2WWMD

Crystal structure of the titin m10-obscurin like 1 ig complex in space group p1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
100
Chain Sequence
b'SRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBSCURIN-LIKE PROTEIN 1
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
total genus 18
structure length 100
sequence length 100
chains with identical sequence T
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wwmD00
4MD0A 5LJYH 1M4KA 5E94B 4FZEH 4LP5A 2BNRD 5JQ6L 1OAYL 5DJXB 5IK3B 1JPST 5ISZA 3O4OB 4JHAL 3VWJD 2Y5TA 3ZKXB 2WUCL 1BFSA 1P2CB 1LDSA 4ISVA 5DJ8A 5C07A 3V4UH 4GXUM 2C3XA 1F11B 1HHJB 3K74B 5DUPH 5F1IA 2MKWA 4G80B 4LVOB 2BSRA 2QQKL 4TULL 3WNPA 1CE1H 5I15H 5IBTH 1NDMA 5C6PB 1HQRB 2ADGA 5EWIH 2H9GA 4WI8A 1T7YA 3T65B 1S7XB 3NH7H 3KPPA 4KJWD 5JQ6H 2QR0A 4KDWA 4QY8A 5DJDB 5HVGB 1VFBA 4YXLL 3VRIB 5D6DA 4NBXB 3UTTA 3OAZH 1N0XL 1X5JA 4P2QA 1EEUA 3GHBL 2F53B 4JRYD 3ILQD 3ROLA 4K94C 1PJ9A 3EO0A 4XVTH 3HPJB 1G9NL 1RIVL 2ESVA 2QADD 3MGOA 3MNWA 4ETYA 3SGKA 1K2DB 5J4MA 1GGIL 4FQ1L 3GJFA 4YK4C 3E3QC 4NQDE 2FO4B 4RFOL 1IGIH 4HC1L 3DX7B 1CFVL 4NM8H 4WV1B 1N2RB 4ZUVB 1BQHA 4YDKL 4MXWL 4KI5C 2CLZA 3S4SB 3SDAC 4M8QA 1G6RB 4GS7C 3WIFB 1MNUL 2HVJB 4JRXB 5DZLA 3F6IA 3PDDA 3STBA 3AU1B 4KRPC 1GGIH 4YAQA 1ZGLA 1QTYT 2X09A 4RZCA 3VE0A 1U58A 3L5WA 4RFOH 3RZWA 3STZA 4G6KL 4NBYB 3KPRB 5CP3H 1PKQA 1ZAGA 3GMOA 1FFRA 3GI9L 1BZ7B 5I17A 3H9SE 4W6WB 3GGWB 3O11A 1YY8A 1WCBA 3VW3H 3E0GA 2K9UA 3CZFB 5HHNB 4RRPG 5E1HB 2DJ4A 4ZO8A 2XZQH 1GL4B 2HJLB 3VXQA 5CIPA 3RNKA 4MVBD 1N6UA 4UAOB 4P23D 2W07A 3RAJL 1KEGL 5BV7C 5SWSD 1XCQB 3F65A 4MD5A 2HRPL 5F3HB 3GI9H 4U0RB 1UKSA 4TUJB 2FRGP 3UTQB 3DBXA 4NP4H 1YPZF 1EXUA 1C1EL 1YYLH 5E6ZA 4ZXBB 4ALAL 2UZIL 2A77L 4U6VL 3OJDB 3CX2A 4ELMB 1TVHA 2O5YH 5HI5D 1VERA 3KVQA 3AB0B 3IDMA 2Z35A 2FJFB 4NC0B 2HRPH 4HZLA 4DK6A 3RWHB 4H26B 1F8TL 2IANA 4N8CL 1ORQB 4J8RA 2YD5A 3WKNA 3FN3A 4G43A 1I7RB 5B39A 1JZ5A 1RZ8B 3ARDC 2KBGA 1YPZE 4XPFL 4MAYA 1AE6L 3D87B 3GMMA 3GSWB 5ILTL 1MUJB 4OF8A 5MP6L 3QI9D 5FUCC 2R1WB 5EH1A 2WBJB 3LRHA 1T5XB 2OXHA 1F8TH 5CJOL 5CAYB 1DUYA 3SDXA 5EA0L 2IPUG 4D0BA 2XZAL 1YEHL 2A6JB 4HCRH 5GS2H 4GRLC 2MHAB 4ZFFB 2BSTA 3FO1B 1M7XA 4XPFH 1KB5L 1AE6H 4DKDC 2Q20A 2PW1B 4LLUB 5DRZA 5ILTH 4OM0L 2QHRH 4PUBL 4UIMB 1DBBH 1JHLH 1FSKB 2BRRL 2IH1B 3T08A 3MFGB 3S36H 1EVTC 1MF2L 2FZ3A 4B7LA 4FQIL 3EOYG 5IW1A 4O5LH 3C8DA 4W4OC 4IMKC 2XZAH 1YEHH 1MCNA 1I8KA 5ESVB 4TNWK 3UPRB 3MJ8B 1AJ7L 1PYWA 1KB5H 4YHOL 3RWDA 5IGXH 4DAGL 5I1JL 4H8WH 5KZCB 5L2JA 1IT9L 4BZ1H 3KXFB 5DQDL 4XBGA 1EO8H 3CFBA 3HE7A 1KNOB 1GZQA 3O8XB 3VD9A 1C5CL 1YNKH 1MF2H 3BUTA 5FOBA 3THML 4FQIH 1NCDH 2OL3A 3FFCB 3P30L 2AV1A 4D8PA 3C60B 4IMLB 3QJHB 5I73C 4DCQB 2BXZA 1OSPL 1AJ7H 2X1OA 3BHBA 5EC1B 4NFBA 4DAGH 1MLCA 5I1JH 4FZ8H 1NKOA 2BNRA 5DZNA 5CSZA 1T21A 5I0DA 4KC3B 3BUYB 4N9OB 4UILL 3TBTA 3OBAA 5C0GB 3BWAB 1C5CH 1QSFB 3B2UC 2E6PA 3QIBC 3WSQL 1KJ3H 1OGAE 3P30H 3BZ4A 2OR9H 1W72B 3VGAB 2COQA 1JPGA 4Q0XL 4Z6AT 5HBBA 4WFHE 1X5KA 2L4OA 4HBCL 2YSSB 3RL2A 4F9PA 3TZVD 1BVKB 1VACA 3OKMB 3DGGB 4HGMA 5DEGA 4MXVF 4NRYB 3LKOB 1F4XH 4G5ZH 2GT9A 4F7CA 1AR1C 4UILH 5A2IH 1HHHB 3OKOB 3JV6B 4U2ZA 2Q8AH 4CN4A 5LCVL 5T5NF 3WSQH 2X4PB 5BMFL 4TRPH 1YEJH 4Q0XH 4JRYA 4TVPL 4HBCH 2ZPKL 1ZT4B 4XRCB 2CLRB 1A1OB 1HHGB 3CK0H 4PRIB 4ZPTA 2ZUTA 1UVQB 5FHBH 4RGNE 3MX0A 1WFTA 5E7BA 4F37K 3F12A 3T2NH 4I0PC 4X6DB 4MXVE 3HB3C 1UKTA 4XVSL 5HYJD 4ZO7A 4IOSD 5DRWB 3IFLH 5BMFH 4BSWB 1B90A 5I75C 2ZPKH 3QUML 1M05B 1KCSL 1S7UB 4Y16C 3TT1L 5JW3H 3CU7A 4KRPD 1LILA 1A4JB 2VJXA 1BVLA 3NABL 5DR5H 1PFCA 3T0AA 4IS6A 4OZFG 1EERB 4NBZB 1FBIL 3SKOB 5KW9H 1T1ZB 3RTQB 1U3HB 1QG3A 5CEYB 4EVNB 2Z8RA 5C6TL 1HILB 4S10A 2P49B 2ZUUA 4PPTA 3EAKA 3L5IA 3QUMH 5JW5B 3WDJA 1GAFL 3ARED 1S5HB 5FF6B 5LG1A 3CUPB 4IJ3C 3RWIB 5GGVL 1MQKH 2FEDC 2B7DT 3IS1X 4IOFC 5EORL 5J9PA 3VFTB 3BRFA 1N64L 1OM3H 3QG7L 5SWSA 1FBIH 1JYNA 1I1AB 3AMLA 2GSGB 3UTZA 2Y06L 1JYWA 1YEEL 3ET9F 4ENEC 4MJIB 1OAUL 3MLSL 3GMNA 1FZKB 1O7SA 5E4EC 4ZAKB 2E7HA 4MNQE 2YD2A 4Z7VF 5TE7H 2DL9A 3W39A 4L4TA 4UT9H 3VGGA 1E4XI 4PJ8C 5EORH 2ED7A 5TDPA 1N64H 1XF3A 1GGBL 2H8PA 5E8NA 1HWGB 5E2VL 3U36B 1CT8A 4ERSL 2XXCB 1UENA 5DJ0A 5DJ6B 2Y06H 3IDYC 2GJZA 4Y0GA 1OAUH 3MLSH 4YO0A 1VKXB 2VABA 2E7CA 2YA1A 3ARDD 5H37H 1MCLA 4JB9L 5CWSA 2DJUA 2FB4H 4FXKA 4LF3A 4Z7VE 3T1FB 3RNQA 1U36A 2QJDA 1WIOA 4POZC 3OKDB 4R4BA 5E2VH 4ZG1A 2HJKA 3QI9A 5I1EL 1XIWA 2XWBB 4GAJL 4KUZH 3C9NB 4M43L 1CL7H 3OXRB 4PJEB 4OCYH 3MRHA 4JDZA 2R69L 4CN1A 1N26A 4GRLD 4KK8C 1I1RA 3BGMA 3LDBB 5JIKA 5E2UH 3MRIA 3U9PL 4DZBA 1YNLH 2PF6A 2FHFA 5BW7C 1QBBA 1FH5L 3K2UH 5BJTB 1ZANH 3PGDB 3RVXC 4M43H 4AQOA 1S5IL 4MGXA 1CGVA 1U95A 1W2KT 1IGML 5IG7A 1R3JA 1A0QH 2R69H 5IOPB 3PL6C 5C7XL 3TGXA 2AEQH 3MO1B 1LNUA 1KN2H 3B9VA 2UZXB 1EAJA 4JPKH 3QULB 3QB7C 1VESA 4H25B 5I8CB 3MRNA 4N0YH 1PZ5B 3ZTJG 2N4IA 4PJ5D 3O2DH 3A6CH 4X5WB 1FH5H 4JPWL 4NRXB 4X83A 3KWWB 5LQBL 1P7QB 1TJHH 3KYAA 1S5IH 1DJSA 1VFAB 5EZIH 3KR3L 4M61A 1UZ8A 3QHTC 2DN7A 5HXMA 3B5TA 2R2BB 1MCQA 3HZKB 5T3ZH 4HAFA 3LQZA 3N9GH 2Y07L 3GUTA 4F8TA 3D0VB 3MLYH 1Z0MA 1SHMA 2VLME 2I9TA 1ETZB 4G8GD 4HGKC 4JPWH 4R2GC 3D18B 2P5ED 5IW6A 3CFEB 5CZVL 4JLRA 2NCMA 3B2UD 3QIBD 1C5DB 2AABH 4PRDA 4G9DA 1N3NB 5J3HC 2OTUA 4MCZA 5K9KA 2XTJC 4F9LC 2CDFA 4QRQB 4OF7A 2Y07H 2FX9L 3TZVA 2YK1L 4XMPL 3RX5A 1BD2B 1TVDA 4PY8I 1NC2B 3RZCC 4XP1L 3WFZA 4QOKD 1JRHI 5HGHB 3MJ9L 4MQ7B 1R5WA 4NGHL 5CZVH 2R8SL 4LSVL 3VXRD 3VXSE 5ITBH 2DQJL 1G7MA 2XTLA 5BCAA 5C0BE 1G7PB 3GBNH 2C1OA 1I7TB 4L8BB 3VXUE 4HV8A 3BP6A 2GEEA 2NTFA 2YC1A 4PR5B 3L5XH 5D7JB 1SVZA 5JR1L 3H7BA 3A6OA 3U46A 3VFWA 1SYVB 3HUJA 4RX4D 4I0PD 3MJ9H 4AMKH 5D7LD 1OAQL 3HB3D 5DVOA 1LQSR 2CXGA 5I66B 5T5FL 3QO0B 5K9JL 1F45A 2UWEB 4JFYB 5HYJA 2D7QA 1EEYA 1U8NA 4PJHF 4Z77B 2FECL 1T22A 5IMLB 1I7UB 4ONGH 3GNMH 2IH3A 3FONA 4NQSB 3ULUH 3RVWD 1YMMB 3V9FA 3BH9B 5JR1H 4Y16D 4JFDB 3LSOA 1MCDA 4FXGA 4PY8J 4XC1H 2Z8SA 1BLNA 1F3JB 3E6FA 2UY6A 1D5ZB 1TETL 1IGJA 8FABA 5K9JH 3QNZA 4MQXC 5IFHH 4G42B 3V7MA 1D7FA 4ONOA 2N1KA 4KKCC 3D25B 4H88L 4MWFA 4PJHE 4OCSL 9CGTA 2OSLA 4JAMA 1EH9A 4DVBB 4PJ7B 3AREA 1Q0YH 2YEZB 3BP5A 3IDGA 1NFKA 2FEDD 2C9AA 3EOBA 4XP4H 3P9MB 4HS3A 5A2LH 5C2BL 5EPMA 1KELL 2ZZUT 1P4IL 3RWJB 2HFGH 1RPQA 2ATKB 3SGEI 1Q94B 5HHPA 2EDJA 4FFZL 4PJDA 3ARQA 1NSNL 3P4MB 2A83B 4H88H 4DKEH 2FYYA 3HMWL 2E27L 4OD1L 4YDJA 1G7JB 1M71B 1FZMB 4OCSH 4UBDC 4U3CA 1NLDH 1AP2B 4FFVC 4K8RL 2X2YA 3QUZC 1KN4L 5FK9B 4JFEA 3BZEB 5C2BH 3MUZ1 4U2YA 4FFZH 1TJGL 4EKXA 1CI5A 4MS8C 3HMWH 1PZUB 4O2FA 5C92A 3BAEL 3UBXB 4Z7WF 1OP3K 5I1KH 4N68A 4M7LL 5GGSB 2I9LA 1DL7L 1KN4H 3FHQA 1FNAA 2J2ZA 1JTPA 4XMLH 3BRDA 4GFTB 1MCJA 2BOBB 2P7TB 4UIKL 5T1DH 5BQ7B 2JIXD 5T1KB 4I3RL 5MEND 5FGCB 3T0EB 4PGZA 3RX7A 3RFZC 4Y8DC 4NQXA 3RWEB 2X5PA 2ADIA 4U1KA 3GSXA 1NUFA 4IBLT 3WHXB 5B38B 1QBAA 3K4ZA 3EKCA 3BAEH 4KK8D 5GS1C 3IVKB 5EOCL 2WQRA 3RY5A 4NNYB 3EYOA 5HHOA 3G5ZB 5C0JB 4Z7WE 2W9EL 1DVFD 5DLMH 4XNMB 1SEQL 3QDMA 1D5IH 2ZSWB 1MJJB 2HJFB 2IPKB 4JHBA 2VZOA 2W9DL 1HN1A 5ID1A 3RVXD 3NBNA 4KMTH 4I3RH 5IBUG 3ROOA 1BM3L 1QA9A 2GTWB 2GTZB 2IBZX 3C2SA 5DD1L 3W9EA 3PL6D 3HLAA 2A38A 1R0AL 4W4OA 4IMKA 4PRNB 5EOCH 1QPXA 2OI9C 1L7TH 1JN6A 2ITDB 1O0VA 3W82A 4V2CB 2W9EH 5SV3A 1IL1B 4PJ5A 5JUEL 3WFHA 4W68A 5GRJH 3DROB 1G7LA 4M7KL 1ED3A 1CXFA 3GIZH 5JMRA 1HXMA 4XCNB 3BKML 2P45B 1A6WL 2BRQA 1X5GA 5F96H 2DDQL 2GSIB 3KDMB 3EDKA 3WN5B 1JHKH 1QFHA 5GRUL 3KYMA 3T2PA 3FB6B 4GW4A 4IRJB 2EEDA 3GM0A 4GW5A 2HMID 1ACZA 3BN9C 3MV7D 2P24A 5SWSE 1HEZA 4JM4H 4R2GD 3BEVA 3RWFB 5JUEH 3SKJL 1A6PA 2APWA 4TNWF 3WDIA 2P5EA 1A64A 4RFNC 4OKVB 3BKMH 4Q2ZB 3EFFB 5J3HD 1DUZA 3FO2A 4CVXB 2DMKA 1KBGL 3BPLB 5GRUH 1U8JA 3HI1B 3EHBC 2F8OA 2PO6C 2X7LA 3NA9L 3U0PA 3N1MC 3RZCD 5ESAB 4KTDH 4DEPC 1LVEA 5C0CB 2CKBA 5FEBA 2DKUA 2VL4A 3PABB 3RKDC 2HTKC 1EHLL 1MI5B 1CIDA 3LKRA 4XCYB 4HS6B 5C9JB 4QXTA 4WI9A 4I13B 4FFWC 1LDPL 4HJJH 1E4JA 5BRZB 5EDXA 3ZYJA 1V3LA 3CH1A 4TPRL 1QYGL 3I9GL 3ARTA 3CCHB 4QTHB 4S1RL 4YHKH 2EH7L 4I0PA 1U6AL 4GRMB 5D7LA 1DBKL 4WHDA 3U4AA 5I16B 4KH2A 4XMKL 5HYSB 3DSFH 1NGQH 1ZSDA 3QDJE 1A3RL 1LDPH 4PJCF 2CDGA 1HYSC 4PD4J 4MDIB 1JWUA 3K1DA 4FQHA 4QWWC 4TPRH 1QYGH 1KB9K 3T4YA 4BQCA 5F44A 3OHXA 4S1RH 1TZGL 3FO9A 3RWGA 4L3AA 1CFSA 2OJEA 1DBKH 2W91A 5JA9A 3PGCA 1H0DB 3HAEH 4JVWA 1WBXB 4MQXD 2VXUH 4XMKH 1QNZL 3I6LD 2NQCA 1LP9A 2OR7A 2YUVA 1FCGA 1GIGL 1S7QB 1ZEAH 4HS8L 1I9IL 1YNTB 2EC9U 2GCYA 1C08B 3D3VB 4QRTA 4PJCE 2K1MA 2W0FA 2E7BA 4APQB 3D0LB 4X6CB 5I76A 4NN6B 1XF2B 3U7YL 1U8IB 4QXGL 1KTDA 3QCTH 1UEYA 3NMEA 1RUQL 1JI1A 1I3RB 2WIIB 3ARXA 4WGVB 4OLXH 5EU3A 1EEQA 3BJLA 4I48A 2J8HA 3BE1L 1U91A 1JF1B 4FQ2L 4HS8H 4UBDD 1A7QL 3WLWC 4M1GL 4LLYB 3KPSB 3K46A 2OS7A 4FFVD 3DVIA 4LSUL 1T0MB 2CK0L 1FYTB 1OL0A 3U7YH 2EEBA 1PKOA 2B5IB 3WL9B 4G9FB 5EZJB 5KSBF 4LCIH 3P77B 5EUOF 2Y6SC 3KYNA 3WIHL 5GGRB 1SVCP 4JFFB 2HLAA 5F1KC 3LZFL 2ZUYA 3WE6B 1UXSA 3BSZL 4K8RC 3OG6B 3DVGA 2E3VA 4FQ2H 3DUSB 2X4NA 5DRXB 5EO1A 5CP7B 4LSUH 2CK0H 1GCFA 2VUOA 1AGEB 3ULVF 3DYOA 3U4BL 5DYOA 4KI5F 4LOUC 1MFBH 4DGIL 3WIHH 2H1PH 1TPXC 5KSBE 4P9HC 5CEXB 5EUOE 2YPVL 3QEQB 3K81A 1KC5H 3N0PB 3GM8A 5MENA 5T3XE 1FL3A 3V6OC 3BSZH 4L8SB 1J5OH 4CW1A 5HDOA 4EXPX 5IWLA 3EYVA 3ARFB 4NO0B 3E3QE 3OR6B 4QRPB 3B2VL 4ZTOL 4U1LB 1S78C 1L7IL 3BKCH 1DSFH 1U8KA 3TH4T 1DVFA 2V2WA 5HYJE 5E1AA 5BW7A 1JZ8A 4IOIB 4DGIH 2D0HA 3ULVE 1OCWH 3Q6GH 4KI5E 4M7ZC 4BK4A 2YPVH 3TEUA 3ARVA 1DEDA 3G5XA 5TPWH 1FGNL 1YYML 3VFUA 4KRMB 3C5JA 4CMMB 4HWEH 3HPLB 1U2CA 3DRTA 4EUPH 2ORBL 1MHHA 5FIEA 1KXVC 5FYLE 4OSUL 2HG5B 1AD0A 3SE3A 1TCRB 1UQSA 2CXKA 3GBLA 5DHVH 5FUZL 4W4NA 3VFNA 4IIQC 3L3JB 1HHIB 3HNSL 3O4OC 2K7QA 4FMKA 3ZKXC 5LAXB 1WT5C 1H9VA 3TIEA 1LGVA 5IEKB 1KLUB 3GEWB 4LVOC 1K85A 1CFQA 1OLZA 5E2TH 4PJXB 3BN9D 2ORBH 4PREA 1BFTA 1UG9A 2H41A 4XH2A 3BW9B 3MV7A 3L5JA 2R2HB 4ODUB 1RZIB 32C2A 4KKAC 3L7FA 4PB9H 1LE5B 4RMSA 2EXYD 5CMAB 3LRGA 5FUZH 1CG9B 2D0FA 3KPLB 1Y6KR 4E41D 5JPMB 1H3UA 3MCLL 1UFUA 3QCUL 3EO1A 2ARWA 1CS6A 2EXWC 5JHDB 2OQJB 1KJVB 1VFOA 2IBGA 1DQQB 4OUOA 3H9HA 2EC8A 3ZL4L 4HIHB 4R97B 1IQWL 1SBSL 3RZCA 4DFIA 3MOAL 1D5BA 4O2EB 4KZEL 5DEFB 4ZUWA 2CMRL 4PRBA 4YNYB 1KUMA 3RKDD 2HTKD 1I8LA 4XPBH 4CNIA 2A6IB 4UDUA 1NAML 4HUWA 5D7KE 3QCUH 5DJYA 1CDHA 2LABA 4HLZH 4FFWD 4HIXH 3L3KA 1ITCA 2PYEB 1JV5A 3P2TA 2H26B 4NZUL 3UROR 4M5YL 3MOAH 2G5RA 1UYWH 4FOMA 5FUCE 4KZEH 1FFNB 3MBXL 5J1AB 5FM8A 2C4FT 5D2NC 4JY4B 1HOCA 3V5HB 2BJML 3BT2L 3R06A 3F7RA 5INCB 2Q86B 5I6XB 1QLEL 5FA4B 1LK3L 2CDEA 1NAMH 1JJUA 1HSBA 1RD6A 4F3FA 3MRCA 1HYSD 1WGOA 2Q7YA 5I18H 3IDXH 3EUUA 4NZUH 3VXTB 4ZOAA 3L95A 4Z7UF 4GW1B 2W59A 4AEHL 2APVA 3MBXH 1F6AA 2HN7B 3VXME 2EE3A 3NCEB 4MJ5B 3G6JB 3FAWA 3BT2H 4L8DB 3P0YL 3ESUF 3I02A 3KPNB 4RMWA 2W60A 3KPMB 3RGVC 3U6RB 4IRZH 4F57L 5GRYA 4WGWB 5TDNB 4K3DL 1JUFB 1T83A 1VGKA 1NC4D 5I30L 4UDTB 1H8OA 3F7QA 4PJ5E 2VIRA 5GGUA 5I74C 1FL6B 3VFVB 2IQAA 1A47A 1E6JH 3ZDZF 5FA3B 4Y5VA 1DQJB 4Z7UE 4A6YA 5K93A 4PV9A 2R0KL 4OZHF 3AB0C 3HFML 1QBLL 2ED9A 4LLAA 2H3NB 2VZ1A 3LQAL 5IESL 1PAMA 1FGVL 1VHPA 1XGPB 2G2RA 4HMDA 4K3DH 4CADA 4EIGB 2EZ0C 2YRZA 3U4EB 2Z9TA 3FT2B 4Q58C 1UZ6F 4G8GE 1EJ6A 4YX2L 4NRZB 4LK4A 5IM7A 2ZG1A 3SGJC 5EOQL 4QCIB 2ZNWA 2V2XA 1MQ8A 2E6JA 3ZDZE 4K23L 2XKNB 4ZTPL 3EDJA 3O4LA 4JO3L 5E6IC 3CFDB 3LQAH 5HGDA 5IVXB 1FGVH 4OZHE 1SJEB 4X0KA 2WBJC 1T1YB 2X89D 1LO4L 4HULB 4OI7A 3QUKA 4HIJB 4PLNC 3V5KB 5KSAB 2WWKO 2J8OA 4QOKE 1ZXQA 5JOFB 4HUNB 4P4KB 3MREA 1A21A 3OAYK 1UZ6E 3B5GA 1TTUA 4LSRL 3VXRE 3S34L 2ARJA 2FGWL 3L3GB 3P4OB 4XC3L 1F2QA 1KYOJ 3IB4A 1HHKA 2V5SA 3KGRA 4JO3H 3W9DA 4Y19D 4X7DC 1X5XA 4Y2DC 1WSST 1JCKA 5E08L 5GRVK 4RGOL 5FECB 3C8KB 5IW3A 1X6LA 4ZFZA 3U0WH 1ADQA 4I9WD 1FO0B 2BOCB 2ENSA 4ZUSA 3EGSB 4ZYKA 2IG2L 2KZWA 4JM2F 1XT5A 4GAGL 4G6MH 3CFKB 4GG8B 3RPIA 5IROC 1J1XL 1QRND 2YUZA 1SM3L 1L0YA 4XXDA 3N1PC 5ADPH 4DW2L 3R8BB 4FQQA 2R1XA 5EC2A 1E4XH 3G6AB 4RGOH 4WI4A 1SJVA 4HUUA 3HAEB 3GSNA 3UDWA 4X5LA 4PG2C 3DX8B 3C60C 5DO2C 3WUZA 5HI3C 2XA3A 1NBQA 4FQLH 1HH6B 4KRNA 4JG0L 5AZEH 1J1XH 2DKSA 3GI8L 2EKSB 4O02H 4Q6IC 4OV6F 1UACL 4PJ9C 2GITB 1JGDA 1UWXH 5CKGA 5AAWA 1NBZA 3PWLB 1YEIH 3X3FL 3N06B 4XNQB 5HHME 3VGAC 4OZIF 1EPFA 4NKDB 1RIUH 2Q76B 4AYFA 3CPLA 3P11L 1KXQE 3QEGH 4KKAD 5AAMA 3BQUB 2MSPA 3BZFA 2DQGL 4JG0H 4NQVA 1MEXH 5ERWA 4TSAL 4NNPL 1IRAY 3UZQA 1NEZA 4MMXC 4NC1E 5IFJB 1SY6L 1D6EB 2EXWD 2VDRH 1IGFH 4J3OC 5IB5B 3MRGB 3X3FH 2F53D 3BPNC 3TBYB 4ELKA 5IHUH 1A7RL 5HPMB 1P84K 1YUHA 4KUCD 1HH9B 3P11H 2J8UA 1N6QL 4OZIE 2GUOA 2XACC 2F19L 5F9JB 2HP4A 4K9EL 4H1LH 3AS3A 4YIQB 3PHOA 1T6WA 3X11B 3ARBA 4TSAH 1CDBA 2WLZA 1KCUL 4N0FB 3IJSB 3QJFB 3MUJA 1SY6H 4P5KA 1J11A 4AENA 5KS9A 4LQFL 1QACA 3IKKA 4B41A 1DLFH 5GRZA 1FJ1B 1N6QH 1HCVA 2VDNL 4X4XB 4OZFA 5SX5H 4C56A 3REWA 1LEIB 3BP7B 4JRXD 3RI5K 4P5TB 3ARSA 2BC4A 43C9A 4X4YA 1OVZA 3OKYA 4G6AD 1P9MC 3G04A 35C8L 3KPRD 4ODVL 2MNUA 1XGQB 5I1LA 4R7DB 4U6XB 1YJDL 4P46B 4LQFH 5DEZA 3RTQC 1S9KC 1U3HC 4GKSA 4BH8B 3IKCB 4MD0B 4AL8H 1ZHLA 2YR3A 4H5SA 4O2CB 4XCEA 3BD3A 1Q72L 4P5MA 4U31A 4HUVA 3SKNA 3FFDB 1T1XA 3QUXC 3FRUA 4EUPB 2Y5TB 4OQTA 4ISVB 4FG6D 4ODVH 3GSRA 4CJ1A 1P7KA 1JYXA 3KAAA 2BSRB 3ZE2F 1I1AC 3PGFH 2GY7B 3D69B 1JRHH 4KHTL 2BHYA 3F62A 3BDYH 4ZNEE 1E28A 1NC4A 1Q72H 2LVCA 4ZAKC 4ZO6A 4XVUC 3GKZA 1ND0B 1QSEA 4ZXBD 2IF7A 3BKYH 4QGTA 1RUML 4Y1AE 4N1EA 2C7UB 3OQ3B 1IC1A 1OB1A 3IFNL 3FQNA 5SWZB 2CIKA 4R7NA 3UTTB 1B9ZA 4LVNB 5D93B 4P2QB 1RUPL 3U1SL 1S3KL 4GXUN 4K3GA 4X9IA 4WCYL 2EZ0D 3MLRL 3MV7E 3KLAA 3ZE2E 4K71B 3MR9B 1DANU 4ORZC 3LCYA 4ESKA 3STLA 2ESVB 3MGOB 3MNWB 2FDBP 3DTXB 1CWVA 4HGWB 4NYLA 4NO2A 2V7NA 1MH5A 4NWUH 1MCRA 1YA5A 4NJ9L 2KDGA 3GMLB 3OSKA 1RUPH 1N4XL 2V9RA 1H3PH 2XTJE 3U1SH 2WBJD 4BSJA 3CXHJ 2HYMA 2Z8VC 2NY4B 1Z6JT 2WP3T 2X89A 3BH8B 1OQXA 1NCWL 3S37X 3UTPD 4Y4KB 5HD8D 1BBDL 2XFXB 4G7VL 1YN6B 4J2XA 2UZYB 4KY1H 4PJGA 4YAQB 2IQ9L 1ZGLB 3MLPA 3LDBC 1U58B 3BISA 3STZB 1R5VA 1PKQB 2CUIA 1K4DB 1N4XH 3O11B 1YY8B 1WCBB 3KJ6L 5HYIA 4M5ZL 1NFIA 4LLVA 4MHHG 2VUYA 3SGEH 4LHJB 3MC0A 3DV6B 3K4DA 4S1QL 1IGTB 4WY7L 5HYQA 3PWJA 1ERNA 5DMYA 4TVPE 4J4PD 2NW2A 5KZCD 1ZLWK 3AY4C 1IC5H 4Q97A 1IMHC 3C5ZB 3DVNB 1AGDB 3KXFD 3MRBB 4HG4K 5J6GA 2E7LA 1QRNA 3O8XD 3W5MA 1OGTB 3NCYP 3MLTB 3DBXB 3NPSB 2DI8A 2B1HL 4LSQH 1KFAL 3PV6A 1T2XA 3FFCD 2NY5H 1MRDH 5FYJH 3LRSA 4YHPA 4YH6A 5F9DC 3C60D 1TVHB 5TQ2L 5HI3D 1F00I 1PVHA 4O00A 4S1QH 4WY7H 4UUJB 4XAKE 2B2XL 5EU6B 3IDMB 3VD7A 4TOYL 4LRNL 5I8KH 4OM1L 4QHNB 5DJXA 5IK3A 5M95B 2XICA 5HGBA 4CU6A 4J8RB 1QSFD 3O3UN 2B1HH 1KFAH 1A6VL 1F11A 2R0ZH 4G80A 3NTCH 4CVZA 1RHHB 5TQ2H 4M6OH 1HQRA 4QHKI 2B2XH 1Q8MA 3T65A 3GMMB 3CVHL 3UJJL 2VLRE 4TOYH 4J12A 4LRNH 2VXQH 4UTBL 3UYRH 1X44A 3LV3B 1CGSH 3VRIA 3T0DA 5CZXC 3UZVB 1A6VH 1IFHL 4D0BB 1FDLL 2F53A 4PS4L 5GPRA 3X13B 1EX0A 5D71L 5KG9B 3UJJH 5D7JC 4PRID 4A2MA 1MCFA 3TA3C 1LO5A 4B50A 1OARL 4KVCL 4FTVB 4UTBH 2FO4A 2ATPB 3KJ4B 5IW1B 5F97E 1MCCA 1IFHH 3TPKA 2QHLA 3CU1A 1I8KB 4PS4H 4WV1A 1N2RA 2CGRL 3NFSH 3QBTB 5DQJA 4K9EC 2X70B 4N0UE 4UV4L 1SQ2N 2EDXA 1C5BH 5D1XB 2HWZH 3L9RB 3WIFA 2ADFH 4QXUL 2WV3A 1DEEB 4XBGB 3WFEH 1T03L 3CFBB 1KPRB 3EO9L 3HE7B 4Q9BA 1OARH 4KVCH 3AU1A 1A1MB 1MHPL 3S88L 2WINB 5HGAB 1OAKH 1B6UA 3RTQD 3K8LA 2AV1B 1SEBA 5HHVH 1U3HD 3IS0X 5F7DB 2RJMA 4X4ZA 2DQDH 2CGRH 2VKXA 5HHNA 4JQIL 1KJMA 4UV4H 5HVHB 1OW0A 1U42A 1OOAA 2HJLA 1T03H 3EO9H 2C26A 1YJDC 3V8CA 2B4CL 1XCQA 1I1AD 3BZ4B 4K7PH 4GG6F 1A14H 1JPGB 1T66D 3JTTB 2DS4A 5F3HA 1I85C 4JZNA 1PEZA 3RL2B 4HWBH 1WJ3A 4TUJA 4MJID 3G9VA 1A9EB 4XP6L 1VACB 4OD3L 4PJBA 3UTQA 4ZAKD 3S98A 4NQCB 1DN0A 3DX6B 1X3DA 4ZXBA 2R0WH 1T0PB 4ELMA 3LS4L 4M1CC 4YHIA 2HFTA 1TIUA 4NFDA 2R4SL 5CEZL 3IF1A 4PY7A 4OT1L 5CFHA 4EI5B 1NBVL 4Z95L 1GC1L 5SX4I 4OZGB 4S1SH 2R9HC 3ZE0F 2KZ1B 1F4HA 3GMRA 3LD8B 4OD3H 4GG6E 1FFOB 4OGXL 3QDGA 3OGCB 1VFUA 2XN9A 4JCMA 3W0WE 2BSSB 1RZ8A 4XAWH 5TJWK 1KTRL 3LS4H 3EZJB 1BQLL 4E41E 4U6TA 2R4SH 5CEZH 5JA8B 1MUJA 4LDLB 1B2WL 2I24N 5KTEH 2R1WA 4KFZC 2H45A 3L6FB 1DQLH 4GKZB 4ODSL 3RX8A 2APFA 3RVUC 4XX1E 5CILH 4OGXH 3V4VH 3ZE0E 3KS0H 1C7TA 2MHAA 4ZFFA 4WU7B 2PW1A 5C0AE 1JF5A 4LLUA 1B2WH 3TO4A 2XWTA 1O7VA 2MCG1 4UIMA 1C8PA 5JOPD 1KIPB 4AIOA 5F7LB 4PRPA 4POUB 4HZAA 1L4IA 4L29B 5ESVA 3DLQR 3UPRA 3OGOE 3MJ8A 4UTAL 5L2KE 4J4PA 1TZIB 3BDBA 4JO2L 5AZ2H 3KXFA 2AXFB 3O45A 2PCPB 1CBVL 3UTZB 1P7QD 4FNLL 2ZUWA 3O8XA 4LEOB 5CD3A 4U1SA 4LP4A 4HXAL 3WN5C 5D72H 1RJCA 4PG2A 4L4TB 3WFDL 3C60A 4IMLA 3QJHA 3QCVL 4DCQA 5TDPB 4PJFB 5EC1A 1ROWA 4JO2H 3U48A 3JVGA 4U33A 5E6YA 3S37L 4PJIB 3UX9B 5DD3L 5DJ0B 1AQKH 2WUBL 1KCLA 2GJZB 5DUBB 4FNLH 5C0GA 4YO0B 3A6BL 1AQDB 3BWAA 1QSFA 1ZT7A 1AC6A 4JO4H 2VZTA 5K9QI 1W72A 2GJ6B 2AJZA 1N0LA 2YSSA 2JJVA 3M8OL 4FXKB 4LF3B 2HTLC 3SBWC 1GGYA 1NMCB 1BD2D 4RDQF 1BVKA 1NC2D 3OKMA 2IFFH 1BF2A 2FNBA 4R4BB 3SHSA 4QRRE 3C09B 1EUTA 3LKOA 4NRYA 1XIWB 2WUBH 5C0DB 5DI8B 5CZXD 2X6MA 2XRAH 1QP1A 2FATL 3H7LA 3OKOA 4JDZB 1S9XA 1TXKA 4LSSL 4PJGF 5F9OH 3WS3A 4HF5L 3T1WA 5I1DB 2J6EL 1IKNC 4R0LA 3REVB 2YZ1A 1ZT4A 4LRIA 3OB0H 4W81A 4Y4HB 1QFPA 5D7JD 4XRCA 3GK8L 43CAB 1HHGA 4PRIA 2AVGA 1UVQA 3DUUB 3GB7A 5GS2D 2W92A 4X6DA 4HJ0C 1MVFA 3SE4C 3O2WL 3EJYD 5IG7B 3CDGA 4LSSH 1V3JA 1R3JB 4OBSA 3B9KB 4XNZC 5DRWA 1JZ3A 1LNUB 4BSWA 4PJGE 3TH3T 5KSVB 5L0QB 4EDWH 1MRFH 1M05A 1YMMD 2JB6B 3MRNB 3V5DB 2OTWB 1ITBB 3GK8H 4JFDD 2EIEA 5E56A 5KVDH 1S7UA 3NACH 4X99A 5TF0A 3INUL 4Y19E 1FAKT 1A4JA 1G9EA 4LSTH 1IEHA 4MX7A 3V6OE 5IJVB 3HMXH 4UV7L 1UB6A 4EBQL 4F80A 3I2CH 1KEML 1KXTB 4I9WE 3SKOA 2L0DA 3RTQA 3C6LC 5CEYA 4EVNA 4JKWA 3GBMH 4NZTL 3PQYE 5JW5A 4OLVH 1JK8B 1MAKA 1S5HA 2GW5A 3CVIL 5FF6A 3CUPA 3RWIA 3WEXB 3INUH 4APQC 1Q9OA 3SJVB 1RJZB 4NN6C 1HI6B 3VFTA 2NY7L 5HDQL 3O6LH 4EBQH 2OTUB 1KEMH 1I1AA 2WSKA 4EUPG 4WUUE 3DV4B 2GYSA 2GSGA 3EFDL 2CDFB 2NY1C 2UUDK 2DWEA 4MJIA 5SX5K 1FZKA 2VO5A 4C4KO 2YMXH 4LLDA 4KMQA 3SE8H 2XG4A 3IETA 5GGQL 4GH7B 4M1CD 4AIZB 2B4CC 4N8VG 3T0XA 3O3AA 2B5IC 5HDQH 2BVPB 1NGPL 4ONFL 4KUCF 4R90L 3EOTL 3U36A 1IEAB 1CDGA 2Z91B 4FFYL 2WBWB 3VA2C 5DJ6A 4HV8B 4OIIL 1CF8L 2YC1B 1J8HB 3W2DH 3U46B 2G9HB 3B6SB 5GGQH 5IKCB 3LH2H 3SDCB 5KVFH 4XPGL 2EKJA 3K8KA 5D7IB 1EGJL 4F33B 2FD6L 4R6UA 3FB5A 2ZCHL 4ONFH 3OKDA 1EEYB 1U8NB 4G8EA 5T1KD 2XWBA 3VGEA 2IH3B 3C9NA 3FONB 3T0ED 3RVUD 1PG7W 1KPUB 4OIIH 4CU7A 1CF8H 1QFWI 4OLUL 4KDTC 1A7PL 3OZ9L 3BXNA 4XPGH 1CLZL 1BLNB 3E6FB 3PWVA 5J56B 1EGJH 2KPNA 2NZ9C 2FD6H 2XKUA 3U79A 1WAAF 1D5MB 1JGVL 3QNZB 3QRFM 3GIVB 4LPWA 5D1ZB 5BJTA 1P5UA 4MWFB 3PGDA 3QZWB 4OF5A 3O6FC 3LVEA 5F8QC 2M1KA 4PTUB 3BP5B 3QIUC 4R3SB 4JRXE 4YEFA 3MO1A 5D2NE 3O3EA 1U41A 1BBJA 5DD5H 1ZGLP 4H25A 5HHPB 3KPRE 1PZ5A 2H32B 1CFTB 4PJDB 4WEBH 3FL7A 2X4QA 4NRXA 3VRLF 1R3LB 4GMTL 3KWWA 1WAAE 5I1CL 3OB8A 4HK3N 4YDJB 3GDBA 4RQQB 4KVNL 2R2BA 5GSRB 4IRJD 3QXAB 4JFEB 5FOJA 3HKFA 1YEDB 3D0VA 1BMGA 3BX7C 2OXGA 2E5EA 4XTRC 3D18A 4K3EH 1BZ9A 3CFEA 4I2XB 3K3QA 3MA9H 1X7QB 4GUPB 4MYWB 1C5DA 1OAXL 5KANG 3VRLE 5BS0B 4KVNH 1JTTA 1N3NA 4X6FB 1EUUA 2HTLD 2FX8L 3LN9A 4QRQA 3FN0H 4P59H 3AC0A 1CXKA 1BD2A 1E4KC 4R9HA 5C0CD 3B5HA 4R97C 1NC2A 3CC5A 3IDJB 5HGHA 3CSYB 4P3DB 4MQ7A 2P42B 3V0WL 1MI5D 4RGMB 1Z9MA 2A1WL 5AWNH 1NFDA 3GSXB 3LY6A 1TTGA 1C16B 1CK0L 2Y25A 4EOWH 1AO7E 2DQTL 1G7PA 3EYOB 4MA3B 1H3GA 2ZWLT 3LB6D 4L8BA 5HHOB 5BRZD 5IMOB 5FB8A 4PR5A 5D7JA 3QDMB 3UTSE 2F8XC 3GSVB 2GAZB 1SYVA 1BJ8A 2G60L 5ID1B 3ES6B 4HCRA 4PLOB 3TF7C 1NAKH 3PWNB 1QA9B 3HZVB 5I66A 4YBHA 2A1WH 3HC4L 3QO0A 3W9EB 4M48H 4P48A 2UWEA 4JFYA 3UTPE 4OFVA 2ADJA 1CK0H 2RGSA 4RAUB 4Z77A 1LK2B 2DQTH 5IMLA 1UT9A 4TYUA 5I1IL 1VPOH 1YMMA 3MLWL 4LFHD 3WFHB 2VDLL 1S8DB 1FG9C 5FXCH 1XGTA 2P47B 3TNMA 5HGGS 4J7RA 1F3JA 4RNRA 3HR5B 1KB5A 2F54B 4ETQB 1D5ZA 1DFBH 3ZHKA 1ZVSA 4JZJB 3BPCA 3QRGL 3KYMB 4L4VB 1VADA 4G42A 1ES0B 2D9CA 3QXVA 2P24B 5E8DL 3D3VD 1KIUA 4MSWB 4PJ7A 2YEZA 4APQD 4IEFB 2R15A 1MAJA 1K6QH 3P9MA 3TPUB 5T3ZD 3VGDA 2ATKA 1Q94A 2AJVH 1DUZB 3FFCE 2C1PB 4H20L 4PLKC 1BAFL 4M4PA 4AY0A 3KPTA 3P4MA 2A83A 4DGVL 2I60H 5BZDB 4FQCL 1G7JA 1M71A 1FZMA 3KPSD 1IAKB 1NCBH 3C08L 5CINL 4JKPL 1AP2A 1FYTD 5F7NC 2HFFA 4JANB 3MNVB 4G9FD 2XQBL 2AK1H 4DN4H 2ZJSL 4XHJC 3RDTB 5EO9B 4JFFD 1RMFH 4TSBH 4BZ2L 1BAFH 3OMZA 1TITA 1J9CT 5B8CB 3PHSA 1IAIL 1S9VB 3MUHL 4FQCH 3UBXA 5KSAC 2ZP0T 4YGAB 5CINH 5E8PB 5GGSA 4N8PA 4BH7B 3MV11 1MFCL 2BOBA 2P7TA 2CO7B 1FQ9C 1CLCA 3H9SB 4JN1L 5T1KA 4BZ2H 3QEQD 3V2AR 4JFQA 3T0EA 1JWSB 1JWUB 2NY3B 2BVEA 4KJYA 1IAIM 3RWEA 3E8UH 4FQHB 8CGTA 3T4YB 3BJ91 3WHXA 5B38A 4H1LG 4LHUB 3IVKA 4LLWB 1PW3A 3ARFD 4NNYA 2HKHH 4NO0D 2AJ3B 4QRPD 4FP8H 1KCVL 1GOHA 1CFSB 4PRHE 2OJEB 3BEWB 3MLXH 5C0JA 3ULUD 4HJGA 4JKKA 3FO0H 4XNMA 2VZ3A 4YDLB 1DQDH 2E9JA 3BYYA 4LCWE 4P2RE 3LHPL 2IPKA 2P4AB 1RVFL 2WWKT 3SDYL 2NY6B 4UNVA 1QR1B 2GTZA 2GCYB 4QRTB 4WFGD 1I9EA 2A9MH 1UJ3B 2ITDA 5TDOA 3NVQA 5EU3B 1IL1A 4NHUB 1CLYL 1NUNB 1L0QA 3IRPX 3EZ8A 3DROA 4I48B 4KROC 2EDQA 3SDYH 5JIIA 4AEIL 4MJ6B 3ARPA 1U91B 3EJJX 1YZZA 3KDMA 3RIFK 2VTFA 5ICZB 5FO9B 3P40A 1N5YL 1YPZB 2XQYK 4IRJA 4YFLF 2C4XA 3UPCA 4UB0L 1XAUA 3WXVL 1TENA 4K3HA 1Z3GL 2DQIH 4HIEB 4XTRD 4Z8FL 2HLAB 1CVSC 3OJMB 4XVJL 3DVGB 4Q2ZA 3EFFA 1RAMA 4L5FH 1J8KA 3DX9B 4CVXA 5JHDD 2X4UA 3HI1A 2B0SL 1II4E 3SBWA 3VA6A 4D94A 1MIEL 4S0SD 5ESAA 2P48B 4UB0H 3UZEA 2QQNL 1D9KA 4PJEF 4YBQC 3QPQD 5FCSH 2APTA 2ITCB 3K1KC 3WFBL 3BGFC 2AJSL 1FL3B 5DC4B 1UM4L 3FQXA 4XCYA 1DBAH 5C08E 2PNDA 5B4MC 1QHPA 4HS6A 5FDYA 4CW1B 5C9JA 3AVEA 4GRWB 1F13A 2PYED 3QXDB 4HKBA 1A1NA 2OL3L 4UOJA 1JPTH 3QAZB 4X7TA 3T04D 2DAVA 2V2WB 5GS0H 3KHQA 2QQNH 1BGXL 1XR9A 1CDYA 3CCHA 2WW8A 3D39E 5HDLA 4P5TC 3ZKMC 1XGYL 4GRMA 3WFBH 4PJEE 1T6VN 1V7NL 5I19L 5HYSA 2OP4L 3DYPA 5J8OA 2VLKE 4P46C 3I75B 2A9NL 4NQEE 4Z7OF 5T1MB 3MRRB 2DLIA 3ZO0A 4MDIA 2P5WA 5DMGC 4LQ1A 2X1QA 2ILLA 4HH8A 3VFNB 3HHRB 1XGYH 4Y88A 4OCWL 2R0LL 2VERN 2LV4A 4V1DE 3SO5A 5TQ0L 3TIEB 2NNAB 5I19H 2BY0A 1MCPL 1H0DA 1WBXA 1OGAB 2PYFB 3NA4A 2OP4H 3O2DA 5DTFB 1CD0A 1CFQB 2YA2A 5DSCA 5D1QB 5I1HL 2A73B 4PREB 1QFOA 1S7QA 1KB9J 2DF3A 4I77L 1G0YR 4YE4H 5E9DA 2F8VA 2XV6B 2AP2A 3D3VA 3L7FB 4Z7OE 3OJ2C 1UKQA 4ZD3L 3P9LB 1YECL 3D0LA 4APQA 4AEEA 3MLZL 4X6CA 2PUQT 1NDGB 1XF2A 5DJCA 1U8IA 3MZTA 2JJTA 5TQ0H 4NNXB 3S5LG 4OI8A 2J12B 5D93C 2FJGA 3E2HB 3ARWA 4E5XB 1JNHA 3WD5H 2MKLC 1D5BB 4K71C 3JWOH 4EQ2A 3NIGF 4LLYA 2GQHA 2EDHA 2BNUA 4RGNB 3RJQB 5IV2A 2EO9A 1T0MA 2DQHL 4WW1B 1IQDB 1FYTA 3SGKC 3LKPB 5D7SL 5E5RB 4XHJD 5EZJA 4PFEA 3VG9B 2PR4L 1QVOA 2LAAA 4HPOL 5GGRA 4UOW0 2WWMC 3L3KB 4JFFA 1JV5B 1ZLUK 3WE6A 2F58L 2NY4C 3A67L 1OP9A 3H9ZA 4MNHB 5DJ2B 3FRPA 5KSAD 3DUSA 3UPAA 5DS8B 5DRXA 5BVPL 4LGRB 4KQ3L 4Y4KC 5CP7A 1NANI 2APBA 2DQHH 1RZ7H 3NIGE 4HUXA 4P4KD 3RUGF 1AGEA 3O3BA 3QUYB 1RUKL 3AS2A 7FABL 3R06B 2J88L 2CDEB 2PR4H 15C8H 2DMCA 4HPOH 4F3FB 3LOWA 1Q0XH 5FKPB 1MFDH 5CEXA 2OX5A 3MJ9A 3FQRA 3L95B 1MJ8L 1YMHB 4L8SA 2E6QA 5BVPH 3ARFA 4HW6A 3OR6A 4QRPA 4HWUA 1BFOB 2AI0L 4U1LA 7FABH 1WWAX 3NZ8B 1WZ1H 4JKLA 4XBEL 1ULVA 1RV6X 5MHSD 2VSCA 3IFPA 2FHBA 4L8CA 3NPSC 4MNQB 2AXHA 4JFDE 1RZKL 2PW2A 1MJ8H 3NPZB 3VG0L 4DTGL 4CMMA 4NCDA 3MXVL 4Y5VB 5DRNB 3ARUA 1I8IB 5KVEH 5SX4H 4QGYA 2HG5A 4NPYA 4I5BA 4PGEB 1TCRA 3ZKQD 2X4RA 3EDDA 5IB2B 3OKEA 2RBLA 3L3JA 2C4FU 4CADB 5LAXA 5E00A 1BOGA 1RZKH 1KLUA 2A6KB 2RHEA 2EDFA 3M17B 3CLFL 3MXVH 2R23A 4HQQH 4OB5H 1CZ8L 4Z7VB 3BW9A 3BQUD 2R2HA 4J3SA 1RZIA 1RFDL 4YHLL 2IALB 3O4LB 1LE5A 4D9RE 5HGDB 5CMAA 1JGEB 4UZGA 4ZQKB 5DURB 4M62L 2DD8L 3KPLA 3PNWB 4QTIL 5KOMC 2H2PC 4C83B 5JHDA 4A2LA 4OCNC 1DQQA 1Q38A 4QHUA 1R3IL 2AGJL 1TQCC 4HIHA 4YBQD 5DK0B 4HIIA 1RFDH 4YHLH 3TYFA 3B8YA 4Q74A 5DEFA 3W9DB 4LCCB 1YEGL 4YNYA 1OWWA 1I1FB 2A6IA 4P0DA 4HK0B 4M62H 5B4MD 2H6PB 4QTIH 3KJ4C 3VU2A 1AXTL 1NCCH 1FVDB 1R3IH 5BO1L 2FHCA 1DQML 4OF6A 5D1XC 4P5TD 1G7HB 3CXDL 1YEGH 5FGCE 1BOYA 5EIVA 3BKJL 3HE7C 4JY4A 3V5HA 2R1XB 2MPAH 5INCA 2JB5H 1FV1B 2Q86A 3E6HA 5FA4A 4HUUB 4P46D 4URTB 2R29L 2R4RL 5E2WL 5JZ7D 1LD9A 1U8OB 4NQUA 2XQYG 1BEYL 1K8IB 2AK4E 3TN0B 5J57B 5HVHC 4GW1A 5EBMB 1HQ4B 12E8H 4G6FB 4XPHH 3CXDH 2HN7A 2B1AH 3OR7B 5L88H 1VA9A 3BKJH 5D70L 5KVGH 3G6JA 1G0DA 1NBZB 3QA3B 3NN8A 4UQ2B 3SE9H 4L8DA 1WCQA 5A16A 3MPCA 3KPNA 3NGBB 3KPMA 3U6RA 1KPVB 2FIRT 5DHYA 5E24E 3HNTL 4F9PC 1BREA 1JUFA 4IHOA 1WEJL 1BEYH 2NYYD 2VLJE 4UDTA 1IM3B 5F1NB 4LAQL 2DQCH 3KPOA 1FL6A 3GMQB 5GQBA 3IXAB 5ERWB 1MFEL 4I3GA 2NY2B 2FGZA 5SWZD 3HRPA 3LIZH 5D70H 3VMPA 3UTTD 4ZUTA 4P2QD 2H3NA 3KPQB 5C0BB 4RBPK 4EQ3A 1YUHB 3VXUB 2AJXH 1PG7X 4NJAL 1NMAL 1WEJH 3LD8C 1AR2A 3D2UA 4IDLA 2ESVD 4QHMA 3SOBL 4LAQH 3TV3L 1MWAH 1IC7L 4K94H 2JELL 2QADC 1NJ9B 1JNLL 5DA0B 3ARBB 1I1CA 5T3XH 5DGQA 4NKQB 2R56L 4QCIA 4IDJL 5L6YL 4AENB 2XKNA 1OSZA 4WRLA 5FCUH 2DQEH 5CGMA 5FDWB 4YWGL 3FB8A 3CFDA 5IVXA 2XIDA 5LXGL 1JGUL 1SJEA 2NY4D 1EBPA 1MCOL 2YPLA 1MY5A 3SQBA 4NJAH 4HIJA 3V5KA 5C9KA 5C0CE 2CH8A 2EIDA 3ULVH 5DWUL 3GKWL 4OZFB 4C56B 4Y4KD 5KSAA 3PJSA 3TV3H 2JELH 1G7QA 4U7MA 5JOFA 1JNLH 1MI5E 43C9B 4P4KA 3O41B 4IDJH 5L6YH 4JFZH 3OV6A 3L3GA 3P4OA 5I1LB 4PTTB 5FYLH 4DN3H 3DNKA 5CHNB 1JGUH 1FORH 5BRZE 4BFIB 1ZHLB 5F9AC 2YKLL 5FECA 1X9QA 3IU3B 4L1HA 3GKWH 3IT8D 3SPVA 1WUNT 1N59B 4NUJB 4EEEA 1NH6A 2BDNH 3VFOA 3FRUB 1LO0L 1FNSL 4RFEA 3GJFK 4GG8A 3C5ZD 2LTQB 1P7KB 2W65A 2X10A 2UYLB 5BV7H 1AC0A 1NL0L 4YXHL 1NPUA 5TE6L 1XR8B 4GLRI 4MA7L 4Y2OA 3G6AA 2YKLH 1QSEB 4N90D 3HAEA 3O9WA 1RURL 4JY6A 4KV5F 3O6ML 2EDNA 5CJBA 1GGCL 1H8SA 1LO0H 1OB1B 5EU6D 2CIKB 4FABL 3CD4A 3LEXA 1HH6A 2DBJA 2EKSA 4DVRL 3T3MF 4G8FB 2GITA 3DUHA 4YXHH 5I71B 3STLB 3PWLA 1PDKA 3QXUA 4NOBA 5D5MF 2V7NB 1MH5B 3O6MH 4NKDA 2EECA 4OCXL 1GVIA 1JTOA 1I1YB 4KV5E 3T77B 2XWJB 3BQUA 5LGKA 1QFWH 4KK9D 4LGPB 4F7TB 3JZ7A 1A5FL 5CKAA 3C09C 1FC1A 3QI9C 4DVRH 1XIWC 3T2OA 2X1PA 3R1GH 2ZOLB 2H2PD 3T3ME 5IFJA 3KPSE 5ITFA 2KQMA 1WC7B 1GOGA 3L3DB 1JP5A 5DUML 3MV8E 4UINL 5MERB 5L9DL 1A6AA 4G9FE 4D2NA 4Y4HC 5D5ME 4F58H 3M45A 3RIFF 2VDPL 5F9JA 2HVKA 3X11A 4FTVD 3ABZA 5EOCJ 5J1TC 3IJSA 4FQJL 2XY2A 3OTTA 4R96A 5ACZB 4FQPA 1P84J 3B9KC 3WIHA 3WO4B 5HYQB 1OT1A 1FJ1A 5BZWB 4LAJH 5D1XD 1VFMA 4X4XA 3BP7A 2VDPH 4OGAC 5J6GB 4P5TA 2F5BH 3HE7D 3QEQE 4Z76B 5EIIB 3RQ3A 1B4RA 4LVHC 2OZ4L 3DO7A 3PWPA 3LRSB 4R7DA 4U6XA 2F74B 3MYJB 3VWKB 1LHZA 3QH3B 1UWGH 4BH8A 3IKCA 4JFHE 3QSKB 3LEYH 3MMEA 4O2CA 4X9HA 2Q1EA 1X5ZA 4JR9L 3WXWH 1RU9L 3FFDA 2BNQA 3V7AE 2NX5A 5GGSY 1FE8H 1J1PH 2N56A 4EUPA 2CKBL 5HTSA 5HGBB 1D5XB 4PJXF 2OZ4H 3F7VB 4I0KA 1X5YA 1JMZA 4G3YH 4CVZB 3H9YA 4ORGB 4X4ME 5EZLB 3D69A 5DHVA 1DE4B 1VDGA 4N8VA 3TZVC 4LPUA 1H3VA 4NQCD 1ND0A 1RU9H 1OAYH 2IEPA 3NAAL 3SQOL 2C7UA 2W1NA 3VH8G 4JHAH 2WUCH 5SWZA 1NQBA 1SMAA 4EI5D 3MROB 1MCIA 2JCCF 2QQKH 3D1MC 4GBXA 4PJXE 4TULH 1Q9WB 3MR9A 1FIEA 4JDVA 3BO8B 3QR2A 4OD2B 5D96C 4ODTL 3MV9B 3UAJD 4HGWA 3DTXA 3RRQA 1LO5B 3NAAH 5KN5B 3SDCC 3KYKL 3QQNA 3G9AB 4YXLH 3TJEL 4BSVB 4M9PA 5DD6B 3GMLA 2F9BT 2JJSC 1N0XH 2DM4A 3NCCB 1QQDB 3QDJB 3GHBH 4C4KT 5DQJB 1REIA 4Z0BL 3BH8A 3X14B 2JCCE 1G9NH 2XOTA 4JPIB 1BVZA 1RIVH 5T5NG 4Y4KA 1X4ZA 5CZKA 4U3HA 1L0XA 2XFXA 4NC2B 3TO2A 4EN3A 1YN6A 4JPVL 4DOHB 1JL8A 3KYKH 4FQ1H 1A3QA 4HC1H 5EBLB 4DK3A 1LE9B 3GHEL 1K4DA 1SEBB 1LWRA 1S9YA 4JGMA 1CFVH 5TF1L 3GO1L 5D1ZC 2PYEE 3DMMB 5DVKA 4YDKH 5F88B 4MXWH 3EJZC 4RA0C 1KJMB 4OLZL 1G1YA 2Z0BA 3AM8A 5KBNC 1NUDA 2NXZB 4FQXB 4MNGA 3AREC 5GRWA 1RULL 2P8PB 1KSRA 1NAMA 1MNUH 3ETBF 3DV6A 1OP3H 1IGTA 1AD9B 4YBLB 1QKZL 1FFPA 4X8XA 3ZSSA 3MCKA 3IRZA 2WM0A 1MJ7L 4G6KH 3OKKB 1J0JA 1PG7L 3C5ZA 3DVNA 2X4TB 1AGDA 3MRBA 4JZNB 4U4BA 4PP1C 3WUWG 2K7PA 4PJBB 1WWWX 1OGTA 3MLTA 4OLZH 1DN0B 3FT4B 5T33L 2OJZL 1RULH 4L4TD 2WIMA 4YHIB 2VOTA 3BOVA 1HKFA 4UUJA 4K2UL 3RAJH 1QKZH 3MBEA 5EU6A 3IF1B 4S2SB 1YY9D 3G5YA 4HG4J 1KEGH 4MQTB 4PY7B 5B21A 1XF4A 2VQ1B 5K9OA 1Y18A 4QHNA 1Z0NA 2Z31A 5F93C 1KCRL 2MJWA 5CSBA 3GMRB 1EMTL 1W0WB 2RIKA 4UT7L 2CUHA 3QDGB 2RR3A 2XN9B 1C1EH 5DXWA 2YRLA 2DLTA 2GJ6D 4ALAH 2DYPA 2A77H 2UZIH 4OCMC 4U6VH 3ZDYF 1RHHA 2BVTA 3MV01 2YHGA 1JZ7A 3P0GB 3SN6N 5K33A 4X80L 3VJ6A 5ANME 1WWCA 4F7EB 4W70A 1XIWD 1MWAB 5DDHB 3LV3A 1EMTH 4N8CH 4UT7H 4UMGA 3FB7A 5C09E 1F58L 3EBAA 4HLJA 1OF2A 4P57A 4YK4B 5LGHL 3X13A 4Y4HD 5A2FA 3JTSB 5IBUB 3ZDYE 2MFNA 4X80H 4DZ8B 5KG9A 3TO4B 5MP6H 2XWTB 5B3NA 4WWKA 3RU8L 5JORB 5CBEB 2XPGA 5DC9B 4QLRA 3SDAB 4FTVA 5CJOH 2CIIB 4JRWA 3X17A 4PRPB 4WW2A 2ATPA 4TUOA 1BQHG 1BX2B 3B9KD 5EA0H 3LPGA 4OV5B 3G6DL 3U7WL 2ICWI 5C0ND 1S9WB 5FFLA 2X70A 2JJWA 4HT1L 4OGAD 5D1XA 3L9RA 3O45B 5D9SB 4OM0H 1DEEA 4PUBH 3MFFA 3RU8H 1KPRA 2BRRH 1ZWIA 3BPOB 4MCYB 1U3JA 1A1MA 5CD3B 3NFNA 2WINA 4U1SB 5HGAA 5GGRY 5FYKD 3G6DH 1M7IB 4UQ3A 4OCRL 5F7DA 3DXAA 1EEZB 5BV7B 3BVNB 4YQXL 1RK1B 4YHOH 4XP9L 4HT1H 5FYJD 1IT9H 4OLYL 5DQDH 2QSQA 3SJVD 2D7OA 5CJXC 3JV0A 5GJTL 3VXOB 1ZT7B 4RAVB 3THMH 4ZFOB 4Q9QL 2EDTA 3JTTA 2AJZB 4OCRH 1A9EA 1OSPH 1T3FA 1OP5H 3QPXL 4NQCA 2R2CA 1TFHA 4J3WA 4I4WB 3DX6A 2ICWJ 3VFGL 3C8HA 4GMSL 4OLYH 5KANI 1FL5B 2HT4D 2V17L 1S9XB 2YN5A 1DCLA 3RDTC 4EI5A 1LO3L 3WS3B 5H8DA 2XT1B 2CRZA 3RKPA 4K07A 4OZGA 4R0LB 1J8HD 5B39G 5B8CC 1FFOA 1FPTL 1WK0A 3OGCA 4C57C 1FNEA 4M03A 3SDCD 2BSSA 2EYSB 2MTPA 3GB7B 5I8OL 2BK8A 4YFLI 1RZJC 3MRJB 4PG9B 3WNOA 1W8OA 4QKXB 3CDGB 4J6RL 5LCVH 1GSMA 4DQOL 4NN7B 1ZS8B 4S0TD 4TVPH 3L6FA 2N7BA 4GKZA 2NY3C 4Y7MA 5E03A 3RVWC 1Q1JL 3TBVB 3VD3A 4JDTL 4X99B 1SY6A 3VXMB 1XCTA 4MX7B 2NTSP 4WU7A 2IGFL 1UB6B 1I8MA 4XVSH 2MMXA 4J6RH 4YDLC 4A6YL 4UNUA 5D1ZD 5HJ3A 1A3LL 2CRMA 5DGRA 3EJZD 4BZYA 2ICEB 4BFGA 1KIPA 1KCSH 4U6HB 1V3MA 1KLGB 4HPYL 1EAPB 3TT1H 3LKNA 1Q9OB 4L29A 4Z7UB 5LVEA 3Q1SL 3VFSB 1UJ3C 3BFOA 3NABH 2OBGA 3QQ3B 2YD4A 2VAJA 1TZIA 4IRSA 5EZOL 3H2WA 1JZ2A 4PP1D 2AXFA 2XZCL 3OAUL 2PCPA 5C6TH 1A3LH 4YHZL 4F7MB 2DWEB 3WCYA 4LIQE 4NM4L 4LEOA 1GAFH 4LLDB 4HPYH 3IETB 1P4LA 2GKIA 2WP3O 5ISZE 3O3AB 5GGVH 5J13B 5FKAB 2ENYA 4JFED 5HHXL 4X6BA 2YWZA 3Q1SH 3HS0A 3QHZL 5C07E 4PJFA 3MGAA 2WLYA 2AQ2A 1AGBA 3QG7H 1IBGL 3RHWK 3S96A 3ZZ1A 5FGRA 2P1YA 4OZHB 1A6UL 4PJIA 3AS0A 1YEEH 4TSCL 5DUBA 3U7AA 3IAGC 1NANH 1RI8A 1RZFL 4NM4H 4ODWA 4OUUB 1AQDA 5BS0D 4HUKB 1EHAA 2BHUA 2GJ6A 4HXBL 2YUXA 4M7JL 3LPWA 1FIGL 1ADQL 1F5WA 5SWZE 3FB5B 3UTTE 1GGBH 2QQLL 4P2QE 1IBGH 4G8EB 3DJ9A 4NT6A 4ERSH 1A6UH 3BZDA 4PB0L 5C0DA 5DI8A 5IT2L 4TSCH 1JF6A 2ESVE 2L7UA 5I1DA 1F97A 3WYRA 5IWLC 1J1OL 1B4JL 4HXBH 3BXNB 3VD4A 5HHOD 4JB9H 1UH2A 3REVA 4XNXL 4Y4HA 3GSNL 3PWVB 5DT1L 3FTGB 3QDMD 1DVFC 43CAA 4XXCA 3MQIA 4ZSOA 5JIPA 1J18A 4TNVK 5I1EH 3DUUA 4GAJH 5CGTA 5GISL 2V2TA 5LGJB 2HH0L 5IT2H 1TJIL 1FG2A 2JK5A 4WJ5B 1RZGA 1PX3A 3B9KA 1E4WL 4N5EC 3PP3H 3O3EB 1BBJB 2E9BA 1J1OH 3IJHB 5KSVA 3J7HA 3FOMB 3V5DA 2JB6A 3U9PH 2OTWA 1PKQE 5E70A 4PLJD 1KJ2L 1H15B 2X9WA 4JM2B 3IFOB 3SE3C 2X4QB 3BI9X 1VCAA 2EO1A 5JW4Q 2VE6A 5IJVA 1TJIH 2F54D 3FCTB 4IJ3B 1IGMH 4L4VD 5HHMB 5C7XH 1M7DB 1RJYB 2G75B 5D1QC 2HMIC 1PY9A 1NLBL 3N85L 1KJ2H 1NCAL 1JK8A 1ZVHA 5JLZB 3S5LA 2J5LB 3WEXA 1FZJB 3CMOL 3O0RL 1BZ9B 3SJVA 1RJZA 3AGVA 5E4EB 3DYMA 5LQBH 5A2JH 4QRUA 1HI6A 2V5MA 4AM0A 4XI5C 4XWGL 4N90E 1K4CB 3KR3H 3DPBA 1FLRL 3DGCR 3MUGB 4PJ8B 1JYVA 3D9AL 3DV4A 4FRWA 3E2HC 2BVYA 2LU4A 1DR9A 1OD7A 4ZPVB 4OZIB 2VDOL 3HRZB 3CC5B 3N1FC 4AIZA 3SDXF 4RGNC 3L1OL 4YUEL 5C86A 1I8LC 3NIDF 2IANE 4L9LB 2WNGA 3RJDA 1NFDB 3RDTD 5DVLA 2BVPA 5DK3A 5JTWA 4XWGH 3VG9C 1U8MA 4BFEA 1IEAA 3ZLQC 1QEWB 2Z91A 3VI3F 1HZHL 2FX9H 5IVOA 5CBAB 2YK1H 4XMPH 1J8HA 2VXVL 3TYGL 4KKBC 2ERJC 4XP1H 3Q2CA 2G9HA 1BJMA 3B6SA 5IKCA 3RP1A 3SDCA 1I4FA 2VZUA 2AEPL 4NGHH 3QUYC 5D7IA 1SJHA 4F33A 2R8SH 3SDXE 4LSVH 2JJSA 3ALPA 3NCBB 3NIDE 2ADJB 2DQJH 3H9SD 4OQTL 5JPNA 3UJIL 3ME0A 5JW4M 4XZUA 1KPUA 2NY3D 3VGBA 1HZHH 3RBGA 2VXVH 2ICCA 5ICXB 3VI3E 4LHUD 1H8NA 3TNNA 1XGTB 3TNMB 3MRMB 4HFWB 3QEUA 1HSAB 4EXKA 1OAQH 4FTVE 4OFYA 4GSDL 4RNRB 1KB5B 5T5FH 4QT5B 1ZVSB 3LEVL 3TVMA 1D5MA 4YGVA 5IB4A 3BPCB 1CU4L 4L3EA 3P4LA 1VADB 3GIVA 5D1ZA 5L8JB 1F3RB 3UJIH 2NY6D 2I25N 3QZWA 1INDL 1T83C 1HIML 2CR6A 3TLRA 3VRJB 4NDMB 2ICES 4PTUA 4L9DA 4R3SA 4D0CB 3O6KL 2RCSL 3RGHA 4O51B 4Y1AB 1IM9B 4X7SL 2ZCKL 4Y5VC 2AQ3A 3TC9A 4GSDH 2VITB 1TETH 3LEVH 3OAYH 2H32A 1CFTA 3VDAA 3TWCL 1R3LA 1B0GB 3Q5TA 1A7OL 4M3KB 2I27N 2IBBA 2EIZB 1INDH 4RQQA 2BNRE 2AXGB 3TESA 3O6KH 1NGYB 3QHFL 4XWOC 5K9QG 3JV4B 5GSRA 3GZKA 3QXAA 2HFFB 4KKNA 4F8QA 3CSBA 4HWBA 1YEFL 1KELH 1YEDA 1P4IH 2FX7L 2V5RA 2XTJB 4XNUL 4BKLB 4YR6A 1NSNH 4TTGA 4KU1A 4I2XA 1A7OH 1X7QA 4MDJB 2E27H 4GUPA 4OD1H 4P9HL 4QHLB 4PBVC 5BS0A 2QV2A 4X6FA 1EJOL 3QHFH 4K8RH 3JXAA 3Q48A 1VGEL 3MODL 2D2OA 2VXSL 3V8OA 4C58B 3IDJA 4JRYE 3CSYA 4P3DA 4RWYL 1TJGH 3HI6L 3WHE0 4U1IB 2VDML 4JFQB 4ZUUA 5ACMA 4KJYB 4WI5A 3SDDB 1C16A 1JNNL 4MA3A 2GFBB 4M7LH 1AI1L 5JOEA 4D0DA 1DL7H 1R24A 3BP4B 3S35X 5IMOA 3UP1A 4HJGB 4CAGA 5IBLC 5DFVC 2VXSH 1MFNA 4WO4A 4ONHB 4GLRH 3GSVA 1HDMA 4UIKH 2GAZA 3ES6A 1J0ZA 1EHXA 2BCKB 3AMKA 2VDMH 3PWNA 3HZVA 3CFCL 4N5ED 2O61B 3QDAA 1RK0B 4RAUA 1JNNH 3UDWC 1LK2A 3QEHB 1A7NL 5TDOB 1AI1H 3WS6A 4HH9B 4OIAA 3QUMB 1IAOB 1SEQH 2YPKA 1I3UA 5HVWA 1S8DA 4M93B 2W9DH 5KOVC 1CDJA 1ORSA 1NCTA 1BM3H 2LU3A 4WI2A 5DD1H 3HR5A 2F54A 4ETQA 1OGAD 4JZJA 1MLBB 4WFHD 1R0AH 1XGUB 3NGBC 4L4VA 2X05A 1ES0A 5D1QD 1AKJB 1A7NH 1X5AA 3UJTL 4ZODA 1KIRB 4MSWA 2VLRB 3DURB 2BVOA 4WDIB 4M7LT 3MRQB 1WQVT 1ZA6B 4TN9A 1T2QL 2EXYC 2V6HA 4MZ2A 3TPUA 2V9TA 5CJXA 4M7KH 3LS5L 2BVUA 4XI5D 3H3KA 2DM7A 5E95B 1A6WH 2QL1A 2DDQH 2YN3A 2C1PA 3QUZB 1AGCA 1NGZB 2X4UB 3WFCL 4L4TE 4XP5L 2IBZY 5EFIB 1SBBA 4JHWL 1R3HB 5BZDA 2Y36L 4ZS6C 1D9KB 1IAKA 1PBYA 2Z92B 4RGND 2R2EB 3I6KA 4PGBB 3SKJH 1ZV5A 3VFMB 1Z9OA 5F72S 1MJUL 2Z4QB 3ARBC 4JANA 4NQDA 5A43C 3MNVA 1G6RL 3LS5H 3FQXB 4NZRL 4P4RB 2YBRB 1KOAA 3RDTA 5EO9A 4HWZB 1IVLA 3V0VB 1DDHA 1Z5LB 1KBGH 2FH6A 4I1NB 4HKBB 1A1NB 3NA9H 1K3IA 5DFTA 2OLDA 1A6TB 4N0UB 5B8CA 4KKBD 4X7TB 3B4NA 2Y36H 1S9VA 4I3SL 2D9QB 5EU5A 1XR9B 4YJZL 4WEUD 5E8PA 3QUYD 1IEBB 4BH7A 1EHLH 5GJSL 3PUCA 1G6RH 2NXYB 5GS1B 4NZRH 5GS0C 3H9SA 5F7FA 1KT2A 1JPFB 1OP5K 4BUGA 4DUXA 1JWSA 2OMBA 3Q6FB 2P5WB 3I9GH 1I9RL 4I3SH 5C0IB 4LHUA 5LKNA 3NCMA 1AY1L 1ONQA 2IMMA 4LLWA 2EH7H 1WZMA 1RIHL 2AJ3A 1U6AH 3L7EB 5CLTA 3BEWA 2D4FA 4U1GB 5B3JF 4XPTL 2C3GA 1WBYB 2OI9B 2LTQC 5DSCB 1TVBB 1A3RH 2FIKA 2Y7QB 2EDLA 2VR4A 1NEUA 1QR1A 4MNQD 5E9DB 2AXJA 4KDVA 3HMXA 4Z7QF 3R4DA 1I9RH 1AY1H 4KKLC 1TZGH 1UJ3A 3HI5L 5DJCB 1RIHH 4MA8L 2Q6WB 4BJLA 4Y5YB 4MAUL 1RUAL 4U49A 5F3BA 4CJ0A 2X40A 1DBJL 5FYKE 4NHUA 5C6WH 3BESR 2FJGB 1QNZH 5B3JE 1Z9SA 2VDQL 1GIGH 4MJ6A 4GG6B 2O5XL 5GS3A 1JNHB 1CN4A 4R26L 5I71C 1I9IH 4XWOD 1U8QB 5ICZA 2BNUB 2HT2C 4ODXB 3W0WB 5FO9A 5IV2B 1PGRB 1YPZA 4P3WA 4Z7QE 3HI5H 3MTRA 4MA8H 4QXGH 4PV8B 5HPOA 1RUQH 3IDIB 4XB8A 1QVOB 3SKMB 3O4LD 5GIRB 4HIEA 2PO6B 3JWOC 4BM7A 1ZLWH 3MXWL 1EDQA 5DURD 5KSUA 2YXMA 3CAFA 3BE1H 2DLGA 3HUJF 1VB9A 5F8RC 2O5XH 4S1DC 3KS0J 1JZ6A 4V2BA 5EBWB 1A7QH 3S9DB 5IHLB 4M1GH 2YWYA 3DX9A 5JNYB 3OL2A 2OM5A 3DSNA 4HUXB 4LPCA 3O3BB 3U0TB 4U0QB 3QXTA 4JGUA 1WICA 5C0AB 1ZTXL 4KAQL 3DRQB 2ITCA 3LZFH 3FQRB 2J7LA 5FAAA 3NCFB 5CSGA 4Y4FA 3HUJE 3RHWF 1MHCB 4GQPH 3WO4C 5HVFB 2LVEA 2M8XA 3QXDA 5DFWH 4KHXL 4MMZC 5L2KB 5IBLD 5DFVD 3U4BH 4N5UA 4W6XB 2BFVL 5ESQB 1U2HA 4ACPA 2E7LC 4F15C 4YHML 3GJEA 4WEMB 3ULSB 3IFPB 4N0RA 5D2LB 1I75A 5J12B 2D3VA 1HKLL 4R8WL 4L8CB 3SY0A 1EGJA 2PW2B 3S36X 1EZVY 1JWMA 3I75A 2E7MA 1GXEA 4PJDF 5GGTL 5T1MA 2FEEL 3MRRA 3B2VH 1CIUA 3H42L 1A9BA 3NZHL 4ZTOH 3T09A 1W72L 2VLMD 4NPYB 1L7IH 3TN0D 3ZSTA 5C71A 1YC8A 3DIFA 4I5BB 3I3DA 2D31B 4G6FD 2X4RB 1Y6MR 3JUYA 3OKEB 3T8XB 3LKSB 1NGWA 5E00B 5ETUB 1BOGB 2NNAA 1FGNH 1YQVL 1YYMH 4WFED 4XCFL 1OGAA 2PYFA 3UC0L 1UM5L 4TNVF 5DTFA 2R23B 5K59F 5D1QA 2A73A 5GGTH 4OSUH 3K4AA 3H42H 4XBPB 2EDRA 4QRRB 4KPHL 4PJDE 3P9LA 3U30B 1HCFX 1NDGA 2NY2D 5TE4L 5C8JB 3TFKD 3HNSH 4NIKB 4ZO9A 4PP2B 3PP3K 2X44D 3VCLB 4NNXA 4XCFH 1YQVH 1JE6A 3S35L 3SGDI 5C0BD 3UC0H 3WIIL 1JPSL 4AZ8A 4JFEE 3VXUD 2BVQA 4QHUB 3PDGA 4GAYB 1D6VL 3EYUL 2LE9A 4ZS6D 4E5XA 4HIIB 5K59E 3TYFB 3UTOA 5JHLL 2VN4A 4MD4A 1IJ9A 3MZGB 2EYTB 3ARBD 4M9OA 4WW1A 1IQDA 5TE4H 3LKPA 1QSZA 2ZOKB 3NCJL 4J1UB 3OPZL 4LARL 3MCLH 2YS4A 3MRFB 1A02N 1XGRB 1ZHNA 1CDCA 1QLRB 4WV1C 2D7PA 2GK0B 4M6NL 4NHCL 1WBZB 3ZL4H 1IQWH 1SBSH 4MNHA 4NKMB 5DJ2A 4C56D 25C8L 5HI4C 5DS8A 1ZT1B 5IR1A 1KF9B 5INDB 2JTDA 4Q7DA 2CMRH 4WENB 2I07B 4K7FB 3QUYA 1A8JH 4G6JL 3NCJH 4J3TA 1HINL 3E6HB 4G6AC 1MCSA 3OPZH 4OFKA 1UH4A 4RRPA 5GS0D 1LD9B 3ZT6A 5FKPA 5HHOE 4RAHA 1T5WA 3VFPA 3DMMC 3BYTA 4FZEL 4M6NH 3UEZA 5F7YC 3PQYB 2VRAA 3QDME 2D7MA 4M5YH 1OW0C 4DGYL 1YMHA 1E27B 2NXZC 4FQXC 4RWHA 1BP3B 1OTTC 1V7ML 4UAOC 1DANT 4YBLC 1BFOA 2BJMH 4LLQA 3NN8B 5HSFA 1HINH 3WJJC 1QLEH 3PDOA 5A16B 1LK3H 4FG6C 1CFNA 3MYZA 4WNQB 3NZ8A 1CE1L 2BMKB 2LQRA 4WUUB 4DUVA 5DHYB 3DI3B 5EWIL 4U0RC 1B0RB 4IHOB 3NH7L 1DTUA 4MNQA 1QSED 3KPOB 1HNFA 4AEHH 3NOIA 4IIQB 4KKLD 4DGYH 4ZXBC 2R39A 1V7MH 2VAAA 5DRNA 1I8IA 2F54E 4J3XA 5KAQG 2Y1VA 5KJRL 4ZUTB 3P0YH 4PGEA 4L4VE 4F57H 5IB2A 2WANA 3HCVB 4XVTL 1TTFA 2K3TA 1YN7B 5EU4B 4LKCA 5I30H 3D2UB 4QHMB 2HT2D 3E1F1 5CGYD 3RVTD 5DZOA 2A6KA 3M17A 3JSSA 2P5EE 4Z7VA 2Q7NA 1IGIL 2DB8A 2APXA 2IC2A 5IIEB 2DQUL 1KCKA 2R0KH 4NM8L 5GZOD 5KJRH 1OSZB 3RWCA 3HFMH 1QBLH 2V7HA 2IALA 3FB8B 5IESH 5JDSB 1JGEA 4ZQKA 4S1DD 5FO7B 2YPLB 3BMVA 4E9LA 3PNWA 3LKQB 3PJSB 1GOFA 2G5BB 4C83A 5HD8C 1KULA 1G7QB 2P46B 4YX2H 2E8ZA 5EOQH 1CDUA 2N7AA 3KYOA 4C59B 2DQUH 3G08B 4K23H 5DK0A 4AQ1B 4ZTPH 3P0VL 3TO4C 3ULVC 3VW3L 3FKUS 4LCCA 3P4NB 3K80A 1FSKC 5BVJB 3DETD 1T20A 1I1FA 1LO4H 2XZQL 4HK0A 1G9MC 2H6PA 3OX8B 5M94B 2V5TA 4JFOB 4U1HB 3SPVB 4NN5B 5D2NB 1NMBL 3VFOB 2XYCA 5DMJB 4QYOB 1FVDA 5D7LE 5I0ZA 3P73B 1LP9F 4JFXA 3GFUA 4RFEB 4LSRH 1OQOA 4J4PC 3S34H 2FGWH 4XC3H 3B9EA 3QFJB 3P0VH 1G7HA 2W65B 2NW3A 3HG1B 3BD5A 3IGAB 4J23A 4MLSA 5E08H 3BPOC 4NP4L 1T04A 3O8XC 4RMRA 1YYLL 5J0BA 5IF0A 1FV1A 3O9WB 1PQZB 4JY6B 2O5YL 5IUSA 1RQ5A 2VISA 3VWKD 1NMBH 1U8OA 4JFPA 2DTSA 3X12B 5E8EA 4LASL 2IG2H 3O2VL 1K8IA 5MEPB 3KLHC 3F7PC 4GAGH 2AW2A 3RGVB 3TN0A 3LEXB 5EBMA 1QO3B 4CDHA 1JVKA 3JVGC 1HQ4A 1Z9LA 5F89B 1LP9E 2X9YA 5EOTA 3AAZA 1SM3H 5FV1L 2QSVA 2CR3A 3OR7A 4DW2H 1GGUA 4QF1B 3QA3A 4UQ2A 4ZOBA 4QRSB 5I74B 1FVCB 4I18B 3QFDB 5CS7A 4CVUA 1KPVA 1V5JA 1WTLA 1IKFL 4OLEA 4LASH 3O2VH 3P9WB 5JO5B 1IM3A 5F1NA 4PGCB 3PF2A 1HXYA 4OJFL 3GI8H 3GMQA 1FP5A 3IXAA 2DIAA 4F7PB 1UACH 3B9DA 1YQ2A 5IVNA 1U8PB 3X3GL 3VXSA 2Y5EA 5ITFB 4HCRL 4JJ5A 3KPQA 1AO7B 2EYRA 5C0BA 3MOBL 3VXUA 1IKFH 1A6AB 4PBXA 4R0LC 2DOCA 3GSOA 4LRIC 4MQSB 1LEKA 3UTSB 5E6IB 4WTWA 1MREL 2QHRL 1DBBL 1JHLL 2HVKB 3MV9D 2DQGH 1N8ZB 4OJFH 1NJ9A 4NNPH 3S36L 5J7CC 4GRWF 3X3GH 4O5LL 4R96B 4YHNB 1XEDA 2CJUL 5ENWA 4LBEB 5FDWA 3QDJD 1A7RH 4NN7C 5IGXL 3MOBH 5I1AB 4H8WL 2UUDH 5HI4D 3L3IB 5IMKB 4BZ1L 1MREH 2F19H 5I1GL 1EO8L 1S7TB 2BP3A 3MGTB 4K7PY 4K9EH 4Y2DB 2XG5A 4U7KA 3GRWL 5MENE 3MJ6A 2FCBA 3OKLB 1YNKL 5CD5D 3O41A 1KCUH 1NCDL 4HKXB 3DO7B 3PWPB 4Z7NF 3JWDC 2CJUH 3JUZA 4PTTA 4GRWE 4NSKA 3DMMD 5CHNA 2D03L 4BFIA 1EBAA 4Y5XB 4PJHA 5KAQF 3MMEB 1R6VA 4FZ8L 5DK2B 1ZHKA 2FWOB 2NXZD 3HE6B 3IU3A 2VDNH 1OTTD 1ZK9A 4FQXD 2BNQB 2NX5B 5I1GH 1N59A 4NUJA 4MB5A 3MRDB 3GRWH 1IAII 2Y23A 1J10A 1KJ3L 3GSQA 2VC2L 2A74B 4Z9KB 2OR9L 1J0IA 35C8H 2WZPD 4Y8AA 1YJDH 2Q87A 3JBG7 4XT1C 2UYLA 1T66C 5DHVB 3KG5A 4YHYB 4Z7NE 2D03H 4N8VB 3TCXA 1Z2KA 2O26U 1XR8A 4G5ZL 1F4XL 4Q6IB 2JJUA 4PJ9B 2RQ8A 3MRKA 5IQ9B 5J13C 3VWJA 4B53A 2Q8AL 5HDBF 2FR4A 4AH2B 5SV4A 2VC2H 3DHJA 4MLIA 4TRPL 4WHCA 1YEJL 5D4QA 4G8FA 4GBXB 5E2JA 4KHTH 1M6OB 3QNXA 1FLTX 3ZYOA 3CK0L 3QDGD 4GKNB 4JDVB 3K8MA 2XN9D 3MA7A 5FHBL 3F5WB 3T2NL 5DMKA 1RUMH 4BUHA 5EUKB 3AXLB 3F7YB 1I1YA 3IFNH 3T77A 2XWJA 3BPNB 1T7XA 3IFLL 1NEZG 4F7TA 5HDBE 1ODAA 1S3KH 4NQTA 1ZA3B 5T3XD 2ZOLA 4WCYH 3MLRH 4X5XA 2ICWB 4J3VA 1WC7A 5JW3L 3TO2B 5DR5L 4EN3B 4I8DA 3L3DA 5IJKA 5MERA 4XX1G 3IDNB 4PRHB 4Z7WA 2QTEA 4NJ9H 5KW9L 4LCWB 3TO4D 3ULVD 4P2RB 4N0CC 1S9YB 1G9NC 4Z0XB 4KI5D 4BQ8A 1HE7A 2CUMA 2WMPA 3SDAD 1UM6L 4NO3A 3ESVF 4PRPD 1NCWH 2NZIA 4MNGB 1BIIB 5JIHA 1I7ZB 1MQKL 2W9LA 5ACZA 1NAMB 1BBDH 4GKOA 4NCC1 1WITA 4G7VH 5FYLD 4HHAB 1FFPB 2IQ9H 1OM3L 3MCKB 1J05A 3HZYA 1MVUA 5BZWA 5MEQB 1E6OL 1MCEA 1JFQL 4JM2C 4L3CA 4Z76A 3KJ6H 5EIIA 1UM6H 4M5ZH 3WJLC 5TE7L 2B20A 3ELAT 4X9BA 3TH2T 3QUXB 4UT9L 2F74A 3MYJA 2PTTB 4LPXA 3VWKA 4P23A 1S7RB 3QH3A 4D3CL 3KLHD 3MBEB 5DF0A 3G5YB 3FQUA 3W11C 1E6OH 1XF4B 1RJLB 1DLHB 2Z93A 5C3LD 5K9OB 1JFQH 3I6LE 1Y18B 1PD6A 2J5LC 2LU7A 2Z31B 1HYRC 4LNRB 3WNLA 4UT6L 1CXHA 4NC1C 4X7EC 1D5XA 5ICYA 2AJYL 3F7VA 3LAFA 5GRXG 2DYPB 3F58L 4ORGA 5EZLA 4JREB 2FB4L 4BA8A 5I8EB 3CX5K 1W0YT 1DE4A 4D3CH 4JZOB 1VENA 3VJ6B 5ECJE 5J6HB 4H0HB 4KUZL 4OQ1A 4OM1H 2I5YL 1CL7L 2QQQA 4OCYL 1IZJA 4UT6H 4L9LC 1UB5B 2Y4SA 3V6BR 5C08B 5D7KD 4KTYA 1EO7A 3FB7B 2AJYH 2HT3C 3MROA 1OF2B 4P57B 3F58H 1QFUL 5E2UL 3V6FB 1YNLL 2AV7B 1Q9WA 3CVHH 3K2UL 3EDFA 3BO8A 4OD2A 3A0OA 3O4LE 3D39B 3ZE1F 1WFOA 3VFRA 5BXFB 1ZANL 3MV9A 4WWKB 3BD4A 1MFAL 2I5YH 2XPGB 5KN5A 4BSVA 4RA3A 3Q5OA 1A0QL 4RDQG 3AFLA 4WW2B 5DD6A 4TUOB 3EJYC 2AEQL 2EE2A 4X6EA 4X9GA 2VLKB 1KN2L 4P2CG 1FDLH 1QQDA