2WWEA

Crystal structure of the phox homology domain of human phosphoinositide-3-kinase-c2-gamma
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
NLYFQSMSIERATILGFSKKSSNLYLIQVTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPEFPHWWHLPFTNSDHRRFRDLNHYMEQILNVSHEVTNSDCVLSFFLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHOINOSITIDE-3-KINASE, CLASS 2, GAMMA POLYPEPTIDE
publication title Crystal Structure of the Phox Homology Domain of Human Phosphoinositide-3-Kinase-C2-Gamma
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 111
sequence length 111
ec nomenclature ec 2.7.1.154: Phosphatidylinositol-4-phosphate 3-kinase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2wweA01
2CSKA 4PQOA 4IKBA 1KMDA 2IWLX 3LUIA 1GD5A 4OXWA 2DYBA 3HPCX 2CZOA 4PQPA 2V6VA 4BGJA 3HPBA 2I4KA 4ON3A 2ETTA 2AR5A 1O7KA 2WWEA 3IQ2A 2REDA 4P2JA 1OCSA 4PZGA 2RAJA 1XTEA 2L73A 4IKDA 4AZ9A 3DYTA 1H6HA 2REAA 2YPSA 4HASA 1KQ6A 4P2IA 1OCUA 3P0CA 1XTNA 2RAIA 2V14A 4IKBB 2RAKA 4AKVA 3FOGA
chains in the Genus database with same CATH superfamily
2CSKA 4PQOA 4IKBA 1KMDA 2IWLX 3LUIA 1GD5A 4OXWA 2DYBA 3HPCX 2CZOA 4PQPA 2V6VA 4BGJA 3HPBA 2I4KA 4ON3A 2ETTA 2AR5A 1O7KA 2WWEA 3IQ2A 2REDA 4P2JA 1OCSA 4PZGA 2RAJA 1XTEA 2L73A 4IKDA 4AZ9A 3DYTA 1H6HA 2REAA 2YPSA 4HASA 1KQ6A 4P2IA 1OCUA 3P0CA 1XTNA 2RAIA 2V14A 4IKBB 2RAKA 4AKVA 3FOGA
chains in the Genus database with same CATH topology
2CSKA 4PQOA 4IKBA 1KMDA 2IWLX 3LUIA 1GD5A 4OXWA 2DYBA 3HPCX 2CZOA 4PQPA 2V6VA 4BGJA 3HPBA 2I4KA 4ON3A 2ETTA 2AR5A 1O7KA 2WWEA 3IQ2A 2REDA 4P2JA 1OCSA 4PZGA 2RAJA 1XTEA 2L73A 4IKDA 4AZ9A 3DYTA 1H6HA 2REAA 2YPSA 4HASA 1KQ6A 4P2IA 1OCUA 3P0CA 1XTNA 2RAIA 2V14A 4IKBB 2RAKA 4AKVA 3FOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSK A;  4PQO A;  4IKB A;  1KMD A;  2IWL X;  3LUI A;  1GD5 A;  4OXW A;  2DYB A;  3HPC X;  2CZO A;  4PQP A;  2V6V A;  4BGJ A;  3HPB A;  2I4K A;  4ON3 A;  2ETT A;  2AR5 A;  1O7K A;  2WWE A;  3IQ2 A;  2RED A;  4P2J A;  1OCS A;  4PZG A;  2RAJ A;  1XTE A;  2L73 A;  4IKD A;  4AZ9 A;  3DYT A;  1H6H A;  2REA A;  2YPS A;  4HAS A;  1KQ6 A;  4P2I A;  1OCU A;  3P0C A;  1XTN A;  2RAI A;  2V14 A;  4IKB B;  2RAK A;  4AKV A;  3FOG A; 
#chains in the Genus database with same CATH topology
 2CSK A;  4PQO A;  4IKB A;  1KMD A;  2IWL X;  3LUI A;  1GD5 A;  4OXW A;  2DYB A;  3HPC X;  2CZO A;  4PQP A;  2V6V A;  4BGJ A;  3HPB A;  2I4K A;  4ON3 A;  2ETT A;  2AR5 A;  1O7K A;  2WWE A;  3IQ2 A;  2RED A;  4P2J A;  1OCS A;  4PZG A;  2RAJ A;  1XTE A;  2L73 A;  4IKD A;  4AZ9 A;  3DYT A;  1H6H A;  2REA A;  2YPS A;  4HAS A;  1KQ6 A;  4P2I A;  1OCU A;  3P0C A;  1XTN A;  2RAI A;  2V14 A;  4IKB B;  2RAK A;  4AKV A;  3FOG A; 
#chains in the Genus database with same CATH homology
 2CSK A;  4PQO A;  4IKB A;  1KMD A;  2IWL X;  3LUI A;  1GD5 A;  4OXW A;  2DYB A;  3HPC X;  2CZO A;  4PQP A;  2V6V A;  4BGJ A;  3HPB A;  2I4K A;  4ON3 A;  2ETT A;  2AR5 A;  1O7K A;  2WWE A;  3IQ2 A;  2RED A;  4P2J A;  1OCS A;  4PZG A;  2RAJ A;  1XTE A;  2L73 A;  4IKD A;  4AZ9 A;  3DYT A;  1H6H A;  2REA A;  2YPS A;  4HAS A;  1KQ6 A;  4P2I A;  1OCU A;  3P0C A;  1XTN A;  2RAI A;  2V14 A;  4IKB B;  2RAK A;  4AKV A;  3FOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...