2WWFA

Plasmodium falciparum thymidylate kinase in complex with tmp and adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
211
structure length
211
Chain Sequence
HMTDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords THYMIDILATE KINASE, PUTATIVE
total genus 83
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwfA00
2B7BA 2GXQA 4KVAA 4YQFA 2ERYA 3EZ7A 1JJVA 3SI7A 3SHWA 2IF0A 3GP8A 4B6FA 3OHMA 2OCAA 2ZRFA 2ZRCA 1YKSA 2VTKA 5KNCA 2HT1A 2NQ2C 4TYNA 4PC3A 2AK3A 3N5CA 2AD1A 1JQJC 4KYUA 4CZ2A 2FH5B 3CWQA 4NYJR 3ZQJA 1G41A 1Z8FA 4DDTA 2GJ8A 3P27A 1KNQA 2I1QA 2YZ2A 3QKSA 4IDOA 5TXGA 3PEWA 2ZAOA 4A9AA 2PJZA 2ZVQX 4YMUA 2C04A 4QGFA 4PZLA 3DEFA 5C2JB 2CBZA 1G8HA 2KBFA 1ZNZA 4B2LA 2ZI9A 1KO4A 2WSMA 3B85A 2W2TA 2ZS7A 3L82B 1MH1A 1RRCA 4HLDA 4DXAA 5J40A 3VQTA 4L15A 1NN3A 2FMXA 5EUMA 1NJFA 5AK0A 2IK8A 6Q21A 2PL3A 3WP0A 1F6BA 2CJWB 2QT1A 3LBNA 1L4YA 3RVBA 5FUWA 4C0SA 2VHUA 1EFTA 1MRNA 2D74A 4PHFA 1KNXA 1XZPA 5IDVA 2C03A 5FBLB 4NBSA 1QHNA 2BCGY 4DLWA 1SVLA 3CZQA 1LS1A 2OEPA 3DHWC 5DE3A 5CM9C 4QNRA 4HATA 4OBEA 4LBWA 4QRHA 3ZZTA 1IN7A 2H1LA 2W2XA 3DMDA 4LY6A 3UPUA 3TGPA 3K70D 3JVVA 5L3RA 4ZDKA 3I1FA 3Q72A 1E2FA 2IS2A 1Y63A 4Q4JA 2IT1A 5KU1A 1UBEA 4LV6A 1W46A 4IEEA 3MMPA 5DN6A 4B3XA 3TR5A 2CVFA 3GLIB 1FPMA 4ZI2A 2IYTA 3I4LA 2Q3HA 1OB2A 3F5FA 3QEJA 2QPOA 5GVSA 5JWRA 3W5IA 4IOJA 4DCTA 2OAQ1 3GJ5A 3ZVMA 521PA 2GBLA 1AK2A 2RGAA 3D7MA 3TSZA 4PAMA 4V0OA 3CRVA 2C9YA 4XD7D 2J41A 4Q47A 3VNUA 1WXQA 2W00A 3A1TA 4DLRA 5D3MA 2QSYA 4AY2A 2V8OA 2VHCA 2LKDA 2X2FA 3HP1A 3AP2A 4NHOA 5CJPA 1P2SA 2CCJA 2HJVA 5JS8A 3RS4A 3T5DA 4NU0A 4AYXA 2OSBA 1Z06A 4AIIA 3A58B 3LXXA 3NH9A 3CRRA 1DAIA 3QY0A 1JI0A 5HR5A 2GAOA 1N5JA 5D3MB 3AVUA 2CHQA 3PUWA 3UXMA 4Q1EA 5LDDC 3FKSA 1ZM9A 2WTUA 4GZMA 1Q20A 4Q1DA 4HZIA 3OIWA 2GK7A 4BPBA 4ZKEA 1L8QA 1O87A 3EAQA 3EG5A 3KQUA 2JLYA 4EJSC 4WZBE 4IDNA 1W0JD 4P33A 4MGIR 4EPRA 2ZTSA 1S96A 4PC2A 1U81A 2ONJA 1AJEA 3KB2A 4Q18A 3K9NA 2C99A 3QXSA 1SVOA 5JJLA 1JR3E 2AK2A 3H0KA 4XSGA 3SHFA 4QHTA 5AUPB 4QBHA 2PBRA 2P6RA 4ZDIA 2QNRA 2XOKD 4JLMA 3WRYC 2OFOA 1ZCAA 2NOAA 4JMPA 4US1R 1AZSC 1XWIA 4MGYR 2BMFA 4TMKA 4D81A 4CEIA 2DYKA 3KL4A 1RRFA 1EGAA 4HB4A 3K0EA 4D4JA 2AWNA 3SS8A 1E2QA 1T4GA 2KI5A 2GJAA 1AIPA 2NO1A 4HDOB 2XTZA 3AVTA 1COWD 4BFSA 3QE0A 2AFIE 4DLUA 5CLLA 4JL5A 3IQWA 1IONA 3VR4A 3CB4A 2IBMA 1E2HA 4XVUA 1IXRC 3C14C 1RPZA 2ZRLA 1DVRA 2PZEA 2RHMA 3CZPA 1GUAA 1OH5A 1HV8A 1Z0KA 2ZI4A 4GP6A 4OQXA 4I1VA 2JDID 4AKGA 3GEHA 1PZNA 1Z63A 5EE5B 1F2UB 3LY5A 1GRNA 1FX0A 5KYKA 4I81A 4JL6A 3AV0B 4TMVA 3MAAC 2DFKB 3QXHA 2V54A 4BEJA 3ZVNA 3B1ZA 1CIPA 1ZD9A 4MITA 5JS7A 3AVYA 4OHYA 4F91B 1XTSA 2DFTA 1A7JA 1EFUA 3NBYC 4L16A 1NF3A 5DI3B 1QVRA 3DVLA 2RAPA 4DLZA 2LKCA 4PANA 3Q5DA 5E7IA 3FDIA 1II0A 4A2PA 3BFXA 2V1UA 5FH9A 3ZIAD 1VG8A 2FEMA 3GLHA 2EVWX 2A78A 4JLOA 4DDVA 2XXAB 4Q7JB 1YZKA 1WQ1R 3UKDA 2JCSA 3CM0A 2FFBA 5LB4A 4ZIRB 4P4TA 1LW7A 2NO9A 2W6ID 2ZITA 4HZUA 3TUZC 3LAWA 1KY2A 3QI2A 3MRSA 4H9GA 4GMDA 1BMFD 2I4IA 2PLFA 4ASUD 2XEXA 1VPLA 4AG5A 2NO7A 1SVWA 4GI7A 3AB3A 3G0HA 1H8HD 3SJZA 5LBIA 1Z0JA 3I8XA 5FOWA 1F2TA 2E87A 4M9ZA 1RFLA 1VIYA 2Q0HA 4DJTA 1KHTA 4RD4A 2C96A 2JJ1D 1EG7A 1GRQA 1M7HA 1G1MA 1US8A 3SE0A 5JI3E 1LNZA 5CB6A 5EJEA 3LNCA 3HJNA 1M8PA 2G9NA 1NVUQ 1CKEA 4EQ6B 3B5JA 4DBLC 2OXCA 1ZBDA 3CNNA 4RVCA 2IYWA 2BJVA 3U7HB 1CJMA 1OXXK 4TSFA 1U90A 2JLSA 2Q9AA 2W58A 4XTCS 1IQPA 4EJSA 2SHKA 1II8B 1G8FA 1ZM3A 2OCPA 1J70A 1KSJA 2GTPA 1YZUA 5KDLA 4FMDF 3H86A 1DE0A 1Z28A 3OIVA 5FTNA 1CJKC 1GITA 2VH5R 1DTSA 1HY3A 4R9UC 1SGWA 2JJ2D 3EWSA 1NBME 3LO5A 3DDCA 3A1UA 4GOXA 4BUJA 3OESA 2ZE6A 1CRQA 2VHJA 1ZC4A 4XVRA 3AM1A 1NLZA 3FFBA 1KSHA 3T12A 2QP9X 3I61A 1NLFA 4RSGA 1N6KA 4B44A 3CF6R 1LS6A 2QT0A 1XXHE 3Q3JB 3SDZA 2KJQA 4CEJA 4IHQA 3U7GA 1I4DD 1HUQA 3GJ0A 1VYTA 2KWIA 5AJYA 4JKIA 4RD1A 3RS2A 4BRWA 1D8TA 1S1MA 1Q44A 3IO5A 2ZM5A 1MV5A 2IXFA 4KO8A 4ESHA 1QVAA 5BQ5A 4A1FA 3S1AA 1A4RA 2GZHA 3EA0A 2ZRPA 3Q8XB 2IXEA 4A4DA 1W0JA 4G5SA 2ZAMA 5EP4A 1OT3A 4OI2A 5CJ2A 2WWGA 4LZZA 1E69A 1U2RA 4GFDA 4HAXA 1KDRA 5BWMA 2IYZA 3ND8A 1JECA 4EFMA 4QC2A 2RGBA 3VKWA 1D2EA 1W0KD 2E1RA 3ZIAA 2WIAA 1NVWQ 2NIPA 4QL3A 5H8WA 5GJVC 4B2PA 4Z51A 5J4HA 5A5GA 1OXSC 3BB3A 2IWRA 2KSQA 5JBQA 5G3ZA 5FPSA 2JLUA 1GAJA 2WJGA 1JJ7A 1W4BA 2QU8A 4A0FA 1PUIA 1DOAA 3RANA 1E9CA 1BMFA 2OZEA 2EW1A 3ZVRA 1OXTA 4BFZA 1NP6A 3NBZC 4OHWA 4ZV4A 2EWVA 2AL7A 3CNOA 3FMOB 3ADKA 2XNDA 4DEXA 5LPNA 1TUIA 4HAZA 1FUKA 3CPHA 3IBYA 4ZO4A 2JLRA 1JR6A 4NKRA 5K8LA 4TLEA 3B1WA 3TQFA 1DEKA 1QHIA 5AJZA 3NHBA 5FI0B 4BQSA 1AA9A 3RAPR 4FMCF 1SXJE 5BYKA 3LQRA 1Z07A 3HU1A 2QY9A 1T5IA 3NXSA 2BM0A 2BCJQ 2XTMA 3GLGA 1YQTA 4LPKA 1ZVQA 2F6RA 3Q7QA 4F93B 1GDDA 1Q0UA 3BC1A 4C0AC 2GZAA 3LA6A 4HAUA 5JCZA 5FPKA 4A6PA 4V0ME 2G83A 3QKRB 3KKMA 1D6JA 4JT2A 3PITA 4ZCIA 3U3JA 2FJUA 4I4LA 3B2EA 4LHVA 2AX4A 1Z08A 4LUCA 4DSNA 4OJKA 1KI9A 1Z83A 1CEEA 5KHOC 2ZSBA 4BZPA 4DLYA 1YRAA 1ZNYA 4BFVA 4CT4B 4YDHB 1KAGA 4U7DA 5JJIA 3SQWA 1Q12A 4IDQA 5C4MA 1A2KC 3LDAA 3LLMA 3PV0A 4C3ZA 4KYIB 3QKUA 2R6DA 4E03A 1E2IA 4BFUA 2GXUA 2G0NA 1NL3A 2ZJAA 3IDQA 5L8VA 2QUZA 2J0SA 3KTAA 5DSZA 2H7VA 4KU4A 2JIZD 2NTYC 3G82C 2F1HA 4FCTA 2RGXA 3TW4A 3KFXA 5FOUA 4G3XA 1G6OA 1OFTA 2OAP1 2D7CA 5DNYB 1MO5A 2VPPA 1Z5ZA 2BKEA 5GJWC 2FA9A 4PHTA 2ZVPX 3ZDQA 4JLNA 3WXMA 2O8FB 2WKPA 5UKDA 1C9KA 2OLJA 4Q66C 4Q4HB 2Z43A 3U4QA 3BS4A 2CLSA 3EIEA 1XEXA 4GPTA 1NN5A 3UG6A 2CDNA 4URVR 3WNCA 3NIBA 3AGQA 3C8UA 4HEJA 3EASA 4FMCB 3GD7A 2ZYTX 4BASA 2IYVA 5FPHA 3IPYA 5AUNB 4M9SA 4S35A 1K6MA 1KOFA 3QNUA 4OYHA 1P9NA 1J7KA 1KY3A 4IFBA 4TTRA 4WAUA 4JVMA 3QF7A 4OQLA 2WV9A 2YOFA 2GVDC 3ONWA 4KFSA 4QJ5A 5FBQB 3HU3A 4Q03A 1IY0A 2VL7A 4I1OA 2RCNA 2AKAB 2OCYC 2X8AA 3FGNA 1TADA 4IW3B 1GIAA 2PZGA 4IOLA 2RB4A 2WICA 4LK2A 3AF2A 1KZ7B 2D06A 1WF3A 3QVUA 1U8AA 2XB4A 3NEYA 3GLIA 2CNWA 2O0HA 3FMFA 2Q3FA 1JALA 1YVDA 2YKGA 4EAQA 4NYMQ 4DCUA 2HF8A 2FGKA 4C0LA 3FHCB 2QMUA 4L8GA 2A2ZA 5KPJA 1AQUA 4FW9A 4ABYA 5SZKB 2ZJZA 2ZETA 3BFVA 3EPJA 3P32A 3GLIE 3T15A 2AFHE 4Q19A 2V4ZA 2F1RA 3L0IB 3RS7A 2G3YA 1EK0A 2VF7A 2QL6A 3RWOA 3AVPA 3L8YA 5AUQA 4MRVA 3RLFA 1Z47A 2CCKA 1WBBA 2OG2A 3UWOA 2RGEA 3IIJA 1NVVQ 3DZ8A 4MRRA 3K53A 2GF0A 5IK2A 4F4CA 2ZJ5A 5HE8A 5J4LA 4Q5IA 1XEFA 3R8FA 3NG1A 3LX8A 4HB3A 1N6RA 2CL7X 2QZ4A 1Z22A 1XXHB 3QVVA 4POAA 2AN9A 3BIFA 2QRZA 4BECA 3I5YA 2B21A 1CF4A 4MYUA 1AM4D 2P67A 1UKYA 3EC2A 3EW9A 2A5DA 4HUQA 1BS1A 1SVKA 1VCNA 2RKOA 3EZ2A 1DG1G 5AR1A 2D62A 1N6OA 3SYKA 1G17A 1G18A 2GBLC 4MKHA 2Z4SA 4QHSA 4GOKA 3MGCA 1Q1EA 3OFND 3DOEA 2WAYA 4N0EA 4KLNA 3Q9LA 3QKSB 2FSHA 1HH4A 1U0JA 2GILA 1GL7A 3CX6A 1G16A 1NY5A 3CWZA 2GESA 1IJEA 5J4VA 4Q01A 2F43A 3GEEA 3I72A 8OHMA 3FHOA 1L2TA 3MWYW 3AUXA 1KJYA 3CX8A 4B35A 4ZCMA 3QKTA 1UPTA 4WXRA 4B3FX 2F43B 3AVWA 4RD2A 2ZE7A 3LW8A 5K8TA 1P2VA 2OE2A 2EFCB 5G40A 5KNBA 1G8PA 2P5TB 4IXNA 1OKKA 4JJZA 3KQNA 3QF4B 3PUZA 2CE7A 4EPXA 1UEJA 1F60A 2C9OA 1IJFA 3EC1A 1EWQA 1UM8A 2RGGA 5D3QA 1SVIA 2PH1A 2HYDA 1GSIA 3ECCA 4YXWD 4DKXA 4YONB 1XCMA 5DYGA 3M4YA 3MWKA 4TSFD 3HPQA 2HEIA 4A8JA 4LC1A 3LQQA 1Q3HA 4Q4LA 2XNDD 1SHKA 1XD9A 3AKYA 1FW6A 3TAHA 1FOEB 3KXKA 1XTJA 4H1UA 4HYYA 2RH5A 4L9SA 1QRAA 2ORIA 2ASEA 4IVQA 3T61A 5HPYB 4EQ6A 4BRUA 4BWYA 2G88A 2OHFA 2EFGA 3WYGA 4DRZA 1P61B 2ZPTX 4MH0R 5L3SA 3EPKA 1IN5A 1QHXA 4Q7KA 1GKYA 5EE3A 2R2AA 3FWYA 3BB1A 5GADl 3QOFA 2CLDX 3ETLA 2GRJA 1P2TA 3CPEA 4L9WA 4DZZA 3UIEA 3HDTA 4WVFA 1JPJA 4JLDA 2PX3A 4GNKA 1G5PA 1Q21A 5C1BA 5L3VA 4JVLA 2OESA 4NYIQ 4MGKR 1Z6YA 1LFDB 2ANBA 5DO9A 3K0FA 5JEEA 5JSZA 4ZPXA 3AP1A 2WHXA 3DM5A 2J0UB 1OV4A 4TT3A 2N42A 2CJWA 3GJ6A 1M34E 3TJZA 5IF9A 4MYTA 4TL7A 5KSOA 1ZRHA 5CIQA 2VIIA 1HE1C 2ZRJA 2WWWA 4WW0A 4BGDA 1KZGB 2V1XA 3NTUA 3WMGA 2QP3A 1BYIA 1G64A 3QXXA 4GL2A 2JDIA 3REFA 2UKDA 4EUNA 1XXHA 1GNQA 2QQEA 1TTTA 2DFNA 1JR3D 2ZRKA 4YMVA 2NPIA 4KJZA 2FSGA 3PEUA 2V7QA 2WMOB 1SKYB 2F1JA 1XCPA 4WA7A 1KK0A 4BLQA 4DUGD 3GPLA 1CJTC 1PLKA 2XX3A 4PX9A 1AQYA 3NKVA 1I4TD 4X8HA 1OYWA 2IYSA 2MMCA 2OCBA 1YZTA 3B1YA 3RS3A 5TMPA 3CRQA 4W5JA 3U3MA 2VP0A 1E32A 4BFXA 2XTNA 1BIFA 2PCLA 3K1JA 1NG9A 1K8RA 2ZSAA 1KDOA 3KKQA 4AC9A 5C46F 3VU9B 3MFYA 1G7RA 2W0MA 1HT2E 2J46A 1IN6A 4Q48A 4ACBA 3LBHA 2FN4A 4JT4A 1OE0A 2W6IA 1X6VA 3O8CA 4LDJA 3OEHA 5LD2C 2J3EA 4MA4A 4E07A 2XB2A 2H17A 2PT7A 5CLQA 3VNVA 3SFZA 3F8TA 1T3HA 4IRUB 1E2LA 1DAKA 1XP8A 1W2GA 4W5WA 2JLXA 1FMJA 2YWEA 3W8NA 3BD9A 2L0XA 3FMIA 4A36A 2GKSA 2OV2A 4LI0A 1VIAA 2O8EA 1VCIA 2VHQA 2YV5A 3MG9A 3NC1C 4HLUA 4Q9HA 1X8LA 4F38A 3P1JA 1IY1A 1G5TA 1ZW6A 2WJVA 3ZZ0A 5J47A 4UXIA 2XNSA 3L0PA 1DADA 4UJ3A 5HCNA 2FV8A 3U7EB 4K8OA 4TN1A 2J7PA 4YXWA 4C7OB 2IUTA 5JWOA 4GRAA 3JVUA 1YE8A 4HDQB 1TEVA 1E96A 1KDTA 2A5GA 3U44B 721PA 2FFHA 2GZDA 4PSKA 2FFQA 4DWJA 2QP4A 2RGNA 3FE2A 1MKYA 3TK1A 2IS6A 2GJ9A 1QDEA 3TKLA 4PZYA 4LYAA 2R8RA 2ZU0C 1G21E 1P9RA 5SZJA 1J90A 4M1TA 2J9RA 4QGAA 4Q1AA 3PG5A 4LPSA 3AP3A 2RMKA 5HE9A 2GHIA 1P4SA 3NEJA 1GKUB 4BE7B 4DLSA 2GK6A 4LHWA 3UMRA 1XTQA 5EUQB 4QNMA 3Q5EA 2F3TA 3RS5A 2HXSA 2YC4C 2BVNA 5CIWA 2XXAA 1G6HA 2W83A 4HUQB 1X1SA 2NO0A 5DGXA 3RSLA 1R2QA 2H92A 1DO0A 1MABB 1UDWA 2J7PD 4G0NA 3VR5A 2YINC 3WRXC 4TQUS 1K5DA 1E6CA 1E9AA 2ZQ5A 4MKGA 5DHAA 4V0LA 4AK9A 2BMEA 5L3QB 1R4AA 3IEVA 3CPJB 3QENA 2PZFA 3N2EA 1KO7A 3DKPA 4MYHA 3SN6A 2NZJA 3K09A 1CR2A 1NN0A 4IXMA 4CF7A 2JJ1A 2BJWA 2PT5A 2YWFA 4URYR 3B8HA 1Z6XA 4IJMA 4PC7A 5KNDA 3OAAA 4H1VA 3B82A 3IGFA 1E1QA 2IXGA 3K9LA 1K5GA 3L2OB 4HSEA 4PO8A 5GJCA 4N1AA 3SYLA 4EPWA 3VU9A 4ZKDA 5B57C 4Q4AA 2UZIR 1TF5A 3NH6A 2IS1A 1IOZA 2IYRA 3LVQE 4P3YA 1NMXA 4LSGA 2O8BB 1HE8B 2VSFA 3A37A 3V4RA 1A2BA 2FDCA 5ANRB 1S1CA 3A4NA 4GDFA 1XCGB 3LRPA 3ND9A 1OIWA 3ZQ6A 1T8TA 4X8MA 1N6NA 4TMXA 5H68A 1JR3A 3VHXA 5FTLA 4ITRC 3LW7A 1IN8A 1R5OA 4TLDA 2BBOA 1NMZA 1E0JA 1OB5A 5FUVA 3KB1A 1DAGA 3P26A 1PV4A 3SJBA 1NIPA 1NI3A 1KO1A 4DLVA 3IQXA 4V0NA 3UG7A 1F5NA 3FKSD 2OXRA 1T8UA 1OFIA 1G5RA 1CU1A 4TYYA 4G01B 3DM9B 1KK1A 3BOSA 1IM2A 1NSFA 1E2MA 4Q9LA 1JXMA 4IVPA 3RRZA 5BN5A 2WIBA 1X8KA 3QXCA 5EXPA 4ZDJA 4PSAA 4Q9IA 1LVGA 4D80A 5JMTA 2PCJA 5EXSA 1CP2A 5FOVA 1N5KA 4G5OA 1W5SA 1KIMA 2VSOA 5EP3A 4LBYA 1YZGA 1XTIA 1E79A 3U2QA 4TZ0A 2ZJYA 3KJHA 4IEIA 4B75A 2UZ3A 2XITA 4DDUA 1DAHA 1HQYE 1G3MA 4TTQA 1P9WA 4HLUC 1P7CA 5AUOB 2ZE8A 2ZI5A 2PX0A 1VCMA 4KBGA 3E5HA 1OIXA 2QSZA 3C16C 1CULC 4AWXA 1Q57A 1KMHA 1MRSA 4D6PA 2BBSA 4MDFA 3KQLA 1LF0A 1LV7A 4CT5A 1US8B 2ZJOA 4KV9A 3GLFB 1B0UA 2D7DA 2O8DA 4O2RA 2ZUBA 2WJYA 4Q4HA 2FU5C 4LX0A 1KAOA 1LTQA 4OQFA 4B6EA 3ICEA 4C0JA 3D3QA 5JFGA 1E1RA 3U44A 3ADBA 2IEZA 1L7VC 4MUAA 2WWXA 2IUUA 3J81k 3TRFA 1M74A 2OBMA 1S3SA 4LWZA 5FOXA 4RD3A 3ASZA 2CL6X 3NHAA 1NBMD 1Z6GA 1FTNA 2P3SA 2A5YB 5EXXA 1UBGA 1ESNA 2G1KA 1SXJA 2VQSA 4O0MA 2A9KA 3TR0A 4RD6A 2CCGA 1CJUC 2YOHA 1RW4A 1VCOA 2MSCB 2A5FA 4PAQA 4LC0A 5IT5A 3WMFA 1R5NA 1RZ3A 2JJ2A 4FMDB 5GVRA 2YOGA 2ZJ8A 3C7KA 2Q9BA 2P0EA 3R20A 4NCHA 5KDOA 4GZLA 1G8GA 4PXAA 5DI3A 4D2IA 4B3GA 2ZI3A 2CL0X 1D9ZA 3X1DA 2VP2A 1KDPA 3A8TA 4MYCA 3UMSA 3EARA 4EFLA 1XPUA 3GJ4A 5FBRB 1ZAKA 2ZRAA 4LJ6A 2VP6A 1UDXA 2ODEA 3CH4B 1T0HB 4L4UA 5JECA 4G5GA 4LJYA 4MKFA 3BERA 1NNEA 1KK2A 3IIMA 1W49A 3AUYA 3MCAA 3EX7C 4G1UC 3GLGB 3WP1B 3PFIA 3R9WA 3BH7A 3TIFA 4JIMA 4EDHA 4D0NA 3CLVA 1ZU4A 1V5WA 3FOZA 2O8CA 1T3LA 1DELA 1RRPA 2GEDA 3A36A 1ZNWA 4NL4H 1M2OB 5E3HA 3AKDA 1E0AA 3CNLA 1ANKA 1R5BA 2Q21A 2ZI7A 3MD0A 2F9MA 3JZMA 5FPTA 4P31A 4DVGA 4V03A 1W1WA 2QGNA 3GLGE 1GRRA 3ZH9B 4PHGA 4JBXA 5DLQC 1Y3AA 1N3BA 1JBKA 1P6XA 3ZD6A 2E9SA 4B33A 1J2JA 3PIRA 3W3AA 2KB0A 2BV3A 4M9QA 2ZR7A 2R62A 3P4XA 2QPTA 4M53A 1QG2A 3K0AA 2ECKA 1D2NA 1S8FA 1U9IA 1FTSA 5JRJA 4B47A 2EFEB 4BFWA 2ZRGA 3BH0A 1ZUIA 4AKEA 1H8ED 3B6EA 3BE4A 3TUIC 3X1WA 2ZRNA 1FUUA 2NO6A 3K0CC 1Z0DA 2OO7A 1GOTA 3OAAD 5DH9A 2VF8A 2K5UA 2J59A 4RY2A 2IUSA 1QHYA 1E4VA 2X19A 3FPAA 4D4MA 1KI8A 2QN6A 2EU8A 2LCFA 1DAFA 1TAGA 4QGHA 1E99A 1G3RA 1XF9A 3IKJA 4XWAA 4DHEA 4XJXA 4DCNA 4QM6A 2ZYUX 1TQ6A 4NMMA 4OK6A 4TLCA 3AF3A 3KXIA 4BLRA 3N70A 4I99A 2PEYA 1LY1A 4NYMR 2B6HA 2H16A 1P72A 3AH8A 1ETUA 3AGPA 3CUEF 5FR1A 4RD0A 1G4UR 2F55A 2F1IA 4OHZA 5KDDA 4Q7LA 3RRNA 3THWA 1WP9A 3G5UA 2WWYA 1ZM7A 3HR7A 1UAAA 4MRNA 3K70C 3O8BA 4MDEA 3O47A 1NSTA 1OFUX 2B7CA 1ODFA 1RE0A 3D8BA 4R98A 2G6BA 1OLOA 2NGRA 2XGJA 3TSWA 1XPOA 1UADA 1PVOA 4UNPA 4B43A 4PZZA 4ON9A 1BO6A 2DWOA 4NYJQ 2AKYA 1W7AA 5G3YA 3KJEA 5A0FA 4GBMA 1VG1A 1NLYA 1TU3A 4GSYA 4QG7A 1NBMA 3PJRA 5FI1B 3RC8A 2XOKA 1R8QA 1HYQA 3GLHE 2N1BA 1E0SA 1ZINA 4M2LA 4D4LA 4Z8YA 4WZAE 3SJAA 4TLBA 4F92B 1OH7A 1JQLB 3W3ZB 3CKLA 4JJKA 2PJRA 1FL9A 4ARZB 1T5LA 3KTAB 4TLAA 4PC6A 1ZM4A 4QHYA 1A1VA 3CIOA 3ICQB 1QZXA 1GZSA 5E95A 3W90A 1R0ZA 1JAIA 2XJ9A 2GA8A 1AS3A 1XMIA 2ZSEA 5FUYA 1CXZA 2ZU6A 1XJCA 1VDZA 2QMEA 2BEJA 4V02A 3B60A 2QE7D 1WB9A 1HURA 5HZKA 2REOA 3IBGA 5J4YA 4C2TA 2FGJA 3W6PA 1XMVA 4O3MA 4TYWA 2P6NA 3AQ4A 5JHGB 1NIJA 3B13B 4DUGA 2BM1A 1OXVA 3PEYA 1OFHA 2ONKA 3UWKA 4AG6A 3OIUA 4A15A 1KI2A 1VMAA 3U3KA 3FMPB 4OI0A 4M22A 4NE2A 2QQ0A 2J1LA 3B9PA 2VHTA 2WVJA 3LVRE 4II7A 3X1YA 1EX6A 4B74A 2JASA 2O8CB 1NJGA 1YHNA 2CE2X 4OJQA 2ZI6A 4M4SA 1AS0A 4U5XA 5KO2A 3CONA 4HUTA 3PEVA 2ORWA 3VAAA 3QG1A 4JBWA 5GJBA 4F7WA 1FX0B 3H2YA 1F2UA 4KI0A 1BYUA 4P0TA 1MO4A 1H65A 2Y8EA 2J7KA 1WE2A 2WWHA 5TVKA 1VTKA 4CEJB 1XPRA 3QPWA 3NBXX 4RZ2A 1XZQA 2B8WA 4Q1FA 4Y0VA 2AXNA 3MJHA 4TT3D 5KUTA 3U5ZB 1KI6B 4HAVA 4WOPA 3VR6A 2YNMA 5JI2E 1J8YF 2WOJA 1W5TA 4JLAA 2X77A 3ZS8A 2PMDA 1G4AE 3AF1A 1DG3A 5L3QA 2FX3A 2BHRA 2WKRA 4FXPA 4DB2A 4BLPA 4CEIB 3HYTA 4TMTA 2XAUA 1GL9B 4NYIR 3SNHA 1I2MA 4PO9A 4CDGA 2P65A 2HLDD 3NDPA 4FN5A 4AKIA 1CR4A 4KITB 1N25A 2REXB 4KODA 3UATA 1CR1A 1F48A 5HKKA 4KFUA 2XSZD 2V55B 4EPTA 2XZOA 1DARA 2J0VA 1M1YE 3BORA 4PQRA 4P32A 2AWOA 1GL6A 5E7MA 2VO1A 5F2EA 1XEXB 2QAJA 3NBFA 2HXYA 1E2PA 1UEIA 2AR7A 1NRJB 4P4UA 2ZREA 5FL7A 3THXA 5FPYA 3F0TA 2IC5A 1Z6AA 3SFVA 5ELXA 3OZXA 4DC9A 3THXB 1NG1A 4TTPA 1OKKD 3W5JA 1DAEA 2WOOA 1EX7A 4ILEA 4C7OA 2QMOA 2GJSA 5TDHA 4JLKA 2OBNA 5LD2B 2GCNA 1AN0A 1E2EA 3EXAA 3CR7A 1GG2A 2WJHA 2ZYWX 4M1YA 4K46A 1G3UA 4KHZA 2R9VA 3L0SA 1C1YA 1HTWA 1KMQA 1FQJA 4M1KA 5KSYA 4BFYA 3RRMA 2PLRA 3BXZA 3LV8A 2JLWA 2VBCA 1OPXA 1T9HA 4GP7A 4IVRA 2ZYVX 1KTVA 5A4JA 1GKIA 4OQNA 3U3OA 2IWHA 3WMEA 4EPYA 2DR3A 1ONBA 1ZU5A 2AXPA 1ZD8A 3IUYA 1XMSA 1DS6A 3PUVA 2KBEA 4Q1BA 2H8KA 1XTKA 2CK3D 3BB4A 1JXOA 1WMSA 3NVAA 4FWIB 4JLJA 4CVNA 2G0TA 2CVHA 2VP9A 4TL6A 3OFNA 1Z2AA 2ZUCA 1E9RA 4QOSA 2BC9A 4LJ4A 2DY1A 4LJ8A 4NCJA 3A4LA 1G19A 3TSOA 1GWNA 5M04A 4PPGA 2WSSD 2O0KA 1II9A 3N2IA 4PR0A 4RKFA 4DCVA 3C15C 2V3CC 1EWRA 4HZUB 2HF9A 1ZP6A 2DWQA 4X8LA 3K0SA 1R0XA 2I3BA 1N6IA 2YC2C 3W6NA 4QBGB 1VYUA 4OK3A 421PA 4V0MA 4Q21A 4LJ5A 1FFHA 3C5HA 3GLHB 2REBA 5EQTA 1E2DA 1HQCA 3T06B 1P3JA 2OM2A 2EYQA 3WNBA 3LWNA 3DOFA 4B76A 1RYFA 4KBFA 4B3BA 4XOIA 2JLQA 2PEZA 2R6AA 3L43A 3AVXA 1EFRD 1M6NA 1BKDR 1IBRA 2D4HA 1KKMA 4PAOA 3I73A 2P6UA 3BFKA 4DSTA 2IYQA 2R6FA 2ZJ2A 2O52A 3AF4A 2UVQA 3PUYA 1GM5A 2VYFA 2VP4A 3SEAA 2WJJA 2Z83A 3RC3A 1AKYA 2V6IA 3AKCA 1N6LA 4DLXA 4TYPA 5KTYA 3QBVA 4JL8A 5F9HA 2J0UA 4LHYA 3C5CA 3B78A 3KDSE 5B58C 2B8TA 3ZZUA 4JVNA 4M21A 3ZYCA 2VRWA 4E09A 3BH6A 3GMTA 5FTMA 3SYNA 1TMKA 5FR2A 4JVSB 1EFCA 2GF9A 4V0KA 4W7SA 4B32A 2GJKA 4XWKA 3KJGA 2HCBA 1JPNA 4RZUA 4A0RA 3B1XA 4O2LA 2HLDA 3REGA 3LFUA 4HB0A 2ZANA 4LV8B 2QRNA 1R0WA 3W34A 2Q9CA 4QXAA 3SC3A 5AWFC 1XNJA 4JLBA 3CW2A 1TU4A 3KFVA 5TB5A 2IYUA 2Z4RA 5CK4A 4NP6A 3PR1A 1NY6A 5JHHB 5KPDA 1RRGA 3P4YA 5E7JA 4HDCA 4OK5A 1PJRA 1E9FA 2BBWA 2RHDA 1SXJB 2C2HA 2ZRDA 1WCV1 3WBJA 3VTKA 1LF5A 4IKEA 1TQDA 3MLEA 4QM7A 3QPUA 4RFSB 2QI9C 4LJ7A 4UXHA 3R9IA 1NVVR 4PPNA 1Z3IX 2HUPA 1OF1A 3ZD7A 4EJSB 1QHHA 4LHXA 1G7CA 4Q7MB 4HLCA 1RVDA 1YZQA 4NCKA 1P60A 3TQCA 3CF0A 2AHOA 4MUBA 2DFLA 3A6PC 2IYXA 1MO6A 3QKRA 1X8JA 3K0CA 3UANA 1RC8A 3GJ8A 2C8VA 2V7QD 2ZIAA 1R8SA 2O0JA 4PHHA 2DBYA 4L5BA 2OLKA 3A1SA 2QROA 2H5EA 3MWJA 4YMTA 2ZSFA 4B71A 4Z1MD 2PMKA 5K8IA 4TQAA 2IEYA 5BW8A 2QBYB 2GAAA 1EFHA 5F9FA 1J8MF 4MKIA 3I3SR 4PPFA 2W6JA 3TW8B 2CEAA 1KMHB 2OUKA 2IHYA 5AJVB 221PA 1G3IA 5EXTA 2RGNC 3MWLA 4U00A 3ZLJA 2O5VA 4HI0E 4UNRA 4R2IA 1ZIOA 1DO2A 3OEEA 1U99A 2WKQA 1N2CE 1RIFA 1EFRA 2BMDA 1W4RA 2ZRBA 4ZIRA 2JLZA 2NZ8A 2QE7A 2ZSDA 3HWSA 1E9EA 4N3NA 4JS0A 4JYBA 1N6PA 4O25A 5CM8B 5FFMA 4F4JA 1W4AA 1E2KA 5KOYA 3GFTA 1N5IA 3KZ1E 2ZRIA 4DSOA 3U3RA 1CLUA 1UF9A 1P75A 1N0VC 4AD8A 2I1VB 3EZ6A 4NTZA 1A82A 2ATXA 4FD2A 3T35A 3I32A 3U61B 3X1XA 2GDJA 3PQCA 1E4YA 1ESMA 1OJLA 2ZRMA 1TPZA 2EQBA 3Q85A 3SJCA 4MQBA 2CLCX 3GJ7A 3AF0A 4G5RA 4US2R 5JSZB 1E9DA 3ZVLA 5IHPA 1YRBA 3IPXA 4LYHA 2JIZA 4JSYA 1FZQA 4ACAA 1QBKC 2RGDA 1M7GA 3CRW1 4DT1A 1G9XA 4B34A 4JLPA 1N6HA 1SVSA 1YR9A 4US0R 4YDSA 4KFTA 2Q3MA 4Q02A 4Q4AB 3T1QA 1Z0FA 2D2FA 2VP5A 1WBDA 4KVGA 3SR0A 3DMNA 4X8OA 3CBQA 5TV2A 4E5UA 4MRSA 1NMYA 3FFAA 3V9PA 1ZYUA 1WA5A 4W9MC 2R65A 4DT1B 3KQHA 3EPHA 3RNLA 2JEOA 4M1OA 3SOPA 2OFXA 3OF5A 4D26A 3SZRA 3GFPA 3TUJC 4DDWA 2TMKA 1L4UA 2BEKA 3HYRA 4PFSA 1IN4A 5HCIA 1VKJA 2WPDD 2QAGC 3H84A 1W4CA 1P2UA 2B92A 4OHXA 2CK3A 2J0QA 3OE7D 3GLFE 2IS4A 1S0UA 1QHGA 1SZPA 4CIDA 1KJZA 2Z0MA 1ZUNB 1MABA 3FTQA 4C0BA 3FB4A 1VG0B 1ZUHA 2XZLA 3Q7PA 3NWJA 1B23P 1OSNA 3KQKA 4LYFA 4W5HA 2BKUA 4UNQA 3V00A 1CJVC 3EZFA 2FZLA 2YWGA 3GJ3A 4UNNA 4C0KA 3E2IA 1JEEA 3O8RA 2ZROA 1JEDA 1CR0A 1ZNXA 2CHVA 1XJQA 4Q9JA 4YMWA 2GEVA 3K9GA 4KLZA 1G8YA 1XMJA 2VSXA 1IXSB 1F2TB 4QBIA 4TMWA 1VHTA 2ZEJA 5EE9A 4B3DA 1KO8A 4J0QA 2GETA 5CITA 4XSHA 3VKGA 3IEUA 2CHGA 2W2VA 3BGWA 1E98A 2KE5A 2WWIA 4TL9A 3VFDA 3E1SA 1PLJA 2WMNB 3QG5A 4URZR 2VA8A 4XH9B 2WBLC 2EYUA 2O8DB 1XB2A 1ZIPA 3GLFA 2DWPA 1E94E 2NPFA 2N46A 1UKEA 4PTLA 4HLQB 3CR8A 4BZQA 3TNFA 2EFHB 1KI7A 5F98A 2YVUA 4RZ3A 5IRCD 2QAGA 1S9DA 1H8EA 1W2HA 2JJ8A 2QA5A 4RCYA 4ZI3A 1TL7C 1YR7A 1XX6A 3SBEA 1JNYA 1QHSA 1E9BA 3K70B 3SQXA 1OXUA 2OBLA 5EP2A 1TF2A 4AYTA 1E2NA 3PVSA 4JKYA 3QIAA 3IHLA 1SXJC 1CS4C 3KKPA 1OIVA 3T1VA 1AZTA 5H70A 3RHFA 5AJXA 3BAFA 2GWHA 2LWIA 2FZ4A 4KCGA 5FBWB 4FWTA 2A7QA 1KI6A 3VX3A 1RJ9A 4C30A 4OKSA 1RKBA 2FSFA 3CF2A 5P21A 1C4OA 3NDBB 1X3SA 3EA5A 3M6AA 4CEHB 2FFAA 1XEWX 1VHLA 1XDBA 2DB3A 1EXMA 2C98A 3SU8A 3WY9A 2HT6A 4TL8A 4PSVA 1A5TA 3DL0A 4Q1CA 3QBTA 1J99A 4IOMA 1D9XA 1GNPA 4NPHA 1U98A 2V9PA 2O8BA 2FF7A 4YMSA 3DZDA 4JLVA 4URWR 3GQBA 4WXPA 1WDTA 1P5ZB 4C0HA 2IA5A 1GP2A 2C77A 2IYLD 5F3WB 3P20A 3AVOA 4YC7A 4B73A 1AGPA 2DHRA 2ZXUA 3K0AB 5BN4A 4FMBB 5BYJA 4P4SB 2FOLA 4IOKA 5DI9A 1ZM2A 4NONA 3TVDA 1KI3A 2GVZC 5KSZA 2FEOA 3D31A 1FP7A 2QM7A 1OYYA 5LB2A 3AVVA 4LRWA 5DIFA 2QTHA 3WHLA 2GCOA 3I92A 1HEIA 4D0GA 2C95A 3V4FA 2GCPA 2WM9B 1MO3A 4LV5B 1E2JA 3S1AB 2W0SA 3THOA 3TMKA 1T91A 3IILA 2AD5A 5B30A 3FYHA 2BMJA 1Q1ZA 4KAXA 3BBPA 4KSBA 1XEWY 2QM8A 2WWFA 4EKDA 3U60B 2QORA 2OILA 2A3RA 2J87A 1Z29A 5FL3A 4MRPA 3EIHA 2R6GA 1UBFA 1IAQA 1T3SA 1G7SA 1AGRA 1WRBA 1W44A 1KJWA 1YJ5A 1YZLA 2IL1A 2ODNA 2R6CA 2OT3B 3BRWD 3QJYA 4BEBA 2MSEB 4Q9KA 3GEIA 4QKQA 3B9QA 1SVMA 2BOVA 2G1JA 4WBSA 1ZJ6A 5H1YA 4LCBA 1R7RA 5JRZA 2Z6VA 4A6XA 2FPMA 4TZ6A 5FL7D 2FPLA 2JLVA 1U8ZA 4A8JB 3K09C 2GXAA 1QF9A 2G77B 1D2MA 1S2MA 3FHTA 2WAXA 4EPVA 3ZS9A 4UKDA 2JA1A 2WZQA 3B7GA 3QSYA 3PXGA 2QMHA 4OL0A 3C41J 4AYWA 1NKSA 4DCSA 3QF4A 4AURA 2H18A 3VMFA 4Q4JB 4QGGA 3PENA 5HKKD 3ZJYA 4R71A 1OHHA 3SBDA 4QFMA 4DIDA 5JLJA 3QXJA 3X1ZA 1NKTA 2O8EB 4LGMA 4XVQA 2RGCA 2ZUDA 1W36D 1XD2B 3B1VA 3T34A 4M9XA 2MMGA 1XFAA 4LBZA 4LHZA 2V6JA 3T1OA 1W47A 3QPVA 4I1UA 4S2EA 5JJKA 3PUXA 1F3OA 3IHWA 2QGZA 1TF7A 2YJTD 3I8SA 3TH5A 621PA 2NMVA 3KJIA 4LYJA 4ZDWA 4KXFB 1AKEA 5CK5A 1R10A 2VEDA 4RKEA 4PC1A 3RS0A 1U0HC 5K8UA 3THYB 1KGDA 2OFWA 4FINA 2HCJB 2BWJA 1Z0AA 4OHVA 1GVNB 4FI3C 2JATA 3TBKA 2BDTA 2YHSA 3T5GA 1BH2A 2C78A 1SHZA 5CDFA 5JZVA 1HT1E 4TYQA 5IK2D 1Q22A 4CGZA 1H8HA 3CX7A 3L8ZA 1KSFX 2GCOB 4KSCA 4NH0A 5DHFA 4EIWA 1P62B 1ZCBA 2C5LA 3QEOA 2F9LA 3FKQA 3WHKA 4TMZA 3M0EA 2ODWA 4CEHA 4R7ZA 5G53C 4P4SA 1W48A 3W8RA 3R9XA 1N0WA 1Q1QA 1Z2CA 4BZXA 4JSTA 2ZJBA 3A1VA 4WIAA 1VG9B 3ADCA 4BLTA 1AS2A 1CTQA 1QG4A 1EESA 2HDNB 2QENA 821PA 4FCVA 1RYHA 1TQ4A 1OW3B 1OHHD 4RZXA 3EWAA 3K0FB 4DEYA 5EZ5A 2DCUA 4Z8XA 1UJ2A 1UFQA 3VHLB 4A2QA 3RWMB 1R6BX 2C9CA 4Z1MA 1YR8A 3EPLA 2ZE5A 1COWA 5CYPA 5J4KA 3KUCA 3H4MA 3AVQA 3I5XA 3TVTA 4DSUA 1SQ5A 4XD7A 1TX4B 3GCGA 3MSXA 1KKLA 2W6JD 3QUSA 1IXZA 2X1VA 5CYOA 3RSOA 2F3RA 1XBTA 2BBTA 3WBKA 5EZ6B 3VKHA 3LH5A 3RABA 1XU4A 1PUJA 4JYCA 4K81B 5FOTA 1II8A 2XZPA 3HR8A 2ODBA 4RJLA 2YWHA 4ESVA 2QEQA 3CH5A 1ZD1A 4B48A 2A30A 4ASUA 1OH6A 4CRWB 2FPKA 1MR3F 3U7FB 1U0LA 4N0DA 3LD9A 4FCWA 4PO1A 4Q00A 3TAUA 1FQKA 2FE4A 2WSSA 2XSZA 5TY0A 2JGNA 2ZRHA 2Q6TA 4Z54A 1YR6A 3A1WA 3R7WA 3RRYA 4XTRA 2QPAA 5CB8A 4BLOA 2O8FA 2QAGB 1E1QD 4LJ9A 1XJ0A 1BOFA 1Z6TA 5FUXA 3WYFA 4B3CA 3NC0C 1G20E 4LJAA 3KUDA 5FOSA 4HAWA 1TQ2A 3VR2A 3U6KA 1FMLA 3W9YA 2ZS8A 3KKNA 4AKHA 1E1RD 1ELOA 4F4IA 3VR1A 1U9IC 2A5JA 3AEZA 4GOJA 1XD2A 3UMFA 3ASYA 4GMXA 1CRPA 3D6TB 4ZCLA 2R44A 4NCIA 2CNWD 2Z5FA 4D82A 2ERXA 3RYTC 1IY2A 3DKVA 1DPFA 3UK6A 3KKOA 4NCNA 2HYIC 3TE6A 3R7WB 1ZC3A 1TNDA 2JAQA 3W6OA 4XWOA 4PPQA 1W36B 3VX4A 1QHHB 1FP6A 5G41A 4DB4A 3U6BA 5FTKA 2EFDB 2IHBA 4U02A 1HA3A 4QJ3A 1W36C 1XD8A 4B2IA 4BFTA 2WPDA 4A2WA 4IFEA 4JBYA 1VECA 4QBFA 3IO3A 4HB2A 4A8JC 2D3WA 2QG6A 4D0LB 3DPUA 4HAYA 5C4GB 3EZ9A 1GNRA 3MJRA 3ADDA 4IDHA 2ZR9A 1CBUA 1FNNA 5SZHB 2DPXA 3THWB 1KI1A 1SKQA 1UKZA 2X2EA 3CO5A 2YYZA 3F3YA 1PLLA 2EWWA 5EP1A 4A0GA 4M1SA 3E70C 4C9BA 1E2GA 1SXJD 3O8DA 1TEXA 3K8YA 3ZGXA 2H57A 2QTVB 2ANCA 4OI1A 1NN1A 1S4QA 1Z0IA 3A4MA 4LBVA 5JWHA 5BN3A 3LX5A 4M1MA 2F7SA 5KSPA 5SZIA 4NZYA 5TARA 1UKVY 4QJ4A 4D25A 4Y0AA 4OQMA 5AJWA 5BXQC 4PQFA 1I2DA 1T6NA 1XRJA 1W0KA 2J45A 4XIGS 4LOAA 3GFOA 4KFRA 1OH8A 2CMKA 4AI6A 3RDPA 1V43A 1UBCA 2HV8A 4URUR 3X2SA 1SKYE 1XTRA 1KI4A 1NVXQ 2D2EA 1N5LA 4OI4A 4ERNA 4A0HA 3HU2A 2ATVA 1E9SA 3BWDD 5DYIA 1Q3TA 3CRMA 1R0YA 1G3QA 2ZR0A 1X86B 3BJIC 4I1SA 3MUFA 4GT1A 4DIEA 4C4PA 1VYVA 2NG1A 1DAMA 3KX2A 1G7TA 4A82A 2XJ4A 1JB1A 2GXSA 4UNSA 4UQOA 4BLSA 1N0UA 3PCRB 4JZKA 3DO6A 4CYMA 1KK3A 1Q1BA 1TUEA 4UJ5A 5EE0A 4FIDA 3WYAA 2QTFA 3OEED 4URXR 3OE7A 1X1RA 4IDPA 4WZ6A 2FG5A 1E79D 4G5QA 1IHUA 4TWZA 1D5CA 2FWRA 3IIKA 3R8CA 1GFIA 4C0QC 3WNDA 4ARZA 4UXJA 5EE1A 1I4LD 3THYA 5J5CA 1P73A 2WJIA 4NDZA 5FBVB 4M0LA 1S9HA 5JEDA 3I62A 1MT0A 2P2LA 2IX3A 5C18A 1KYIA 5FTJA 3U4QB 1RJ9B 3FVQA 2IYYA 4EFNA 4A92A 2FNAA 3LLUA 3GJXC 5HZHA 5JCPA 1MOZA 5CDFE 4R2HA 4RCZA 1YU9A 3JZAA 4MGZR 1G291 5B2ZA 2HJGA 1S3GA 2BIFA 2QBYA 1JAHA 5HTKA 1FNMA 2IF2A 2P5SA 5L3SB 2GNOA 3LXRA 3C4JA 1GILA 2VLIA 3LBIA 4M8NE 3EIQA 1E0KA 5E4FA 2GEUA 2ORVA 4TQ9A 1GTVA 3AKEA 2MSDB 1YZNA 4YLGA 1KSGA 3VR3A 2ZS9A 1T0JB 4D4KA 3T1TA 3OEHD 4RFVA 5DN6D 4CW7A 2IW3A 3KXLA 4E22A 3M1IA 1O3YA 3OIYA 1E3MA 2CXXA 3BK7A 4DLTA 3HPRA 1DBSA 3L0OA 3TLXA 1SULA 1U94A 2FSIA 4RFSA 5B64A 1U8YA 4M1WA 5DISB 121PA 1ZMXA 2J5XA 3K9HA 3QQ5A 3H1TA 4PQYA 4C2UA 1M7BA 1LB1B 1KO5A
chains in the Genus database with same CATH superfamily
3AI7A 1RM0A 4YUXA 2GXQA 1WB9A 4UTRA 1WUKS 1JJVA 5LL6P 1W2WB 3O31A 1RU3A 1CUEA 2IF0A 4XR4A 2MJLA 3PFHA 3FPHA 2CKMA 2OCAA 2I6FA 1KFEB 2PKQP 4G07A 4Y2XA 5AVOA 4EG0A 2V7UA 4G97A 3H1BA 2VTKA 3TLKA 4C01A 2NQ2C 1E5VA 2C7RA 2X23A 4Q3DA 2FETA 3HCNA 2EKLA 3N0VA 1QRDA 1A5ZA 5LYJB 3FVVA 3EDQA 3H2HA 4EVIA 2GEFA 3H16A 3N5CA 4CDMA 4AQ7A 3CWQA 4MCJA 4HDMB 4COOA 1ZQ9A 2XD9A 5A4KA 3KZNA 4NYJR 3MTJA 1U28A 3PEWA 2G1AA 4J6FA 4AMBA 3JQRA 3TB4A 4YMUA 4KIFA 3AL3A 5DT9A 2XTAA 1EUCA 3DEFA 2C2KA 5B37A 2ZBQA 1QRUA 1E4EA 4HGZA 4NDNE 4Y6RA 3ZN2A 4AS1A 1RQGA 3HDGA 2B36A 4GW3A 4H0NA 5B3KA 3AEKB 3R40A 6GPBA 2ZS7A 3L82B 1MH1A 4X60A 1OZGA 3UB2A 1SQSA 5IARA 4PG8A 3RC9A 5JNLA 2ZYIA 1KQPA 3QNMA 4YP7A 1X14A 1YZYA 4KC0A 4TRRA 5B4VA 2GOYA 3N8IA 4C0XA 5JTTA 2AJ8A 2NV6A 5ED0A 1NJFA 2ZPUA 5AK0A 4JLSA 2BSAA 4MUXA 1PK7A 1SHTX 3ON5A 1RKXA 4MQ4A 3SVLA 3LBNA 3RVBA 1V16A 4HMQA 1HSOA 1K3FA 5WRFA 4EH1A 2PMCA 1TYCA 1Y4AE 2WLSA 2XIJA 3EXFB 2JCBA 4PHFA 3PC6A 4TM8A 3JARA 1XZPA 5KX5F 1RAEA 4IIFA 2H1RA 1TM7E 1R4MB 4MYDA 3NAZA 4G0XA 3U48A 2YHBA 3MJFA 2O8NA 3UMCA 2EP8A 3LC1O 3DHWC 3G3EA 5HF8A 2BEVB 5KWVA 1E3WB 3I9LA 5TLSA 4GKAA 4QNRA 4OBEA 2KQUA 1QYXA 3O1IC 5DU2A 3ZZTA 2RHBA 3DMDA 4ETWA 4LKRA 2I9PA 1GXSA 1BXRB 4G37A 3GFBA 1X1EA 3K70D 1E3JA 4J91A 1NP3A 1E2FA 2EP5A 2PRYA 2IHUA 3EQ2A 1Y63A 4Q4JA 5KU1A 4EEXA 3JQGB 2X0DA 1UBEA 5JBNA 2BE9A 3PNVA 5T4EA 3V4LA 3IELA 4CBVA 1SBYA 3S8MA 1W46A 4IEEA 4QPZA 3BEOA 3R5FA 5E7QA 3HB1A 4KOEC 2VXCA 3TR5A 5KYWB 1ZKMA 2XCQA 3P2YA 5IWCA 1JFLA 1XCLA 4FBMA 3GLIB 2BFBB 4ZI2A 2RSLA 3QEJA 4UDYX 2OHOA 4DTCA 1SCKA 5GVSA 5JWRA 2NVUA 3W5IA 4DCTA 1U9YA 3GJYA 4OHYA 2A9OA 3C8ZA 1SOMA 5GV7A 4IGFA 4P7JA 3D9QX 2GBLA 1SPBS 1E7WA 4J2OA 3SBOA 2RGAA 1A9XA 1HDRA 2O1XA 3IULA 4OB7A 3GXBA 2IVZA 3CRVA 2C9YA 4QTUB 4XD7D 3ESDA 1UPUA 4MUJA 4J7AA 2W00A 4OEHA 3A7EA 5D3MA 2X2FA 4TS4A 1VL0A 5IH7A 1Z15A 3M4ZA 1O97C 4N48A 1KFKB 3DV9A 3FZYA 5KC9A 2FRXA 2R00C 1JS1X 1YO6A 3IODA 3EUAA 3ITKA 3LP5A 2ZZNA 3OPYB 5FV7A 2H4ZA 4PYKA 1I0ZA 1R3UA 3BMCA 3BD6A 4NU0A 5SYNA 1SR8A 2ZDQA 3HCPA 3UJHA 4DUYB 3DE7X 4FKZA 4B9EA 1DJPA 1JI0A 2M98A 2AMLA 3OZWA 1CQJA 2YZMA 5D3MB 1F2VA 2CHQA 1DDGA 2G7MC 2ID8A 4Q1EA 4JI3B 4BAUA 3PFCA 1ZM9A 3D6UA 3PA8A 1HOXA 1RAIA 2CJPA 1N7IA 2PGOA 3L9WA 1J5PA 3FMVA 3OIWA 4FC7A 4FDMA 1UFOA 5AI6A 4FYXA 1O87A 4JXKA 4YBZA 3EG5A 2JLYA 2PKEA 1BMQA 3GGGA 5DW3A 2ZTSA 4IH4A 4UVHA 1U81A 4OHFA 3AUAA 4CQLB 2JANA 3QXSA 2CNDA 1Y9AA 1JR3E 4P34A 3D6JA 4RSHA 1L7DA 1ZCZA 2G63A 5AUPB 5LNK1 5DM60 1HYBA 3OKFA 4NCXA 3CKKA 2ZAYA 4QBHA 4DR2B 3K1YA 3QVWA 1ZH6A 3HL4A 4JMPA 4PO3X 5BR8B 4MGYR 2BFDA 5K8CA 2GD0A 2JBWA 3PQ8A 3GLSA 1FJXA 4CEIA 3C8DA 3J7TA 4WCVA 3HJTA 5J2TB 4OSEA 2ZKIA 1CUCA 1XRRA 2HTEA 3RTGA 1T4GA 1M8FA 4JEMA 4J3JA 2FW8A 4G81A 2A86A 2XTJA 1COWD 3EIOA 4EHAA 3AVTA 4JYZA 1YBHA 2NT3A 2AFIE 5ESXA 1FA9A 4DLUA 4LMAA 1J22A 3L3BA 3CB4A 4X1OA 4XVUA 1Q17A 3SG0A 3GA5A 3HJRA 3K4PA 2ZRLA 2RHMA 2FQXA 3CZPA 1EDDA 4TMFA 4UPVA 5DTMA 2OVBA 5B1IA 2A8YA 3DW3X 1GPH1 1HV8A 2BFCA 2ZI4A 4L3WA 4ZPJA 1V39A 3Q9NA 5FRDA 3RC2A 4EG4A 1LBTA 3MJ4A 4GP6A 3DONA 4OQQA 4RZSA 4FOLA 3T38A 2ZYRA 4MUYA 5M5BA 1TZCA 1USGA 1O0BA 2JFWA 3A4YA 2O57A 3EJWA 3N76A 4ZT7A 3ZY6A 1Z63A 4KO2S 5EE5B 3SVZA 1GRNA 1ZZEA 2B7LA 5AW9A 1LX7A 3ZV4A 3UJPA 2CY0A 4H3SA 2AHRA 4YFVA 2L69A 1WKBA 3DQQA 4OHPA 3M3HA 4MITA 4U7WA 5NLLA 4BTLA 3EE6A 5C5DA 3AVYA 4F91B 1XTSA 1GGKA 2ZIEA 3IAUA 4C21A 1T4CB 1QVRA 5ALDA 1N2ZA 1T9BA 4GPD1 1QZ3A 2VDQB 2LKCA 3JXEA 4YJ3F 3UCFA 3HCOA 1YQWA 5E7IA 4F5DA 1UODA 2DPLA 3H7AA 3FDIA 1K8XB 2O3QA 3VC2A 1AQJA 2WF6A 1JDUA 1XMXA 5FH9A 2GBIA 4FR0A 1DAOA 3DPSA 4O8ZA 2EVWX 1B74A 2I7TA 3L07A 3SQLA 1XWFA 3OX3A 2HEGA 1WQ1R 1H1TA 2C9MA 4P4TA 1Q15A 2W6ID 2ZITA 1CNFA 4KO3S 1PL8A 5E9AA 3UMVA 5LQAA 4MRMA 1PKXA 5TQ2A 5I7VA 3IUBA 2HA7A 3M33A 3MRSA 3GEMA 2I4IA 2PLFA 4TSRA 3W2FA 4ASUD 1MIOA 3AMVA 4FE7A 1OWMA 4HLNA 4MVJA 4U2CA 3FDZB 3HEMA 3LKBA 4OG2A 3HSSA 4EHIA 2H4YA 4FLMA 1C3VA 1Z0JA 3DW1X 3LT0A 1UZLA 4E08A 4CKBA 1T1SA 4BTEA 4MV3A 5A3JA 5CB4B 5B3JC 3OQNA 4JUAA 4HQFA 1Q14A 4O59O 1YI8A 2GAIA 2WIGA 1KHTA 1JFVA 4RD4A 5LA6B 4HWSA 2G72A 5LQKA 1F7UA 1UBOS 1M7HA 1U2PA 1J8DA 1LNZA 3EAGA 5CDTA 5EJEA 3A7DA 1ENYA 4LXHA 2CV2A 2UZ1B 3HJNA 2G9NA 2JI8A 4KQCA 3G2HA 1WW8A 5A7FA 4O4HA 5C1OA 5JBIA 3TEMA 4YRFA 3ZV6A 2CUTA 4NQZA 4S1NA 4FYHA 1UBJS 1P1FA 1DC6A 1RQPA 2JAPA 3VDRA 1CJMA 5ILOA 2F8LA 4TSFA 2JLSA 3I83A 5ULLA 2BLLA 3ZGNA 1IQPA 1VSVA 5DMXA 2SHKA 1II8B 2P79A 4IO1A 4UDXX 2I8LA 4Y98A 3V4SA 4HG2A 2JB9A 1TJNA 1KSJA 2GTPA 2NO4A 3HMKA 1QU3A 4OMUA 1YZUA 1U7UA 1O9HA 1C7ZA 2PUCA 3DMGA 1KY5A 2I2WA 4Y30A 3H86A 5DBFA 2JA2A 1Z28A 1QQ5A 2QD2A 5ELLA 4TXJA 4XGNA 2JBHA 3RASA 2X7HA 1SGWA 3C5VA 4O5OA 4A23A 3Q5GA 4I5IA 4RK0A 3A1UA 3OESA 4M0MA 1JIUA 2ZE6A 1CRQA 2VHJA 1HG0A 3GT3A 3PXUA 3DV2A 4FU0A 3R44A 3UN1A 1ZC4A 3KEGA 1A4IA 5HGJA 3C6XA 5KMGA 2BGNA 3VAYA 4RSGA 1N6KA 1HORA 4OBWA 4WK4B 1C8VB 1PEAA 3RS0A 3STXA 4B44A 2ID9A 1LS6A 5FUQA 5BMVB 4BMZA 3SDZA 4IR7A 3OPMA 4E4RA 4X5OA 1EHIA 4BGEA 1RBMA 5HWSA 3H5RA 2ISSD 2WU4A 3RUPA 3GJ0A 4JLUA 5PGMA 2KWIA 2NQTA 5AJYA 4RD1A 3SR3A 3CN7A 4ETNA 1D8TA 3IO5A 1JHDA 1MV5A 3NV7A 4KO8A 3WB9A 2P9TA 4PLGA 3TBHA 4E5NA 3W5UA 5K20A 1AH2A 2GLUA 1LLUA 5HS6A 4MW0A 1R50A 4Y2PA 3VU8A 4NCAA 2GZHA 1NNUA 3PYLA 3KOOA 2F8TA 4A4DA 3ZE1B 1OT3A 5AW1A 3I04A 3EEQA 4LZZA 5B1YA 3PJDA 1E69A 1JHRA 3EHDA 3PTZA 2J09A 5FYQA 1EJBA 1K89A 3Q2IA 1AKNA 1KDRA 4R9VA 3SM3A 1JECA 4UOZA 2CB0A 4QC2A 1HSZA 2OV6A 1GQYA 2Z8YA 4KKXB 4NZPA 1W0KD 3ZIAA 1NVWQ 1NUSA 3B7PA 3GRZA 4X7BA 3ZX4A 1F6DA 4B2PA 4R7GA 5JNUA 2B25A 5AMXA 3BUSA 4GX5A 4IV0A 2JNWA 2IDMA 4I0WB 2BR4A 1H6DA 2WJGA 1MU0A 4ZTUB 1J0BA 4IDCA 2I6GA 3DTVA 5L7WA 2BGKA 1PUIA 1E4OA 4MR7A 2PZAA 3ZCPA 4DC1A 3PYMA 2EW1A 3D5EA 1OXTA 1C80A 1NP6A 1PG2A 2C2ZA 3ODPA 4QT0A 2X40A 4OHWA 3ZLUA 4DZRA 4LIPD 3CNOA 4JQCA 2XNDA 4I1PA 3CKYA 1OGJA 3IBYA 1Z18A 5K6AC 1YNOA 1HKHA 3DV0B 1NQUA 2JCGA 1POWA 2IYPA 2PZBA 3GGDA 3NHBA 4BQSA 1AA9A 4GMHA 1PGQA 1U2ZA 1WDWB 1M0EA 1Z07A 2QY9A 3LL4A 4L73A 1L5ZA 3U19A 3TNYA 3JQFA 4J07A 4WA8A 3DDHA 2VPWA 5KYUB 1U3GA 4MS3B 1JDVA 4KDEA 1KMCA 3V8BA 5JPDA 2XYRA 4E13A 3PTAA 1EXDA 2YHUA 2B61A 1GDDA 2VG8A 2Z58A 3FMGA 4JJAA 3NKFA 4X84A 2Q07A 5AHWA 4BMSA 2DUJA 5IJZA 4KR3A 4CLRA 4M37A 1GTMA 2G83A 2P4QA 1OBOA 4PSCA 4RMJA 4BGIA 2GZ1A 4I4LA 4QAJA 3B2EA 3TG2A 4R9NA 4L0CA 4OLFA 4IUYA 4Q7QA 2WD9A 2CN1A 2WKSA 3USZA 1KI9A 1Z83A 4AL4A 2WC1A 4ZAFA 4YUVA 1EM8B 4G0YA 2Q7DA 4N0PA 4CMEC 4CT4B 4KPUA 4DLYA 4YDHB 1KAGA 1FDIA 4U7DA 1NI5A 3EIUA 3EQ9A 3G6WA 3QYPA 4MARA 1KDVA 4JOCA 1ISGA 3CNQS 3ROXA 4KYIB 1YK0A 2GHQA 4N9QA 4Y3UA 2RHJA 3M5DA 4RIIA 1E2IA 5KYNA 1F8XA 1NL3A 2G0NA 2Q3EA 1QYWA 2V0NA 3LU1A 1ISIA 1N4DA 3IXLA 3KTAA 4OQPA 2H1FA 4WNAB 1WB6A 1XELA 1GAQA 3E6AA 5DSZA 5EFZA 2QPLA 1O08A 3DC2A 3STVA 4ANFA 4XWWA 3DFZA 1YULA 1ZGCA 3GDOA 1T2NA 4WCFA 4X71A 5D00A 1GUFA 3ISVA 3OCCA 3Q7EA 1CLEA 3TW4A 1G6OA 2OAP1 5JAZA 3PLNA 1C3OA 1FNDA 2X4GA 1K4KA 5GJWC 3S2UA 4MQUA 2ESRA 1YQGA 1OZ0A 2ZVPX 4RLFA 3HBAA 2I33A 4FYWA 3GRFA 2WKPA 3P2MA 4IUDS 1C9KA 4ND2A 4MVXA 4R84A 4ENWA 1M2JA 2Z43A 3HWX1 3RV3A 2QTBA 1U3DA 1NN5A 1RYBA 3L4EA 2IOQA 4NG4A 5TQ0A 4URVR 3NIBA 4KDCA 2FKNA 3ZXXA 4BFLA 4EM6A 4TV9A 2PSHA 3LUPA 4ZT2A 4M7RA 3NB0A 4IIEA 4FMCB 2HTFA 1RM4A 2WTBA 1RWKA 4XSVA 5AUNB 5TGDA 4MUNA 1W9HA 1KOFA 4G5HA 3ZNQA 4WAUA 4DRXA 3PF8A 3CGGA 2G8LA 3QF7A 3O2QB 1SBHA 1Q6ZA 2AGVA 1KYYA 2YOFA 4KFSA 4OQLA 3C85A 4X3PA 3TX6A 2IU6A 2VR1A 3KQTA 3B6IA 4KEAA 1A3CA 1AV7A 3IAM6 4K9NA 4RK6A 1K75A 1MB2A 4IOLA 4U1RA 4HBGA 4BNGA 4DPKA 3AFHA 3FHLA 2K6GA 4ZYYA 4IFTA 2Q3FA 2AQHA 4AJKA 4EAQA 5BPFA 1LDNA 1U2DC 2PFKA 4JEIA 2FGKA 1Q83A 3P7MA 5BYBA 4L8GA 3U3ZA 6REQA 1LK5A 4CQJA 2DBZA 2ZJZA 2CFOA 2ZETA 3EA4A 2H85A 3MTIA 4RF3A 2IPAB 3SR4A 3SEZA 3PWZA 4DJ5X 4Q19A 3PXXA 2F1RA 2VDPB 3L0IB 4E0BA 1GPKA 4HEQA 2A84A 2PAAA 2I54A 2MU1A 1DWPA 3QVSA 4MEBA 4N8EA 5BN1A 4Z4EA 2VF7A 4LXIA 5ICEA 3DNMA 4MRVA 3ICEA 3DMHA 2CCKA 2X7XA 2RGEA 3QWHA 3UWOA 3NUQA 4XARA 4FVTA 4UU8A 4MVCA 3BGOS 3KSMA 3TLYA 1DQYA 1JZQA 2V7EA 3OSZA 4FHGA 4NZNA 4D4HA 3MBOA 2BYTA 2ZJ5A 4MKRA 5LFAA 5JZSA 4EDFA 1P3DA 1XEFA 3DZHA 3NG1A 3LX8A 5I9MA 3STHA 3R8FA 4Z3OA 1G42A 1YAJA 3LHSA 4POAA 2AN9A 5DRTA 3AFNA 5D86A 2WF9A 5IC6A 3I5YA 3SSNA 4MYUA 3TDKA 1AM4D 2WT9A 3JU3A 3EC2A 2OY0A 3EW9A 3PK0A 4KQGA 5IABA 5LOVF 4F4HA 4BO7A 1SVKA 3K8OE 1IBSA 2RBEA 2GBLC 2BH9A 1THMA 1LD3A 1W85A 4TTTS 2Z1MA 2FPUA 4A8TA 4UFNA 3EGXA 2DUUA 1LK7A 4GOKA 3ZXSA 1NRWA 3GPBA 1YS7A 4N6GA 2CNOA 4MTLA 4PGFA 1O94A 2LVBA 4E51A 1FRNA 2Y93A 5F73A 5AVJA 5JD3A 1EJ0A 1R4ZA 1FYFA 3E9CA 2W2QA 1SXHA 4QLOA 4R8SA 3I5UA 1FCJA 3GROA 4DNXA 5A7HA 3AO0B 2VK4A 3CY6A 3CZ4A 3QUQA 3PDUA 5LP6A 3AL0C 1NY5A 2VJAA 3JWIA 4XOUA 3CWZA 4EECA 1UFRA 2VK8A 1V8ZA 2GESA 4LN1A 2XZDA 4Q01A 2GR9A 3I72A 3FTEA 3AUXA 4ZCMA 1UPTA 1XZJA 3GGSA 4F6CA 3LW8A 1FE8A 4XB1A 3T1YB 2F62A 5KNBA 2XDWA 4EJ2A 2P5TB 3LIPA 4GBED 4KO4S 2A9FA 1ECLA 3ZLVA 4WACA 3KQNA 3PUZA 1KJIA 1IJFA 1R16A 3AG5A 1PJ2A 1H2RS 2DFPA 2G36A 3H87A 2EQ5A 2HF2A 2MYTA 5D6OA 3W0LB 3TZ6A 4DKXA 2ROQA 3IKVA 1AG9A 4U9IS 3QX7A 4RTLA 4CKCA 3ZYZA 5LZ8A 4E2YA 1PK9A 4JZYA 4IUBS 1UMKA 4LC1A 3HJHA 3EMBA 5ITSA 3EZYA 2FSVC 4Z4FA 3DEIA 1NFFA 1LPBB 1X94A 4PM4A 1VJDA 2P3QA 1XTJA 1K97A 2BMWA 4UTNA 1RTKA 1ZO8A 2GZSA 4Q93A 4L9SA 1EGVB 4DCJA 1TA0A 3LOUA 4HRXA 4J0JA 5BOSB 1UK6A 4QIHA 3FZNA 4XASA 5IKXA 2WE8A 4G9GA 4IZOA 5ICSA 7MDHA 5JMWA 4I14A 4BRUA 4BWYA 1I30A 1UBRS 2FW1A 5TGZA 2QV0A 3GWZA 1DCTA 3UT5A 3WYGA 4AIIA 3WWEA 4L5CA 3B9RA 4MH0R 4MQ5A 5L3SA 3AIMA 4L7VA 2ZIXA 4EOGA 5IHXA 1IN5A 4Y2GA 1GKYA 3T5PA 5EE3A 1LBQA 2R2AA 3GIWA 3VDMA 5TQJA 4CJXA 1TT5B 3E22B 4C2AA 1P2TA 3WLRA 2VYNA 5J5AA 1JPJA 1J0EA 1R00A 1RHMA 2F17A 4JLDA 1ZFNA 2PX3A 5DLPA 3ZCUA 1T9DA 1G5PA 2HK8A 1Q21A 1L7BA 1PUXA 2JGAA 3A32A 2I78A 4L22A 1PWHA 3O1JC 1U3WA 3PE6A 1T8WA 1Z6YA 4MGKR 4NYIQ 5I8PA 4RK5A 2PS0A 1RACA 4HF7A 2BUCA 2WHXA 1LQUA 5IJXA 3PFKA 1DHTA 4TT3A 4B0OA 3BULA 4JU9A 3HNOA 3GJ6A 5H59A 4JCOA 1I3KA 3ET5A 3RVQA 1M34E 1TZJA 4GX2A 5CEJA 1MVNA 5KTPA 4B3TB 3KT8A 2BGGA 1Y1RA 4MYTA 4GRIA 4TL7A 4HH0A 5B3LA 1TAHA 4HL6A 5EPEA 4DIKA 4DS3A 2WWWA 2PGAA 2QZSA 4E30A 4WW0A 2WD7B 2H7CA 3HKCA 3L06A 1FP4A 1NZJA 2V1XA 1F4VA 3OO0A 3UICA 4FZJA 3WMGA 4H31A 1JH9A 3EF1A 2I3DA 2WD7A 3FD8A 4WZAB 4CUKA 2UKDA 4ERXA 5JISA 2M6KA 5CA1A 3VV3A 5C8YF 1GNQA 1EI9A 2VXOA 2NU6B 1PNVA 5IAAA 1U0OC 3L7MA 2ZRKA 3U4IA 4KJZA 5JH7B 3R23A 3CLUD 2ZIVB 4KRGA 1SKYB 5INTA 3TZLA 1L4KA 1V3TA 2GFQA 3Q6MA 1CJTC 2OAGA 4KPGA 4Y9TA 2M1XA 3TRKA 4I36A 1AQYA 1JP7A 3IQFA 1URPA 5AVZA 1OQAA 2PKXA 3B3QA 3OTIA 1Q0TA 1UT5A 4EL0A 5F2OA 2GPSA 3ZK9A 5TMPA 4BFXA 1FRZA 2XTNA 2PCLA 3TQIA 1Q1NA 3BWVA 4FOTA 5EIBC 3VZCA 2QX8A 2I4RA 1K8RA 3H1GA 4KTTE 4JJFA 4D8UA 3O8NA 3AEXA 4KDRA 1T6YA 5KCZA 3WIBA 3MFYA 1G7RA 3VHQA 4I2VA 5EVJA 1P0PA 4EW2A 1V8PA 1W5EA 5FLYA 4ICIA 3TD6A 5JZMA 4JT4A 2XYGA 1X6VA 2ZSUA 3O8CA 5JYEA 4TUYF 1BZYA 2ERCA 1VC2A 5KNCD 5LD2C 4MA4A 1B3BA 2I2FA 3L18A 5CMLA 1PJ4A 2LDXA 2XAAA 4JP5A 1GLNA 2H3HA 4I4IA 3OQJA 1T3HA 1K0UA 3O8OB 3UUWA 2UUCB 1RHJA 1W2GA 4A8HA 4BNJA 1FMJA 2JLXA 1V4BA 2X2PA 2FEPA 1D4ZA 3T7KA 4HPWA 4Y2TA 1WABA 1BE1A 1EBFA 1KGSA 2OV2A 4JQZA 3LK7A 3EBLA 4LI0A 3S2SA 5EJ9A 4AY4A 4Q4DA 2O8EA 4FFVA 1ULBA 1VCIA 3JR3A 5T6MA 1SC9A 4R16A 4KMRA 2QD5A 4Q9HA 1H4VB 4F38A 5ITZB 4R01A 2Q2QA 5DBEX 3M81A 2XE8A 2YMQA 1ENOA 2XNKA 4NOMA 4EY7A 2XNSA 5LXTF 5CDSA 5LQJA 1K68A 1J1UA 1YTUA 5HCNA 1XLTC 1BRTA 1ZN7A 3NV9A 4L0QA 4MO9A 4OPMA 4L8WB 1GZ4A 1V48A 4IEFB 1K8ZB 2RJ3A 4B84A 4OQZA 4C7OB 2DUNA 2IUTA 1QQAA 3QBDA 4HDQB 4PX2A 1YE8A 2WF8A 4Z9AA 3R09A 3LRXA 1OFGA 2HLHA 4IXDA 4CF3A 1Q1AA 3U1BA 4U2EA 4DWJA 2HN9A 4WFJA 1LSJA 4CG3A 2YS6A 3F96A 1QDEA 1QLJA 2HQOA 3TKLA 3U4DA 1G4HA 2R8RA 3PGLA 1NW3A 4EKIA 3QU4A 2CSUA 2F48A 1L4BA 2Q3LA 1FFSA 3HCWA 5D51S 4M1TA 1X7XB 5I45A 3PG5A 4IIJA 3ZE6A 1GUDA 3WGJA 2YW9A 2XLCA 3EGXB 4XXHA 5EG5A 1GKUB 3MMZA 1L5KA 4BMYA 1GHTA 2IW1A 2PD6A 4PW0A 3H6HA 5LQRA 1NM5C 3ZR4B 2F3TA 2UUAB 1SPXA 2YC4C 2BVNA 2FXVA 1EWYA 1G6HA 1YWGO 3SS7X 4I46A 4TXHA 1F8FA 3T7JA 1YNSA 2QRGA 5DHPA 5DGXA 3UHAA 4AZTA 5I8ZA 1GNSA 2H92A 2J7PD 1MABB 1U2SA 4PLTA 2IH4A 5ER9A 1VDMA 1WUJS 4FGUA 4DQ0A 3ETCA 2QIOA 3C0KA 3F5SA 3HYCA 1ODJA 4C08A 2GN1A 1PNRA 3NVMB 2RBGA 3PPIA 3W2IA 1SUWA 3CPJB 3DJFA 1LPSA 4LAFA 1KO7A 4YJGA 3DKPA 4PCVA 1CYDA 4LCJA 2HHCA 3VV2A 3MMXA 3QVGB 1CR2A 1QRTA 5MF6A 1B2LA 3GRVA 1UBSB 4CF7A 2B6NA 3AUJB 4H7IA 4OREX 4BV8A 4ZMBA 1NVEA 2Q7OE 1EYZA 1O2DA 1Z6XA 4LSZA 4MR8B 5C8DA 5IAGA 2TRSB 3B82A 1LQTA 4MXDA 2IXGA 5DW0A 1K5GA 4AUMA 1RYZA 1FX1A 4F11A 1KR2A 2VAMA 1T9AA 3DDUA 2VDMB 1M8JA 3I45A 1PDOA 2PPVA 1PJ3A 3SD7A 3ZU6A 3NMUF 3OFSA 1ZSNA 1NMXA 3EVAA 3T7SA 1HE8B 3KO8A 3IR5A 4J1TC 1KDYA 2JBAB 3JQ8B 4I8IA 3SICE 3BE6A 4HNAA 4M0CA 2WJ3A 1NDUA 1ORDA 1ZL2A 5DHQA 5JS2A 1XCGB 2PKWA 4GDFA 3ZQ6A 1T8TA 1MORA 1FQOA 2AV6A 4TMXA 5FTLA 5LZ2A 1R5OA 5MN5A 3U1TA 1X7WB 1KEZA 4JJIA 1NMZA 1SC6A 4WMLA 2D4AA 3P26A 4QODA 2A88A 3TF5A 2CZCA 4GKVA 4R2KA 3L0DA 2P9CA 1NI3A 3AERA 4ZICA 3LHKA 3A05A 3AY3A 3IQXA 2YWBA 3OQOA 2QRHA 2GO1A 5AKGA 5AVSA 4TN5A 3PC4A 3NCTA 4WE3A 4B6JA 4DJFC 1TM4E 1NSFA 4JBIA 1DJNA 1QH1B 1Y81A 1F20A 1JXMA 2I62A 1WNTA 3DO8A 2WWRA 2XE7A 4IVPA 1X8KA 5BN5A 3DDNA 4I4CA 5AVXA 5EHNA 4Q16A 5KVSA 2DERA 5ADVA 4QA9A 5K3FA 1RJWA 1HLFA 1PTKA 4AWAA 4JU8A 1EXWA 1RI2A 1KIMA 1NR7A 1W5SA 2C4TA 4B6QA 4ENRA 1XTIA 3HKDA 3UA3A 2ZJYA 3KJHA 1ENPA 2O2DA 2UZ3A 2XITA 4NF2A 4B75A 5AW6A 3TTYA 3JSXA 3JD0A 1GFZA 2ZVJA 1G3MA 3K16A 1CT9A 1P9WA 2DMRA 3O83A 4G0QA 1TK2A 5KNDH 1SBTA 4KE6A 3FYCA 4IGEA 4D46A 4JA2A 4KBGA 3S44A 3V33A 1OIXA 2QSZA 2E4YA 3DZKA 4MPDA 1RQNA 3K20A 3OZVA 3NM4A 4AWXA 3GYBA 3OX4A 2GN2A 4TX1A 1ZJ4A 3HCBA 3KQLA 4PIVA 5A9RA 3B20A 5A6VA 2GSWA 3ANTA 4WK2B 2ZYDA 1B0UA 5MHTA 5REQA 4O2RA 4MO2A 1MAHA 2FU5C 3S7TA 1EIWA 4ECEA 3NDJA 4PNZA 4OXQA 1B0PA 4L9AA 4ARBA 2Q2VA 3EMDA 4HADA 1QHFA 3ROFA 2Q2WA 4KWCA 3A27A 4UHCA 2WZDA 2BRUA 1VRCA 3ZU5A 1YVPA 4LE0A 3KVRA 4TLMB 1NW8A 2W93A 3FUUA 3VYRB 4QJBA 5I8WA 3BKXA 2B1RA 4FPXA 3ZEAA 3V8VA 1N92A 5ALJA 4UCWA 1EM8A 2SECE 5EXXA 3WICA 3W8DA 2QYOA 13PKA 1CDDA 5IULC 3WAJA 2IHZA 2FQQA 1S7GA 3TL3A 4ZMRA 4X1IB 2A9KA 3LVBA 4G4SO 1K7SN 1WG8A 3TR0A 1JHVA 1CJUC 3ENVA 4NJOA 2XUZA 5EJIA 5IZ4A 1SHUX 2MSCB 3LKVA 2PK3A 3DE4X 5IT5A 3WMFA 1RZ3A 4D9JA 2JJ2A 4ECAA 5ALYA 1LGYA 1ARZA 5AP9A 1WV1A 1E8DA 1LBSA 4EY6A 3A9TA 5KDOA 5DI3A 4C03A 4ZO8A 1XF1A 3WLQA 3BJRA 2CL0X 3WAKA 4BVLA 4YWJA 1D9ZA 2JEZA 4MI1A 4KREA 4EFLA 4M88A 3UMSA 1Y1SA 3LT4A 4MYCA 3TTSA 2WTMA 4H3HB 1H6AA 1Z74A 3ZWPA 2NYVA 3CZMA 4ML3A 4XIJA 5T57A 3FG9A 3SX0A 3E3OA 5FLKA 4NMHA 4LJYA 4MKFA 1NNEA 1KETA 3GDHA 2JJQA 3AUYA 4YP0A 3EX7C 1WU8A 3HBNA 4F5EA 4UDNA 1JHOA 3NBUA 5IT4A 4ZQEA 1N32B 1SU8A 2RBKA 5HIJA 1OX5A 2PKQO 3DF9A 4EDHA 5FJIA 4LF6B 3VYVA 1SQFA 1DELA 1NUHA 4RKWA 3JQ6A 5CA0F 5E3HA 1KVRA 3P71T 2J3IA 6REQB 3O4GA 2AFIB 4GH5A 3CB2A 1P0FA 1TFUA 3DE0X 2I65A 4UM5A 1R5BA 2C0QA 4ZCIA 1KFCB 4S1OA 3RTAA 3JZMA 4X54A 1ISPA 3GUYA 3UUEA 3OCWA 4P31A 3O8QB 4B87A 4QVIA 3NNDA 1H5UA 2D5BA 3Q3GE 2OZVA 1W1WA 4DSAA 2JZOA 5AJUA 3T5MA 3GLGE 3T4UA 5A5FA 4F96A 1JJIA 1PFYA 1Y3AA 2XUFA 4L8YA 3ZD6A 3NTQA 2RHOA 1NYTA 4YACA 2E82A 3K32A 2B2CA 3LY7A 4KXVA 4YAWA 4EB3A 2HQBA 3W3AA 5CGQB 1UIMA 4QICA 6LDHA 4CM9D 2R62A 3P4XA 3AESA 4M53A 3OP4A 4MV9A 4H7KA 2OXTA 4FE4A 1MX9A 1U9IA 2X6RA 1WMAA 1FTSA 5ALRA 1O96B 1BHSA 2P9QA 1GUZA 3GFFA 4B47A 4BFWA 4QTZA 3UM9A 5HTOA 1ZUIA 3M6XA 2GPBA 3X1WA 4HGOA 4AY3A 2ZRNA 3RF6A 3WNZA 2K5UA 1O6ZA 4I6JA 3TJMA 2J9YB 2PX2A 3AEUB 3MB5A 1QHYA 2P78A 2X19A 3FPAA 3IT0A 1NAHA 4BO0A 1KI8A 2QN6A 2J3KA 1FS6A 5FNVA 4LF7B 1QYIA 2LCFA 3E8MA 5T64A 3VR3D 4DLPA 4L3VA 4KPEC 4L2IA 2M2IA 4RSRA 3H6KA 4GR4A 2NWQA 3ITEA 4TLCA 5EEHA 3N70A 3JAKB 2PEYA 1LY1A 3ORFA 1TJ4A 2JH8A 1EQUA 2C7GA 2HRZA 3G2IA 4NYMR 5G0TA 9ABPA 4GMKA 1XMQB 1PL6A 1QCDA 2HOQA 4WY8A 4Z9BA 1ETUA 1S8AA 2F3UA 3AW9A 3WYDA 4FSHA 5FR1A 1JNXX 1G4UR 5CD9A 3FCUB 4ALKA 5KDDA 3THWA 3QWFA 2Z1DA 4LRXA 3IHKA 1D1TA 4R83A 1OVMA 1A96A 5K3CA 1D0IA 4MDEA 1VI2A 5A6SB 2B7CA 1OFUX 2N0SA 4ARUA 1FVOA 1ODFA 3MMSA 4MUIA 4R98A 2E4XA 3OFVA 2NUAB 1OLOA 1P19A 3CKMA 4UHEA 1QLWA 3QP9A 4RAOA 3TSWA 2HBRA 3PE3A 2R7AA 3SS8A 4OX9B 3DVAB 4DLNA 3OE5A 3TBFA 1WS6A 1CFJA 4B80A 3C1OA 1OGYA 3QLUC 4MV7A 3LQ2A 5IDXA 1G6KA 5G3YA 5T41A 2QTGA 2BI8A 2OCIA 3WQSB 4WKCA 3L7YA 4FEEA 4ZC8A 5G02A 2FVYA 3HMQA 1ZOOA 1GPUA 2ODAA 3EVEA 1Z88A 1V7CA 3PJRA 2GK3A 3RC8A 5FI1B 2NSYA 2XOKA 4CLRB 4RVNA 5LQMA 3VRHA 4KQ1A 4M2LA 4KWHA 4Z8YA 1R88A 1YUBA 2DFDA 2RGWA 4TLBA 4D74A 2JJYA 1W93A 1NXQA 1GU0A 2RI1A 3CZ9A 3A2KA 3USCS 4I9HA 4S1PA 4ARZB 4U7HA 1T5LA 1D6NA 5ABPA 4O63O 2Q46A 1FIUA 5ILGA 1NJ2A 3W04A 1GZSA 1CY1A 2HHLA 3P0EA 5E95A 3VVLA 2R4QA 1JAIA 1QAMA 2MSKA 3M3DA 4RAQA 3SF8B 3U4HA 3ZWQA 5B55A 3NHMA 3TNDA 1XMIA 2IKQA 2ZU6A 2YIDA 1WW3A 5E4TA 1XJCA 2GHTA 3DE6X 3VOTA 3KAPA 2QMEA 1GGHA 3B6JA 2MINA 2QE7D 3E1GA 3I0MA 5AKLA 5DCUA 3T5BA 3WMRA 1QF7A 3MOGA 3S8YA 5ENDA 1TVMA 2HMTA 5B58T 3SGLA 1I2BA 5JU6A 2VF2A 2P6NA 3AQ4A 3S4YA 4Y18A 4CM4A 4DUGA 1CZUA 1L7OA 1OXVA 5SICE 4D41A 2YZ7A 4NFHA 1A8HA 2V0CA 3WO0A 3VA7A 3ROKA 3TZCA 3U3KA 5CIYA 10MHA 4OB8A 4NE2A 2QQ0A 2J1LA 3B9PA 1F38A 2WVJA 2IELA 2OHIA 3CQ9A 3EVFA 4XDHA 5F4BA 3QEBZ 1A69A 4B74A 3NJRA 4ARIA 1XQ6A 4ROTA 4K6MA 5C7OO 5C37A 2CE2X 2EZTA 2ZI6A 1YQXA 4U5XA 3OICA 3P0JA 3OC0A 1S6YA 2WFLB 3EQ6A 5DCWA 2XR1A 1AMNA 2GB4A 4BNFA 5GJBA 4HRVA 1WZEA 5CD1A 1FX0B 4P0TA 1MO4A 1Z26A 2EKZA 2Y8EA 3GVHA 4GD3Q 3O3CA 1JAZA 2I6UA 3HNPA 1RHQA 5TVKA 4CEJB 5ECDA 1D8AA 2INGX 2XLBA 5EKDA 3NBXX 1PD1A 4RZ2A 4EGAA 5LQUA 2PZMA 3L9XA 1Y7LA 1NOKA 2C54A 3GCDA 1N3LA 5EKXA 4TT3D 2VPQA 2GBGA 3NBQA 3OJOA 3ZK7A 4MR8A 4CFZA 3U3XA 2TECE 2CYCA 4XIFA 1U11A 2V0GA 1YOVB 2YNMA 1PO7A 3T4EA 4ND1A 2CLMB 1W5TA 2WOJA 4JLAA 4R31A 4MP3A 5JFTA 3ZS8A 1Z5VA 3N0XA 1RKUA 2DUMA 3AF1A 4JH0A 4H4EA 1W88A 2NO5A 2H63A 3LS2A 3FH0A 3R0JA 3ZGVA 4HH3C 4OJYA 4CIWA 4MHTA 2BSXA 2DLNA 2XAUA 4K86A 3TTTA 1WEKA 1Q95A 1A27A 1RJEA 2P65A 4M0PA 1B43A 2P77A 3DZGA