2WWFA

Plasmodium falciparum thymidylate kinase in complex with tmp and adp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
211
structure length
211
Chain Sequence
b'HMTDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDILATE KINASE, PUTATIVE
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 83
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwfA00
2VHJA 1E9EA 2UZIR 2JGNA 2ORVA 3FHOA 1E0SA 2WOOA 4LYHA 1E2HA 3NTUA 1R2QA 5C2JB 1ZNYA 3KTAB 3SJCA 2IYWA 4UNPA 3OHMA 3LAWA 4EPVA 1E2IA 1OF1A 2A3RA 2IYUA 2OCPA 3AVQA 2HLDA 1S1MA 1YR6A 1W36C 4MRRA 2WIBA 4EPTA 2WSSA 1F5NA 5CYPA 2VP9A 2CJWB 1S2MA 1CLUA 1KO7A 1T0HB 4HAVA 3VNVA 4XTRA 4LZZA 4HLUA 3QQ5A 4CZ2A 1N6IA 1Q12A 4GPTA 3TVTA 2Z0MA 3AV0B 5KSYA 2OILA 2FH5B 1GVNB 4ZV4A 3OE7A 3U61B 2Y8EA 3AF3A 4PSAA 1DAFA 4BE7B 1II8A 3CH5A 3NBYC 1XTRA 1PUIA 1E1RA 4G5SA 5JI3E 1RRFA 1E2GA 1P7CA 3SFVA 2OT3B 4EQ6A 1R8SA 1VTKA 1YRBA 4V0MA 1VCNA 3AVXA 1T8UA 1FOEB 2OM2A 3U7HB 3IIMA 3T06B 3A1TA 4DLXA 4TYWA 2VP4A 3KKNA 4HUTA 1I4TD 4QJ4A 1ZU5A 1OB2A 1JR6A 2FEOA 1ELOA 2E87A 5AUOB 2DB3A 3TE6A 4UXJA 2IXEA 4US1R 4II7A 1GL9B 3L2OB 5TDHA 4ABYA 2CVHA 3RHFA 2N46A 1F48A 3ZZUA 5FR2A 3SNHA 2OESA 1NF3A 2OBNA 4ARZA 1U8YA 3EWAA 4M1MA 1OFIA 3QI2A 4MITA 3H4MA 3T34A 1TQDA 4JBYA 3S1AB 1XCGB 3WRXC 2EFEB 4ZKDA 3OEHD 1RKBA 4HLUC 2QE7A 2VSOA 1OIVA 3IO3A 4HZUB 3GD7A 2Z83A 4PAOA 4N3NA 4RD4A 1Z6YA 4YDHB 4OHVA 1HQYE 1SXJD 2GCOB 4QRHA 3KKOA 2DY1A 3CNLA 4IKEA 2ORWA 2WVJA 2XB4A 4Q4JA 5HKKA 2GESA 1NBMD 4D2IA 3VX4A 3K70D 1TPZA 3AKCA 4IOMA 4G1UC 5HTKA 2HLDD 2QMUA 2EWVA 3MWLA 1NVVQ 2WSSD 3FMOB 4KSBA 1OH6A 2CHGA 1KI6B 3CRVA 4D81A 1DAEA 2AD1A 5EUQB 5A4JA 2NMVA 4OL0A 2XZPA 4ZCMA 5G3ZA 1T5IA 1WA5A 1XDBA 1KJZA 3DL0A 1KSFX 3OE7D 4LYAA 1N5IA 1U9IA 1MABA 3MWKA 2PT7A 2IYRA 4AWXA 4IOJA 3BGWA 1E2PA 1XWIA 4IOLA 3K8YA 4MGIR 4E09A 3MG9A 3QKUA 4OJQA 3DMDA 4IXMA 4JVSB 5TVKA 3TKLA 4A8JB 5FOWA 5HR5A 3P27A 4B33A 4DEYA 2A5JA 2R6DA 2RKOA 1CR2A 2XEXA 5JFGA 2P5SA 4RCZA 4M22A 1G7CA 2BM1A 3VMFA 2J7PA 4B6FA 1WBDA 4L4UA 4TMZA 2C96A 3U6BA 3BE4A 4I1SA 4QNMA 2ZRHA 3CRW1 4QFMA 1FMJA 2CK3D 5FBRB 1N2CE 3PQCA 2P6NA 2Q3FA 5F9HA 4QM7A 2O8DB 5J5CA 3PIRA 4QG7A 1XJQA 1W0KA 5KDOA 4JLPA 5H1YA 3X1YA 1W2GA 1P73A 1E4VA 2WJHA 3EA5A 2BBSA 2W83A 1E2KA 5FL7D 4ITRC 5FPSA 3HYTA 4Q1DA 3CUEF 4O3MA 1LB1B 1YZGA 2QNRA 2AWNA 4MA4A 1TL7C 1CRQA 1IY0A 4NPHA 3VU9B 3ZD7A 4KHZA 2O0KA 3I8SA 5FUWA 3RRNA 4A0RA 2EFCB 5HKKD 4MRNA 3K70B 2RAPA 4XTCS 1PUJA 2ZJAA 3PEVA 5FOVA 1ZCBA 4HATA 2PLRA 1KAOA 1XTQA 3VR2A 3AVPA 1UBFA 4UNNA 1TX4B 1E9AA 1G17A 2OBLA 5K8UA 1SVMA 1VYTA 1A4RA 2ZIAA 4I81A 2OLJA 4WZAE 1ZP6A 2J0VA 1ZRHA 3TGPA 2IWRA 1GG2A 4P4TA 1MO4A 1X1RA 4PSKA 1L2TA 2OXCA 3D31A 1NY6A 3KJGA 1II8B 4RY2A 4A2QA 2QRNA 5JWRA 1CR0A 4HI0E 2MSCB 3RC3A 4W5JA 4EAQA 1KMHA 2R2AA 4Q9HA 2CL6X 4URYR 3WNBA 3GLHA 4OK3A 1YZTA 1ZVQA 4TZ6A 2ZTSA 1MO6A 4NYIQ 1R0YA 2A5DA 5KNBA 2F1JA 4Q9IA 4KFUA 4A6PA 4DLUA 2J7PD 4EFLA 3LV8A 1ZD9A 1A7JA 3M4YA 2BM0A 2HDNB 4B2PA 4UXIA 4GDFA 4JYCA 2NIPA 2Q9CA 4DIDA 2NG1A 2ZETA 1Z0JA 3PUZA 4ARZB 1Z6AA 2OG2A 3HP1A 4PFSA 2J87A 2QAGA 4C7OA 1IBRA 2Z43A 3RS2A 4QBHA 1ZM4A 2W2XA 4AKEA 2B8WA 4C2UA 4Z8YA 4D4JA 2O0HA 1Z0AA 4I4LA 3BRWD 1KK0A 3CZPA 4Q1BA 3NDBB 1CULC 4LK2A 2AHOA 1XEFA 2G0TA 4M4SA 2QEQA 4WW0A 2YV5A 4DHEA 1Q44A 3NC0C 1VCMA 2C03A 1F6BA 2BJVA 3FKQA 2BEJA 4TYQA 2W2VA 3CPJB 2FPKA 4JLMA 4Q4JB 4WZBE 1CR1A 4F93B 2ASEA 4KAXA 4MKHA 4NHOA 5JWOA 1G3IA 1WCV1 4LCBA 5BWMA 2O8BB 3P4XA 3IGFA 1KJYA 2QMEA 1D9XA 4IVRA 4CT5A 5KTYA 2PEYA 4TN1A 4BEJA 3QBTA 3HU2A 3Q9LA 1LY1A 1FL9A 1MOZA 1N0WA 2CL7X 4KSCA 1ZD1A 1D5CA 2ZU6A 1KK1A 2RGGA 1Z8FA 1SKQA 1OFTA 3EAQA 4G01B 2GJSA 1JBKA 1KDPA 1MABB 3GJ7A 4A0GA 4K81B 2C5LA 5ELXA 4M1WA 1YR8A 4ZCLA 3B8HA 3B1WA 2QA5A 1G4AE 2PX0A 3GPLA 1SVKA 1RYFA 4UQOA 1G291 1XF9A 1US8A 2ZREA 2RCNA 4BRUA 1XMVA 2CVFA 2YWGA 5DLQC 1NN3A 3CF0A 3T1TA 1E2FA 3UWKA 2PL3A 4B34A 2Q6TA 4FMDF 1PV4A 3UANA 4CDGA 4QGAA 1TMKA 3GFTA 3L43A 1W4RA 2HT6A 2JLSA 2X77A 4IDOA 2BCGY 3SN6A 4MGZR 5BN5A 2QPTA 2BCJQ 4PQRA 2GA8A 4YQFA 2H18A 4L16A 4NYJQ 1KSJA 4DWJA 5CB8A 1XB2A 4DDWA 4TMVA 3OAAD 4DB2A 2V1UA 1JXOA 1N25A 2WKQA 5JHGB 1QHIA 2ZSDA 4HLCA 2DBYA 1OFUX 1FW6A 421PA 3QIAA 2QBYA 4IDNA 5LPNA 1L8QA 4A4DA 1NJFA 1P5ZB 3AGPA 3C14C 2L0XA 4LJ5A 5ANRB 3ASYA 5FPHA 5KNDA 5EE5B 3DZDA 2ZI7A 1CKEA 3H2YA 5DI3A 1R10A 5FUYA 2ZPTX 3X2SA 1XTJA 2BDTA 3L82B 2QMOA 2VP0A 1G7TA 2ZYVX 3NG1A 4ASUD 1VCIA 2JASA 3ADKA 4M9SA 2IYZA 3I62A 5J47A 2QT0A 3PEYA 4P32A 3DVLA 3H1TA 4JBWA 1IY2A 4DXAA 1NIPA 3VR5A 2QAJA 4FXPA 3I4LA 2WWIA 2ZRMA 4OK5A 3K0CA 4LHVA 2PMKA 3CX7A 2AXNA 1GNQA 1OXXK 4WIAA 3GEIA 4PR0A 1OH7A 2GJAA 1FTNA 4P4UA 2Q3MA 1KMHB 2FFBA 3TUIC 3V4FA 2EU8A 4BLQA 1AQYA 3GLHB 4B3XA 1KI4A 2QTHA 2O0JA 1AZTA 2Q3HA 3D7MA 3CF6R 1G5PA 5J4KA 2AX4A 4KFSA 2IYSA 2V3CC 1H8ED 2OCBA 4CVNA 5TMPA 4D6PA 2XNDA 2BC9A 1QHXA 3BFKA 5EXPA 2W2TA 1KTVA 1X3SA 3DKPA 3CM0A 3UMFA 4CYMA 2NO1A 1AM4D 1GRRA 1W4BA 1LS6A 4TLCA 3QSYA 1P9RA 4FCVA 1NN0A 5IF9A 2YC4C 1GTVA 1XBTA 2ZAOA 4Z1MA 2ZITA 3KQLA 2QAGB 3SBEA 4C7OB 2IS1A 3MD0A 4R2IA 5DYGA 2EYUA 4L9WA 4LUCA 1T91A 2OE2A 3K0CC 1U81A 4BQSA 2GVZC 1PLKA 5EQTA 2O8EA 1TU4A 3R9XA 5JJLA 3QG1A 3FFBA 4BFYA 2ZRAA 4M1KA 3GJ8A 2QP9X 4QJ3A 2ZRCA 3I5YA 1XJCA 2NZJA 3REFA 4BLTA 5JSZA 2ODWA 2EVWX 1JPNA 2IUSA 3GJ6A 2QPOA 3ICEA 3AVUA 4C3ZA 1LS1A 2MSDB 5EZ5A 3CX8A 4CT4B 1KO8A 4TLAA 2VHCA 3G5UA 1N5LA 4LDJA 4PAMA 1KZGB 3NHBA 1OIWA 1GFIA 4TMKA 4EJSA 3LH5A 4KYIB 5DIFA 2MMGA 3FVQA 4RKFA 1NSTA 4PPFA 5SZKB 2GAOA 2DWPA 4WA7A 2NO0A 1E2LA 3SEAA 3UWOA 4RD2A 1GWNA 5EXTA 1TEXA 4NCNA 3RDPA 4GOJA 1D8TA 2J1LA 1AS3A 3AKDA 1NLZA 3BH0A 2WJJA 3VR6A 1US8B 2G6BA 1ZIOA 3DMNA 3CH4B 3IEVA 3T35A 1NI3A 4KFTA 4Z54A 2R44A 1SVSA 1TAGA 2J9RA 4B47A 4F91B 2YYZA 4V0ME 3TAHA 1VG9B 2P3SA 1KY3A 3VHXA 1NN5A 3SHFA 1E2JA 3FMPB 4KITB 1IY1A 1MO3A 1W49A 2AR7A 4ZIRA 3PVSA 3CNNA 3ZVLA 2EFDB 1IQPA 1UKYA 4Z1MD 1IXSB 1UF9A 4GRAA 3W5IA 4V0KA 3H86A 4G5RA 4N0DA 5TY0A 4TLBA 5B64A 2PT5A 4K46A 2HF9A 2W6JD 3U60B 3AP3A 3BWDD 4FW9A 2NZ8A 1WBBA 1LVGA 2BKEA 2V6JA 3EW9A 4L15A 4TTRA 3SI7A 4B44A 5FPYA 4XD7D 1F3OA 3B9QA 4URXR 3MSXA 4C0AC 3GQBA 5JRJA 4AKHA 4US0R 5DI3B 3DKVA 2QQ0A 1XMIA 2HXSA 2GK6A 3NH6A 3VNUA 3EIEA 5KDDA 3V4RA 1J90A 2G77B 1BH2A 4V02A 3T61A 3ASZA 4JLKA 5TARA 5L3QA 3UKDA 1EESA 1Z0KA 2G9NA 5GVSA 4QGFA 2HT1A 3LX5A 3ZGXA 4JL8A 2C2HA 1KDOA 2C99A 3BH6A 4OI2A 1DTSA 1P3JA 4FMCB 2WPDA 1U0JA 2YOGA 1DO0A 3K0FA 1VKJA 1Y3AA 1HT2E 2ZQ5A 1UDXA 3C15C 3K9LA 2FX3A 1NG9A 5BYJA 4A2PA 1UADA 2J59A 2VHQA 1GDDA 3BS4A 4IW3B 4A0HA 4PO1A 4Q9KA 1L7VC 3T12A 1FZQA 1A5TA 1NP6A 3R8FA 1ANKA 4DSNA 1YZQA 4F7WA 1S9HA 1T5LA 4PC6A 2CBZA 5E4FA 3O47A 4DLRA 1S9DA 3BAFA 1DAMA 1UBCA 3D3QA 3FDIA 4GMXA 4C30A 3CZQA 2ZE8A 4B74A 1R0XA 5KSPA 5J4HA 4Q03A 1JNYA 3SOPA 4BRWA 2R6FA 2Z4SA 3VX3A 3Q5EA 3DHWC 4B6EA 2DFNA 3C8UA 2GJKA 4Q4AA 4U02A 1SZPA 4KVAA 5EE0A 2ZRDA 5KU1A 4YMSA 1M6NA 2LKCA 5HE8A 1M34E 1VHLA 4PPNA 5GJVC 4M1TA 5BN4A 4YLGA 3EXAA 4D4KA 4IDQA 5JSZB 1ZM3A 4MYCA 2ZRIA 3HR8A 3RANA 1AKYA 1Z08A 5KHOC 2VF7A 2VL7A 3BH7A 4C0LA 1AS2A 3NVAA 1AKEA 1EFHA 2H17A 1QHYA 3IQXA 3IBGA 1J70A 2ZE7A 2UKDA 2ZRLA 4EJSB 3BXZA 3EC1A 3RWOA 5JJKA 1WRBA 2BHRA 2RMKA 3RS0A 2A5GA 1N5KA 2ERYA 4PZLA 1T9HA 3B1XA 4B76A 3EA0A 2WPDD 4ESVA 5JS7A 2I3BA 5J4VA 3RS7A 3U7FB 3AVWA 4NTZA 3UK6A 3KKMA 1ZM7A 3AF2A 1Z5ZA 3T1VA 1R0ZA 1D2MA 2JCSA 3LQQA 4BFTA 4C0QC 2NTYC 2QGNA 2PMDA 2W00A 3VR4A 1XD2A 2P2LA 4LHXA 3TK1A 3WRYC 2KJQA 4O2RA 1KSHA 1YZKA 3OIWA 2PBRA 3GLHE 2WWYA 3QKRA 2C77A 1H8HA 1BIFA 1V43A 3N2EA 5EUMA 1T6NA 3GP8A 1E79D 2B21A 1OT3A 1ZNZA 4HAXA 3FE2A 3KB2A 3OEEA 3K0AA 2VSFA 4C2TA 1EFRA 3SYKA 2IXFA 2PZGA 4H1UA 1JI0A 2AN9A 2VP2A 3AGQA 1CBUA 3G0HA 5KUTA 1O3YA 3HYRA 3IHWA 3ZVRA 3WXMA 1BKDR 4HAUA 4LV6A 2WTUA 1RRCA 2VPPA 3E1SA 1FPMA 4Q7LA 1CU1A 1FFHA 2WWWA 2XB2A 1YQTA 3TMKA 4DZZA 1X6VA 2IYLD 2N42A 1OXSC 3VAAA 4D4LA 5P21A 3A1UA 4HB2A 4DB4A 3VR3A 1LF5A 3X1ZA 4WAUA 5IK2A 3EPHA 2XXAB 3C5HA 2OEPA 1JB1A 4RD3A 3KXIA 1Q57A 1Z0FA 2OO7A 3MUFA 4AIIA 5L3QB 1P9NA 4BLPA 4NH0A 4UNQA 2AKYA 4WBSA 5G40A 4LV5B 3TSZA 1E9RA 4L5BA 3TRFA 4A2WA 4C0JA 1QDEA 1CJVC 1KI9A 2QORA 4AI6A 1GKYA 3MJHA 3K0FB 3L8ZA 3PUXA 4QL3A 2MMCA 3GEHA 3QXCA 4GZLA 4NDZA 5IDVA 3UIEA 3WHKA 3EPLA 1U2RA 1E2EA 1XXHA 2AKAB 4TL8A 4U00A 3RYTC 3U44A 2QY9A 3MGCA 2HYIC 1W36D 1DAIA 3B9PA 4M9ZA 3TR0A 4B3DA 2V6IA 1DOAA 2IX3A 2FN4A 3EZ2A 1NSFA 2B6HA 2RGCA 4A82A 4HB0A 1CS4C 1G8YA 1G3UA 4LI0A 2REXB 4M53A 4IEEA 4QHYA 1I2MA 4JLOA 4TYYA 4EPYA 1JR3A 2ATXA 4KBFA 3QG5A 3ZYCA 1YJ5A 3OEED 221PA 4NE2A 3SZRA 2QRZA 3FHTA 1NVVR 4Q4AB 4KXFB 4ILEA 4KLNA 2GF9A 3CWZA 1F2UA 3QKTA 3GJXC 1RC8A 4GOKA 5C4GB 5M04A 4NCIA 3BOSA 3SJAA 2GHIA 1Q3TA 2WWFA 1G7SA 1P4SA 4FD2A 1DE0A 4FINA 2IW3A 1U8ZA 4XVUA 1S8FA 2GJ8A 4RSGA 1LV7A 3MMPA 4Q4HB 2EQBA 4EKDA 3IUYA 2JAQA 4I1OA 4GFDA 3ADBA 2Z6VA 1T3LA 1MO5A 4RKEA 1UBGA 4B3GA 4GI7A 1FMLA 4A36A 1VG0B 3F8TA 5FI1B 5CYOA 2FFQA 4CRWB 1OJLA 1KI2A 2QENA 1KI1A 4A1FA 5SZHB 1UFQA 3I73A 1UKVY 2VEDA 5BYKA 2JEOA 4I1VA 1XFAA 5LB4A 1E32A 2H16A 2PLFA 1E1RD 5G3YA 5A0FA 1D2EA 1F60A 3CRMA 2DR3A 1AGPA 2P67A 3GEEA 2GEVA 4PO8A 3LBHA 4WVFA 3TBKA 2OCAA 5GJBA 1G6OA 1XD2B 2D2EA 1W36B 1M7GA 2XX3A 3PEWA 1A82A 4TT3A 2O8FA 2IK8A 2V8OA 1C9KA 3I3SR 3B1YA 3KFXA 1B0UA 3KKQA 3PUYA 4DLWA 5E95A 4ZI3A 5JBQA 3QKRB 4BASA 2KE5A 2PEZA 2YWEA 4HZIA 4I99A 3TQFA 4FI3C 2NGRA 3UPUA 4MGYR 1NMYA 1Z06A 2ANCA 2CLDX 4BEBA 8OHMA 1HY3A 1AN0A 4M21A 4Z8XA 3AUXA 4BECA 3K0AB 4LSGA 3WY9A 4H9GA 4KYUA 2ZEJA 2NO7A 1KIMA 1PJRA 1ZBDA 2ZUDA 1T8TA 2QE7D 2QG6A 3LFUA 2XJ4A 3EPKA 1OE0A 5F2EA 2DWOA 1D6JA 2GEDA 3RS4A 5EE1A 2F7SA 2OBMA 5JCPA 2VYFA 4IJMA 4MRPA 6Q21A 2YJTD 4LC0A 5CITA 4Q02A 5KDLA 1GZSA 2DCUA 1DVRA 2JIZA 2EFGA 3I92A 2CDNA 5LDDC 4RZXA 2FDCA 2H57A 4PZYA 3MJRA 3D8BA 1NMZA 4PXAA 4C0HA 1T3HA 4TWZA 3AH8A 1X86B 3TAUA 2CNWA 4DUGA 5F3WB 2GDJA 4NYIR 4A92A 2AWOA 4EPXA 1Q3HA 1TQ4A 4NCHA 3B85A 2BBWA 1GUAA 2GILA 4KU4A 1ESMA 2QM8A 2XTMA 3AEZA 4V0OA 3OZXA 4HEJA 3VQTA 2F1HA 2FFHA 4LJ9A 5CDFA 3BB4A 1XXHB 4EQ6B 1SULA 2PCLA 3U44B 3EZ7A 4C0SA 2HJVA 2OHFA 4ZI2A 3U6KA 3A6PC 1W47A 1II9A 1RW4A 2VBCA 2ZR0A 4TT3D 5GVRA 2DHRA 2OXRA 1ZUNB 5DISB 4P31A 3NKVA 1OFHA 3U2QA 3ADDA 1E9DA 1HV8A 1BYUA 1KGDA 3WYAA 5KYKA 1XJ0A 2WKPA 5G41A 3I8XA 1OHHA 4BFVA 1E69A 3X1DA 1TF5A 1T0JB 4PAQA 2G0NA 4G3XA 4TTPA 1W0KD 3DEFA 3NH9A 2ZRKA 2RH5A 4QC2A 4RD6A 4TL6A 5JMTA 3QPWA 3AB3A 3ZS9A 2IYVA 1F2UB 2QP3A 5DHFA 4BUJA 1WDTA 3ND8A 1GL7A 3EZ9A 1I4DD 3NBXX 3B7GA 1IONA 3LLMA 1TTTA 3RWMB 1M74A 3KUCA 3CRRA 3DDCA 1N6RA 2WJVA 3AVOA 5FFMA 4TQ9A 2ZRNA 2OFWA 4Y0AA 4JIMA 1IN6A 5LD2C 4RVCA 2J45A 1W2HA 2B7BA 3FMFA 4IFEA 1N6OA 2DFKB 1FUUA 1OV4A 2YOFA 3BBPA 1NVWQ 3B60A 4AURA 2YZ2A 1BO6A 2J0UA 3K0EA 1BS1A 4DCSA 4DUGD 4B48A 3SYLA 3HJNA 4TMXA 5H8WA 1OYYA 1TF7A 2GXSA 1FUKA 1QRAA 3BC1A 1SKYB 5JEEA 3VKWA 2VHTA 1M2OB 1NG1A 2P0EA 3EIQA 2YVUA 1XTIA 4PC3A 1NY5A 4MUAA 1YR7A 2HCBA 4QJ5A 2JLRA 2BMJA 2A5FA 4LPSA 4Q1CA 2V54A 3WP1B 1PLJA 4ACBA 2H8KA 1G1MA 4G5OA 1JQJC 3CNOA 4NYJR 2FWRA 2JJ2A 2J46A 3OIVA 3FYHA 3RS3A 3W5JA 3RAPR 1ZC4A 1GITA 1N6PA 1W46A 3LQRA 1FQJA 4TQUS 4YXWD 2O8FB 3IEUA 5B58C 1VYVA 2A9KA 2QZ4A 3FFAA 3OIYA 2QN6A 5DSZA 1JEDA 3F3YA 3U3OA 4V0LA 4XVQA 5KOYA 1NLFA 3HWSA 4POAA 5FOXA 4BFXA 1YHNA 1VPLA 2KSQA 2OLKA 2GJ9A 3ICQB 821PA 5FBQB 1M1YE 1A2BA 1EFCA 1DAGA 1OW3B 3GLFE 4DEXA 2IS2A 1VECA 1E9CA 1FX0A 5H68A 2OAP1 4L9SA 3MWYW 2VH5R 3JVUA 4OQLA 4IVPA 4PANA 2Q0HA 3PEUA 3LW8A 4XSHA 4QNRA 1GNPA 3L0OA 4DLYA 3THYA 1YU9A 3SQWA 2JJ8A 2GF0A 1P72A 3VFDA 5TXGA 4FMDB 1Z6GA 2IS6A 2QPAA 1Q21A 3PITA 5JWHA 5DNYB 1M8PA 2D3WA 2XOKA 1E94E 1NMXA 2A7QA 2GRJA 1YKSA 3I32A 2HUPA 3R9WA 4KO8A 1UDWA 2W0SA 4EPWA 2JJ1A 3N70A 4H1VA 4PTLA 4JLAA 3LO5A 4HSEA 4RZ3A 1GRQA 4C0KA 3LDAA 5FTMA 5HCNA 1K8RA 1TQ6A 2WAXA 2J0SA 4URVR 2BKUA 2RGAA 2RGXA 4RZUA 3ZDQA 3UMRA 1W5TA 1KY2A 3A4LA 3EARA 4Q1FA 4S2EA 3P4YA 3FHCB 1G7RA 3X1XA 4M1SA 1R5OA 2YWHA 4C4PA 4ZDJA 5DHAA 3NXSA 3QXSA 1NN1A 3T1OA 4F92B 2PX3A 2AFIE 3GJ5A 4OQXA 4W7SA 3HDTA 4R9UC 3I5XA 2IF2A 4JT4A 4BPBA 1KOFA 1QVRA 1KSGA 3QUSA 4KFRA 3GCGA 5JZVA 3CO5A 1HURA 1U90A 4HDCA 1CF4A 1WE2A 1MRNA 4ZDIA 2D7DA 3EG5A 1DEKA 5HZKA 1R5BA 4M2LA 1EWRA 1R4AA 2XJ9A 3PCRB 4UNSA 2F3TA 2FU5C 4DSTA 1N6HA 1G18A 1CJMA 2D2FA 2O8CA 3SJZA 1YZLA 3SHWA 4LYFA 4QBFA 2ZS9A 1KI8A 1D2NA 4Z51A 3PUVA 5F9FA 1X1SA 3QKSA 2OUKA 2V1XA 3EPJA 2BMFA 3U7EB 2BIFA 2R9VA 2UVQA 4YMTA 2YWFA 4UNRA 1XEXA 2DWQA 3H84A 3M6AA 1DG1G 4LHYA 1N0UA 3C5CA 3SFZA 2C95A 4HDQB 5DGXA 2AFHE 3SR0A 2FFAA 3K0SA 1A1VA 2J0QA 4EPRA 4OQFA 5DYIA 3THWA 4GMDA 2IEYA 3F0TA 3WNDA 4DIEA 2ATVA 3BK7A 621PA 2Q21A 2WWHA 5DN6A 3IQWA 4D82A 1JXMA 3FPAA 2QP4A 4DSOA 3ZH9B 4C0BA 2FA9A 3G82C 3KQKA 3GLIA 1DADA 1TQ2A 4JLNA 4MYTA 5CK4A 2G83A 2H1LA 3KZ1E 3AP2A 2WJYA 1IJEA 1XXHE 2QI9C 4BFUA 2H5EA 1BMFA 1G8FA 1MV5A 2CL0X 5JECA 2ZJBA 1W48A 2XNDD 1DARA 3LW7A 1VMAA 3OFNA 3TLXA 2BWJA 4HB4A 2E9SA 1RJ9A 2XNSA 4KV9A 1N6NA 2RGEA 1QBKC 2C9CA 3SS8A 4F4CA 4JLBA 3GFOA 4R2HA 2D4HA 2V55B 3QNUA 1EFUA 4Q1AA 5AUPB 1RPZA 1S3SA 1JR3E 1U94A 4LBWA 4LHZA 2FPLA 5KNCA 2D62A 2F6RA 2YINC 1U99A 1FX0B 3AKEA 2FPMA 4WOPA 2RB4A 4BLSA 2E1RA 4Q66C 1EK0A 2QBYB 2ZYTX 1G64A 1G9XA 4AKIA 5HCIA 2GETA 1R0WA 3E70C 3MLEA 5UKDA 1ZAKA 2R6AA 2BBTA 4MYHA 4M8NE 2VTKA 3PXGA 5H70A 4FMCF 3QPUA 3IBYA 2RGNC 2ZI6A 1P9WA 3B78A 2OFXA 2QU8A 4PZZA 3TUZC 1E6CA 1XPOA 3GMTA 4NZYA 1P6XA 4JSTA 1JQLB 5AJWA 3PG5A 2JLZA 4B71A 1CJKC 2ZANA 2CE2X 1OIXA 5AJYA 1QF9A 3SQXA 2ZSAA 2X8AA 5LB2A 1VIYA 4RD0A 3ZD6A 3QE0A 2WM9B 1U8AA 5FBWB 1SKYE 2ZS8A 3BD9A 4DBLC 1OYWA 2PJRA 3P26A 2N1BA 4OQMA 2JLUA 3NEJA 3RC8A 2ZAMA 2XSZA 1XD9A 1MH1A 5BN3A 3B13B 1DPFA 1G5TA 1T3SA 4HDOB 2JATA 4MKGA 4NCKA 4NCJA 1JECA 1WQ1R 3QVUA 1VHTA 2VSXA 4LJ7A 3NIBA 4BFSA 1TUIA 4JLVA 2IWHA 5CIWA 2AL7A 3OFND 5CJ2A 4OQNA 4MDEA 5FOTA 3A1SA 5E7MA 2ZRFA 2GVDC 2NO9A 4XSGA 5E7JA 3GLFA 1VCOA 4DLSA 4TL7A 4TYNA 4XWOA 1OB5A 3ZVNA 4CGZA 1NVUQ 3GJ3A 1Z29A 1JAIA 3M1IA 4JL6A 4HYYA 1IHUA 2C98A 4YMUA 3OIUA 2IF0A 1MR3F 4OJKA 3ZLJA 4IOKA 1ZM9A 2ZI3A 4DCVA 3JZAA 3ZJYA 1T4GA 1VG8A 1TU3A 2W58A 1P62B 4TTQA 4UXHA 5CIQA 1WB9A 2O8EB 3BERA 2IL1A 5D3QA 2ODNA 3NEYA 4OK6A 4EIWA 1E0JA 2ZE5A 4Q7KA 5B30A 3R7WA 3RRYA 3LY5A 2EW1A 2C04A 3IKJA 2G1KA 1AGRA 3QF4A 3QOFA 3BFXA 2V7QA 4TSFA 5CLLA 2C9YA 1XEXB 1IN4A 4ZDKA 2ZVPX 4LBYA 1J8YF 1QHNA 2CHQA 2IA5A 3CPHA 4HZUA 3O8RA 2IYXA 3RSOA 2OCYC 1G3MA 4JKIA 5LBIA 3K9GA 1E98A 4URZR 4NL4H 3M0EA 4AYTA 5EJEA 2CMKA 3MRSA 4FWTA 4PO9A 4OHZA 1F2TA 1FQKA 3LRPA 3KFVA 1Z0DA 4IDHA 1W0JA 1N6LA 4DDUA 5K8IA 1YRAA 3PJRA 1UJ2A 3GFPA 1E99A 4CIDA 3V00A 2FG5A 4PC1A 2SHKA 4GP7A 1ZIPA 3IIKA 1SHZA 3UXMA 2AD5A 3QY0A 2YC2C 3K09A 1R7RA 1ZMXA 1AK2A 2QTFA 2JLVA 1S96A 4NYMR 1E3MA 2PCJA 3KJIA 3FGNA 3TJZA 2IBMA 5CDFE 1N5JA 2FEMA 3QJYA 5FR1A 4QBIA 2O52A 2VIIA 1Q1BA 1XEWX 2V9PA 3ND9A 3MAAC 1AA9A 4GT1A 2LKDA 4PX9A 1QHGA 2IS4A 4PPQA 1KZ7B 3SJBA 3AQ4A 1SVIA 4ZIRB 3H0KA 3ZQ6A 4LJAA 2GXUA 5FPTA 4CW7A 5L8VA 1TNDA 3TNFA 2QQEA 1HE8B 5JRZA 4Q5IA 4XIGS 2HF8A 5KPJA 4Q7MB 3KXKA 1OXVA 1GL6A 4DRZA 5J4YA 3W6PA 3QXJA 4GL2A 4QKQA 3CBQA 1KJWA 1PVOA 5DH9A 2F55A 2WV9A 4A6XA 2MSEB 4TMTA 1JALA 2O8DA 1IJFA 3AF0A 4B3CA 3K09C 3KQHA 3EZ6A 5DE3A 4LV8B 2BVNA 1R8QA 3R20A 2HYDA 2J7KA 1KK2A 1RRGA 4UKDA 1HT1E 3OEHA 4B35A 3EIHA 3KJHA 3LLUA 3NC1C 3Q7QA 2ZUCA 1ZYUA 1QG4A 3X1WA 3B1ZA 1XPRA 4F4JA 2WMOB 2F1RA 2FSHA 1XZQA 4Q48A 4B3BA 3U4QA 4Y0VA 1Q1QA 1SXJA 2Q9BA 1SVLA 2D06A 4ZKEA 1DELA 5FL3A 2IHYA 3VTKA 1EXMA 1W0JD 1DBSA 1NBMA 3CPEA 4A8JC 4A0FA 3QEOA 1W4AA 1E2NA 3GLGA 4M1OA 1G8HA 3B1VA 3HPRA 1W1WA 3WMEA 3NDPA 4IVQA 2NO6A 2REOA 4GBMA 5AJVB 4IEIA 5L3RA 4DCTA 3I72A 3WP0A 4CEJA 2CCGA 2VF8A 4TQAA 4TYPA 1AZSC 3THOA 4B32A 4DCUA 1COWA 3BFVA 3AKYA 1G8PA 3KXLA 2ZR7A 1XPUA 4Q9JA 1H65A 3OF5A 4TLDA 2F1IA 3TSWA 4AK9A 1H8HD 4X8LA 5C46F 4AC9A 5J4LA 4KJZA 1RRPA 2G88A 3LBNA 1KDTA 4DC9A 3BJIC 4D0GA 4LOAA 3A36A 1EFRD 2QL6A 4PQYA 2KI5A 3GLFB 4BFZA 1TF2A 3KQNA 2FNAA 3RRMA 1SXJC 4NP6A 1NRJB 4GNKA 1DO2A 5AUQA 5JS8A 3LWNA 2ONJA 4G5GA 3K70C 1YVDA 3AVVA 2CK3A 4DCNA 4TL9A 2WOJA 3ZS8A 2VQSA 2RGBA 2ZSEA 5FUVA 1W44A 2ZS7A 3IHLA 5CJPA 2F9MA 2ZJZA 3R7WB 4QHTA 4E22A 3F5FA 3QF4B 4O25A 1AS0A 3T15A 5JLJA 2BEKA 2QGZA 3RABA 5JHHB 3PENA 2HCJB 3RSLA 3SE0A 5IK2D 4M9XA 4Q9LA 3W34A 2GKSA 2QUZA 2X2FA 3W3ZB 1Z83A 1C1YA 3CF2A 3NWJA 4GP6A 5FL7A 4EUNA 1P60A 1KKLA 2F43A 1W7AA 2WJGA 2ZI9A 2GXQA 3D6TB 4ZPXA 4YONB 3ZQJA 1CJUC 1F2TB 1OH5A 3SU8A 2FZ4A 2OSBA 5L3VA 5E3HA 5IHPA 1G16A 1GRNA 4LBVA 4W5WA 721PA 4QOSA 1IOZA 2ZM5A 4QBGB 2O8BA 3W8NA 4AY2A 4NU0A 1G6HA 3EZFA 4PSVA 4QM6A 4D80A 4V03A 1WP9A 4CEIA 4LWZA 1CJTC 1BOFA 2GXAA 3IILA 1ZW6A 1MRSA 2EYQA 1Z0IA 4W9MC 1COWD 2FV8A 4NKRA 3HR7A 4OHWA 2ZE6A 3GJ4A 4DVGA 4LRWA 4FCTA 1D9ZA 3AUYA 2HJGA 4FCWA 1JEEA 4HAWA 4R7ZA 3A58B 4AYXA 4YC7A 1P2SA 3A8TA 1P2UA 4ZO4A 4BZXA 1II0A 1JR3D 2A30A 2A78A 5E7IA 3OESA 4IXNA 1XMSA 1Z3IX 3NHAA 5AJZA 4RFVA 4US2R 4RFSA 1KI7A 2VP6A 2ZI4A 3SBDA 2UZ3A 3VHLB 4Q4LA 4LBZA 1S3GA 4Q18A 4CF7A 4HUQA 1R6BX 3QENA 1NJGA 4R71A 4JSYA 3T1QA 4O0MA 1ZM2A 5JJIA 3WBJA 1IAQA 2GAAA 2OV2A 3IO5A 4LC1A 5AUNB 3DOEA 3E2IA 3KKPA 1FNMA 3ONWA 4NONA 3W9YA 2R62A 1XU4A 4YMWA 2BMEA 1N3BA 2CLSA 2PJZA 2XZLA 3LVQE 5KO2A 1G5RA 4ON9A 2AK3A 1XCMA 3TW8B 1CP2A 4X8OA 4MKIA 3AF1A 1KO1A 5GJWC 1U0HC 1J2JA 3EX7C 4DLZA 4JZKA 3K1JA 1U9IC 3U3MA 4DDVA 1E2QA 3U4QB 1SXJB 1XP8A 1E9BA 2YOHA 3KL4A 1I2DA 4HLDA 1K5DA 1Z2AA 1E4YA 1VYUA 2JDIA 3GLGB 4D4MA 1E2DA 2BJWA 3CLVA 1Z63A 4P0TA 4LY6A 5KPDA 2PZEA 5EP2A 3VR1A 2ZYWX 4OI1A 4CEJB 1A2KC 3GLIE 3CIOA 3U5ZB 1XD8A 1NNEA 2FF7A 1S0UA 5B57C 4URWR 2H92A 1X8JA 3K9HA 3QBVA 3J81k 2HEIA 1GP2A 1TEVA 3DOFA 4G0NA 4U7DA 4J0QA 1IN8A 3RNLA 4RCYA 4X8MA 2QSZA 5CLQA 1QHSA 2QT1A 4PHGA 2FSIA 4BFWA 4OHXA 1GOTA 4JYBA 1G21E 1DAKA 2AXPA 3BB1A 3LX8A 5KSZA 5EXXA 1P75A 1UBEA 4YDSA 1RYHA 1R5NA 4HLQB 1ZCAA 1VIAA 4MYUA 5DO9A 2REBA 1CXZA 5JI2E 3TR5A 4K8OA 4XOIA 3FOZA 2PH1A 3T5DA 4EFNA 3K9NA 4KI0A 1G8GA 1OXTA 2ZRPA 2IUUA 1U0LA 3ZZTA 1Z6XA 1TADA 4KCGA 2Q9AA 2RHDA 3C4JA 1EGAA 2CE7A 4M9QA 4DLVA 3O8CA 2JIZD 3CW2A 4MRVA 3C7KA 4TMWA 4AKGA 2EWWA 2FGJA 4DJTA 5KSOA 1G3RA 2IYQA 3WNCA 3OAAA 2ANBA 1Y63A 4ESHA 3VKGA 2CNWD 2ZXUA 2F43B 4DDTA 4C9BA 3QXHA 1N6KA 1NIJA 5HPYB 2W6IA 1EX6A 1LW7A 3KJEA 1ESNA 4MKFA 3THXA 1Z28A 1G3QA 2R8RA 3TIFA 2WKRA 2XTZA 1TUEA 3UG6A 3W6NA 4NMMA 3CR7A 5EZ6B 2JDID 4P4SA 1ONBA 2IXGA 3E5HA 4Q47A 3U3KA 4ASUA 5CM9C 4CEIB 2FSFA 1YE8A 1ZNXA 2QROA 1LNZA 2B8TA 1E0AA 5EXSA 2JLWA 4URUR 3MCAA 1JPJA 1SQ5A 3JVVA 3NBFA 3ZVMA 4OHYA 1GNRA 3TW4A 1X8KA 5FOUA 4HAZA 3KUDA 1Q20A 1V5WA 3O8BA 3WYFA 4KBGA 1NL3A 1QG2A 1ZD8A 4KVGA 2QAGC 5GJCA 3QF7A 2W0MA 1CTQA 1RIFA 4GSYA 2BBOA 2VP5A 1KHTA 2F3RA 1HA3A 3A4MA 3W3AA 2P65A 1OHHD 3SYNA 2C8VA 3P20A 1S4QA 4LHWA 5D3MA 3KB1A 4WZ6A 3VU9A 2IYTA 2KB0A 5TV2A 1ZU4A 1L4UA 4NBSA 3ZZ0A 2LCFA 5SZJA 4RFSB 5IT5A 3LNCA 5GADl 4I1UA 1P2VA 4IFBA 4BWYA 1HQCA 1H8EA 4JS0A 1Z07A 4BLRA 2BOVA 4HUQB 3Q7PA 3WMFA 5C4MA 4JJKA 2GZDA 1HEIA 4Q19A 1PLLA 3SDZA 3AM1A 2OZEA 2IHBA 4HAYA 3TQCA 3FKSA 3QEJA 1LFDB 5J40A 4OYHA 1OSNA 2ZRGA 3EASA 1XX6A 4N1AA 2HXYA 1QZXA 2FJUA 5AK0A 2ZYUX 2A2ZA 4L8GA 1ZUHA 1GILA 2HV8A 2V4ZA 2ZU0C 4MH0R 2W6ID 121PA 2QSYA 5TB5A 4YMVA 3L0IB 3A1VA 3U7GA 2XGJA 1OXUA 4AG5A 4V0NA 4JVNA 4O2LA 1IM2A 2BV3A 1Z6TA 3LBIA 2P5TB 5K8LA 2OAQ1 1MKYA 2WAYA 1NVXQ 2FE4A 2DYKA 2X19A 1BYIA 2XAUA 5EE9A 2DFLA 2WBLC 3Q85A 4JLJA 5LD2B 3RVBA 4G5QA 3QXXA 2JJ2D 2ZJ8A 3MFYA 4PHFA 4E07A 3QPVA 3LXXA 4JVLA 1W5SA 1IN7A 1DS6A 3DPUA 4FMBB 2G3YA 1YZUA 3DO6A 2GK7A 4Q7JB 4P33A 3A1WA 4P3YA 1QVAA 3Q5DA 4JVMA 2ZJ5A 5L3SA 3I1FA 1ZUIA 5FTJA 2RHMA 3FMIA 2WJIA 2K5UA 1Q0UA 2GBLA 2CCJA 1G4UR 2D7CA 4XJXA 5JCZA 2C78A 4KODA 4OKSA 4AD8A 1SVOA 3W6OA 1DAHA 1KDRA 2R6CA 2FZLA 3V9PA 1FNNA 1QHHA 4JLDA 2WZQA 2FOLA 2VO1A 3P32A 4OI0A 3ETLA 5BQ5A 1W4CA 2WSMA 3PR1A 3HU1A 5EE3A 521PA 3W90A 3CWQA 4PQFA 2IUTA 1E9FA 3LA6A 1KNXA 4PC2A 4MGKR 4XH9B 3DZ8A 4OI4A 4Q00A 1IXZA 1ODFA 2NOAA 2J41A 5CB6A 2CHVA 2I4IA 2ZVQX 1UM8A 3FKSD 5AR1A 5FI0B 3L8YA 4ERNA 2W6JA 2J0UB 1GKIA 5AWFC 1SGWA 2NPIA 2XOKD 4W5HA 2J5XA 2R65A 2DPXA 2ZSFA 4JMPA 3WYGA 4XD7A 1G20E 2GBLC 2ODEA 4U5XA 1M7BA 5FTKA 1HE1C 5DI9A 3ADCA 3THXB 2R6GA 2JJ1D 1SXJE 3IPYA 3AVYA 4F38A 5CK5A 4A9AA 3Q72A 4GZMA 4P4SB 4DKXA 3IIJA 2GWHA 3MWJA 1XZPA 4FWIB 1NBME 3CR8A 1Q1ZA 4PHTA 1KO5A 3GLGE 1DG3A 1YR9A 4DLTA 1CEEA 1O87A 3PFIA 2RGNA 4MDFA 1M7HA 3KDSE 1J99A 3R8CA 2ZROA 1KI3A 3GJ0A 3Q3JB 1ZJ6A 1E0KA 3T5GA 4BGDA 4UJ5A 1G19A 1YZNA 3UMSA 5HZHA 1RVDA 2EFHB 3O8DA 2TMKA 4KLZA 4JL5A 3PV0A 1XTSA 5FH9A 4AYWA 2ORIA 4XWKA 5D3MB 4D0NA 2ZSBA 3N2IA 3U3JA 4IHQA 4YXWA 4ZCIA 5C18A 1KK3A 2LWIA 4LGMA 1J8MF 4DT1A 2IC5A 2WHXA 2ECKA 1EFTA 1K5GA 1UPTA 1E1QA 2CCKA 2GTPA 3B6EA 2VHUA 4LJ8A 4QHSA 1WF3A 1I4LD 2WICA 1LF0A 2I1VB 2WWGA 2OFOA 1GKUB 3EWSA 4CEHA 1P61B 2AK2A 3B82A 4ACAA 5B2ZA 1XTKA 1AJEA 1OH8A 3THYB 2WMNB 2P6UA 1OKKA 2RGDA 2ZRJA 4BZQA 4EJSC 3ZIAA 4E5UA 4B75A 3RS5A 4LJYA 2XZOA 5IRCD 2Z5FA 1UKEA 2ONKA 2ZUBA 4AG6A 1KMQA 1RE0A 2KBFA 4M0LA 3IDQA 2JA1A 3K53A 3I61A 1GSIA 4LPKA 4F4IA 4EFMA 4Q1EA 1KYIA 1JAHA 2G1JA 4PHHA 1CR4A 5DN6D 3KTAA 1FP6A 1G41A 2CEAA 4Q21A 1U98A 2FGKA 2H7VA 4B3FX 1XEWY 1K6MA 4XVRA 1E9SA 4FN5A 3QVVA 5K8TA 4RD1A 2XXAA 1GIAA 2FSGA 4JT2A 1N0VC 1XRJA 2ZRBA 4X8HA 2ZR9A 3AF4A 3TH5A 2CJWA 2GZAA 2IT1A 4TZ0A 1HTWA 1WMSA 1OPXA 4WXRA 2GZHA 3CONA 3NBZC 2KWIA 4D0LB 3UG7A 1HH4A 1BMFD 5BXQC 3WHLA 1RFLA 1P2TA 1FP7A 2I1QA 1EG7A 3PUWA 3REGA 5FTLA 3KX2A 1ZC3A 5L3SB 2DFTA 4LJ6A 5FOSA 4D25A 4MRSA 1KAGA 5SZIA 5A5GA 1VG1A 2NPFA 4RJLA 2Z4RA 3JZMA 2JLXA 1KNQA 2GCPA 2ODBA 2A5YB 5FTNA 1KKMA 3RLFA 1ZNWA 4BLOA 3CB4A 2D74A 1OLOA 1SHKA 1QHHB 1ZINA 2GNOA 2YHSA 2WWXA 3N5CA 3P1JA 1PZNA 3Q8XB 3R9IA 1IN5A 4LYJA 2QMHA 4JBXA 4BZPA 5AJXA 1E1QD 2X1VA 1Z2CA 3HU3A 3TSOA 2VLIA 4IRUB 4RZ2A 1NLYA 3CKLA 2CLCX 3HPQA 2O8CB 1HUQA 1E79A 4QXAA 2F9LA 3VKHA 3QKSB 5FUXA 1AIPA 2IEZA 3SC3A 5BW8A 1OKKD 4HB3A 3S1AA 2QM7A 5F98A 3ZIAD 3C16C 4B73A 2CXXA 2X2EA 1MT0A 3TUJC 2BMDA 1Z22A 3B2EA 3EC2A 4JKYA 5G53C 3THWB 5CM8B 1KO4A 2GCOA 4E03A 2P6RA 3LXRA 1NKSA 1XNJA 3C41J 3RRZA 4PC7A 2KBEA 2B92A 2ZI5A 4Q4HA 5FPKA 4R98A 2ZJ2A 2JLYA 1WXQA 2VRWA 1XMJA 3DM5A 2GCNA 1HYQA 1UEIA 3A4NA 3UATA 5FBVB 3GLIB 1E2MA 2ZJOA 4GOXA 5JEDA 1CIPA 2XSZD 1E96A 1KI6A 3LD9A 4FIDA 2C9OA 3CRQA 4IDPA 1SVWA 3L0PA 4XWAA 2JLQA 3IPXA 4LX0A 1S1CA 3WBKA 3A37A 3BORA 2NQ2C 2B7CA 4JJZA 2GEUA 3KQUA 3U3RA 2WIAA 1RJ9B 1EX7A 3WMGA 4UJ3A 4TLEA 2YNMA 1ETUA 4ZDWA 1IXRC 4EDHA 5FBLB 2XITA 4A8JA 4A15A 4D26A 1EWQA 2FMXA 4DSUA 2PZFA 2ZJYA 5EP4A 2QTVB 1VDZA 3FTQA 3FB4A 4LJ4A 4DT1B 4B2IA 1Q22A 1UEJA 3CX6A 4M1YA 1Q1EA 4B2LA 3ECCA 1JJVA 1JJ7A 1AQUA 4PPGA 4N0EA 1UKZA 1CRPA 4CEHB 3BIFA 1XCPA 4S35A 1GAJA 5C1BA 1GM5A 4MQBA 3AP1A 2J3EA 3DM9B 1C4OA 4B43A 1J7KA 1NKTA 4OBEA 3LVRE 1L4YA 1X8LA 4QGGA 2VA8A 3AVTA 1LTQA 2V7QD 1Z47A 2IYYA 3FWYA 4TSFD 1RZ3A 2O5VA 4NYMQ 4WXPA 5EP1A 3BB3A 4Q01A 2ERXA 2XTNA 2YKGA 1B23P 3TVDA 1UAAA 4QGHA 3L0SA 4MUBA 5EP3A 3W8RA 3B5JA 5HE9A 1FTSA
chains in the Genus database with same CATH superfamily
2WNIA 2F3UA 3FHOA 1DGQA 4FWTA 1U2GA 2FCAA 4RJIA 2NVUB 2YNMC 1ZNYA 1M0EA 2O2HA 3RFCA 3F3KA 1DT3A 4WEQA 4HGQA 4UNPA 4WK0B 1B3BA 6ADHA 1I1HA 2QXTA 3COJA 3Q0TA 2VP3A 2IYUA 2XXJA 4O1IA 4CG2A 4B3TB 3R3WA 3QELA 1YR6A 2I7VA 2DH6A 1EWVA 2NSYA 4EK9A 2BFDB 4I4NA 2REQA 1QB7A 4D79A 3DEAA 1O4VA 2VP9A 4E6EA 4RH0A 1KJJA 5EJIA 3VNVA 3NAZA 4LZZA 4C01A 1XZKA 4CETA 1U3VA 3G0DA 3QPAA 4CZ2A 4LXHA 3HFSA 4GPTA 4FBMA 5DV9A 1CUSA 1H2BA 1OI3A 4PSAA 5CUQA 2VBGA 1WKCA 2J5KA 1WUHS 4RVDA 4Q16A 5CCEA 3NBYC 1BX1A 3MPUA 4HDAA 1PUIA 1UJ5A 2JNWA 4RY0A 3CC8A 1WLSA 3C1TA 1D4FA 1ZHHA 2OT3B 2XGGA 1G9SA 4EQ6A 3HJUA 1YRBA 1YI0A 4V0MA 4UU1A 1B6SA 1DC3A 1J2RA 1T8UA 3D3NA 1H22A 3HXKA 5EEGA 3IIMA 3AVXA 3W0LB 4BNVA 3OD1A 2CN1A 1I4TD 2YASA 1JR6A 2ZWIA 3EGIA 1ELOA 2XDQB 5AUOB 2DB3A 2PWYA 4UW9A 2PUJA 3NB0A 5DLYA 4ZRMA 2UUAB 3TOZA 1KVRA 4EEXA 4WKCA 3SK0A 5I7VA 3G5TA 1KDVA 3ER9A 5TDHA 4RJ2A 3RTEA 2D3TA 5FR2A 1TO6A 3SNHA 1QWOA 1YE3A 2G08A 1CIJA 1MVOA 4MWCA 1VCHA 3QUCA 1DOZA 2FF5A 3LC0A 4MITA 3H4MA 2JKVA 4GBJA 4HQNA 3T34A 4NE7A 4HF7A 4JBYA 3MWEA 4KQ9A 1BRMA 1OX5A 1XCGB 2EFEB 1D03A 3BMOA 3CRNA 1RKBA 4ME6A 2QE7A 1SXQA 4QYTA 4R1OA 1IZ0A 2QXUA 4UCWA 4PTZA 2C1ZA 3IO3A 3KSMA 3A70A 4HZUB 1C5KA 3IA2A 3KJFA 5FBHA 3PA8A 2EJWA 5A71A 5JXJA 1XJWA 4X60A 4UNIA 1GKLA 4S12A 1PJCA 5JISA 2GFIA 2HLPA 3M34A 5FNVB 1HZJA 4EO4A 1YE5A 2I80A 4DANA 3KKOA 1G66A 3NM6B 2EJCA 1N1MA 4KXQA 4G9BA 1YOVB 2XCIA 5ENZA 4IKEA 5JD4A 2PXHA 4F3KA 5KBYA 1C3LA 2VDNB 4GKAA 5HJ2A 1NBMD 2V8BA 3VX4A 5I7HA 3UFXB 1TPZA 1TMGE 3X1MA 1CRLA 1Q7BA 3IE0A 2M6RA 4R8SA 4LJRA 2HLDD 2QMUA 3HVJA 4S1VA 5LUBA 3ZW9A 2JBAA 5AI0A 3FMOB 3HB9A 3VJKA 4V1CI 1X7XB 4XFJA 4ZEVA 2C5BA 1W73A 2JFHA 1YONA 3LP6A 4PNPA 5JCJD 5A4JA 1N36B 1WCWA 2NMVA 3LA8A 5K0LA 4AVYA 1ETHA 4KUGA 5GIPE 3OE7D 3UM9A 4R01A 5CJJA 4GICA 3MWKA 2IYRA 1EWKA 4IOJA 1XVLA 1SQ0A 2G5CA 5LU8A 5C3UA 4C07A 1E2PA 2O5RA 4MGIR 4E09A 1ZJ5A 2NN3C 3DMDA 4IXMA 2GHQA 4TRRA 1XZGA 4QBKA 4XZ3A 3T4XA 4QE3A 3ZV4A 3P27A 4A8JB 4FONA 3HBFA 2VCEA 1CR2A 5BNFA 5JFGA 1Y6FA 1T3GA 2P5SA 1N2GA 3ZK7A 4RCZA 5M7EA 2BM1A 1WBDA 1GAEO 3FSGD 5C37A 4EZEA 4K6KA 4QNMA 4HAOA 2A9FA 1BG6A 2QQGA 3CRW1 1LEHA 3NHLA 2ALJA 2P6NA 2NXWA 2BMVA 3PQCA 1H5QA 2HH9A 1D3AA 2Y4OA 1R0SA 4FEGA 3TWOA 5HS6A 1JHOA 3AMVA 4QRIA 2QUAA 1WNTA 2JBHA 3DHEA 1GLVA 1N1GA 2GZRA 3BULA 3G8YA 4D4IA 5H1YA 3X1YA 3F5SA 4F4HA 4IS2A 2B83A 1Q2XA 5TQ2A 1NXWA 1E4VA 1B41A 1CY7A 3WRWA 1E2KA 2B4KA 3GMDA 3R44A 1UXHA 2ARKA 2Z4TA 3CZ9A 5EXEA 4B6QA 5AVRA 4Q9AA 4O3MA 1U0FA 4JUIA 4M0DA 1I33A 2H1RA 4MLCA 3EMKA 2AWNA 4NMXB 3U4HA 3IAEA 1IY0A 4MGEA 5DRTA 4ZPJA 3RI3A 2ST1A 2HHLA 3ZE7A 4A0RA 4LF9B 2RGRA 3K70B 1Q16A 4JJEA 5EINA 2YJ5A 2ZJAA 1S2LA 3I3OA 5J59A 3PEEA 5THKA 1ZCBA 4ENPA 1KGSA 1TA0A 3ANLA 1DEOA 1XTQA 2I5PO 1Y7IA 2E4YA 5CA0A 3AVPA 1QFMA 4NICA 1HDIA 3BTUA 4MB0A 3D4BA 3O1IC 4AECA 3ITEA 2ZT8A 3CNQS 3TGPA 1LDYA 1ZUD1 3A6ZA 4P84A 1Y8QA 1K06A 4KGZA 4YT8A 3KTDA 1XDDA 4J16A 4D02A 5L51A 4PSKA 1L2TA 2OXCA 2PIAA 3D31A 4K8RB 3VPDA 3OO0A 3DMYA 5BWOA 4CI0B 1BJRE 2CWWA 4YRKA 2R4TA 2OSVA 5K6TA 4HI0E 1E60A 2MSCB 5JCXA 3RC3A 1HKHA 4YLEA 1HKUA 4M7RA 1XRSB 2OVBA 3PLAE 2B4RO 4B8WA 2WJ6A 2QMQA 6GPBA 4KNVA 2ETVA 4L0QA 3GLHA 4AN1A 4OK3A 1P80A 5GM1A 2YXLA 1ZVQA 5K4HA 3DQPA 2Q28A 1QOPB 4NYIQ 7MHTA 1Y5RA 4EF6A 3B53X 4FI3F 4FSDA 5B1IA 1XGKA 4EFLA 1T25A 2L19A 2RHCA 2HDNB 2IEAA 4B2PA 1Y5IA 4B6OA 4CCYB 2XRZA 1JILA 1MP0A 2NIPA 2Q9CA 3DYBA 4RIHA 3T1NA 3UV6A 1OJ7A 1BW9A 3GDHA 3H2ZA 2C20A 4BJ1A 3PB3A 3C5EA 1C81A 1Z6AA 2QAGA 1SHUX 4C7OA 1DPGA 2Z43A 3HZHA 3RS2A 2Z08A 1KL7A 1SU7A 3F97A 3T3PB 4D8YA 2W2XA 4IL5A 2TECE 2ZBQA 2Y6UA 3HP7A 4AKEA 4XWYA 2QVBA 2O0HA 4XGKA 1KK0A 4RA6A 2ZAYA 4Q1BA 1Y6JA 3HE3A 4MB6A 1F1BA 4LK2A 2AHOA 2A14A 1XEFA 2DECA 1ENYA 4DWOA 4ZYLA 3WNVA 2JH8A 2GQ0A 3L18A 4U7WA 4ZT3A 5DYYA 5U1PA 1U6KA 1VMDA 2LXNA 3NRCA 2BEJA 1BC5A 1L1QA 2YHBA 3R4CA 4JLMA 4P7KA 1YASA 3H2IA 4Q4JB 3K4HA 4KAXA 3ZX5A 5D8DA 3IQZA 1SCAA 3SMQA 1Q95A 2ATCA 5BWMA 5K01A 3P4XA 4CDMA 1KJYA 2BI7A 1HDEA 4IVRA 1YO6A 3NEPX 4CT5A 4TN1A 3EEOA 4BEJA 2NUPB 1TE2A 3Q9LA 4M38A 4D8TA 5HF6A 2DBVO 1QVWA 2VG8A 3PSHA 3SY8A 1T35A 3ZWPA 5J2UF 4MWGA 2I7DA 1C7JA 1NX6A 1VSBA 1GSOA 2ZU6A 3GJSA 3PL1A 4J07A 5CMLA 1FX1A 2ICAA 3A6DA 1O8CA 5ALKA 3E84A 3EAQA 2WB2A 2CNOA 3X2FA 1EB8A 1TFRA 2ODPA 2OP1A 2PWZA 1TQ8A 3A26A 3Q2OA 1RQPA 2PMEA 4EG3A 2OQIA 4ZCLA 3AFNA 5LA6F 1G4AE 1FS6A 2NYVA 1CW2B 4L07A 1RYFA 1X7GA 2IXDA 3KOWA 2GI4A 4UQOA 4WI1A 4ECEA 1TO2E 2BISA 2DCMA 2IP1A 3A2MA 2RCNA 3JYPA 4CLOA 1NBOA 1EDBA 2VDVE 3IALA 5DLQC 2V9ZA 1NN3A 4C3UA 1P0QA 2VQDA 3UWKA 4UD2A 2R86A 1Y5LA 3IJPA 2X4GA 1Y42X 4UD6A 3TR6A 5JAZA 1Q1AA 4CDGA 2AB0A 1ZN9A 1JXAA 5A4KA 2X77A 2C2WA 3O4FA 4HQKA 2BCGY 3HZOA 3HEAA 4OXNA 5HDBB 4MGZR 1I7PA 4PQRA 4WXHA 1OI2A 1KEWA 4L16A 4UBJA 4WECA 5DZSA 1RJWA 2SKCA 3BRSA 4PQGA 2NU8B 4A6EA 3G2PA 3AETB 1PSZA 3G2OA 3HA5A 4TMVA 1DAOA 2V1UA 2PRYA 3EMVA 1RMQA 4O29A 2WKQA 2DBYA 2RCYA 2CW5A 5J2TF 5CGQB 1BE0A 4WLOA 1EG2A 4IDNA 1TAQA 1MPTA 1VBFA 1RI5A 1L5OA 4H4CA 3C14C 3MCWA 3ED1A 2L0XA 4K03A 4B7AA 1XV5A 2V7PA 1CJSA 5DP1A 2RHJA 2YIJA 1JHZA 3D3EA 4QM7A 2PL5A 2FETA 3OM8A 1PT8A 1T5BA 2H4XA 1V6SA 2OC9A 3H2YA 2Q41A 1RAFA 1R10A 2Q5QA 4U7FA 2ZPTX 3X2SA 3JQGB 5G4KA 2ZYVX 1LPNA 4EP1A 3RUPA 4TXNA 5KC9A 2JASA 1LBIA 1M0SA 1ZZEA 4G4SP 5JROA 4JQSA 1F3LA 3LRTA 1I0ZA 1VHQA 5JATA 3H1TA 1MB3A 3I9V6 4FQ7A 3DLAA 2DUJA 1B0PA 1V3UA 3VR5A 4A26A 4EW3A 5L45A 3LC7O 2XOXA 3Q3CA 4HNAB 4L72A 1O94C 4DTCA 1GNQA 1OXXK 4TRJA 3GEIA 1L7EA 3W2IA 1GXSB 3FFWA 1Y1RA 1YNOA 3IBSA 2CB0A 2UZ0A 4GI2A 2Q8PA 3CYFA 4NZNA 5D1NA 4MOWA 4CLRB 1OH7A 3ZLTA 4PX3A 5A06A 1ODKA 3OCYA 3PQEA 4RACA 3SX2A 5H82A 5I7WA 4DC0A 3TUIC 5EMMA 3T7CA 4BLQA 2JK0A 3BE5A 2QTHA 5IN4A 1AZTA 2AX3A 2N0SA 5KQMA 4HNRA 5J4KA 4QAQA 5ES4B 4KN8A 2FLKA 2IYSA 2AUMA 4CL3A 5K0FA 3NR2A 5K4GA 1I36A 2H9IA 2XNDA 4NJOA 5LSAA 1XA4A 2VPWA 3BFKA 2QD2A 4NU5A 2QW8A 1L6RA 2W2TA 5CCXA 2YN2A 1UK9A 1QP8A 3ZZ1A 4CYMA 2DETA 1GRRA 3DMHA 2FRDA 2NNWB 4OHCA 3UBMA 5BUSA 2R4UA 1NN0A 1GTVA 3ZXUB 5FJJA 4Z1MA 5EPEA 3I2IA 1D1PA 4PGFA 3OUZA 3MD0A 3OX3A 3O4JA 1H23A 2D5AA 3D64A 4E5VA 3DZIA 4EYEA 3HUEA 1R12A 1T91A 2VDQB 1IIRA 4H6XA 3PQ7A 5JBNA 2W8ZA 3FCSB 4X20A 2HQBA 3OQOA 2D6FA 3ZXYA 2QIOA 3IKTA 1TU4A 4YJ3B 2NSDA 3FFBA 4M1KA 2QP9X 1YDGA 4KH1A 4AFNA 3VOAA 2Z95A 2GN1A 2NZJA 2XADA 1E58A 2GZMA 4CCSA 3F6RA 4LZAA 1SC1A 1JPNA 4FGWA 1SQSA 3AVUA 2TYSB 4P92A 3AL0C 3KQQA 1C8BA 2C92A 4C3ZA 3DAFA 3GLVA 3CX8A 1W88B 4QWMA 2R7MA 1IOWA 2SBTA 5AW7A 4BFLA 1EFKA 4OJYA 1J8DA 3ZJ4A 2EZ9A 3FPJA 3K2QA 4HDKA 5A4AA 1JIXA 4P53A 1XN4A 4F1KA 1EVIA 2IH2A 3LH5A 5DIFA 1JEYB 2QXYA 2PGAA 5T6BA 3B3AA 1P1HA 2WB4A 3IUNA 5I4BA 1USVA 2WVGA 2XIQA 1D0SA 2HJSA 4QELA 3SC2A 1QVZA 4EYGA 2DWPA 3H8SA 2JAPA 4L7QA 1T6XA 5KOJB 1ACLA 1H2FA 1OUMA 3UWOA 5KHAA 1KQPA 3L5KA 3OMXA 1N0IA 4NCNA 3RDPA 3KEFA 4BBAA 1UXIA 4GOJA 1D8TA 1NYRA 1NM5C 5HF9A 2J1LA 3RHZA 4MVJH 3HMKA 1B8PA 1H2YA 2KYRA 3FCEA 3I9MA 2XT6A 3BA1A 3BH0A 4IG9A 5FWXA 2A1UB 4D9IA 3CG4A 5F3DA 1JI3A 1ZIOA 3DMNA 5ESXA 1KYQA 4HQLA 1SOUA 4KO4S 3T35A 2WYIA 1NUSA 3DEHA 2R44A 1HYHA 1SVSA 3KAKA 3I0MA 4F91B 1NW5A 2OGUA 3QTTA 4N5NA 4V0ME 3TAHA 4IDAA 3T1YB 3VYTB 2P3SA 3VHXA 4CF6A 1E2JA 1K6IA 2UXBB 3G2MA 2GK3A 3B6ZA 3TG2A 4NZZA 3INRA 4KITB 1IY1A 3R3SA 1W49A 1Y33E 3GZJA 4OKIA 3IUQA 3OY7A 3TM5A 5JADA 3U19A 2C5FA 1X39A 5DHRA 2BFBB 4IUDS 3ZTTA 3INTA 1IQPA 4FKBA 1TCAA 5COBA 1EB9A 5AXCA 1D2RA 3EOBI 4JC0A 2BUBA 1LBHA 4YUWA 1AF7A 4UTNA 3A6KA 1SZDA 2CUTA 2PT5A 3R3UA 4K46A 3U60B 1BD4A 1JDZA 4V38A 2QR2A 3VDXA 1LVGA 4QPJC 1U3DA 4B44A 3ZNPA 1A4XA 2HADA 3JASB 3SICE 4URXR 4MPTA 1AD2A 5HWSA 4C0AC 4BU1A 1CUWA 3GQBA 3OBBA 2YS7A 3I6YA 3IMKA 3IP6A 1ZONA 3NFRA 4X6UA 5C81A 3B1FA 4X1IA 4KO2S 3V4RA 4F2GA 1S2NA 3WGOA 1VXOA 1FLAA 3F2IA 3GDGA 2A35A 3LPDA 1Z0KA 5A04A 1AQLA 2G9NA 3KOUA 2DUMA 2R8BA 3IQHX 4QGFA 3LP5A 3V97A 2JD1A 4RSMA 3GUYA 3ZGXA 1QWSA 5KOHB 1ZSYA 3FYSA 3URMA 4ER0A 1KDOA 2JGMA 1DTSA 4R6XA 1P3JA 2B69A 4U9UA 4YCSA 1T8WA 2Q2OA 2X5OA 1F4PA 5ECWA 3SC4A 4PAWA 1N2OA 5C8YA 3JARB 2IHKA 1Y3AA 5LN1A 4JD5A 4WNCA 1P7WA 1QR2A 1UDXA 1XLVA 4QSMA 3EXHB 3O3CA 2DWUA 5BYJA 3U3XA 4A2PA 4DLKA 1NG9A 1UADA 2GN4A 1T8PA 4CQJA 5LP1A 5ADHA 5KX5F 4OOEA 2FWPA 5JU6A 2HRBA 1YVRA 3MVEA 2XCQA 1ZWLA 3BS4A 1RKUA 4IW3B 5CLIA 2HCTA 2E5WA 2A0WA 3WS7A 2O5CA 1FZQA 3OPMA 3UOWA 2ET6A 4LQ4A 2I66A 4R9VA 1YZQA 1SAYA 2G67A 1JG7A 4YALA 5DSTA 2G17A 4YRBA 2C7QA 4MLPA 1DAMA 4C30A 2GCIA 2B20A 5KVQA 3CZQA 5LJIA 1ONPA 4W8OA 5IDQA 4BRWA 4NFLA 3W5BA 1RWMA 2R6FA 3VX3A 4IJ6A 2C0PA 3O4GA 5L7YA 2FTKE 2ZCVA 2A9QA 3PGMA 3C8UA 5EJ7A 3OC6A 4YJ2A 1SZPA 3TCNA 3WRVA 1YFLA 1TI7A 5KU1A 1W0CA 1M6NA 3P0JA 4MCAA 5HE8A 1M34E 3RJZA 2QDXA 3ENWA 4ZHQB 2XVAA 3NJRA 4M1TA 5GJVC 4AJEA 4YLGA 3EXAA 5LMCA 4L5YA 4ROTA 1PWXA 3VKVA 4O6VA 1LRJA 4QUIA 4ZVUA 4LXXA 4RHUA 3WJ1A 5A7FA 2P62A 5JSZB 3RB8A 3WL6A 1PEDA 2GCEA 1RI3A 3HDYA 1I3CA 3HR8A 4W1PA 2GTHA 2VL7A 4C0LA 4WWHA 1DC6A 1G5QA 1KQOA 4BCBA 1EFHA 4JP2A 4DOMA 2G63A 2H17A 1DJQA 1QHYA 3IQXA 4JR0A 4JGGA 3NDJA 4WKGA 4MHOA 2VJKA 4HVCA 1UFVA 3ME5A 4BO8A 1PL7A 1CE8A 3FTEA 3RREA 1QDLB 3I04A 3MM4A 3KYCB 3UJ7A 4EJSB 2AZMA 1GZ3A 5HJEA 2O7RA 1S5PA 5HUJA 5I4IA 4R1MA 1OU0A 3MJFA 4URFA 3PSAA 4DY6A 4GM4A 3M6WA 2NO4A 1L9KA 2AOWA 4JCOA 2WHYA 3DKKA 4LSZA 1T9HA 3B1XA 4N12A 2XECA 3TMYA 1G63A 5JQWA 5GOZA 1GSAA 5EQJB 3U56A 1THMA 1XYYA 3FOAA 3F74A 4F8JA 4LNHA 3K1YA 1T13A 4TWRA 1R0ZA 3NS7A 4UUOA 2VXYA 2VWQA 1GRCA 1A9QA 2NTYC 3EIOA 4KQIA 4XW2A 3R7FA 1DHRA 3MMSA 3G17A 4ZZ2A 3LY7A 1M2EA 4IRXA 2DUNA 4QICA 3OIWA 2PBRA 3GLHE 2WWYA 1ODJA 2C3UA 3BMCB 3DHNA 3QKRA 2C77A 2DFVA 4LVUA 4NJMA 5EJGA 1BIFA 1P4GA 1TYZA 1KA9H 2MT9A 3RBXA 4YFYA 4LRSB 3VSDA 2V6GA 2YWRA 3VVLA 2XYQA 2R5WA 3U1VA 2C5AA 3J7AC 1C0PA 4G07A 4KXLA 3BWBA 1SH7A 4Y1FA 2Q3DA 3DDNA 4EUEA 1B93A 2IXFA 4NV3A 4XSVA 3KE8A 2AN9A 2VP2A 3KOMA 1KH1A 3COSA 2BM9A 4YI3A 3N0TA 3AGQA 4YP1A 3RFUA 3TB6A 2J4FA 4AJPA 2VK2A 4HAUA 4LV6A 1B14A 4ZCQA 3IBCA 5H80A 2X0FA 4BVBA 3OJXA 3NTXA 1N8TA 5LLDA 2WWVD 4O5AA 2O0MA 5EJAA 1CU1A 4FNAA 4MVJI 3JRWA 2WWWA 2XW6A 4R4JA 3RYFB 1YQTA 3TMKA 4N8DA 4C7JA 4F4IA 4DZZA 4UDYX 1CUCA 1EM6A 1OXSC 2E4UA 1BE8A 2AZXA 4PYLA 1FP1D 1EP9A 1JLHA 3LTNC 3L92A 1YC2A 1PNOA 4PGMA 1M5TA 4NOLA 3VR3A 1LF5A 2M2IA 2X4DA 1Z5NA 1RZUA 3HVHA 3JATA 4BTLA 5JC8A 3EPHA 3VBCA 3C5HA 2PLAA 2OEPA 3E1GA 3OHSX 5LQRA 4BPRA 4Y30A 4YRTA 3KXIA 2H54A 5K3BA 3SE7A 1Q57A 1CNMA 4OFBA 4AIIA 1SJ9A 4ARCA 1IEVA 4HS4A 4XUGB 4NH0A 3PQ4A 2AKYA 2F00A 2OA0A 4LV5B 4XIJA 1E9RA 3FFXA 4IMJB 4LA4A 3V5NA 1QDEA 4HG2A 1CJVC 4AI6A 4FOLA 4LC9A 1ZQ1A 3K0FB 2A7XA 3UAZA 2MMCA 1YFZA 3QXCA 4GZLA 1I1OA 4IXWA 2YWCA 3T41A 4A6DA 4EZBA 1U2RA 3ADPA 5CBPA 3WL5A 1OI4A 3DVQX 4U00A 2OG1A 1KEVA 1V6AA 3ABRB 3U44A 2B0JA 5EIBD 3A14A 1PZMA 5F77A 3UMGA 1GZ4A 1T0IA 5FLKA 3PHHA 3B9PA 2XMQA 1G2QA 1ZG3A 4M9ZA 4M0MA 4B3DA 4CCAA 3IP5A 1NSFA 3PKZA 3GEMA 2B6HA 1OBHA 5CB4B 4IH9A 4HB0A 5TX7A 3ERCA 3EISA 1UC4B 4OHMA 4DEVA 1JMVA 5EERA 4W9NC 2QVCA 5F64A 4GVPA 4EB3A 4M53A 1M6VB 4L22A 1EVEA 1NT2A 3SX0A 2ATXA 4KBFA 3QG5A 1YJ5A 3OEED 2ID9A 221PA 4BVFA 1LNSA 3D54D 3ODPA 3BM5A 3QLEA 2VUHB 1QAOA 1NLMA 2R00A 1LI4A 4FMPA 4HQ0A 5FB3A 4C4ZA 3NKLA 1UMBB 4ILEA 4KLNA 4NEQA 1F7UA 2PU5A 3FCXA 1L4BA 2WTNA 2FR1A 3FPHA 2PXAA 3RHSA 1W9HA 3UHAA 4CLDA 2WFMA 5DT9A 5JV5A 4OBXA 1LLFA 1INLA 3KOXA 1TOAA 3PGVA 1EI9A 4KE8A 1G7SA 4FD2A 1ZD3A 3NPAA 4Z0NA 4GEGA 5AVSA 2IW3A 2X6QA 5E9WA 4RL4A 2GJ8A 1UWLA 3T0FA 1LV7A 1SUPA 3HJHA 3MMPA 5AJTA 3K20A 1T26A 4ZOAA 4C6HA 4WSOA 2VC2B 4DV1B 4EKDA 3IUYA 1FLNA 1VKZA 2HJWA 4OG2A 4R16A 3SP1A 3ZDRA 3Q0EA 1JAZA 5THQA 1RI1A 2ZTLA 6CHYA 4B7XA 3ANYB 1EZZA 3DMPA 3O5AA 3VH1A 2JGIA 1RQ2A 2OZLB 2FFQA 4OXYA 4CRWB 3HJAA 4RKRA 1KI2A 4DCPA 2BTQB 3QVOA 1EMDA 1PJ3A 3PC4A 3ML1A 1T2FA 4A1FA 3IPLA 3QH4A 1IB6A 1UKVY 5B58T 1HFEL 2QRKA 2VEDA 3BWMA 5ALTA 2JEOA 3M4JA 1M2OA 4OU4A 1YAJA 1A71A 4NCXA 5LQJA 2H16A 3O4VA 2WYOA 2HGZA 1WUJS 1DRUA 4LMRA 1R0BA 2Y68A 3RAFC 4DA4A 1D2EA 1EDEA 1UBKS 4GR4A 1QB8A 1NC3A 4P98A 3VISA 1CZUA 2P67A 1LSOA 3GEEA 3I6MA 4RVOA 2JJMA 4BNHA 5LM3A 2GM4A 1YHZA 3TBKA 3PT5A 1DEHA 1XD2B 2D2EA 2CUNA 4NJEA 4TYMA 1M7GA 2XX3A 4XGQA 3VTAA 2HWKA 1DINA 8ADHA 3WGIA 3PEWA 1T8RA 2IK8A 4C6SA 1C9KA 1MN6A 2BHNA 4E70A 5JBQA 1YS6A 4HXFB 1RJEA 4WASA 2XGOA 4MEAA 3EHEA 2PEZA 4I99A 3UPUA 2G8NA 4FI3C 4Q05A 2ANCA 1GDHA 1GGJA 5EZQA 4BEBA 1QS0B 4Z8XA 3AUXA 4Z5XA 3K0AB 3WY9A 4B0PA 5HCUA 3OQIB 3KSBC 3ORFA 3PRKE 3VGJA 1PWHA 3ELBA 2VUIB 4Q9DA 1ZBDA 4LKRA 2ZUDA 2QE7D 4OP3A 5JS6A 1XMOB 2I29A 4K26A 2DWOA 2MINB 1D6JA 2GEDA 1XT6A 1ZH2A 2VOJA 3BF7A 2FMKA 2VYFA 1CD5A 1L7QA 1MJFA 2JFYA 2EX1A 2QG9A 3FMGA 1WDLA 4NENA 1QRSA 3PC8A 3LLCA 4WNAA 1W94A 2C3OA 3F4LA 4Q02A 2BGTA 3OWHA 3EY4A 5SY9A 3RAJA 2C7GA 2FW9A 4JOQA 2QTCA 3I92A 1C8LA 3HJGA 5K3OA 1XCBA 4P7FA 2Z8YA 3MJRA 3Q41A 3F9IA 3T9AA 1I3MA 2JH3A 4X61A 1HNZB 1NW7A 3G6KA 2B1GA 3E61A 1T3HA 4TWZA 4ZO9A 4OUDB 5F21A 5IANA 1PFUA 2GDJA 4N0MA 5B1DA 2ZR8A 4K88A 3IRVA 1NJ2A 2AWOA 1N78A 1DRJA 1Q3HA 1MB2A 1TQ4A 3DKIA 5AVVA 3DMGA 2BEUB 4PLWA 4X71A 3MLBA 2I55A 4KU4A 1GGFA 1LJ8A 5BWLA 4ZJUA 3CXUA 3JAKB 3OZXA 4HEJA 5GIOE 2H0AA 4GXTA 1MX9A 4XOUA 1QGDA 4ZZIA 3AEKB 2NW6A 4L6AA 4RKWA 2BTOA 3PWSA 3TZLA 1SULA 2OFFA 4ALIA 4B7UA 1ZMOA 2J3QA 2HJVA 2OHFA 4G1FA 3KJQA 2NU6B 3A6PC 1W47A 1EK5A 3JQ6A 3MOSA 5L95A 4TXLA 4MRAA 3RARA 1QRUA 2IHNA 2Z58A 2OXRA 1ZUNB 3DEIA 1LV8A 2XUHA 1OFHA 3U2QA 3ODGA 2JCBA 4WCDA 1TZJA 4XASA 1LLDA 4Y0NA 4OFXA 3COPA 4ZEOA 1UZNA 5GONF 3DV2A 3I8XA 4ARUA 3BTSA 1NKVA 3QWHA 1E69A 4I1PA 1TF5A 1T0JB 4XARA 4PAQA 1W5BA 1H2HA 4RHEA 3ZG6A 4CMKA 3S4YA 4YRLA 3DEFA 3H6GA 2ZRKA 2RH5A 1WR8A 4QC2A 4RD6A 1H93A 3QPWA 4TL6A 1WMAA 1AKMA 4Q3AA 3CQ9A 4RAOA 1QP7A 3VDRA 5AW1A 2PUEA 1GL7A 1I4DD 2EF0A 4EYSA 2BZ0A 3M33A 4CIXA 4DV2B 1IE3A 3BGSA 2I0FA 3RWMB 1M74A 2EBHX 3EOZA 3I01A 4BO1A 2H7XA 1VKNA 3I2HA 5FFMA 1ECLA 2ZRNA 1ZK3A 3WDKA 1PWEA 1FSFA 3C6YA 3IVXA 5EA2A 3V2UA 2ZK7A 2FP3A 5LD2C 4F2HA 1ILWA 2BRUC 2XB9A 1KJIA 1RKVA 2B7BA 3FMFA 1NVGA 4IFEA 3FDXA 4L78A 5IAEA 1ES9A 1OV4A 1PS0A 2UVDA 1H66A 2WKSA 1GU0A 4MV8A 3U26A 5B2FA 3B60A 1OPRA 4PBTA 2EFJA 3L4BC 1E7MA 5SV2A 1YCDA 5TMBA 3AKZA 1KVQA 1Z74A 3V55A 5CHEA 2GB4A 4DUGD 5KYVA 3WLHA 2PFSA 4ZYUA 2GXSA 2FEAA 1ISJA 1XI2A 3C43A 4MW0A 3EQ2A 5CYGA 2CXTA 4XX0A 1EX1A 1EEXB 2VJMB 5L4LA 4GPIB 5AVZA 1WB6A 4QFDA 1ID8A 3PD1A 2A5FA 4LPSA 4M89A 5ILOA 4ACBA 1Y5MA 3DOHA 3KKLA 4ZVNA 3FI0A 4NYJR 1GZ7A 3WK6A 4KRFA 5NULA 4RULA 2E55A 3JQ9C 1Z2EA 1V8ZA 2HJHA 3RS3A 4FLFA 3MN1A 2E6KA 5KYWA 1ZC4A 1GITA 4L6CA 4RF3A 1FQJA 3CJQA 5AXBA 4YQEA 4RA9B 1QF7A 3ESBA 3CW8X 1AXRA 1CUIA 1DQNA 4ZA2A 3U3OA 4V0LA 1Q5PA 1HDOA 2SKDA 2Z9BA 1VB3A 3CO0S 4KUEA 3CW9A 5KOYA 1NLFA 1ZK1A 2KSQA 3O2NA 1K4YA 2ZIXA 3HEMA 5FBQB 5HIKA 1GDTA 1M1YE 2H85A 5GGYA 5JC1A 3VU8A 4AROA 4U2EA 5TEVA 3GLFE 5IDXA 3ZGZA 1KS2A 2CSXA 5H68A 2YXEA 1EGVB 1VHWA 2WR8A 2VH5R 3KQYA 3WL4A 4JBIA 2FZEA 2B1QA 1YS4A 2DJIA 9ATCA 2VDWB 3C1OA 1JSRA 4XSHA 3L7OA 3O1LA 4P7BA 4EITA 3L0OA 4GYJA 3SQWA 4WJKB 4BO5A 4U7PB 3A25A 5LKRA 2JJ8A 3N2KA 1ZIDA 1WNFA 2QJOA 4DE5A 2QX8A 4K9DA 3HLTA 4FMDB 1Y8RB 1EQAA 1T36B 3L41A 1GQSA 2QPAA 1Q21A 4JC4A 2PG3A 1YQWA 1J06A 1OASA 3GT7A 4DMMA 1WUIS 3T3OA 1U02A 3BGVA 4XDHA 2ZIGA 1E94E 1NMXA 3QFTA 1QP4A 4RV4A 2OBFA 3ZZNA 1QIIA 1UDWA 3A6GA 3IXQA 1I7NA 3IPAA 1U8CB 5DP2A 1RQGA 2OCKA 5DHSA 1T2UA 3R1IA 1FFBA 1GPYA 1ZL2A 1K6XA 3KQVA 1K8RA 5HCNA 3RYIB 3BE8A 2J0SA 2X8BA 2RGAA 1GGEA 3HVIA 4N82A 4QXRA 2ETXA 4RZUA 3UMRA 5L6MB 1W5TA 1FMCA 3EARA 1SC4A 3B5IA 1H3FA 3NORA 2RI6A 3P4YA 2H7CA 3QVGB 5F78A 3NATA 1FFGA 4B3IA 1FVHA 1SOWA 3FWZA 1VZ2A 1JHXA 3E22B 4R1SA 1RWPA 3OZSA 3UJ9A 3W1VA 5TGZA 5AK3A 5DHAA 3CVXA 1TK2A 3NXSA 3WQRA 4F92B 1AK9A 4R8VA 2AFIE 3GJ5A 3EZGA 1O5IA 5EOVA 2NZXA 3HDTA 4UDXX 3I5XA 4BPBA 3EXFA 1ZA2A 1KOFA 3MGKA 5DWDA 4BB0A 4XB1A 5BW5A 5JZVA 3FTFA 3DF9A 3WADA 3HY6A 3ZJVA 1O8BA 1HURA 1U90A 3OFVA 4HDCA 2CL5A 4O4IB 5KWJA 1MRNA 2P4EA 3C3AA 4ZQIA 2FQ1A 2PWPA 3IJRA 1DEKA 3MQ2A 1NM5A 4ZDIA 4M2LA 1DEXA 2DERA 3W04A 5J3JA 1P1FA 2GERA 1N6HA 4DDMA 4PU0A 4HADA 4O4HA 4GQIA 3ER6A 3DB1A 3T9BA 1GFWA 4RVHA 1X1QA 2IHZA 4MUIA 3M83A 5K9ZA 1SQGA 3I5UA 2XA9A 5HIIA 1KYVA 4NXNB 1E1CB 3RT7A 3QNMA 3ZHCA 5F9FA 2Q1SA 2V1XA 2WI8A 3D1LA 4ZCRA 3AR4A 4XPIB 2W98A 2R9VA 3AM5A 1Z5VA 4L1KA 4UNRA 2DWQA 1JKMA 2VHEA 3DGFC 3H84A 3M6AA 3KDAA 4IGIA 4PSDA 2NX2A 2FCRA 3C5CA 3N8HA 4TKVB 3T99A 4N6NA 5DGXA 4IIEA 3H8VA 5JPCA 3GZNB 1A1VA 4FDVA 3HFGA 1N4DA 4I8XA 3PZRA 2QMZA 2IEYA 3F0TA 4GMDA 5T6MA 1DZIA 4DIEA 2TSYB 3BK7A 1MIOB 3OQ6A 5BV8A 3L6DA 5L7WA 1ZJZA 3TRDA 2BHSA 2WWHA 3IQWA 4L50A 4F12A 5M29A 4K86A 2G76A 2GAIA 3EA4A 1ZJ4A 2XKBA 4IUCS 1GQOA 5H4HA 2FA9A 2ENUA 2ID4A 4NS4A 4YAKA 1JPUA 1M2WA 1JLRA 3NT2A 3ANTA 2PD6A 2ZIFA 1DADA 4MYTA 3EFOA 5A2QA 1CF2O 3BZUA 3RFVA 3EQ7A 5EJ6A 2BDUA 4ZAGA 3EVEA 1SUAA 5B3LA 3AP2A 4RESA 1FDUA 5ENVA 4H17A 4CR7A 1UODA 5FV7A 3GRPA 5I4CA 1BCRA 2H5EA 3TCKA 1BMFA 4LRTB 1MV5A 3M3DA 3C3CA 3IP3A 3TGWA 1R4NB 7REQB 5DBEX 1EJBA 2BFCB 2HC9A 4PYMA 4BV8A 4BQIA 5JECA 2XNDD 3VNAA 1VL8A 2XCTB 4KOEC 5HF8A 3D5QA 5CNKA 4JBHA 4M1QA 4UASA 4FYXA 2E9SA 1RJ9A 2Y9MB 2TMYA 2FRVA 3GV0A 4KB5A 1QBKC 4UVHA 1ACMA 4BMDA 2XUOA 4JLBA 3ZPXA 1O6ZA 1VBKA 3R40A 2D4HA 1EFUA 1X74A 1LU9A 2FPLA 4CV1A 1Z5WA 4OMDA 5LL6P 4UU8A 5DM1A 3RUIA 2R7NA 2X0KA 2WIGA 3UAYA 4QG3A 1FX0B 5KINB 1U1FA 1M1ZA 4KXVA 4CKBB 2E1RA 1M6HA 1EE9A 3LQYA 3H9BA 4K3UA 2ZYTX 1G9XA 4OSEA 4AKIA 1FFYA 5F5LA 4PLYA 3RLIA 1R0WA 2ACWA 3UB2A 5FV4A 5DFAA 5KAPA 1N2IA 2ZIWB 3DFZA 3IODA 1R3UA 3R0VA 1CY0A 1U0BB 3A7DA 4Z9FA 1V6CA 1W5EA 2ZI6A 1YDWA 2YIMA 1JHQA 4N01A 1Z17A 4EB6A 2QB5A 1AKUA 1E6CA 1VJ1A 5TQ0A 1L5NA 4JSTA 2IPMA 1JQLB 3TRHA 3F6CA 3PR2B 2NSLA 4OCZA 5TEWA 2RARA 1AMUA 3ZWMA 1JZQA 4NOJA 1SKUA 3ESQA 2OV1A 1V16B 1AGYA 2NUAA 2ZSAA 4PG8A 3KZOA 2AI2A 1GTG1 1V4NA 1VIYA 3EDCA 4OTZA 4UU7A 2WM9B 3GLSA 4CMIB 3QBDA 4UM7A 4E7OA 1VIMA 3BD9A 3GEBA 3W4JA 4HWRA 5B6IA 1E2BA 2PJRA 3P26A 2E18A 5ALVA 3DEKA 2ZAMA 2IPAB 2NQTA 4KL8S 5E1MA 1N2HA 3QVXA 1LSUA 5CEJA