 5HBFA 2DIEA 4WKFA 2BVTA 1CIUA 5EFDA 3I3DA 2G41A 2WMKA 1XD1A 4D6HA 4GQQA 3BCFA 3CPUA 1US3A 2ZXQA 2J7DA 1U2YA 3K8MA 1UR0A 4X0NA 4F8XA 5I3DA 1B1YA 4KRTA 4ZEPA 3IAQA 1X6NA 2OWXA 3QR3A 4GQRA 2DEPA 4P8WA 4D72A 4PMDA 1F4AA 3T0AA 2D0GA 3AICA 4FLRA 5I0DA 1YQ2A 4U3AA 2V3DA 3VGFA 5A8OA 3T2QA 1J10A 1DWFM 1C8XA 4UZSA 1A47A 3OBAA 3WSUA 1UR1A 2YLLA 2WB5A 4FLQA 5DT5A 2C0HA 1PEZA 2NT0A 3RM8A 4JL2A 1N82A 5CLTA 1UH4A 1G01A 2G3JA 2UY4A 3ZM8A 5IXEA 1M7XA 3WF4A 1V6VA 1ZBKA 2WMGA 2EPKX 2IXUA 4U5KA 4OBSA 3PZUA 5BROA 3GBDA 4PEEA 2YBTA 4CU7A 4C7FA 3VIPA 4AIUA 3A3HA 1ISZA 5BRPA 3N13A 3UR7A 1KXVA 2Z1KA 3LMYA 4ML4A 4CU6A 3AIVA 2VJXA 1EIBA 1UQZA 4GO9A 2DT3A 2W4XA 3G6LA 2WVSA 2BXYA 2IXVA 1E55A 3AHVA 3VD4A 5A2CA 3VDHA 2YL6A 4Q22A 1OIMA 1UHVA 2VZTA 4UFJA 4ATWA 2XVKA 1ZJAA 1EXPA 1FFQA 1UWIA 1WE5A 3GXDA 5A6KA 3N9KA 2WMHA 2JEPA 3WF1A 5HPOA 2D2OA 4P8XA 3VIOA 2VX7A 4TTUA 4IM4A 3GBEA 2EPMX 2DT2A 2XVPA 3AS2A 4JFTA 4W8BA 4XV0A 1AQMA 3AMLA 4E8CA 4M8UA 3WBEA 1JZ3A 3GXIA 5BRQA 4CVWA 3J7HA 2ZUSA 2V38A 3FAWA 1EH9A 2J4GA 1LWJA 3WD1A 1GCYA 2PBOA 2WC4A 1JZ4A 3OGRA 3AS0A 3VM5A 1MQRA 1J0JA 3DYPA 2XSBA 2J62A 3DHUA 2XYLA 4HZ6A 1H2JA 5ABEA 5I5RA 3FY1A 3NDZA 2GJXB 3CH9A 3IANA 3WH8A 4C7GA 2NT1A 1B31A 1B30A 3EMCA 3ZT5A 1MQQA 3AROA 2ZX7A 3LPPA 1GJUA 4NZCA 4X0VA 3A4AA 3W28A 2GJRA 3VIFA 1NH6A 2DIJA 5EFFA 3SCPA 2D23A 3VILA 2WW5A 1SR0A 3RDKA 3NDYA 3CMJA 4DM1A 2ZX6A 3ZJKA 3OLGA 3WUGA 1LL6A 2V5CA 4CCDA 1W1TA 4MB1A 1E6ZA 1CXHA 1HT6A 2FDMA 1WZLA 1UD6A 3KL3A 4PMYA 3L4YA 4HMEA 5I79A 1CPUA 3ARPA 3PTKA 3AMKA 2WMIB 4JHZA 3DECA 2JFEX 3UEQA 1CXKA 4PCSA 3N11A 2PWHA 7A3HA 4W8LA 1GUVA 2WBKA 3POHA 3NSXA 4EKJA 4GZJA 4WJXA 3IJ7A 4D1IA 1QNQA 4V28A 3N1AA 1IV8A 3KWXA 3VDAA 3I3EA 4DUXA 1EGZA 3IAPA 1QNRA 1FH9A 4P7RA 4WF7A 5LA1A 1QI5A 3WY1A 1OSEA 3NYDA 5HOSA 1HL8A 4UOJA 5GNZA 3MUAA 3W37A 2VCAA 4UNIA 3BH4A 1EO7A 1NOWA 3BMVA 2E40A 1E0WA 5A2AA 1W3KA 4HOZA 1CLVA 1Z32X 1CGTA 3O6AA 5I2UA 3MUZ1 3ZR5A 3O9NA 3VDCA 3CUFA 3EDJA 4W7VA 2XHYA 4J3VA 3U7VA 1CYGA 3SUUA 4HMDA 3GH7A 1QHPA 2J74A 2WXDM 4D6FA 3KEHA 1GJWA 2BXZA 4H7VA 1J12A 2WWDA 5A2BA 1UKPA 3MUY1 4JKMA 2D0FA 3SUTA 1ISXA 1TA3A 3RM9A 2DSUA 4QLJA 2BY2A 3EDDA 3PZNA 1IT0A 1JAKA 1RD6A 2GK1A 4OKDA 1ZB5A 1TG7A 3VMPA 1JG9A 1W3JA 3IK2A 3AS1A 1UD3A 1D2KA 4F79A 2PI6A 4LXFA 4HPGA 5EB8A 3SEPA 1PJ9A 3AYRA 2EPNA 2V3GA 3K8LA 3W6MA 4J3UA 5HDRA 1TZ7A 2J7CA 2WBGA 1JZ6A 5GQBA 3WDQA 2WK2A 3UR8A 2G3IA 4FMVA 3LPFA 4M1RA 1HKMA 4ATLA 5FKYA 2J8GA 1GVIA 4UFLA 1JNEA 2F2HA 2IUZA 2CBUA 3IJ8A 1V08A 3WL0A 3CHDA 2DH2A 1KQYA 1TUXA 5GNXA 5JBDA 4MB4A 1XYZA 4BS0A 2YA2A 4RE3A 1BVZA 4GZIA 2ZUNA 4W93A 2NSXA 2D24A 1JYWA 1M04A 1KR0A 4CN4A 3K1DA 3MS8A 5E9AA 2QMJA 1OM0A 5I24A 2EXOA 4TX6A 2XWDA 1VAHA 3FAXA 3W25A 3L4UA 5AYBA 1V03A 1MFUA 1QHZA 2WMJA 1OWQA 3A4WA 1H41A 3WD0A 1E72M 3W38A 1A3HA 1UH2A 2ZIDA 2VRQA 2YKKA 1JGIA 1GOMA 2G3MA 4A3YA 4MNJA 4D6IA 2O9TA 2VTFA 3VD5A 3FNDA 1UZ1A 2VO5A 4KMQA 3VGGA 1XV8A 3AIWA 3OLIA 1QBAA 2J77A 3RO8A 3SCTA 3O2LA 5ABFA 4Z2GA 1WDPA 5A95A 1GQKA 1JD7A 2JE8A 5FCZA 1KGWA 2W5FA 2Y24A 2V3FA 1K9DA 3TTOA 1J0KA 1BVNP 1FP9A 9CGTA 4EAMA 1XYFA 3AIBA 3ARWA 2WCSA 3N18A 1V0LA 1XH2A 4AWEA 1E56A 3SCSA 1C7SA 1OB0A 2PBGA 1CLXA 1OCQA 4WSKA 4KWUA 3CLWA 1ODZA 3TONA 2WVTA 1KGUA 3WF3A 1XSKA 4XB3A 3VTRA 3WDIA 4CD8A 1W9DM 2J7EA 1LWHA 3MKKA 1V3IA 2J79A 1HJSA 3ARUA 1QBBA 1JIBA 1W9XA 5I77A 4IUGA 4NI3A 2XM2A 1E3ZA 3SIMA 4JFUA 4NRSA 1VBRA 2X2YA 4E2OA 4MDOA 3BC9A 1E4MM 3VPLA 1CTNA 2CCRA 1I75A 2WSPA 4D6JA 4MNLA 2VCCA 2XIIA 3PN8A 1VJZA 2G4FA 3CZJA 4U2YA 3PZMA 2J7BA 4IPNB 1KBBA 5JBEA 1DWGM 4M81A 3WMBA 2CBIA 1WKYA 4UCFA 6CGTA 1QNPA 3WNLA 2ZICA 4CUCA 4U5IA 1ZU8A 1PX4A 2DSVA 2QPUA 4YHGA 4L4PA 2WHJA 4GPNA 3ARSA 4QLLA 1XC6A 4AZIA 4UFIA 1CDGA 4UOQA 4F66A 3VGHA 5DMYA 3GNOA 3UESA 1NM9A 3PZ9A 1UKSA 1NP2A 4CD4A 1TFVA 1WAWA 2DPEA 4P7LA 4DWSB 4DWSC 4ZFMA 2O92A 4AZ6A 4UOZA 5FOOA 1KCKA 4M56A 1XH0A 4J3WA 1ZBWA 2EO7A 1HXJA 3B9DA 1MW3A 4HZ7A 1KGXA 2VZOA 4AZCB 1ISVA 3TTYA 1HP4A 3T08A 5A8MA 3RCNA 1E9LA 1XD0A 5ECUA 2J75A 2CHOA 4EK7A 3AMGA 1J0ZA 1E6QM 2DT0A 4GO8A 1XCXA 1Y7VA 1V0MA 3SCQA 2Y8VA 4LQ1A 1GORA 3SCNA 4UQCA 1Q6FA 4GKLA 4M82A 3CMGA 5M3WA 5D8WA 2E9BA 4WLCA 1V02A 4AD4A 5CXPA 2OSYA 1WZKA 2WVUA 3L4TA 3SUWA 4F9JA 1AQHA 4PMRA 4BQ3A 3B9EA 1UD8A 1NWUA 1QVBA 1BYCA 1TE1A 2JF6A 1ISWA 2W91A 1R86A 2WCGA 3SCVA 3ZJ8A 3QOMA 1QNOA 2CXGA 4DUWA 4PUDA 6A3HA 3CZLA 2PB1A 4AXNA 2GUYA 1J0IA 3DYMA 4NSBA 1E40A 1E1FA 4ZENA 1KXHA 4WSJA 1CZ1A 1VBUA 3GXFA 1W3HA 3WH6A 2WZEA 4FF5A 2GK1B 4UTFA 5CSUA 3WF0A 4CN6A 2ZUMA 5EBAA 1FHDA 1B0IA 1C7TA 3CO4A 4MB3A 3VVGA 4OBRA 1KBKA 1UKQA 1V6XA 3FW6A 1E15A 3VDBA 2VR4A 1K6AA 3RPMA 3PZTA 2NW0A 4PTMA 2ZE0A 5DO8A 4PMNA 1E6XM 1UA3A 4QAWA 4B3LA 3KZSA 3ALFA 3ZT6A 2RGLA 4HP5A 1OGSA 2Y5EA 1XSJA 3EDEA 1HNYA 3WQ8A 4TTGA 3EBVA 2BS9A 1UH3A 1QOXA 4TOQA 4ZXOA 4HZ8A 4URIA 4FK9A 1R8LA 1WDSA 3HU7A 1BGGA 3B8SA 4E8DA 1VIWA 1WDRA 3UCQA 3KL5A 3CHCA 3ZQ9A 5CPTA 7CGTA 3VIMA 1HL9A 4H2CA 1E5NA 3CUHA 3U7BA 1FP8A 2FHFA 1JZ8A 3HMCA 5A6SA 4BQ2A 4U2ZA 4HA3A 2J47A 3W29A 1JXJA 3RJXA 1BTCA 3CZGA 1KB3A 3GNRA 2DSKA 2DDXA 2D0HA 1V6UA 1VEPA 2CHNA 2OWWA 1GOIA 3GTNA 4V2XA 3OGSA 3WNPA 2YOCA 4D6DA 1W3LA 2XJ7A 4UQ9A 1SMAA 1B3VA 3I3BA 4D1JA 3WMCA 2GDUA 4XX6A 1EHAA 3VIKA 1GNXA 1AVAA 2FH6A 2ZXDA 1JAEA 4N42A 1H5VA 3VO0A 3GH5A 4LGXA 3WNKA 5AY7A 4J3TA 3BAXA 4ZE4A 1NARA 2XFRA 3MSGA 2G8ZA 4H8HA 3EDFA 1DTUA 1UD2A 2ZUWA 4DWSA 3VNYA 3RMEA 2AOSA 2WC7A 5DEZA 1W1VA 2C8NA 1XRVA 1PZ2A 1VJSA 1E4IA 2J7FA 1JDDA 3D3AA 5A6JA 3AIRA 4Y7EA 1VFMA 5A8QA 4CKQA 3IJ9A 3VGDA 4MAZA 3PZIA 2CERA 5AC5A 4W88A 4J3SA 3MMWA 2BY3A 4W8AA 4MAVA 3WQVA 2WNWA 4OOUA 2W61A 1EOMA 3K8KA 1VB9A 1VEOA 2VVSA 1MWOA 3PZQA 2BNJA 2ZWZA 4U3CA 2GVYA 1HN1A 3WIJA 2XSAA 1NWRA 3EMQA 1QI0A 1GVYA 3WH9A 1V3LA 4U33A 3E1F1 4DM2A 2E8ZA 2ZOXA 1FA2A 1XSIA 3SCWA 2EBNA 4HU8A 3AHXA 4GI9A 4QP0A 2A3AA 4MTVA 1WP6A 4J7RA 2UY5A 4UQBA 1XCWA 4Z2IA 2ZXAA 3VGEA 3LPGA 4UFHA 2V5DA 5JIWA 4AC1X 4AYSA 1LL7A 8A3HA 1TA3B 1O7AA 3GNPA 1FHLA 5DT7A 2YBUA 5BWFA 3CHFA 3WQ5A 2E3ZA 3WH5A 4ATDA 1CXFA 1SMDA 3WFZA 5A1AA 3CZ8A 1WPCA 3WNNA 4Z2KA 3RILA 3WMSA 1V3JA 4FLSA 1KWGA 3RJYA 5M17A 3PZGA 2DSZA 1J0HA 3EDKA 1DHKA 1BYAA 4BQ5A 1DEDA 4EE9A 1KXTA 3M07A 4PRWA 2FHBA 2W62A 3A47A 1UR8A 1E3XA 1B3YA 2ZX8A 4QCFA 2WHLA 4AMCA 1EDGA 3HJEA 3UERA 1CXLA 3WDRA 2C7FA 4H8UA 3VINA 2FH8A 4CCCA 2YL8A 2ZUVA 5BYWA 3U5UA 3ZSTA 1UWQA 4JCMA 4AZBA 4ZE5A 1PZ3A 4MNKA 3OB8A 3TTQA 1UA7A 1JDAA 1HJXA 1UD4A 4HPHA 1S46A 5ABHA 1QI4A 2D22A 2BVDA 1UR4A 1ECEA 1HKKA 3CHEA 3ARQA 5D9NA 1R7AA 1E73M 1B3ZA 3AJ7A 1DP0A 4B3KA 1CBGA 1B3WA 3OLEA 3AZRA 3W81A 2RGMA 1UR9A 3OA5A 4E4PA 2XM1A 2YIHA 3AIEA 1JZ5A 2XTKA 4PYSA 1MXDA 5DFAA 1ITCA 2XFFA 2Y8KA 3KL0A 1GQIA 5HNNA 1G9HA 3BLPX 1Q6EA 2O9PA 3AMCA 1Q6DA 4ACZA 4MADA 2CIPA 5CGTA 2OYLA 1BYBA 2XWEA 3S2CA 4BQ4A 4LYRA 4W5ZA 2DT1A 3GM8A 4PCTA 2WPGA 4F9DA 3CGTA 1VFUA 3DYOA 4R5EA 1G0CA 3LPOA 1EHNA 4AEFA 1HVQA 2DH3A 1TVPA 2XUCA 2E8YA 4KGJA 3CIVA 1BAGA 2MANA 2CEQA 1JFHA 1DWHM 1V3KA 1G1YA 1H0IA 1C91A 3NSMA 4PUEA 1H3GA 4BF7A 1LG1A 3WUEA 1CWYA 2J7GA 1J9YA 2BY1A 2XVLA 1M03A 2D1ZA 5LA2A 3HN3A 3PTQA 4WK9A 1WZMA 3FHAA 3ALGA 5IFTA 2WZHA 3ARXA 3AXXA 1E6RA 1UKOA 1BHGA 3WQ4A 1EOKA 4AZ7A 4R27A 3F5KA 3BAKA 3K4AA 3BAYA 1W9VA 5CSYA 1KXQA 1CGXA 4M29A 4B15A 3N04A 4ZXLA 1JYVA 3MO4A 4M24A 1SFSA 3F4VA 3F5LA 4W86A 5CG0A 4K68A 1YHTA 1MFVA 1E70M 4PTVA 1LQ0A 1ESWA 3AXIA 4J3XA 3ZSSA 5FIPA 2EPOA 1GOKA 3ZMRA 3THDA 2ZWYA 3F5JA 4JKLA 4HU0A 3AI0A 4OZOA 4U31A 5E6ZA 3WN6A 1EDTA 3AIUA 3B9AA 1UYQA 3SCRA 1M01A 2O9OA 4AZCA 1OD8A 4CU8A 1K9TA 3L4ZA 2X0HA 1CGWA 2OWCA 2QMKA 2Y2WA 1XH1A 1NQ6A 1UQYA 4PMQA 2WKLA 3OG2A 4W89A 2A3EA 2QV4A 3WENA 2ZUUA 1BLIA 1JFXA 4MB5A 1BSIA 1FFRA 5D9OA 4D6GA 2EQDA 3AFBA 2XVGA 1UWRA 2W63A 2VZUA 4PMUA 3GDBA 5GPRA 3WNOA 2BHYA 2PC8A 1P6WA 5CLWA 2D20A 5ABGA 3T0DA 1VRXA 2CBJA 1HJQA 2VRKA 1J0YA 1FH7A 2JF7A 2PWFA 2BVYA 3VD3A 4S3KA 5BCAA 2XGBA 3MV11 4OIFA 2HISA 4AY1A 1W1YA 5I23A 5M5DA 2CYGA 3W0KA 5IHRA 1WNOA 2WMIA 5JBFA 5CPQA 4P7OA 1AMYA 1FH8A 2WC3A 3WEMA 3ZOAA 3TP4A 2UY2A 2OYKA 3ARTA 5A6LA 2X1IA 4Z2LA 1O6IA 2XG9A 2A3CA 5ABFB 3WELA 3OLDA 5E09A 3WL1A 2VQUA 4QLKA 2FHCA 2WYSA 2GJPA 2ZXBA 1RPKA 3VKKA 2X05A 4PN2A 4WIWA 5FL0A 2JALA 5D4YA 4TVCA 1BG4A 4HA1A 4V27A 3PZVA 2ZUTA 5A94A 5KEZA 3WQWA 1IZJA 2J7HA 2WMFA 4JZ5A 4JFWA 3U57A 2AAAA 3WEOA 3NIYA 4UQDA 3VMOA 1CGVA 5CQ1A 4GINA 4P7QA 6TAAA 4BZYA 4CN1A 2WVVB 1HX0A 4PMVA 4HMCA 1HJVA 1B3XA 3CUIA 2QLYA 2YL5A 3BSHA 4Z2JA 1US2A 5BXSA 2QF8A 3ARZA 3QOKA 2ZX5A 4AZGA 5LYRA 2XPKA 3WD2A 1JL8A 1HP5A 1GHSA 1PBGA 1W32A 1W9UA 2DSWA 3T2OA 1UUQA 2BV9A 3OZPA 1D3CA 5HXMA 3WDJA 1WCGA 4W5UA 3AHYA 3MSDA 1JI1A 4QCEA 3FN9A 1NOUA 2VRJA 1E43A 2VUYA 1SYTA 4BCEA 1H11A 5CPSA 1TR1A 4YN5A 5E6YA 1XHGA 3FXYA 3WF2A 1BF2A 3QGVA 3AZTA 1HF6A 2ZX9A 2QPSA 2CKRA 3OGVA 5FL1A 4YHEA 1UD5A 1ZJBA 2UWFA 5KZ6A 3W24A 5C71A 2VX6A 2WLYA 4D6EA 2G3NA 1E0XA 1E4LA 3MU7A 1HJWA 5I78A 4UFMA 4GIAA 1V02E 1UKTA 3SCUA 3VOCA 1PIGA 1VENA 1JZ2A 1BPLB 5E0FA 3W53A 1MW1A 1WO2A 2FGZA 4UR9A 1JYNA 1UWTA 2VURA 3FHQA 1IZKA 1LL4A 2WAGA 4S3JA 2WM0A 2YLAA 1BQCA 1UWUA 2WHMA 3AYSA 5F7UA 2VC9A 5A8PA 1AQ0A 1WZAA 1Q6GA 4LYPA 2QHAA 4XZWA 1KFWA 3MANA 1GOWA 3BGAA 5IFPA 4H8VA 1RP8A 4AD1A 4W7WA 4J27A 3DC0A 1BG9A 3UG3A 3VIHA 3WNMA 1M53A 2WWCA 1UG6A 3SUSA 5I6SA 8CGTA 2GJXA 4LX4A 1MYRA 5BXPA 1HVXA 2VZVA 3BAJA 1UOKA 1JYXA 3ARRA 1H09A 1JF5A 5AYIA 4LYQA 3WH7A 2VX5A 2PWGA 1ZS2A 1Q6CA 1GZJA 3ZJ7A 2CNCA 1MQPA 4LPCA 3VMNA 4GZEA 4W85A 4MDPA 3VNZA 2VZSA 7TAAA 4H41A 3WFLA 4UQAA 3GYCA 3WUFA 1C93A 1WDQA 3AISA 1K9FA 1B90A 3BCDA 2O9RA 4JIEA 4PBGA 1DWIM 1VF8A 2CESA 3T0BA 1EA9C 1V3HA 4P7NA 1V6YA 4KH2A 2E9LA 4AZ5A 1V6WA 2BHUA 2VI0A 2XGIA 2EPLX 4AIEA 2DGAA 4MJ2A 1ZL1A 4RE2A 4AIOA 2VX4A 1NWSA 3U5YA 3APGA 4XZBA 4A3HA 1QW9A 4UFKA 5A6AA 3SCOA 4PSPA 2WHKA 1JNDA 3G6MA 5LA0A 4TXEA 2VNCA 1OBAA 1KCLA 1CENA 1JI2A 2J25A 2YDSA 1CXEA 3AXHA 3VUPA 3NSNA 1E6PA 3T2PA 3VM7A 5BXRA 3PHAA 1OT2A 1JD9A 2CBVA 1GQLA 3OIHA 4Q7NA 2Z1SA 5D9MA 3WKZA 1GW1A 1QHOA 1K9EA 3L4XA 2B31A 2F61A 2WKGA 4WKHA 2ESCA 5A69A 1CNVA 1GPFA 4AD0A 1V0KA 4TVUA 2BFGA 1E4NA 2TAAA 1C8YA 3VX1A 5C8BB 4PTXA 4W84A 1V3MA 2VCBA 4H04A 2BY0A 2X8RA 4B16A 3T09A 4QDMA 3D5HA 3AHTA
chains in the Genus database with same CATH superfamily
2Z6JA 5I3KA 3B0PA 4F0HA 2WZIA 4NYUA 2X09A 5AYYA 4MWAD 2PE4A 4CCZA 3UGVA 2PGEA 4PMXA 3TNBA 1KLYA 2PRLA 2V3EA 2OYMA 1KWKA 3V5OA 4DEFA 3VFLA 3B0VC 3TE9A 4IQDA 4JTGA 4QG8A 3S1UA 3GDTA 1R7OA 4LANA 2WVVA 5TD4A 3VCNA 4KFNA 1ZSXA 1ZALA 5K9CA 4TV6A 3T55A 1LLOA 3UA3A 2GGJA 4CQCA 3ZO9A 2FB3A 1IIGA 3VNKA 4NYYA 5D02A 1UCWA 3NVTA 1LORA 3TSMA 2Z4GA 1P0DA 2Y1HA 1GW9A 4UQEA 2VWTA 2E6FA 3RK8A 1C90A 4HU3A 2NXGA 1VHNA 5A6MA 4UWMA 2POZA 1AJZA 4PTWA 1E1EA 1VEMA 3MCNA 1TE6A 4L64A 4JHOA 3CB8A 4IL0A 1OCJA 1K03A 1M7PA 4GI8A 3VD9A 1BGAA 2ZBTA 3IRSA 2A2IA 4ZBCA 2H90A 4AD5A 2CETA 2DZXA 1QI3A 3GXNA 3VYLA 3MMDA 3W6LA 3WBXA 3WK1A 4NF7A 3LLDA 4DO4A 4GBDA 2XFWA 4AZHA 2ZFAA 1W1PA 3LV5A 5D04C 3W83A 2OLHA 2PP3A 1DIDA 4W7UA 4M6VA 3W1LA 1SJAA 1QW8A 3LYEA 3SGGA 1XJBA 3EA1A 2UV8G 1R9ZA 9XIAA 2PTDA 1C92A 3S4TA 4FLOA 3ZIZA 2AQVA 2YR1A 3W7OA 4P8VA 3P82A 5AC4A 1AK5A 4DPQA 1NWTA 5D8ZA 1PS9A 4YL2A 5BWAA 4W87A 1E5JA 4NAEA 5C70A 4TX8A 5EYWA 3SRKA 5A3HA 3C3UA 4Q7IA 4I9AA 2A6LA 2GQAA 4YJ5A 3TIMA 1H5YA 1C8QA 1ZQ5A 1J18A 2OELA 4JQAA 3THCA 4RDYA 1TJ2A 4IP7A 1F3XA 2P1FA 4UMCA 4PFHA 3CL6A 4O16A 5FAGA 3VD7A 1UASA 5I03A 3QVQA 4HT3A 1O1ZA 4NAFA 2VMFA 3BAWA 3N15A 1W9BM 4Q8QA 4TQTA 1DJWA 3NCOA 1XL9A 2H9AA 3TN6A 2R91A 1MW2A 3FVDA 4D71A 5A8NA 1FX6A 2VFEA 1L0PA 4H9UA 3SW6A 2G37A 2EJ1A 4DO7A 1TPWA 4Q8NA 3QSTA 1R85A 3KP0A 4NP7A 1F6YA 4CEUC 2ASHA 4ACZB 3CNYA 5IHSA 1JDCA 2W92A 1EA0A 1K8XA 1PE1A 2VL4A 4HA4A 2AKMA 3ABSA 3GU1A 4JCLA 1XRSA 4AWSA 5CC5A 3LHYA 1H4PA 2R1KA 1OGBA 3FKRA 3M6DA 2Z2BA 3BMWA 2W27A 4A3RA 1NFGA 1N7KA 6ENLA 3OJGA 5DRCA 4IPLA 3EX2A 4Q8MA 3BURA 4FB7A 5TAOA 1G5AA 3BSGA 1YXDA 2PTZA 3W75A 4KRUA 1MXGA 1W91A 1IE7C 1PHWA 5AHNA 2Q01A 3WD3A 5DCEA 4C60A 4KQNA 1TKKA 4TUFA 1F3TA 3G2GA 1XCFA 3TVAA 1S2WA 4PTDA 1OGGA 4YPJA 3WDHA 4IGNA 2QGYA 4L4OA 2BVTA 5EFDA 2G41A 4TMCA 3LI0A 2YCIX 3FGCB 1OFDA 3IVSA 2FFCA 1F61A 4E2BA 1U2YA 4N4QA 5PTDA 2WQPA 4ZEPA 3QFWA 4W9TA 3BVJA 4GUGA 4A05A 4J2PA 2BVWA 4GUJA 4L65A 3QC0A 4A2RA 2DEPA 4P8WA 1F4AA 2PD5A 1EGVA 5I0DA 3EAUA 2B0MA 3VGFA 1J10A 2J13A 4LAMA 1A47A 5DX7A 1PEZA 3RM8A 3R79A 4JL2A 4O15A 1HQTA 1EWDA 1QT1A 4OV9A 3NXFA 1ZBKA 6REQA 5F2LA 3S83A 4EOUA 4LAKA 4PEEA 2YBTA 1A5CA 3IJ6A 3VIPA 5BRPA 1KXVA 1RXOB 3L5AA 2VJXA 2DT3A 2ZZ2A 3VKBA 3G6LA 3PB2A 4W4QA 3N4AA 3U6WA 3O0KA 4K7VA 3VD4A 1GZ1A 1OFOA 1J2WA 4FOKA 4UFJA 4ATWA 4FX8A 2XVKA 2A7RA 1WE5A 4UTWA 3WJWA 2WMHA 2XZ9A 4R3UA 2R1PA 4KWSA 2Z28A 4H6EA 3VIOA 2VX7A 3SGUA 4ZTYA 4E4FA 3GC5A 3S2NA 1XDMA 4M0XA 3H2OA 2RDUA 1X39A 4BF9A 3WBEA 3GXIA 3WLQA 4A21A 4CVWA 3GFZA 2ZUSA 1ZY9A 3FAWA 3TAKA 5D09A 3KVJA 2O0TA 2V0TA 3WD1A 1GCYA 2WC4A 2FZBA 3AS0A 4CQ8A 1J2BA 1U5VA 3W7KA 5I5RA 5K9XA 4NZ3A 1QW7A 4KCWA 1EKOA 3IANA 2QDEA 4C7GA 4CEXC 2I57A 1Y5VA 4TV5A 3LPPA 1OFQA 1CT5A 3C2YA 2GYIA 4K8GA 3O16A 5G4EA 4MKNA 4DQWA 5AHMA 4ZO9A 4DM1A 3WUGA 1LL6A 2OX4A 2QXWA 1AG1O 2CC0A 1CXHA 5KZEA 1HT6A 2IKGA 4XAPA 1RLCL 5LNWA 1ENUA 2BOEX 3IIPA 3W7MA 2QCGA 1ADSA 1S2UA 2YW3A 4MG4A 1YADA 5I79A 2WMIB 1CXKA 2OZ0A 3SO7A 4C6FA 1EJRC 2KAUC 1VBGA 4NZ1A 2ZRYA 3NSXA 3IJ7A 1A5OC 1D3GA 5M2FX 5HQLA 9RUBA 3H4GA 3N1AA 3ATYA 4IHCA 3P6LA 2F6XA 4PODA 3FJ6A 2GOUA 3U2OA 3A24A 3LENA 3CUZA 1V77A 1NF7A 4OTKA 4XZLX 2LLEA 4DJEC 3MZNA 4B3ZA 1A80A 1TV3A 3TQPA 3CK5A 1EO7A 1OEPA 3BMVA 3PJTA 2E40A 5HJLA 4HOZA 5F1VA 2ZRUA 3CU2A 1IF2A 3GWQA 3ZR5A 4MM1A 4R88A 2NQ5A 4US6A 4HSOA 4W7VA 4J3VA 1CYGA 2XIOA 3PWIA 3HOJA 1EJXC 3OEXA 1J12A 4WRHA 2IQDA 1K7EA 2QDDA 4O8RA 1UKPA 4DJFA 3L65A 3IUHA 1KM1A 2YXOA 3THUA 1A0DA 3RM9A 2DSUA 4QLJA 3PFRA 2GK1A 3FIGA 3MHFA 1ZB5A 4OKDA 4GYPC 4HVXA 1DXEA 1XRFA 4AU0A 1AH0A 1TZ9A 4GIRA 1W3JA 4ZB2A 4HHLA 1UD3A 4F79A 1NU5A 4HPGA 1ZZMA 5A8GA 1PJ9A 3AYRA 3WX7A 3NZPA 2V3GA 3CAQA 2VM8A 4XTIA 3WJYA 2WBGA 1JZ6A 2WSQA 3PPHA 2WK2A 3UR8A 3L9CA 3O3RA 2ZVIA 4ATLA 1HKMA 2VOMA 3RF9A 4WQ6A 1ITQA 3G24A 1GVIA 4UFLA 1JNEA 2F2HA 5EA9A 3U48A 4KBXA 2QCNA 3WL0A 3I4EA 3S2MA 3GHRA 1TUXA 5GNXA 5C7HA 5JBDA 3S2LA 2YA2A 4RE3A 3N9RA 4GZIA 5HUOA 2ZUNA 4Q7BA 4W93A 4YVVA 2D24A 1JYWA 4GI4A 4X22A 1M04A 4LF2A 3GU2A 2QDHA 4RUBA 1OFEA 2YCKX 4HJWA 2QMJA 2EXOA 4TX6A 3H2CA 2XDFA 3PULA 3VOJA 1J96A 5AB3A 1V03A 1MFUA 1O94A 2QGHA 3A4WA 5I3JA 3WD0A 3W38A 3E0VA 4JQ2A 1WAUA 1UZHA 1BSLA 1JGIA 2Q09A 2PGFA 4D6IA 3TN5A 1UJQA 2VTFA 4EAYA 1P43A 1TQXA 1GVEA 1QBAA 3UPMA 4E5TA 1XGEA 5CZ0A 1U1HA 4MJZA 3TKFA 2Y63A 5FEPA 3GVWA 4R7OA 3N14A 1P6BA 3LMZA 4PUUA 1A5MC 2CWXA 3N25A 3TDFA 4AWEA 3P8JA 1E56A 4H9YA 5LGXA 3UJFA 2PBGA 3FEMA 3ZZ1A 1XSKA 1IZCA 4XAZA 2J66A 2J7EA 1LWHA 2I14A 1NDYA 3MKKA 3ARUA 4QXIA 4LF1A 2PDWA 1QUMA 3D0CA 5FF3A 3EWCA 3ZLFA 1TPH1 1CTNA 2JK2A 3BJSA 4MNLA 2XIIA 4QQUA 3WLOA 1VJZA 1W8SA 4U2YA 3G1RA 4IPNB 3CAKA 1P5BA 1UP2A 1ZFJA 4HN4A 3Q65A 2EGZA 4G7EB 5CPLA 4L4PA 4Z08A 3P5YA 1JVNA 2WHJA 3WJSA 2INEA 4C6NA 3DESA 3VGHA 1H7XA 3GNOA 4PZVA 4LCRA 1NP2A 1UIOA 4ADUA 1SO6A 2EJAA 2O92A 4QITA 2A85A 2X0SA 1ZBWA 2EO7A 1HXJA 1KGXA 2VZOA 3W7IA 3TTYA 1MO0A 3TC6A 1SZGA 3O1NA 4IH3A 3RCNA 5DCDA 4F0MA 3W22A 4O1DA 3AMGA 1E6QM 2EHHA 3M9YA 2Y8VA 4LQ1A 1GORA 1F8IA 3LTYA 5CZJA 3E2RA 4RPQA 1V79A 3CMGA 3BW4A 5M3WA 3K2GA 4HNTA 5D38A 1VS1A 3L2IA 1WZKA 2WVUA 4F9JA 1JR1A 1BXCA 4M6UA 1BYCA 1TE1A 1LWIA 4K2SA 3VC5A 3SCVA 3LXCA 4HCLA 1QNOA 3R7MA 1DE6A 1M65A 3IJDA 6A3HA 2XH0A 4XAYA 2GUYA 1J0IA 3DYMA 5LSMA 4ZENA 1VBUA 2VD8A 3MJYA 3GXFA 1W3HA 1I9CB 1G67A 1W17A 4GMEA 4FF5A 2F9RA 4S2CA 3B8DA 1FHVA 3LCXA 2BGQA 3K1GA 3P62A 1P1XA 4EIVA 3OU8A 3N29A 3VVGA 4OBRA 1KBKA 3FW6A 4UNLA 1LQ2A 1GVFA 3VDBA 4IG2A 2PDUA 3PZTA 3HM7A 4BEUA 4PTMA 1Y5XA 4IGMA 4HN8A 4QAWA 4XIMA 5FACA 4I7WA 3ALFA 1G7UA 2X1SA 2Y5EA 3KVLA 3QLDA 4K8HA 1XSJA 1HNYA 4TTGA 2BS9A 2QCLA 2VKZG 1WDSA 2V5LA 3HU7A 4Q8VA 4WY0A 3QGAC 3GY1A 4E8DA 3TC7A 2QIIA 1WDRA 1XGDA 3UCQA 4QE5A 2QCEA 3CHCA 3BCJA 4X2RA 4DELA 1SZRA 1A5SA 2Z26A 3AC0A 3VIMA 4UXDA 4Y9OA 4JX6A 2YGYA 1UIPA 4LEQA 1TTIA 2I5IA 3H26A 2QJHA 4XD6A 3CUHA 3U7BA 4Q4MA 3NZGA 2IQTA 1FP8A 2FHFA 1DXIA 4AIBA 1LM1A 5A6SA 4BQ2A 3LU2A 1MNSA 1AL8A 1MRQA 1F3EA 3FA3A 4L4MA 1TWDA 1JXJA 4O4WA 4GGBA 2V63A 2DZVA 2W0UA 4Q8UA 6XIAA 3QC3A 3CLMA 3OGSA 3FJ4A 1PO9A 1XX1A 1W3LA 4FF7A 3W84A 3I3BA 4XX6A 5T26A 1EHAA 1GNXA 2ZXDA 2I9EA 3Q94A 3HGSA 3GH5A 4X2PA 3WNKA 2B7QA 3N2OA 3SB0A 2DORA 1NARA 3MW7A 5K7JA 5D2WA 1QJWA 1LDCA 4QIUA 1PUDA 2G8ZA 3R0KA 1H63A 1UD2A 3IACA 3RMEA 1W1VA 3PVFA 1E4IA 7TIMA 4Y9MA 5H6HA 4JQ1A 3WLSA 1SPQA 4ZR8A 3BK0A 4BI6A 1X7IA 2OO0A 3OHIA 1VFMA 3EWUA 4Y7EA 4DIAA 3ANVA 2FMNA 1QPRA 3WCZA 3P67A 1EP3A 1YKWA 4NXKA 2CLHA 5SWUA 3C86A 2CERA 1A0CA 3MMWA 4DBSA 2WNWA 1VB9A 2VVSA 2ANUA 5B80A 2BNJA 4U3CA 3EA3A 3WIJA 2Y5JA 4AX7A 1ZJHA 3WH9A 3MCMA 3ZR4A 3TK7A 4DM2A 4KRZA 3BLOA 3E02A 1H61A 1JUKA 2DJXA 4HU8A 1E0UA 4JTIA 3M5YA 3W7HA 2UY5A 4MFEA 1P7TA 3P60A 4NL1A 1XYMA 2NQZA 3R94A 3VGEA 5FA5A 3TQ0A 1NF0A 2X1TA 4PL2A 3ID7A 1EC7A 3DZ1A 4AC1X 3S8HA 2Z1BA 3I65A 3VNLA 4LTSA 5GVJA 4TIMA 4BHYA 4FNUA 3T07A 2YBUA 4G1NA 1RK5A 1JJKA 3WH5A 3EPNA 3WLMA 4ATDA 3LQLA 4FNRA 1Q7QA 4C1KA 2XZ7A 3CZ8A 1US0A 3UY7A 4H6RA 5IDZA 1K8ZA 3RILA 3TROA 3WMSA 1V3JA 4XBKA 1ZLPA 3CV2A 3O05A 1J0HA 1DHKA 4BQ5A 1KXTA 1RVGA 2FHBA 2W62A 3A47A 2PURA 4LBUA 1ME8A 2HVOA 3UERA 1YE6A 4BJHA 3VINA 3L7RA 4H8UA 3QMTA 4MZ8A 5G1TA 3VNJA 3U5UA 3ZSTA 3HB9A 1VCFA 1PZ3A 2DU2A 3WJXA 3TWBA 3OB8A 5EMLA 3TTQA 4G56A 1UA7A 2RUSA 1AH3A 5KMYA 1JDAA 3UWEA 3G1HA 1KKOA 4MF4A 3W72A 1QI4A 3JZUA 3HPZA 1VLIA 3CHEA 4PRTA 3ARQA 3DFSA 3BZGA 1R7AA 1E73M 1NELA 3USBA 1DKWA 1CBGA 3AZRA 4UTUA 1J8VA 3T81A 3S6OA 3UXAA 3PBWA 4PYSA 3A22A 1ITCA 2XFFA 5K4XA 4XK2A 1RA5A 3AMCA 4ACZA 2IKJA 2Y62A 4MADA 5CGTA 2DT1A 5I3IA 4BI7A 3GM8A 2PS2A 3DYOA 3KRSA 4IICA 1HVQA 1TPC1 2AQOA 3A12A 4Z1DA 2QCHA 3ZVHA 3UW6A 1O5XA 3BOFA 3TSBA 5BOOA 1DWHM 1KTBA 5DCBA 3DKJA 3NSMA 1A0EA 1NIUA 3W74A 3WLLA 1J9YA 4NILA 4WGXA 2Q3OA 5LA2A 3FHAA 2RFGA 3ALGA 4O1BA 1Y0EA 2PD9A 2RAGA 5HATA 3L0GA 1VPYA 3KVKA 1E6RA 1UKOA 4R27A 3BAKA 3K4AA 3V4BA 3KBVA 3GIPA 4M29A 2PGWA 3N04A 1S2CA 3CS2A 1QMLA 3GIYA 1WA3A 1LQ0A 4GXMA 1LUCA 4J3XA 2W9MA 2QULA 3W2UA 4D9PA 4DX3A 3I68A 4JKLA 3H2MA 3MUXA 3EWWA 1RJPA 4GX8A 3HPXA 2A6NA 4NG3A 1EDTA 3B9AA 1UYQA 1I2RA 2AGKA 2YXXA 4CLMA 3GVRA 2C71A 3W86A 3OG2A 1U1UA 4YTUA 2A3EA 2WZMA 3OVGA 2ZUUA 3FSTA 4MB5A 2I9UA 5D9OA 2OFJA 3FDGA 3M7WA 4H01A 3SI9A 4XKYA 3AFBA 1UWRA 4NX5A 3UR2A 4PMUA 3GDBA 2Z7GA 3U8GA 4JN8A 1P6WA 5CLWA 2PEVA 1IEXA 3B8IA 1QCWA 3F2CA 3GE7A 3LGDA 4A2SA 5BCAA 4XD3A 1W3TA 2HISA 4L61A 2FQIA 5IHRA 4HBKA 4RR4A 2GUUA 4HNVA 3WEMA 2OEMA 3ZOAA 5J5DA 3MP4A 1KM4A 5AYXA 3TU9A 1TJRA 4O11A 2OYKA 1DXFA 3GDLA 3NG3A 4YVXA 4CNNA 2X1IA 4Z2LA 1O6IA 1DORA 2CZ5A 2QVHA 5I3HA 2A3CA 5E09A 4FAMA 3WLPA 1IGWA 3FGCA 1T41A 3M0KA 2Q8ZA 2V68A 4OHQA 3SAZA 2ZXBA 1UB3A 4PN2A 5D4YA 3OYZA 4XD5A 5CBJA 4QGCA 2FPYA 3NL2A 1QRQA 2J7HA 3WQWA 3UXLA 4JFWA 2GQ8A 1RCXB 2CFFA 3IGXA 4UQDA 1Y65A 2YFOA 3VMOA 4H00A 4GINA 3PWAA 4CN1A 4OQVA 2WVVB 2PDFA 3C8NA 3CUIA 3LNMA 4MPQA 1SGJA 2YL5A 4KF1A 3ARZA 3QOKA 5L9FA 2ZX5A 3UCDA 2GVEA 1LRTA 2XPKA 3WD2A 1JCMP 1JL8A 1HP5A 2IS7A 1PBGA 3CB3A 3AYVA 1ZCOA 3WYZA 4KFPA 4I5RA 5CBIA 3AWOA 3M0HA 1R6WA 5K4ZA 4W5UA 2QUVA 3AHYA 1OZQA 3FN9A 1NOUA 4LFYA 1E43A 3M0XA 4NJIA 1SYTA 3P14A 3EWDA 3E0FA 5K3VA 1XHGA 3WF2A 2WSYA 1HF6A 3NXLA 2QPSA 3MSYA 1EYWA 2XH7A 1UD5A 4Z42C 3NA8A 2HS6A 4TU1A 3HV9A 4FOJA 4H83A 4A35A 3A23A 1DVJA 2VX6A 4S3EA 5KZMA 2YX0A 4LVDA 1SJBA 1S2TA 1E4LA 1FWJC 4JR5A 5I78A 4UFMA 3AUJA 1UMYA 2P53A 3SCUA 1TX2A 1YPXA 3HQPA 1G4EA 1PIGA 1VENA 4MUZA 3MWAA 1EB3A 1XM3A 1K1DA 5E0FA 3W53A 1MW1A 4CNUA 2Y85A 2FGZA 5HWJA 4EPBC 1UWTA 2QJGA 3R6IA 3L12A 1IZKA 3A9BA 2P0OA 1TX0A 4S3JA 4JEQA 1EL3A 3SECA 5HWNA 3SSZA 3A5VA 3W2MA 4RV3A 1S38A 1F74A 3F1QA 1VFLA 1TPDA 2Y7DA 5IRPA 1Q6GA 4C6LA 1I2NA 2HE8A 2QHAA 3GAYA 4RPPA 3G22A 3G8RA 4I5XA 3F4WA 5KINA 1TZZA 1LCOA 3V1HA 1BG9A 4NXSA 4XZIA 3SUSA 4YTSA 5MF5A 2XGZA 3W2JA 1R3YA 3MDUA 3NZ1A 4ZCWA 4CNPA 1KRBC 5I02A 3BLEA 3ZJ7A 4GQBA 1DQUA 1OZMA 3KLLA 2CNCA 4IP5A 1R2SA 4LPCA 4W85A 7TAAA 4UQAA 4NY2A 2YSWA 3SY8A 1WDQA 1K9FA 1B90A 2CESA 1EA9C 3CQJA 5U4NA 1S5TA 4FX6M 4ALDA 4O19A 1P6CA 2NX3A 4AZ5A 2FLIA 4AIEA 1XG4A 4MJ2A 1XIBA 2C14A 4XZBA 3EEGA 1QW9A 1DIKA 3SCOA 4PSPA 5LIWX 4ROQA 3KRBA 1AJ0A 2I5GA 2DZUA 4TXEA 1TV5A 5HQEA 1CENA 2YDSA 1EEPA 1EF3A 3AXHA 3NSNA 1E6PA 5BXRA 2HRWA 4PCFA 1QOQA 1CB2A 2CBVA 4CQDA 1GQLA 2Z27A 3RN6A 3MKCA 4NUWA 4HA0A 1K9EA 1YBQA 3TQKA 1EFZA 1Y8BA 1H60A 1AUSL 3MSRA 3RX3A 1QNVA 2ZRXA 4DAIA 5A69A 3TZFA 1V0KA 2PP1A 1XLDA 3PSWA 1XC4A 4IIHA 1E4NA 3VX1A 4IFRA 3B03A 1KM2A 2XN0A 3CT2A 1BRLA 3WLNA 2VHLA 2OXNA 3EWYA 3VXGA 4OUIA 1VLWA 3D5HA 4E8GA 4V15A 2TSYA 4R7WA 4AC7C 3K5XA 2UBPC 1L6WA 2GDVA 4FA3A 5CH9A 3VU2A 1U5JA 4JY9A 3G1FA 1UR2A 3ABZA 2E4TA 2I7GA 3HMJG 3LCFA 2RDWA 4A6GA 1IHIA 3B8WA 3XIMA 2XIBA 3WDPP 4PSRA 4JL1A 3DCPA 3M0YA 1R87A 2DQXA 1J11A 5A6BA 2PC4A 2PLMA 3AHZA 1MW0A 4PMOA 3MKVA 3M7SA 4ICMA 4UR8A 4A4AA 1ZRQA 4GK8A 3WLJA 1MDRA 1OINA 4MWAA 4UUIA 3ABOA 3ZJ6A 5LIYX 4KIEA 1J5TA 4WJEA 1SZEA 1CEOA 1I45A 1WXJA 3VIIA 3CL7A 2QVNA 1L9WA 3CTTA 3W7DA 1HKJA 3MV01 3PJXA 3H23A 1DJHA 1QK2A 4XZ9A 4LWWA 2P88A 3K4WA 3SRFA 2J24A 3K46A 5HUPA 1MEHA 3E6EA 3CZEA 1XQLA 3B0UX 4MWAB 3WEZA 1LF1A 5C9WA 1MUMA 1FWIC 1IWPA 2E0PA 2AKZA 1FWFC 2OMAA 3LCLA 5EMUA 1C3FA 2A3BA 4DO5A 4PBFA 3FX4A 4JDYA 4C1NA 2XFYA 1KW1A 3PWGA 1YBQB 5EMJA 3SURA 3WLHA 3H54A 1UMLA 4PULA 2ZADA 3LCIA 3MWCA 4G2DA 1XYLA 2RJHA 4LRTA 4JX4A 3CWHA 3NQMA 5D37A 3A5FA 3AXMA 2INFA 1EO5A 1TMLA 5FI8A 3RX2A 1EDQA 3JU2A 1V0NA 1VFFA 4AVNA 2IKIA 2DVTA 3TW9A 3W1TA 2CKSA 3SJNA 4D8AA 1IEIA 4QISA 1H49A 1P0NA 3UETA 4XUYA 4FOUA 2Q8XA 1FHUA 2JEQA 4X9YA 1XIHA 4A8IA 3LBCA 1SFTA 4B4HA 1REQA 1NDZA 4A8NA 5IDIA 2C0AA 3MCOA 4ZTXA 5E93A 3CJPA 1PX8A 2GSEA 1RH9A 3HQ1A 3A3XA 4GH1A 2ZA2A 4O53A 1HJUA 1OC7A 4B2DA 2QQ6A 3TMLA 5FD0A 4LU0A 1DWJM 4JTRA 4DYJA 4QBXA 1JDEA 3UG5A 3M5VA 4ECLA 2L5HA 2X16A 3CEUA 5BXTA 1E9YB 4NQ1A 4M51A 4DJDC 5HQMA 3E5PA 4QFUA 1FWHC 3NGFA 2ZDRA 3MUIA 1CGUA 1AZ1A 1GOOA 3CBWA 1KM0A 5H8UA 1YTDA 1RK6A 3BLKA 4RZ6A 4WDWA 3N2BA 2PWEA 3PFMA 2F8QA 1RQHA 4HZMA 3SUVA 3JW7A 1JCYA 3WBYA 4P8UA 1CGYA 2JKAA 1M6JA 3CUGA 3HF3A 4PMZA 2YA1A 4E3VA 1LOQA 1F5ZA 5CZKA 1W9PA 5KETA 1XR2A 1XDJA 3UCCA 2W79A 4S3BA 1QAPA 2YDQA 2QS8A 3ARVA 3K4DA 3AIQA 4GWEA 1CI1A 1ML1A 1Q45A 2VOTA 3PG8A 2Y88A 4O54A 4LALA 1I1XA 1B9ZA 1WX0A 2CPUA 2UY3A 1TREA 1NP0A 3KRUA 3QJAA 3EMZA 5CGMA 1JZ7A 4IIGA 5C0QA 1XS2A 1HW6A 1GK8A 2VELA 1UWSA 2XVNA 3UG4A 1YE4A 3SGZA 4L7ZA 1JCXA 1W3IA 4EXBA 3VOFA 3EWBX 3CPGA 2BP1A 5AZ1A 4IOTA 5AHIA 4JTSA 1H1NA 1W2PA 3P0XA 1TYGA 1A5NC 1HTIA 1HFBA 1LROA 1D3HA 4HTYA 4H6QA 4XKMA 5D03A 4HMNA 3RLVA 3RIKA 5EMYA 4AW7A 3N12A 1U30A 1PTDA 3M0MA 3CT7A 1XDLA 2X0YA 1PX3A 2DVXA 4LT9A 1U1JA 2JIEA 3RM4A 3AMDA 1MUCA 3G1YA 1E0TA 2W67A 4DWSD 1HKIA 4TVDA 4B91A 1B2YA 4DJFD 3NQ8A 2QKFA 2OSWA 4BKNA 4JIRA 2O4MA 2WLZA 3QV7A 4IPIA 5HBFA 2DJLA 1CIUA 3A3WA 3I3DA 2FZMA 1XD1A 1K70A 2VR2A 1LZOA 3APYA 4D6HA 5DN1A 3BCFA 1AMKA 3WJZA 3ZLGA 1YNQA 1UR0A 4X0NA 3GUWA 3KBJA 3IJQA 3RITA 1X6NA 3AJXA 2NLIA 1KO0A 5EU9A 2PLJA 5IBXA 4D72A 2OB3A 3UZXA 2E68A 1O4UA 4DJDA 2D0GA 3AICA 4FLRA 4HU4A 3TJLA 3T2QA 3OIXA 1S1PA 3OBAA 3FSUA 4WOQA 1GVQA 4F0SA 5D32A 5DT5A 4RZBA 1PKYA 2X40A 3F2DA 1WOAA 2HBXA 1N82A 3RHGA 5CLTA 4NKCA 1G01A 3HGJA 2PZNA 3BUVA 4PFMA 4F0LA 1XLBA 2DVUA 3G3DA 3ZM8A 5IXEA 3WF4A 3S0CA 1V6VA 1FKXA 4OBSA 3PZUA 4NJGA 1M7JA 4C7FA 4DF0A 3H7UA 3UXIA 3KHDA 3UR7A 2Z1KA 2RHGA 1EIBA 1UQZA 4GO9A 2W4XA 4B4FA 3ZLHA 1P0KA 4K7YA 2BXYA 1E55A 3M44A 3GTFA 3MP5A 3LCGA 4Y8FA 4BEQA 2YL6A 4Q22A 4ZQPA 4MLJA 5C9ZA 2VDGA 5HWMA 1PDYA 1FFQA 3GXDA 2HS8A 2O7QA 1T8XA 3WF1A 2VEFA 4NIRA 3B9NA 4G7EA 3V5FA 3TNOA 5E0KA 1C8VA 4IM4A 3M0JA 3AS2A 1EYEA 3UA4A 1JZ3A 5BRQA 3J7HA 1HZYA 4RDWA 1EH9A 4IP4A 2J4GA 2PBOA 1T40A 1FXPA 1VCVA 3DU0A 4NNCA 1DIOA 1J0JA 1Q6RA 2J62A 5ABEA 1QASA 3FY1A 5HINA 3NDZA 2P3EA 3PJUA 3ITGA 4RDZA 3WH8A 2X1RA 2NT1A 1UBSA 1WKFA 1S1RA 2G3FA 3ZT5A 3AROA 5LHFA 2ZX7A 4ZOEA 4DI9A 1GJUA 1TWWA 2GJRA 5E5CA 5EFFA 3SCPA 1T7LA 5LIXX 2D23A 3VILA 4AH7A 1LQAA 2WW5A 3EGJA 1SR0A 4HYRA 3NDYA 2ZE3A 4LUIA 2ZX6A 5HJYA 2OZTA 5F2GA 5XINA 3RLGA 4H4IA 3T1GA 5F4XA 4N4PA 3ABQA 5D2VA 1F8MA 1ZJIA 5FJTA 1WZLA 2PMQA 3TWAA 3KL3A 3L4YA 5XIAA 4RV8A 1BWLA 3ARPA 5CPNA 3AMKA 1LBMA 1OFPA 3DECA 4JYEA 3UEQA 1FDYA 3BANA 1OFAA 3AWNA 1OQFA 4JTCA 3ME3A 3POHA 4ES4A 4WJXA 3LUTA 5T91A 1IV8A 3I3EA 2A0NA 2GVGA 2Y5SA 1FH9A 4JX5A 1QI5A 1GGOA 1OSEA 4F0KA 3NYDA 5HOSA 4DJEA 1HL8A 5GNZA 3PB0A 3HPFA 2VCAA 2ZC8A 5CAHA 3KDNA 3I7SA 4H3DA 3DHFA 1XYBA 5A2AA 3NPUA 3IGHX 5I2UA 1GWJA 5CBBA 3MUZ1 3R11A 3VFCA 3QV6A 3G1AA 3XISA 5ECVA 3MT1A 3STCA 3L68A 5AC6A 1E1CA 2RH9A 1XBVA 4KERA 4D6FA 5JU6A 3HQOA 3KTXA 3KEHA 3W87A 2WWDA 5A2BA 4F40A 3GG8A 4MLRA 1H7WA 3SUTA 1ISXA 1TA3A 4REQA 4XZNX 2BY2A 4O1EA 3LA4A 3PZNA 3VAVA 1R30A 5AYZA 5T9BG 3VMPA 3CAWA 3AS1A 1D2KA 1XLLA 1KBJA 3SEPA 1NFPA 2DZPA 4O52A 2ACQA 2EPNA 4UTJA 3K8LA 4LUSA 1J5SA 4N9CA 3W6MA 4PUKA 4J3UA 1TZ7A 3KFTA 4PB3A 1U5HA 4HTBA 3TEVA 2HQAA 4ERIA 2G3IA 2J8GA 1Z8AA 1V08A 3CHDA 2YB1A 4M7TA 2NUXA 4BI5A 4MB4A 4GKTA 5G2WA 2HBVA 4PR4A 2NSXA 3RRXA 4I8YA 3BW2A 3UWWA 1T6MA 1KR0A 3LHVA 3QKZA 3M43A 3MB9A 1ONXA 6PTDA 1EZWA 1YEYA 2QUNA 3MS8A 5E9AA 3FAXA 3L4UA 5AYBA 1RPXA 4MJMA 2PDXA 2FTPA 3LRLA 4H7CA 1DJGA 1OWQA 3GS6A 3RXZA 4Z0SA 1H41A 3EEZA 3M1ZA 1A3HA 2VRQA 5C9XA 2QJMA 2G3MA 3VOHA 2FJUB 3MO7A 4MNJA 2O9TA 2VD9A 3OZMA 3ONBA 3VD5A 4DXVA 3M64A 3TYBA 4KMQA 4UCGA 2XSXA 1XV8A 3AIWA 2CZFA 5B7YA 1JPMA 4E2DA 1FWTA 1LT8A 4J9JA 4Z2GA 1WDPA 5FF0A 4R9OA 4WUIA 3EKGA 2DW7A 4ADTA 4Q8PA 1KGWA 4C6DA 3GSMA 2Y24A 1K9DA 3LZ5A 3TTOA 1J0KA 5HA7A 1BVNP 9CGTA 4WR3A 4EAMA 1QXLA 3AIBA 3ARWA 2DW6A 2HK1A 3KP1A 4JTFA 4O10A 2HK0A 3TW6A 1OB0A 2NWRA 4WSKA 1FWDC 1TTJA 4JTUA 3WF3A 4POCA 3FJLA 4XB3A 3VTRA 4CD8A 1NTHA 1V3IA 1GTEA 1R47A 3DFNA 3KCOA 1HJSA 5CG7A 7PTDA 1JIBA 2ZRWA 4IUGA 3BLFA 4FSAA 3GLCA 2E09A 3HGRA 5DY3A 4JFUA 4J35A 4NRSA 3N2TA 2R24A 3FKKA 1L6SA 1W1B1 3BC9A 1AA1B 4MZYA 3NAVA 3F4CA 1PB0A 5XIMA 3QMSA 2VCCA 4QEEA 2G4FA 3HFTA 3V18A 3PZMA 3PG9A 3LXAA 2BASA 2CW6A 2CBIA 2OJPA 1WKYA 4GYPA 4WX2A 4NZFA 1ZU8A 4QHRA 4CNOA 1TTPA 3GTIA 4GPNA 1PDZA 3DFHA 1XC6A 4AZIA 4UFIA 3TR2A 2HVNA 5DMYA 3EOEA 4C91A 4MSSA 2Z1WA 2ZCGA 3PZ9A 4JTKA 4CD4A 1JULA 2DZWA 1TFVA 1TJPA 1ELSA 2DPEA 5AZ0A 4P7LA 3EOOA 2A3LA 2C15A 1MDLA 1TPFA 2BOGX 2HE5A 1ISVA 4QG9A 4QJ5B 3T08A 2BGNE 3NQGA 2HEJA 3QTPA 2J75A 3W23A 5G1MA 1O12A 1GKQA 1TPUA 4GO8A 3SZ8A 1Y7VA 3SCNA 2AAMA 4UQCA 3QY6A 2IMRA 4M82A 5D8WA 4BY3A 4ASTA 3L5LA 1EJWC 3ONCA 3W9ZA 2OZ8A 2ISFA 4WLCA 4AD4A 3BICA 2O7SA 1Z7AA 3L4TA 3SUWA 1AQHA 5E9XA 3TFCA 1EWEA 2WCGA 4EACA 2YYTA 3DI0A 3CZLA 1W5PA 2GJLA 2PB1A 1FUYA 3OG3A 3DFPA 2QUMA 1E1FA 3EX1A 5I09A 3TCEA 4WSJA 1UW9A 2DZAA 1FDZA 1AJ2A 3WH6A 4YTRA 3L67A 4UTFA 3QQ1A 5CSUA 1S2AA 3G0UA 2ZUMA 3EB2A 4GVHA 1VPXA 1C7TA 3H7VA 4MB3A 2VR4A 2X41A 1K6AA 4WZHA 3NWRA 4HB7A 2NW0A 2HJPA 3AYTA 2SFPA 1B5TA 3L66A 4M1BA 3SRDA 3G1SA 5DO8A 4PMNA 2P8CA 1FCBA 1BVWA 1W54A 2A4AA 4KWOA 4O12A 3ZT6A 1IR2A 3V7PA 2RGLA 3SN4A 5M1TA 1OGSA 5CJMA 3M0IA 3V16A 3MI6A 1PVNA 5DY2A 1XIEA 1R3SA 4HZ8A 4FK9A 1KC7A 3C52A 3HO8A 4JYDA 2FFIA 3IJIA 3KL5A 3ZQ9A 5CPTA 4GG9A 7CGTA 4H2CA 3WLRA 1BWVA 2TPSA 3CAVA 3M5XA 3QYSA 1G4TA 1S5VA 2PAJA 3CV1A 2OKTA 3B9OA 3GNNA 4O4VA 4WD0A 4PCPA 3CPRA 3LHUA 4J3ZA 4HNNA 1JCTA 2R8WA 1YYAA 3LRMA 3URQA 3PUOA 3QR1A 4MIMA 1W5QA 3IK4A 4HA3A 3TYUA 4ORMA 5K2ZA 1BTCA 1VQTA 1S5MA 1KB3A 3GNRA 2V81A 1GEHA 2DSKA 5REQA 5CPMA 3IPWA 2DDXA 4UTIA 4IZGA 1V6UA 2CHNA 2NX1A 2OWWA 3HG2A 2RKXA 2WNQA 2X2GA 3NQDA 4IIFA 3PC0A 2OCZA 4D6DA 3REQB 4GVGA 1R3TA 4UQ9A 5AVHA 3H12A 3VUSA 1AVAA 2FH6A 4O1FA 1H5VA 3T0CA 3VO0A 2XH2A 4J3TA 3BAXA 3GVVA 2XFRA 3C4UA 3MSGA 1DTUA 2WC7A 5DEZA 2C8NA 1AD1A 1XRVA 4N6FA 3N3TA 3LGEA 3DIPA 1EPVA 2J9ZA 4E0CA 3D3AA 5A6JA 2PDHA 3AIRA 3CXOA 1P4CA 3EKZA 2VGIA 3WG6A 3IJ9A 1DBTA 1WDWA 3T0TA 3C0SA 5AC5A 1XP3A 1VJIA 1XIGA 2BX7A 1C29A 3W2LA 1EOMA 2GWGA 3LLFA 3PZQA 2Q02A 1HN1A 2CLMA 2XSAA 1NWRA 3VABA 3W7GA 1V3LA 1RALA 1IEVA 3GKFA 5JQ9A 2E8ZA 2ZOXA 4JTHA 3JR2A 3JS3A 2BSLA 1XLKA 3SCWA 2EBNA 3AHXA 1TWSA 3EB4A 4QP0A 4MTVA 2A3AA 2FJKA 4E3TA 1WP6A 1TELA 4LC8A 4J7RA 4JN6A 2DIKA 3HZ3A 1TV8A 4IX2A 4Z2IA 3LPGA 4UFHA 2V5DA 1XKJA 1AFSA 3APTA 1JPIA 3QQWA 4I3GA 1HUVA 4AEOA 1GVSA 2YYUA 1O7AA 2PODA 5DT7A 3OBKA 3DFOA 3FOKA 3MP3A 4NZJA 1KV8A 1NJJA 3UJ2A 4DF1A 1CXFA 2V2CA 1SMDA 3O8AA 5A1AA 3H70A 5HANA 2VYOA 3RLHA 3WNNA 4NT0A 3SN1A 1OF6A 3RJYA 4MZ1A 1BYAA 2YCEA 4EE9A 3M07A 3ELFA 1J6PA 1UR8A 1DJYA 4HYWA 3G77A 2ZX8A 4AMCA 1GG1A 1IXOA 1BKHA 3HJEA 4H7ZA 1CXLA 2NZLA 1WUFA 3M41A 4HCDA 3BG5A 2ZUVA 5MKGB 2I1OA 3IVUA 4MNKA 1E1CB 4RX0A 1HJXA 1VFTA 4J5NA 1HKKA 1EBGA 4RK8A 5D9NA 1KRMA 5DBTA 1B3ZA 3R89A 2OO6A 3T40A 4B3KA 2RGMA 4MWAC 3BG3A 3MUCA 2XTKA 1MXDA 5GJPA 1GQIA 5HNNA 1B4EA 1Q6EA 2O9PA 3B8VA 1GVOA 3U2CA 1R3VA 2CIPA 3N6HA 4INFA 1N8FA 4F0RA 2ATSA 4YWSA 1Z41A 3CGTA 4F48A 1G0CA 4PB5A 1EHNA 2DH3A 2XUCA 1MEWA 1GPWA 1H7OA 4KGJA 2CEQA 1V3KA 4GFIA 1R0MA 1C91A 4BF7A 4PGLA 1LG1A 3WUEA 5LGZA 2BY1A 2XVLA 3KVMA 2Q8LA 3PTQA 1K4HA 4ZA0A 2O4QA 4K3ZA 1T8QA 5IFTA 3LHTA 3ARXA 4H8NA 1WBHA 2REQB 3MHGA 3R8GA 1BHGA 1UROA 3F5KA 1YRRA 5CSYA 4PUWA 3UNDA 3UZZA 3EXTA 1MEIA 4ZXLA 2J9XA 4C6EA 2PDJA 1JYVA 4KEUA 3UWYA 3F4VA 1CX9A 3F5LA 3W3OA 2OLSA 3UGRA 1MFVA 1E70M 4PTVA 3DBPA 3TZNA 1QFEA 3ZSSA 3CMFA 4YMZA 4KCVA 1VZWA 4F2TA 3BWWA 4ERGA 4HU0A 4NASA 1R3RA 1TO3A 3AI0A 4OZOA 3S5ZA 3AIUA 3SCRA 4ZODA 2GSHA 2NX9A 2QNEA 4DXKA 4B5WA 2X0HA 2OWCA 4IMEA 2QMKA 2Y2WA 1XH1A 4NAEB 1NQ6A 1SSDA 4PMQA 1YNYA 4RXGA 1R2RA 4W89A 2QV4A 3C2EA 3PUGA 3PUDA 2IW0A 4C6KA 1JFXA 1KCZA 2W3ZA 4RW3A 4XQ6A 1BSIA 1FFRA 4C5ZA 2CHRA 3GC2A 3QV8A 1ONEA 3BGJA 2BG5A 2W63A 3C0QA 4IJCA 1ZGDA 2R82A 4P2VA 1NEYA 1YTEA 5ABGA 3HA1A 3M16A 2VRKA 3CO8A 1FH7A 3VD3A 3E0WA 4DZAA 3AU2A 3PPCA 3T8LA 4OIFA 4BK9A 3MVTA 5I23A 2BODX 2DFAA 3OPSA 4QROA 2NQ9A 1FQ0A 1AMYA 3REQA 2ZTJA 2GGHA 5HK4A 2MUCA 4BF5A 1PL9A 1T99A 4A22A 3CH0A 4OFCA 1R3WA 4LW7A 4N9BA 3OLDA 1QOPA 3H7RA 4KW2A 1DIEA 2WYSA 1RPKA 2X05A 4WIWA 5FL0A 2JALA 5JMUA 4N02A 1JGMA 4WDXA 1BG4A 4V27A 2PRMA 2ZUTA 2WJDA 2IPGA 3V3WA 3W1MA 4HNCA 5KEZA 4FEZA 1IZJA 2XIQA 4NHVA 3NIYA 4XD4A 1AW2A 3GB6A 3L0KA 4BZYA 4HMCA 3EPMA 4BR1A 1B3XA 4IX0A 3BPWA 3BZJA 5FSEC 2QYGA 2VFFA 2PLCA 3W85A 2QZRA 3U4AA 4HPJA 2QF8A 4A8RA 3FA4A 4S3GA 4LS2A 4RDVA 1GHSA 1W32A 1UUQA 1THFD 1IR1A 1IGSA 4M19A 3KCLA 4IJBA 2EAWA 3HPSA 4QCEA 1N8IA 3K30A 5E6YA 1ADDA 4GX9A 4AHPA 2P10A 3BQ5A 3WQPA 1FWSA 1BF2A 1T0OA 4GGHA 2HXTA 1X98A 1LTDA 1Z3NA 2QF7A 3UYCA 3NVDA 1EP2A 1Z48A 1N2VA 3W24A 5C71A 2R1NA 2WLYA 2G3NA 1E0XA 1UC5A 4FZIA 3H2FA 3LB0A 1HJWA 3QV9A 4GYJA 4GIAA 3NDOA 3U0HA 3UWUA 3THQA 2P3ZA 2YFNA 1KFBA 2QCDB 1XPGA 2KZHA 3C8FA 5CZSA 3BDKA 4M6QA 3W00A 3CIWA 1BQCA 3AYSA 2VC9A 4ZFCA 5J04A 4PA8A 4M5PA 2J8TA 1HKVA 4EWND 1B54A 1RP8A 1UJPA 5EGRA 4LV9A 3W1NA 5FEWA 5ENLA 9XIMA 3UG3A 3VIHA 3RR1A 1M53A 1K3UA 2OOGA 4XKYB 1UG6A 3ZFHA 8CGTA 1SJDA 3Q4DA 4ERAA 1FWRA 5BXPA 3W1UA 2GVLA 3RG6A 3BAJA 3RGTA 3ARRA 5AFDA 1H09A 1JF5A 1TTQA 1Q6QA 2VX5A 5F1UA 4US5D 3T4CA 1EF2A 1MQPA 1TJ0A 4G9PA 4QJ4B 2INZA 2C91A 3GYCA 1EC9A 1C93A 3CEPA 5FJUA 4UTTC 4QDWA 2NSOA 1VF8A 3LOTA 4QE1A 3T0BA 3RX4A 1YXCA 1RHCA 1LUCB 1KA9F 2E9LA 3OQ8A 5FJPA 4JIPA 3BOLA 4IQJA 4UTWC 3KS5A 2FTYA 1EGMA 4L1XA 1NWSA 4WDTA 3P3BA 2A7PA 3D46A 5A6AA 4NZ5A 1JNDA 2NQLA 3M0LA 1UC4A 1Z69A 3G6MA 1REQB 1XLGA 3EX4A 4LVBA 2J25A 3VUPA 3WQOA 1TVLA 1T96A 3LBOA 1OT2A 2PDBA 2Z1SA 5J5RA 4GJJA 2C1HA 5EMMA 3OTRA 3L4XA 2AQWA 2FZNA 3PK7A 2WKGA 4IXXA 1PKMA 2BOFX 3H2AA 2ESCA 3NL5A 4KEVA 3H8AA 1I0DA 1GPFA 3PPFA 4ILSA 4MUPA 3C3NA 4TVUA 3U4FA 4N7QA 3R8RA 2VWSA 2VCBA 2DZBA 2X8RA 2E28A 3S5OA 3ISIX 4LUJA 4IMDA 3AHTA 2DUXA 5HPCA 4IQLA 3UZJA 1EJTC 4JOMA 3NL6A 4Q33A 1K7FA 3R13A 4Y9PA 2NXHA 2YZ5A 4CD6A 2PTWA 2WANA 3BAIA 4AEEA 2D3LA 1I1WA 2ZZ6A 1KQZA 1F6KA 5H91A 1QATA 1G6CA 4DJED 4B5TA 5A6BD 1AL7A 2HDJA 3TTSA 4JTJA 1FOBA 1SO5A 2VDHA 3VX0A 4WKAA 1RBLA 3WK0A 4Q4PA 2P8BA 3QZEA 5T9CE 1X6LA 5CJNA 2MNRA 4HQVA 5I3GA 3B05A 4CD5A 1DV7A 2FGLA 3FV9A 4FIQA 3P84A 2YW4A 1BFNA 2ISVA 3EYPA 4ZMGA 1ZBVA 3ECQA 3WLIA 4GXPA 2TMDA 5KITA 1SJCA 3DKLA 4BFAA 1ODUA 3OHMB 2CLIA 4FNTA 2VFHA 4Y96A 3W01A 3CWOX 3NM3A 1EQCA 1A4MA 3EXRA 2A3HA 4QM1A 4AISA 4OUEA 3SQLA 2PWDA 1GQJA 2OSXA 4RCXA 3W73A 3P61A 4GCAA 1L2QA 2VT0A 4TO8A 4QAIA 3PTMA 2PF0A 2PWUA 3P5ZA 2C3ZA 4IF2A 3ENLA 3II1A 4NNAA 3QHOA 4BA0A 4KGLA 1H1ZA 1HO4A 3PUEA 4GY1A 4XSMA 4O8AA 4RE4A 4GLEA 3LTSA 4ZQMA 3TOPA 3GH4A 4Z1AA 3VGBA 2CU0A 2Y89A 1SO3A 5DXXA 1H7NA 1ADOA 2GFTA 4MJ4A 1U33A 3A4XA 3L4VA 1T5AA 4QJ1A 5L6UA 2ZRZA 4OJYA 1JEZA 1JPHA 4O1CA 4GUHA 5M03A 3OVQA 4HSNA 2OZ3A 4I5UA 3BXWA 3AOFA 1QO5A 5E0CA 1D7FA 4N0RA 2FYMA 3MQTA 2ISDA 2CLPA 3UVIA 1VFOA 4GCXA 2Y7FA 4JPGA 5C2GA 4CD7A 1TQJA 1TV4A 3FCPA 4RZ4A 4DUVA 3M47A 4HCHA 1BWKA 4ZB5A 1PIFA 3FFSA 4EPDC 1ZUAX 3HGOA 4D6CA 3AQUA 4RL3A 1G4SA 3UP8A 1KFKA 1CECA 2VC5A 1KR1A 1BYDA 3FYOA 4NJKA 3TA9A 2PTYA 2YDAA 3DXIA 3C56A 1Q5MA 1RBAA 2HVMA 5FEZA 2YJQA 3CUJA 3OOQA 3LY0A 3W27A 4CVUA 1DTNA 4CQAA 2V82A 5EL1A 2VR5A 3KZPA 4PEKA 3HBLA 3QQ0A 3PNZA 2YCJA 1XBZA 1EUAA 2OR2A 2H9AB 2W6RA 3ITYA 1DOSA 1E6SM 1A5AA 4MPKA 1O5QA 4J28A 5BOFA 1SVDA 3T6CA 2QEZA 4PB4A 4OT7A 3DENA 2NV1A 3OZOA 4IISA 1RJQA 5BZAA 2OOFA 1I2OA 3VIJA 3CTLA 1N55A 3UR5A 2YL9A 3N17A 1W2VA 4UZUA 4Q4RA 1AD4A 1J01A 5C6MA 4Z2HA 5FF2A 5TF0A 2FZ9A 3GDRA 3VC6A 4RW5A 4PE8A 2TRSA 4UTMA 2VVNA 2P76A 5BMWA 3WBAA 2E9MA 4FXRA 5CJ5A 2QCDA 1XIDA 1SZNA 3WD4A 4ENLA 1XUZA 3NQCA 1L6FA 3S6TA 4DF2A 1VFSA 1D9EA 4R85A 1GKPA 4ZVJA 1E71M 4ACYA 1OIFA 3QPYA 3IGUA 1MMFA 1OCBA 3LCWA 1RA0A 3BLDA 3FXGA 1UZDA 4K36A 2J8FA 3W7JA 1QPKA 5H1WA 3T05A 4JHMA 4F2BA 3C5QA 4L1GA 3THAA 3FLUA 3PTDA 3G18A 1G94A 1XGZA 3BO9A 3EXSA 4WDUA 2F6UA 3ARYA 3WQ6A 4WKFA 2AL1A 1BXBA 3U9IA 2HNEA 4GQQA 3EPOA 4DLFA 1EX5A 3CPUA 3LQGA 1US3A 2J7DA 3W1RA 1SSGA 4UR7A 3JRKA 1NDWA 1IT8A 4F8XA 3S1GA 3ES8A 5I3DA 3NQEA 3IV3A 4C90A 1B1YA 1UOZA 2Z24A 2HNHA 4KRTA 3IAQA 2OWXA 4Q6JA 3D6NA 1Q66A 3Q37A 3HTWA 1Q8AA 3IWPA 3SY1A 4GQRA 1GEQA 4KS0A 2G50A 1TWZA 3T0AA 4YTTA 1K02A 3TSDA 3GR7A 1EP1A 4I9JA 1DWFM 1C8XA 4UZSA 3PSVA 3WSUA 1UR1A 2YLLA 4PUNA 2WB5A 4FLQA 4GYFA 2YBVA 2NT0A 1W6TA 1UH4A 4S23A 2UY4A 2F6KA 1M7XA 2WMGA 2IXUA 4U5KA 3UG8A 3GRIA 3GBDA 1J79A 4AIUA 1V8EA 3QF0A 1YTKA 1ISZA 3LMYA 4CU6A 1JQXA 4LCSA 1KKRA 1R5YA 2WVSA 2X42A 3DBNA 4WY0F 3AHVA 3W71A 2X7WA 3VDHA 5AOUA 1OIMA 5CC6A 3E2VA 1UHVA 1PZ1A 4DZ5A 2VZTA 4G5DA 2DUAA 3LM3A 4GVFA 2JGQA 3R10A 3HG3A 3ABXA 3V36A 4LB4A 5C55A 3W7NA 2D2OA 4P8XA 1OHLA 3O6YX 4Y8EA 4GVIA 1YDYA 3VK5A 2EPMX 2XVPA 4MYXA 4GD0A 4R33A 3HFYA 4W8BA 4XV0A 3AMLA 3FJNA 3S2JA 4LSBA 4M8UA 3BLIA 4DYEA 2HPMA 2WJFA 3TJXA 1LWJA 5D33A 3TYZA 1MQRA 4J4KA 1ICPA 2GWNA 4H9MA 4HZ6A 1H2JA 1FY6A 2WZTA 4XISA 4DJDD 3QZ6A 1XFBA 2V8ZA 3CH9A 1KFJA 4AUBA 4GNKB 5JH1A 1B30A 3EMCA 1MQQA 5FAJA 5LZLA 3A4AA 4H2HA 3VIFA 5F4SA 1ZP4A 1BD0A 1NH6A 5EY5A 3WBWA 4U28A 2WOQA 1JCNA 1RSCA 3CMJA 4IL2A 3EA2A 3WQCA 3OLGA 3TH6A 2VEMA 2V5CA 3KBNA 1H50A 4O0ZA 1W1TA 4XAFA 3U2EA 1LOLA 3LBMA 3UZWA 5FSDC 2FDMA 3MA8A 3CWNA 1ZPTA 1ALDA 4TX9A 1UD6A 2KX9A 2C79A 3HURA 4IQEA 2ISWA 4JHZA 3I6EA 4PCSA 3DH7A 1ICQA 3F2BA 1VP5A 7A3HA 3ZS4A 4W8LA 2Y0FA 4EKJA 3LSCA 4GZJA 1XLIA 5G2IA 3KXQA 3TQVA 4FR1A 1QNQA 3LCHA 4V28A 4DUXA 3KWXA 1EBHA 1F3WA 1FWGC 1EGZA 3VNDA 3KCJA 1QNRA 4P7RA 3MI3A 2Z2UA 3N4EA 4IIBA 4JTTA 1F6PA 5TNVA 5LHEA 3KTSA 3MUAA 3W37A 4UNIA 4A8LA 3BH4A 1UP3A 1NOWA 1O5RA 4HK7A 3GKAA 1E0WA 3QFEA 4C1LA 2V2DA 3GU9A 3GO2A 1Z32X 3O6AA 3ORWA 4HYVA 3V5CA 3CUFA 3EDJA 3N9SA 3LZ3A 1A50A 3U7VA 1KTCA 3TA6A 1D8WA 3GH7A 2WXDM 3CC1A 3GG7A 3SRHA 2PWVA 2BXZA 3UWVA 1POKA 3VKDA 2Z6IA 3MUY1 4JKMA 2QT3A 2QV5A 1X6UA 4M7SA 4L4LA 4H9ZA 3GR8A 1IT0A 1PKLA 1RD6A 3C0JA 1YX1A 1JG9A 3IK2A 2FPVA 1TPEA 3VNIA 2C1GA 4LXFA 2PF8A 5BRBA 4QSHA 1L6GA 1SW7A 1RR2A 5HDRA 1M9HA 4YYFA 2QCCA 2ACSA 4FMVA 1MSSA 5FKYA 1TB3A 5LIUX 1VRDA 4LS0A 2IUZA 2FIQA 2CBUA 2I5QA 1VFHA 2DH2A 1KQYA 3CASA 5BOEA 3UFYA 1XYZA 4BS0A 1Z6KA 4Q4KA 4AHOA 3OODA 3IIOA 4OGZA 1FTXA 5DBUA 1K6WA 3EZ4A 3UPWA 3NOEA 2OTDA 4D8LA 4JYFA 5I24A 5U7SA 4HPXA 2XWDA 1VAHA 1F76A 3PM6A 2ZDSA 3W2KA 2B7PA 2WMJA 5DMMA 1E72M 1UH2A 5IOBA 1GOMA 4DI8A 4LJ3A 3S1XA 3W7RA 3TLQA 5HNTA 2ZZ4A 3GG1A 3FNDA 3GAKA 3Q58A 3ANYA 1IT7A 3F03K 2P5NA 2J77A 1GZGA 3RO8A 3O2LA 3C2RA 4IMFA 4FX7A 1JD7A 4S3FA 3RU6A 3MJMA 3ANUA 3W7EA 2JE8A 1RY8A 1FBAA 4IJRA 1K7XA 1J93A 1FP9A 4JTEA 4IGHA 5FEXA 4IIEA 1XYFA 5G4WA 1IIHA 2YCLA 3N73A 3S42A 4HGXA 1V0LA 4H9XA 3DC8A 2CZEA 2OQLA 1JDFA 3SCSA 2Z1VA 4Q4OA 1OCQA 1BRLB 4KWUA 3TONA 1ODZA 2WVTA 1KGUA 3I4KA 3LNPA 2E1WA 3WDIA 2PLKA 2QIWA 4QEHA 1RUSA 1XYAA 1QBBA 1FCUA 5I77A 1E3ZA 4CNTA 1UPPA 4GFSA 2XIJA 1J6OA 4WHBA 2X2YA 3QM3A 1M3UA 2GPTA 1RCOB 3N6QA 2CCRA 1I75A 2WSPA 3E0LA 4YYCA 3CZJA 4XTDA 1KCXA 2J7BA 4O28A 5JBEA 1DWGM 5REQB 8XIAA 3S5SA 2D73A 4ICCX 1QR7A 2DSVA 4ZQCA 3ARSA 4QLLA 2B7OA 2PPGA 4B92A 3FK4A 3MHUA 2V5JA 4QE4A 1NM9A 4HNUA 3KBSA 3WLKX 3SM0A 1WAWA 4ZO6A 1Q3NA 4DWSC 5I7GA 2I56A 1OADA 4ZFMA 3GTHA 5CPOA 4LUSB 5FOOA 4O0QA 1KCKA 4M56A 4ZQRA 4O57A 4J3WA 4MHBA 2WJEA 5ABTA 3B9DA 4HZ7A 1MW3A 2PDLA 4EX4A 4YLWA 1Q7ZA 1HP4A 4NVTA 5A8MA 1E9LA 4R9XA 3LD5A 5HMSA 2ABBA 3NR0A 3B4UA 4LB3A 1XBXA 1PYMA 1V0MA 1M5WA 2ZZ3A 4IG2B 1VC4A 4F4RA 1QPOA 2E9BA 3E38A 3NQFA 4HNLA 5GJNA 5CXPA 2OSYA 3DUGA 3NEVA 3GUGA 4PMRA 4BQ3A 1NWUA 1QVBA 2E5CA 2JF6A 4MWAE 1ISWA 3S1VA 3S9IA 1R86A 5CC3A 1E9IA 3ZJ8A 4Y9NA 2Z29A 3L21A 1XW8A 4ZSUA 2J27A 1WXZA 1WV2A 4PUDA 1UWAA 2R6OA 4NSBA 1E40A 3O7UA 3CQ0A 4I6VA 4IMCA 1KXHA 3OW1A 1KV5A 3CUXA 1Q7MA 3ITXA 2YB4A 1Q4WA 4DNHA 3COTA 2WZEA 3WF0A 4CN6A 4G8TA 4I9MA 4MMWA 1X8CA 4GYKA 4LUYA 1RCQA 1EX1A 1KLZA 1LOSA 3LRKA 1V6XA 4NX0A 2EG8A 4GXWA 1E15A 4I8DA 6ALDA 3IVTA 4L9YA 4C6JA 3MMTA 2ZE0A 3S6DA 2PCEA 3W7PA 2F2KA 1LYXA 4B5NA 1X8FA 3KZSA 1RD5A 3GQYA 5F2IA 5GJMA 4IXHA 3E2SA 2C16A 4Y2WA 4P61A 5FJOA 4JIHA 1GOXA 3LS9A 1QOXA 5K9DA 4UIOA 1R8LA 4HHHA 1ZP3A 3T42A 1VIWA 1XFCA