2WWOA

Yersinia pseudotuberculosis superoxide dismutase c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
NDKASMTVKINESLPQGNGKALGTVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHLDPNKTGVHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDNYSDHPMPLGGGGARMACGVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Crystal Structure of the Yersinia Pseudotuberculosis Superoxide Dismutase (Sodc)
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Oxidoreductase
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wwoA00
1E9PB 1YSOA 1EQWA 1P1VA 1SXSA 5CU9A 4OH2A 2C9UA 1SPDA 3HOGA 2WKOA 1E9PA 3CQQA 1OEZW 2Z7ZA 3T5WA 2AF2A 2AQPA 1EJ8A 1SDAB 1B4TA 1E9QA 1OAJA 1SDYA 1DSWA 1Q0EA 1SRDA 2WKOF 1AZVA 1JK9B 1Z9PA 2ZKXA 1SXBA 2GBVA 3H2QA 1QUPA 3S0PA 3H2PA 4A7SA 1BZOA 1IBBA 3LTVA 1HL5A 1IBFA 1RK7A 2GBTA 1F1GA 3HW7A 1FUNA 4N3UA 2WYZA 2Z7UA 1XTMA 1SXAA 1XTLA 3KM2A 2C9SA 2WZ0A 1SXZA 3GTVA 4OJAA 1L3NA 2AQSA 3KBFA 1F1AA 1E9QB 1F18A 2Q2LA 2K4WA 3KBEA 1BA9A 3ECUA 1PZSA 2VR7A 4A7GA 2Z7YA 3QQDA 2ZKYA 2JLPA 5KBMA 1YAZA 1CB4A 1TO4A 3ECWA 1JCVA 1HL4A 4BCZA 1OZTG 1N19A 3ECVA 2AQTA 2VR6A 3KH3A 4A7GF 1XSOA 2AQNA 3GZOA 2WWNA 3F7LA 2VR8A 4A7VA 1SXNA 2R27A 4U4IA 2SODB 3CQPA 1PU0A 1PTZA 1ESOA 1S4IA 3MKGA 1TO5A 3K91A 2WWOA 3F7KA 1IBDA 1F1DA 4A7UA 2ZOWA 2E47A 4N3TA 3QQDB 5KBLA 4MCMA 3GQFA 3HFFA 4BCYA 2V0AA 1CBJA 3RE0A 3L9EA 1U3NA 3KH4A 1MFMA 1OZUA 2NNXA 2WZ5A 1KMGA 1DO5A 1E9OA 3PU7A 1OALA 1IB5A 1SXCA 1YAIA 2AQQA 1UXMA 1B4LA 3GZQA 4A7QA 4FF9A 2WYTA 3KM1A 2E46A 4L05A 4MCNA 1COBA 2ZKWA 2JCWA 1SOSA 2WZ6A 1IBHA 2GBUA 5KBKA 2XJKA 3MNDA 2LU5A 3GZPA 1N18A 2AQRA 2APSA 3CE1A 4A7TA 2XJLA 4B3EA 2Z7WA 1E9OB 1JK9A 2AEOA 3GTTA 3L9YA 1UXLA 1Z9NA 3SODB 4BD4A 2C9VA
chains in the Genus database with same CATH superfamily
2N7BA 1IAKB 3IDJB 3V7MA 1YEIL 5LQBH 3SQBA 1HT6A 3QFGA 1PPIA 5AVTB 1G7LA 4R90H 4PB9H 3H9HA 1AZCA 5IQLA 2N3JA 4FFZL 2LT9A 1EEQA 1OTSD 1QUPA 3H2PA 3FU7A 4PG9A 4JFHD 2NYZA 2JVUA 1P4LA 1UGKA 1AI1H 1FFOA 1FORL 1U3YA 5JR1H 2LTQB 2W8CA 1RJZB 2AW2A 1CZ8L 3OKOA 4P49A 1TEFA 3FN9A 1UA6H 3UAAA 4NOBA 1XF2A 4ZAKB 4JRXA 4JO4H 5AUMA 1KBBA 4ICXA 1BQKA 4HT1L 4ONFH 3HI1B 4V1DD 1I9JL 1E0OB 1E8ZA 3MODL 2F53B 1NIEA 5GS1A 4Z7VF 2K4WA 3V0WH 4KQ0A 4J2XA 1KB5B 3T08A 3MZGB 1WC7A 3Q7JA 5F9WB 1F3JB 2WMPA 4OFDA 5ACMA 1P7QD 5B39A 3QR0A 5HI5D 2UZYB 4LVHC 5K9QI 2X70A 3I02B 1MFDL 3NFSL 4F7TB 3UBGA 2W60B 4JHWH 4E41B 4GUPB 4ZTOL 5LGYA 4PJCE 4TQ8A 1BVNT 2ARJA 2FYVA 3U48A 4YXLH 3NZHH 4JKPL 4S0TD 3PWPD 3LKPB 1P2CA 4LHJB 4MAYA 3TESA 2YLKA 4NHUA 1Y6MR 3SE8L 1E6JL 3ZHNA 1QW8A 3QHZH 2XWCA 4LBAA 3QDAA 1L9TA 4N3TA 2P24B 3JQOB 2X1XR 4P5KB 1X4XA 2DZEA 1KUMA 5EU4B 1JK8A 2H6PB 2Z91A 4Y5YA 5E9DB 1AOZA 5E2WH 5GS1C 3TPUA 3O3BA 4Y8DC 4A38A 5JHBA 3UPRA 2ATPB 5ABAA 5TGBA 1WAAF 4AKPA 2EUWA 4U7SA 4L5FE 1S9VB 2APTA 4HWEL 5J13C 4I0KA 4PJGF 4WUUB 1EZVX 5BZWB 1TZGL 2OA9A 1P7HL 4HOZA 3B2XA 5E7BA 1A4JA 5KYYA 2LU5A 2Q8BH 2CIKA 3T6VA 1JERA 4G9FD 1NMBL 1DR9A 1J18A 2ITFA 3ZRSA 3FUJA 3AVEA 1T5KA 4R0LA 5F7WC 2F9BT 4DCQB 2GCYB 1KGWA 3T77B 3V5KA 4RQQB 2VLLB 5HDOA 4FQ2H 4D9RD 1IE5A 3HC4L 2QZ5A 1NLDH 2J25A 4XO5A 3VFMB 4LOUD 5I1HH 4NC0B 5LXGL 2NY1C 3VUAA 1EGJH 4XH2A 1CTMA 1JPFB 2VE6A 3QJTB 1INQB 4NRXB 1U3HB 3OPUA 1ZK5A 2UWEE 3MBED 3C5XA 3BZDA 1B0IA 2Y0SA 1QACA 1TCRA 3HG1A 2EDLA 5IW3A 3W81A 4NN6B 4R0LC 1EO8H 2ZAHA 3KPPB 3TA3A 3CH1A 4CBZA 1R1CA 2LU3A 1CN4A 3EH2A 2HLEB 4XC1H 4XCNA 4ZYKB 1FNGA 3SQOH 2GITA 1NAKH 1TR7A 3L9BA 3B4NA 4UM8A 5CD3B 3QI9B 3UJIL 1CGWA 4MDJA 1NBVH 2DAVA 3IJEA 3SJVD 2EE9A 3ECQA 3PIQA 5DUPL 2Z31D 3QZMA 2OJEB 2IDSA 2ENJA 3WO4B 2IFFL 3HI6L 1WIPA 3FT2A 4FOMA 2ZKHH 1A3RH 2FX8H 4XXCA 1FO0L 3P54A 1PD6A 3UZQB 3UTTE 3CVHL 4OQTH 1M05B 3FO1B 4ZO9A 1PG7X 5FWQA 3P2BA 1DZ0A 3SGDH 5JOFA 3T3PB 4FJYA 1MDAA 3ARZA 1EAPA 4OTXH 3X12A 3S97C 5CILH 1QFOA 3WFEH 4N0CC 4DEWA 4KK5D 2BW4A 2FRGP 3MYJA 2HUHA 2CU9A 1L7IL 3F6JA 4TUOA 4PCTA 3IPFA 4JW3A 3WNOA 2YQ3A 3B9AA 1BYNA 3WHXB 2JLLA 2X2IA 1J0HA 3GSNA 3IS0X 5A16A 2C9AA 1G9NH 2ENQA 3ZE2E 3X1BA 4KTDH 1DDTA 1V10A 3W9EB 5KSBE 4IHOB 4A7QA 1OSEA 3QUML 1INDH 5A7BA 4F92B 35C8L 3TIEB 3GSOA 3LRHA 3WTWA 4XPTH 3ARSA 4N2IA 1ED3A 1HZHH 5FA3A 3B37A 1AZRA 4UT6H 2JKSA 1XGQA 2B59A 2DQDH 1RK0A 4EMZA 1XGPB 1MCLA 4JVPA 2ENYA 1ND0A 2UUDH 3VXSE 4Y4HB 3MLRL 4JG1L 2X2UA 4M5YH 2RACA 3MCLH 3PGDB 2RCSH 5DLMH 5ADOL 1XSKA 5B8CA 2WOYA 2K7QA 5FC9A 3UL4A 4DFIA 1FZKB 1WFIA 3Q2VA 2Y6TE 2HTKC 4GH7B 3EFOA 4HMEA 2XFXA 3M07A 3RIAK 3GSRB 2D0FA 1QSEA 2EABA 3L9YA 3WUZA 1FDLL 1TNMA 3H42L 4JDEA 4PGZA 4YZFE 3X1FA 3ARXA 5EO0B 5E0QA 1T21A 2O93L 3PABB 5FDWA 1R24B 3GSVA 2G2PA 3LKRA 3NRQA 4GKZB 4P2RA 4RVBA 3CMOL 3M1BA 1GAFH 3FT1A 4YDKL 3HZ3A 2FEEL 2VN3A 4QTIH 5F1NB 5C0JB 4OZHA 3CBJB 1GGUA 3U9PH 4YXHL 1T20B 1OLZA 1FAIL 4F8NA 1PLGL 2C8NA 2WUCL 4JMNA 3CPLA 5E8PA 4X6FA 1JZ8A 4Z7OF 2DWDB 2WBJB 4P5TC 1RK7A 4X7CC 5L88H 2AJ3A 2A6IB 2EDMA 3HHRB 3DUUA 4K0OA 3QEGL 5E1GA 4N3UA 2Z7UA 3PWVA 1U6AH 4OZ4A 4LSRL 3FUEA 1T3FB 2IGFH 3QXVA 1AP2A 1IKOP 1M57B 1MI5D 3SCMD 3TYGH 5J8OA 4GRWF 5DJ2B 5E1AA 4AGOA 1CFSA 2VCOA 1GGBH 3QEUB 4PI0A 3N0PB 4JDVB 2AZUA 1RZFL 4MJIE 4PUBL 1ZLDA 4HUMB 4IK7A 4Q8BA 3W9DA 2MKWA 3VFVB 4PJDF 2RIKA 2DEWX 4L8DA 2FO4B 4A2GA 3NBNA 4HFWB 1NANI 3RVVD 5IHUL 3L3OA 1QLRB 2C34A 1Y1DA 3W82A 4H20H 3TNNB 1SYVA 1U8QB 4HJ0D 4MVBC 2WWNA 5FYJE 1JDAA 5I9QB 2ZNWA 3KXFB 2ADIB 4P2OD 5C0BA 1CF8L 1JBJA 3SYAA 3LZFH 4LMQI 1CYGA 3FQ2A 5HHVL 4P9HH 1RZGA 3WLWD 1DQDL 5FKAA 3WMSA 4Q2ZA 2HRPH 4IU2A 2IGLA 4TVPH 5D1ZD 5HHOA 3QQDB 3GKWL 3JWOC 4UM9D 2B4CC 2RAMA 1NGWA 3F58L 5FO9B 5JDJA 1XIWD 3BGFB 4YE4L 4JDZB 3ZDXF 3DYOA 3UIZA 2LR4A 5C08B 5DZPA 1DO5A 2CZNA 5KBNC 2YIHA 4QOKE 3PU7A 3GRWL 4HWBH 1MREL 3L3OC 5IB3B 2O5YL 1UD4A 3R19A 5IQ9B 5KANG 3NP4A 2XQYK 4JFZH 4RWYH 3V5DB 3QWRA 1I8UA 3OBAA 2VDNH 1EXUB 3QUKA 4JRYB 5DDHA 4TOYL 3VFPB 4PGJA 2IF7A 2JJVA 1E90A 4QRPA 3Q8EA 3PWLB 5EU5B 1ONQA 4L5FL 4QMEA 3P4OA 1CD0A 1T2QL 3HR5B 2LHAA 1SQMA 3DVFA 5I1GH 1EFXA 5MP6H 1P5VB 2OMYB 2XXMB 2B1HL 2H5UA 1VLXA 4GIAA 3JT2A 5TE7H 1KLFA 2G75A 3EYFA 4FQJL 2FATH 3U4KA 3D4CA 3D07A 3UAEA 4F33A 3FL7A 1RULL 1E5UI 5I1AB 3MHZA 4ZMWA 2BVEA 4PJ5A 4JFWA 4X5WB 5K69A 4U33A 4BBWA 5I8CB 5JPMA 2MTAA 5ILTH 2CXGA 2MTPA 3CFQA 5DMGD 3W5MA 1V7NL 1OEZW 4HD5A 5CINH 2QMKA 2BDNH 3CZEA 4ELKB 1DVXA 2GTWB 4ONHA 4KK8C 3OHXC 2ZUTA 1CD8A 2BY0A 3E6FB 1QX1A 4YSOA 4MBRA 1DSWA 5A2AA 5LBSH 4N2EA 1F6AA 3WFBL 2YD5A 1W0WB 1QLEL 4QRTB 3S0PA 1GGCH 3SY0A 4YDIH 1HWGB 1IBBA 3IXTB 1WLHA 1PCXA 3K6DA 5A2LH 1IM9A 2R69A 3EOYG 2QR0B 3CZFB 2B9AA 3OKMA 4KK6D 4AZ8B 1PSKL 4PS4L 2GJ6B 3P02A 4DP7X 5AW5B 2FSEB 3HPJA 5D70L 1RIHH 3SBRA 4HWNA 4ZPVB 4MQXD 4OJAA 3RL1B 3GT6A 3VXNB 1KDIA 4P57B 1L3NA 5IROA 4JNXA 4ZX3A 1KCBA 1AFVH 4QT5B 2K9FB 3QNFA 5I1IL 2DQGH 1MCDA 2HJLA 3JV4A 3KYKH 5M94B 4ZDHA 1YN6A 5JPMC 4N2LA 5EOCJ 4UBDD 3TBSA 4MMZB 3ARTA 3VW3H 2IPTH 1INEL 4KUCD 3PP3K 3QFDB 3MMEA 5C2BH 1BLNB 5IMLB 5EUOE 4YEFA 3OX8B 3NSJA 1WWCA 4X4XB 3DXAB 5DVMA 3T3ME 4KHXH 4NKDB 2CMRL 4BWWA 4H25A 4XWOC 3K91A 1NWPA 1ADWA 3ZKND 3UBXA 1J86A 5B7FA 5CFHA 5IB1B 5ICZB 4OZIF 1KACB 4JFFE 1FP5A 3CZNA 3HFFA 2I60H 3D52A 3CBKB 1NICA 2XOTA 5MEOB 1XDTT 4TV3A 2DM3A 3UFIA 1SJXA 1JV2B 1XR8B 3KNBB 5AZEH 2NY4D 2V8MA 1YEEH 2Z1KA 4HIIB 1G7MA 4LLMB 4XNMB 5D8JL 2R59A 2WUBL 5ANME 4KXBA 1YEGH 3DJZA 4B0MM 3NCJH 3QW9A 4GAYA 3B6SA 1A6ZB 2XFGB 1ZV2A 4EI6A 5GS3A 1EDYA 4OGXL 7PCYA 4LHUA 2E86A 1XCQA 4OZGF 3D39D 1IAKA 3IDJA 3BMVA 4KXDA 3DC0A 1CU4H 1IU1A 5DJCB 4I0CC 4NJAH 3QBTB 2R2HB 1UWGH 4UB0L 2EYRB 5GZNA 4JDTH 2Y1AA 1LO5B 1J8RA 4GMTL 3LRKA 1GZHA 4IBUA 1R6VA 4UT9A 3NIGF 4OLZH 4N0YL 2P44B 3PJSB 3JTTB 1J8KA 5IQNA 3MA7B 4TLTA 5T5FH 2FYYB 3GWJA 3QUXB 4EDXB 3O4LB 1U8PB 1JTPA 2GK0B 1RJZA 4W9KC 3N06B 5JA9A 5IHHA 2OMBA 4M5TA 1SPDA 2X41A 1SDDB 3SGJA 4IHBA 1O9WA 3JWNG 2E8ZA 4PJBA 3HI1A 4JFOB 1R5VA 2F53A 5EIIB 4WV1B 3KMDA 1KB5A 3SKJH 2P52A 2Z93B 2YD0A 1M2VB 2V3DA 2BVTA 1GC1H 2OCFD 1F3JA 3UEQA 4AVIA 3KPRB 5BRZD 2UZYA 2BXZA 1E5AA 5GZNC 1UYWH 2R7EB 3I02A 2XY1A 4F7TA 4E41A 4GUPA 1WUZA 5I66B 5D7SH 5F6HJ 1T03H 1J9CT 1IIKA 1SXAA 4X50A 1BQRA 4GY4A 4ONGH 3LKPA 1TZ8A 1OTSC 4N1EA 1I7ZB 3RB7A 5J9PB 2F0CA 3O3DB 4EDWH 4NC1E 5T3XD 2P24A 4P5KA 4FERA 1A7RH 5EU4A 1JCVA 2H6PA 5E9DA 2GI0A 4YEEA 4KKCD 2LE9A 1TMCB 3QEQE 3BFOA 4H4NA 1IGYB 2QGCA 2ATPA 4ACTA 3GNML 1HS6A 1N8OE 2IDTA 3PAUA 2VO5A 1NBYB 4HPOH 2IG2L 2XYBA 3T2NL 5EEXA 4WUUA 3NJHA 3FO2B 4NN5B 1PQZB 4YPGB 1SYSB 5JMRA 5FYJL 1JZFA 5BZWA 1XO8A 3R7QA 4AQ1B 2IAND 4I0PD 4NO2A 1CBJA 2VLJD 3FUNA 5FO8B 3KLLA 4AGPA 1PJ9A 2WQXA 1S78C 4MXQD 4DCQA 2GCYA 4PJEE 2ZXGA 4K2UL 1I3VA 3VRLE 4RQQA 4N6RA 2VLLA 4CRPA 4QKTA 1J1XH 1P84J 3QXAB 2D7TL 5BZZA 5AL8A 2OYLA 3S48A 3VFMA 1GYCA 1A4BA 2AKRB 2X4PB 4JN1H 3SDXF 1PZCA 5F8QC 3PPEA 1AIZA 3EZ8A 3K2UL 2DLFL 4YPJA 3HBZA 1JPFA 3TVMD 4NRXA 1INQA 4POZC 1GMEA 1U3HA 2CXKA 2QGBA 1ZV9A 3VXUB 3PV6B 1P4IH 4YGVB 4PPTA 5IOKA 4KJWD 3HE6D 1KXQE 4QKXB 4ZTPH 5FGCB 4UTAH 2QKIB 4F2FA 3M86A 3RYMA 4RNRA 2NX5D 4Y2DD 3ARUA 3KPPA 1MHPL 1G5AA 1CFVH 2V9RA 3JBG7 1NBQA 3OZ9H 3RPKA 4ZYKA 1A6UL 4PP1D 1F58H 3D12B 4F9PA 1WBYB 4GRWH 5HHME 5CD3A 3QI9A 2YQBA 2FNBA 2OZNA 2YD2A 2Y3AA 4JZJB 5D9SB 3U2SB 1PG7H 1VA9A 3BAJA 2OJEA 3NSXA 4DT2A 3PPSA 5E4EC 4DVBB 2XQBL 1FO0B 1TJGH 2CK0L 3EJUA 4PJAE 4RISH 3CVHB 4XO8A 1XGRB 1F3DJ 2P46B 5KSUB 1OGTB 1GOFA 5EOQH 1K6QH 3G9VA 3UZQA 5E6ZA 4IRZH 3FKUS 1M05A 3FO1A 1TDQA 4FLQA 4AMKH 5FECB 3U4BL 1NGQL 2WSPA 2RD0A 4PWFA 4RLDA 4ZZFA 5BV7H 1JHKL 4ATTA 4NQED 1ZRUA 3GPEA 4P4RB 3VCLA 4XP5H 2ZE0A 3C8DA 5CCJA 2JJWA 3NCWA 4YK4B 5DCCA 4F8OA 3CHSA 3FFOA 3L5XL 3US9A 1JF5A 5L4FA 4CC1A 2G3MA 4R83A 1E4XL 1XGYH 1ZT1B 5HI4D 4NQUA 3WHXA 3GINA 3L7EB 3G08A 5A7EA 4TLKA 3TBBA 1Q38A 4MS8C 3W9EA 4IHOA 3MUHL 2GJPA 3PY9A 2OS7A 3H9SD 3MV11 5DK0B 3CJJA 4GFXA 4XWGH 3TIEA 1Q1PA 2Z31C 3NDYE 4X2UA 2VZTA 1A7QH 3IMSA 3KR3L 2J72A 4JFED 5CGMA 1XGPA 1A21A 2YUXA 3EZJB 4Y4HA 2GY7B 4RFOH 3B8YA 1DQVA 3PGDA 4RDQF 3UH8A 4M5ZH 1FZKA 3ULUD 4UTCA 1GMIA 4Y9BA 3WBDA 3AT0A 2VH5H 2FT6A 3GSRA 4RMBA 1N0LB 4X8JB 5EBMB 5TF1L 4CADB 5TTRA 1HI6B 1PX8A 3FT9A 1RZIB 5EO0A 1RUQL 3PABA 3DLQR 1D5MB 1R24A 2DTMH 4GKZA 3EDDA 1P6AB 3A4DA 2VW6A 5C0AE 3M88A 4H8WL 5F1NA 2XBZA 4A55A 4DQAA 2F1EA 5TQ2H 5C0JA 1GS6X 5ESAB 4QO1B 1OW0A 4TQEH 4WRLA 3GM0A 1SGKA 3FT3B 2DWDA 2ICES 2WBJA 4JZOB 1MCPL 1OTUC 1VEOA 4FD0A 4Y4HC 3WAKA 3MRKB 1MEXH 2VQ1B 3P3UA 2A6IA 2VDPH 3E6HB 2DQIL 4FXTA 1XZ0B 1N64H 1SOXA 1T3FA 5AW6B 4H8QA 1KYOJ 1G4RA 5HDLA 1OAZL 1PX3A 5DJ2A 2XWTB 2XN0A 3QEUA 3UPAA 3ZXAC 3D25B 3NCYS 1ET8A 1U91B 1RUAL 3VFVA 3EOTH 4ZMXA 3X3FL 2FO4A 1LTXA 4Q6YA 4ANWA 4HFWA 3LS4L 1SFHA 3QC5X 1WAPA 4TMPA 1QLRA 4AGQA 5KG9B 4ZW5A 9CGTA 5T3ZD 1FYTD 3TNNA 4H8PA 3CTTA 1U8QA 4FEIA 2YO3A 1JGVL 3PV7A 1OW0C 3KXFA 2AI0H 5K9KB 2H6OA 1I1AD 1PY0A 2Z1PA 1EANA 3TPKA 3GTVA 2M83A 3L1EA 2EEAA 2OSYA 5DWUL 2H3NA 3CDGB 2YOCA 4PJCB 3C5JB 4LL9A 5F7YC 2EE3A 3NH7H 2ZOLB 3DPDA 3N40F 3QQDA 3RZCD 3AW5A 4HZ1A 3HBQA 3O9WB 5MEPA 1GRWA 5EPMB 5FO9A 2KKQA 4MJ2A 2KDGA 3QFJD 5BNXD 4JDZA 2J57A 3HZMB 4WNJA 3SKOA 4R90L 2AV7B 4PB9L 5C08A 4BQ9A 2VKXA 2YK1H 4FKHA 3K4DA 4ZI8A 3C60D 4NWTH 2JSFA 1O6TA 1BG9A 4WWID 5IB3A 1AI1L 5E7FA 3RUGF 5IQ9A 2XI9A 4TQIA 4WI0B 3Q9QA 5JR1L 4V11A 3V5DA 2WXHA 1MJ7H 1EXUA 3VFPA 1N12A 4EVNB 2YD3A 4RX4D 1GW0A 3QYNA 5EU5A 3PWLA 4DGVH 1AOHA 4HJ0C 5EBWB 3SGKC 4ONFL 3HR5A 4P2OC 1J8SA 1PG7W 3V0WL 3ZTNH 3FDWA 2GFBB 3EOBB 3QDME 5GHWH 3IAQA 1P5VA 1WA1X 2OMYA 3BZ4B 3QC6X 1JZ4A 4GG6F 5KZCD 3HC3H 4P59H 5AVXB 2YGOA 3BGFC 2YPVH 3FK3A 4TNEA 4ODHH 4JHWL 1ANUA 5I1AA 1OAUH 3FSVA 1PEWA 4TVPE 1EHXA 1OT1A 4X5WA 5I8CA 5DFWH 4DUXA 4R7XA 3LQZB 3MXVH 3NZHL 4HZAA 2EDFA 4F2EA 3VMNA 1QLEB 4ELKA 2GTWA 1X44A 3CXFA 3ZHLA 3E6FA 5JXEA 4G5AA 3LXAA 3QHZL 1JTOA 3G6JF 5TFSH 1FSKB 3VD2A 1W0WA 2EVGA 4QRTA 1C7SA 2NUTB 4HAKA 3IXTA 4JRXD 5C86A 4G5ZL 5E2WL 2UWEB 2OMZA 5F1SA 2Q9OA 2QR0A 1QPKA 3CZFA 3LNEA 3VXQB 2XIDA 5BXFB 4JGNA 4AZ8A 3EHBD 2GJ6A 1FF5A 2FSEA 2B3RA 4ZPVA 2ZUUA 4HHAB 2VLKD 3RL1A 3VXNA 4P57A 1EJ8A 4R9HA 1F2XK 2JCCF 5ITFB 1DJSA 1A9EB 4QT5A 1DJXA 5SWZE 5I0YA 2WKOF 1CDBA 2FH6A 2Q7YB 1WD9A 1YY9D 4MJHA 2Q8BL 5D2LE 4MMZA 3Q6FB 3AFLA 1H6UA 5I28A 1G0YR 3HVDA 4LARH 3UO1H 3APCA 4MAYD 5DD1H 5C3LD 3QFDA 4W9GC 4J8RB 1BLNA 5F0MB 5GGSY 3OX8A 4X4XA 1KOAA 1SZNA 3DXAA 25C8H 5FV1L 3PNRB 5FUCC 1EEUA 2ZG3A 4NKDA 4FQ2L 2WTPA 4RSYA 3WCYA 4AXWB 2DPKA 1NLDL 4L8BB 4IRJB 4QY8B 3UTTB 4LNRB 5I1HL 1ROWA 1YNTB 3K6OA 4Z7VE 5ICZA 3HAEB 4KKNA 3QWNA 5IB1A 3WFCH 3NP3A 1EGJL 1HIMH 4L4TD 3AG1B 4DGIH 1Z5LB 4G8GB 4LU5H 2XNAB 1JAEA 3C6SB 3F8UB 4KK6C 5EO9B 5MEOA 4HUUB 1JPST 1XR8A 1JV2A 4IKLA 5CZXD 2VR8A 4LLMA 4HIIA 3PL6B 4XNMA 3MRQB 4ZUUB 1AE6H 2VABB 1A6ZA 1G5GA 4BE5A 3QUYB 2SEBA 3ZE2B 5AVRB 4UBDC 4LPXA 5KSBB 1UKQA 2D9CA 3O6FA 1B9ZA 2KYIA 5D7JD 5EIVA 5IGXH 4N28A 1BDYA 1XV8A 5DJCA 3SQOL 2R2HA 1MFMA 1NAKL 2EYRA 4FFZA 2CAKA 2OYMA 1A6WH 3HB3B 1LO5A 5MENE 2HSIA 2WINB 4Q6IB 2ZCHH 4FQIH 3SDCD 5FYLH 3VXSB 1PZ5B 5IUSA 3PJSA 3JTTA 1WAAE 3MA7A 5D7IF 5T8IA 2FYYA 4PD4K 1QG3A 3QUXA 4X4ME 1U33A 4DP8X 4EDXA 4ELMF 4EI5B 3O4LA 2ZKHL 1U8PA 1A3RL 2GK0A 3TCLB 2PCFB 1G9HA 5T1KB 4OQTL 5D1ZI 3VI3A 3TEUA 4X9BA 4PJHE 4WI8A 3R0NA 1E65A 1SDDA 1DDHB 5FW6A 2NY4C 3MNVB 4OTXL 1G6RH 4JFOA 1BJ1H 1DQMH 3G5YB 3LKSB 5CILL 2MQ3A 4WV1A 2DIEA 4BH8B 3WFEL 1AYOA 3O6FC 2Z93A 1NUFA 4MB4A 1M2VA 5INCB 4HJEA 1RVFH 1U8OA 5IJKA 3KPRA 1NJ9B 3TH2T 1PY9A 3QDJB 5B22A 4P23C 4WWKD 5I66A 3O8XB 2WWKO 5EU6E 1G9NL 4EZKA 2Y7OA 4YQXH 4R4ND 4KJPD 3O6LH 5LNDA 3LD8C 1BPVA 5DUBB 3Q1SH 2MOVA 4OCNC 3MRGB 4KDVA 1EAQA 1I7ZA 2EE2A 4XPBH 5J9PA 2VXVH 3O3DA 2FD6H 3OAYH 1P6WA 4M3HA 3RY6A 1JYNA 1DBMH 2DQDL 4MJIB 3SOTA 5AKSA 3LNHA 5IBTH 5FHBH 3ZKSD 1SY6H 1TQTA 3QORD 2DWTA 4M5YL 3MCLL 1QPPA 2RCSL 4M1DH 2R8SH 5DLML 4WV1C 2NY3D 3EJYC 3QARA 2EVHA 3O3EA 1IGYA 3UGEA 4JPVH 3N41B 1PD0A 3D6GA 3JWDC 4HIXH 1JGIA 1NBYA 2EDNA 3WEBA 1MHHB 3JVFC 2X1WL 2BY3A 2Q2LA 3FO2A 1PQZA 4YPGA 1SYSA 4F1ZA 1QVOA 2UY6A 3KWWA 2AQ3A 3FB8B 3DK2A 4AQ1A 1WYJA 5E24E 2NYYC 4DAGL 3CFJB 5BRPA 1N19A 5FO8A 4JZNB 4CKQA 4F8PA 4XMVA 4U3HA 3EJCA 5EZOH 1JD9A 1NCIA 4OZFH 1MQKH 3U9PL 5I71B 4JY6B 1JFQL 1DQJA 1OHZA 1FZOA 3EH1A 2B3IA 2IDFA 4WI3A 1AZBA 4KK9C 3VMOA 1MAMH 2PXYD 4QOKB 4ZFOL 3QXAA 1A7PL 2ICWJ 5F3BB 1WO2A 1T2JA 3NJIA 2AKRA 3TYGL 2ID5A 1B4JH 1SVZA 2X4PA 4DO5A 5MEQB 1RPKA 1GGBL 4LCWD 4Y1AB 5F96L 5HGHB 1QSED 4AYDC 3AQYA 1XQ4A 2BP8B 4FQCL 3I2CL 3SKNB 5FWRA 3TV3L 4YNYB 3WNPA 2HLFC 1OAYH 4LIQH 3VTMA 3VXUA 3PV6A 4P2RD 4YGVA 2YHGA 4LVNB 4KH2A 5D7KD 1L9SA 2QKIA 3FAXA 2HKAA 4DO4A 4I0PC 1X5GA 3FT0A 4DKEH 5JTWA 3TTYA 4PGBB 4L1BA 4MASA 3VGAB 1IVLA 4AKOA 3HAEG 4LLVB 1YEHH 4LDLB 4MXQC 2VDRH 2WN2A 1RCYA 4P9HL 4OV5B 3LV3B 2C1PB 5IW6B 4GRLD 1NFDF 5CIPH 1WBYA 3AT8A 2XTJE 1QFUH 3KLHD 4F27A 4HKZB 1CT8B 2HRPL 4TVPL 4JZJA 5D9SA 4MRBA 4WKXA 3U2SA 3U7YH 5ISZE 5K9OB 1CYWA 4GXVH 5J7CC 5DS2A 4DVBA 2QVIA 2IH1B 1FO0A 2JKRM 3CVHA 1XGRA 1KYUA 3L4UA 1FVDB 5KSUA 1OGTA 2KLTA 3QCTH 4N86A 2IVFC 1P1VA 1SLWA 4HWBL 3TVMC 2ADYA 4WO4A 5FECA 1UEMA 2QKIC 1WSST 4ZMLA 5E99H 4GP8B 4JFZL 2X6UA 4RWYL 3FSZA 1UCTA 2VDNL 2WY3B 3SPHA 4IOFC 4LKCB 2C3HA 2F5AL 5IFAH 1TVHB 3HE6C 3VNYA 4OB5L 1T2XA 4P4RA 3E80A 4ZQKB 3AXIA 1QWNA 2WLZA 1NEZB 4XNDA 3WIAA 3QNYB 3PXLA 4Y2DC 4FYQA 4Z7OE 5DD0H 5I1GL 4PGEB 5CZVH 3PHQB 5EMYA 5MP6L 3IE4A 1W15A 3QUMA 1ZVNA 3RWGB 2XN1A 3SD5A 3V6BR 3EJRA 5TE7L 4XVJH 4GG8B 1J0KA 3H56A 1CF1A 3ML9A 5DK0A 4ZMZA 3LIUA 4FQ1L 2ATAA 5EUOB 5LCVH 3BPNC 1EMTH 4IOSA 3T3MB 4HC1H 2Z7YA 1BBDL 3QJVB 2Q3XA 4J3VA 1QI4A 4U2YA 2CHZA 3DA0A 3GMRB 4WO4C 2GI7A 5AYQA 5L4JA 4LSVH 5CINL 3DECA 1UZ8B 2C4XA 3STBA 3RIFK 4ANKA 4JFFB 4M8QA 3U30B 4I9WD 1KGYE 2GJJA 5EF3A 4YK4C 4CADA 5EBMA 1N0LA 4X8JA 1CR9L 1TOXA 4YBHA 1HI6A 5ANMB 1RZIA 4HK3N 2ZUYA 4YBLB 1UM6L 3N6YA 8PAZA 1D5MA 2Z8RA 4XTRC 4BSVA 4KX7A 5EZJB 5DJYB 1KYFA 4BK5C 5HI4C 4BXSV 1TZAA 2ADFL 5GGRY 1AFVL 4K07A 1N2RB 5DYFA 1HZKA 3KYKL 5ESAA 4QO1A 4G1MB 4IJTA 2X2JA 2LGNA 3FF8A 4G3YH 4HWUA 3FT3A 3T0AA 5EIQA 4JZOA 3VW3L 4MB3A 2IPTL 3X11B 2VQ1A 1I8MB 1N26A 4XVSH 5FLUA 3TBTB 3APNA 3E6HA 2QADD 4PJXF 1KBKA 1QWUA 1XZ0A 2HUEA 4GAFB 4OGAC 2YXVA 1ETA1 1J1PH 2VZVA 1RZJC 3DV4A 4OF6A 3UX9B 2XWTA 4KHXL 1X4ZA 3BE1H 3D25A 3ULUC 4I5BB 1U91A 2A9AA 2FQEA 4GO9A 2XIBA 3H9ZA 1AGBB 3ETTA 2BIOA 3IJ9A 5GJSH 2I60L 1MY5A 1W91A 1UJ3C 4ANVA 2MSPA 1GJWA 5KG9A 2AK1L 4UTBH 1DZBA 2DKMA 2GAZA 5IROD 4E68A 2R1WB 4BFGA 3CSBA 5AZEL 1WK0A 3QP3A 1YEEL 3MRLB 2EIKB 5K9KA 1YEGL 1CL7I 3NCJL 4X83A 4HUNB 5BW7A 2JQAA 2IDQA 1QTYT 4PJCA 4RAHA 1OAJA 3HG4A 3C5JA 3MTRA 5EZIL 1BIIA 1CICB 2ZOLA 4PIBA 4A7SA 1CJYA 1CU4L 5A2KH 3O9WA 3VGDA 3GMMB 5EPMA 3SSGA 3IJ7A 1RAMA 1UWGL 5E1QA 3HZMA 3GRWA 1QP1A 2EDEA 1HXYB 4ZFFB 3HNTH 2AV7A 3NJVA 2NNAB 4LRNH 1C8QA 3FN3A 1KGUA 4XMKH 4Y5XC 4GIPD 4G42A 4OLZL 4YAQB 1BVLB 4U1NB 5BOPA 3QEQB 1SXZA 1S5IH 2AJVL 3EH4B 4X7EC 2IMMA 1Z6JT 4TTGA 4WI0A 1L6PA 3T2OA 4TTDD 1ZSDB 3GXMA 4MKTA 4KZDH 1UZ6E 1J7VR 1SJEB 4P04A 3GM8A 3LQAC 2ZF8A 4NLHA 5CR1A 4IBWA 1KPVB 4XN2A 3RI5K 3EBHA 2BCMA 2GFBA 3EOBA 3DI2B 4LHUD 3F83A 2DQTL 3BZ4A 1GC1L 2I69A 3QWQB 2OYKA 3CQPA 5DYOB 3ESOA 2ORBH 3V4VH 1A3LH 4PSPA 3P0VH 1QYGH 4IKNA 3RZCC 5I6NA 4PJEB 4KQ4H 3LH2H 5JXAL 1KXVA 5D7SL 2P5EE 4PFEA 5F7BA 1UJTA 1T03L 3P11L 3M7OA 4KXZI 1NUDA 1IL1B 1V7MH 3LQZA 3KPLB 3ARYA 4HCRH 4Y9FA 4OZIE 1IUZA 4ONGL 3WOVA 3C60C 1CWVA 3WDHA 4EDWL 3BMWA 3BIKB 4RFNB 2FJUB 4HIJB 3IN0A 1B3JA 1A7RL 3B7SA 2NUTA 4HS8H 4ZAKD 3EDFA 2UWEA 4NENB 3VXQA 4M6AA 5BXFA 2A9DA 2ODHA 5EZLB 4HCIA 4HPOL 1W80A 5A2IH 3L13A 2K7PA 1JMXA 4HHAA 1HJBC 1KLGB 3KJ4C 2ZG1A 4X8XA 1KXVC 1A9EA 2J1XA 4HJJH 4E41D 3SQRA 1OGAE 3OMZA 5EORL 5GS0D 2Q7YA 3BHBB 2HWZH 2O5ZH 4YHPB 5HHMB 4AGMA 1BF5A 3C2SA 1A64A 4P4KD 3PWNB 5JW3H 3TU6A 3SYOA 1E5BA 2VXTH 3DOSB 4J8RA 4UIKH 3FQ1A 4LPYA 3ASWA 3I3DA 4M9PA 3ZHKA 4PJAB 1KV3A 4WY7H 3ELAT 3P4NB 4PM1A 4AXWA 1LK3H 1J1XL 2NXZB 4UDTB 4L8BA 1W8OA 4IRJA 4QY8A 4LNRA 4XB7A 3UTTA 4S1DD 1YNTA 2B77A 1OF2B 2YEZB 3HAEA 4K7PL 4JN1L 4ODBD 4PRBB 4CGTA 1CXIA 2BC4B 1KELL 3CZSA 1PZ2A 3BGMB 1Z5LA 2ZQKA 4G8GA 2XNAA 3C6SA 2DQUH 5CO1A 4HUUA 1MCOH 4KOBA 2IMNA 4X7SH 3KPSD 4EZMA 4WEUD 2EIMB 1I85C 2OMUB 3PL6A 3MRQA 1A6PA 4ZUUA 1Y18B 4DP5X 4YHZL 3DK0A 5IP4A 2AJSH 2VABA 3ZDZF 3BWAB 5C0DA 2DLIA 4UTAL 2OW7A 3QUYA 4K8RH 2HXAA 3OLIA 4GFTB 4M8RA 3MLWH 5KSBA 3QIWC 2YBRB 3HS8A 4QAWA 1CFVL 1H6TA 3OZ9L 3WNNA 4AV5A 3EG9B 5FUZL 1F58L 4TNGA 3BPLC 1OCCB 2CK2A 2WINA 4Q6IA 4XBMA 3ZDWA 2OTUB 2JMRA 3ASOB 3VXSA 2ZWZA 3PAYA 1PZ5A 3GJFH 4Y4FD 1SN5A 5PCYA 1BQHB 1X7QB 5I23A 4RISL 4N5EC 4BK4A 3CFCH 4A6YL 1MAKA 1I8IB 3T8MA 4EI5A 1F02I 3TCLA 4FYSA 5EOQL 1B2WH 4MHHI 1K6QL 1U3HD 2PCFA 2WBKA 5KBLA 4IRZL 5T1KA 3ZE0F 3EFFB 3PFQA 4AMKL 2EEBA 3L4YA 1DDHA 4XBGB 3QUYC 3MNVA 2HTLD 2AEQH 3LKSA 3G5YA 5D1XD 5A6IA 5BV7L 2Y2TA 2A6JB 4BH8A 1YYMH 3FPYA 4JQXA 5INCA 3X13A 4XP5L 5B1BB 4LHQB 1NJ9A 5KBDA 1A2YB 1T1WB 4X6DF 2XKNB 3QDJA 4WW2B 4IDJH 3APFA 5D7JC 3HB3C 3GBEA 1Z9LA 3HE7B 3O8XA 2CDFB 2NZ1A 2IPUG 1QATA 3H2WA 1BOYA 2DTSA 1AO7E 1E6OH 4GW5B 3FUFA 5L8JB 3GLZA 1V05A 5DUBA 4XWGL 2ILLA 5FYLE 4JKNA 1A7QL 3UGUA 4DSYA 1SBBA 1A9BB 1UFUA 4MJIA 4OF5A 1DEEB 4UQAA 5EO1B 1GJUA 1KEMH 1FIGH 3KWUA 4RFOL 3MBXL 5SWSD 2WOBA 5B4MC 3GSUB 4M5ZL 4JQXC 3ILPB 1QOKA 2HG0A 4I85A 4LEXH 3G04B 3PLYA 1AXSB 1OOAA 3CLEH 2P8PB 4XC3L 2IIJA 2QBWA 3ZKXB 1MHHA 3V0VA 4C58B 4UQIM 4JFDE 1BFVH 3KYMB 2J6WA 1B0WA 3FB8A 3IMBA 1IJNA 3CFNA 1OM3H 1N5YH 3RA7H 2DTML 1AGCB 2VZUA 3CFJA 5C1MB 3K6FA 4OZHF 4WWKC 4B9GA 2R51A 4D9LH 5K33A 3CG8A 1UT1A 2Y07H 3MV9E 4KX9A 3OKEB 2WO2B 4JY6A 4JHBA 3LEYH 4ZFOB 5AVSB 3W1ZA 3E2HB 3EO9L 3UTSD 3I85A 4QOKA 2VDPL 4HOXA 1WEJL 2DF3A 1JPGB 1ZJAA 1QBBA 5F3BA 3QORC 2Y7SA 3P69A 1T0MA 3HNSL 5MEQA 2NY3C 4G8EB 5HGHA 1OL0A 1E2VA 4OF7A 4ESKA 3P0YL 2BP8A 1ES0B 2AQNA 2NYKA 3SKNA 2DJUA 2MQCA 4I88A 4YNYA 1ADQH 3S88L 5DMYA 3SO3B 4I87A 2A2QT 4NCC1 4CSZA 5F7LB 3S3BB 2IOMA 3QDMB 5FB8B 2AEPL 2F5BH 1KXHA 4HXAH 4NNYA 4N90D 3MSPA 5I71C 1N7MH 2FIKB 2F8XC 4RDBA 2EXTA 4PGBA 1O9ZA 3QVAA 2AI0L 3OAUH 2XWDA 1TQBB 4LLVA 3F05A 1QSFB 1HHIB 4OV5A 8FABB 3LV3A 2C1PA 3IMUA 5IW6A 2P26A 3DX7B 3S36L 4MA1B 4HKZA 1CT8A 3NH7L 5I18L 5I1JL 3RTQB 5K9OA 1XXFC 2PXYC 5LXVA 1WISA 1QQDB 2ITEA 3BXNB 1F42A 3LIZH 4FE9A 5E8NA 1WZ1H 1XMWA 2IH1A 1R9FA 4Y19E 2A4EA 2IH3B 2QQLL 3T9WA 5EV7A 3TCXA 3BD3A 2YK1L 4NWTL 3VGGA 3RQ3A 3ZKMC 2VDNB 4C83B 2CHNA 3OZLA 4C8XA 3WJJA 1ORQB 2BZCA 3JYBA 2WPGA 3WMPA 3QPKA 1OE3A 4LCYB 4OGYH 1MJ7L 1F4AA 4FFVC 3ZT7A 4LKCA 1ZE3C 4LIQE 2OCCB 4KKAD 1TVHA 2IEPA 4OCWH 3GEWB 3VGAC 1K85A 4JPIB 3VM7A 4MQ7B 4ZQKA 1BQHG 5SWZB 4LVOC 3QNYA 5I6XB 4NKMB 1QTSA 4PD4J 4PGEA 3L1OH 3PHQA 5GHWL 4FNTA 5D2LB 5CJQH 3RWGA 3CN1A 3QUHA 4E42B 4DPCX 4AJWA 1X6NA 4GRLC 3ARRA 4GG8A 2A9MH 3HC3L 4P59L 2YPVL 3WD5H 5EUOA 1I9EA 1HDMB 2PN5A 4POYA 1OAUL 4FI6A 1MZYA 1T0NB 1HWWA 4I1NB 5AKTA 4E0RB 3EDKA 3SDYH 3UABA 3GMRA 3H55A 3MXVL 5SX4I 3WJJC 5J57B 2PPFA 3RX5A 4Z3FA 2BVOB 1BIHA 1OVZA 1TZIB 1A4KB 1UZ8A 1WDAA 3I6LD 3QDGE 4Z7VB 3VFWB 3WY3A 4JFFA 1KIUB 2Y23A 4XHQA 5TFSL 4JRYD 4WHYH 1XTMA 5DC2A 5JQ6L 3PHAA 4MXVE 3D05A 1B90A 2VDLH 3CFEB 3NJMA 3GMNB 4YUEH 4HDIB 1NEUA 5AVVB 4AL8H 5ANMA 2ZJSL 4J7RA 4YHYB 2VR9A 2H2SD 3IYLW 1DSYA 4WFEE 3OB0K 5EZJA 5DJYA 5IFJB 4LL1A 4OFKA 5G2NA 3QIBD 3KH3A 1JNLH 2OJ1A 1HINL 4K5LA 3GZOA 3WN5B 1N2RA 4PH8A 1P0SE 4KQ3H 1U3JA 1TZHB 3VX1A 4C56E 1DQTA 1MDTA 4G1MA 5E56A 2XYCA 3IDIA 2NNCA 2IAMD 1CURA 3R4DA 3U4EA 5MENB 3L4WA 3BAEL 3X11A 1I8MA 4LARL 4UYQA 3UO1L 5DD1L 3TBTA 3T0EE 1A6VH 3RUGE 5KBPA 4X4ZA 1XH0A 3TEWA 3Q05A 2NDGA 25C8L 2BNQD 1UTDA 2ERJB 3MUUA 3QRGH 4NUMA 4PJGB 4HU8A 4FXKB 4NHCH 4I5BA 3QAQA 3AG4B 3F3HA 4PJHB 3KPNB 5FS5A 1AGBA 4JFQB 3WFCL 4BQCA 1HIML 1WFOA 3CN2A 4NQDB 4AEEA 7TAAA 4Z7NE 1COBA 4GG6E 1YC7A 5HDWA 2NNFA 2R1WA 4PRPE 3FU8A 5L7XH 3JZ7A 2QTEA 3MRLA 5E6ID 2K45A 3G6DH 1AE6L 3T0VA 1QEXA 1BFSA 5CEYB 3MRRB 1ASPA 4M6NH 4U1HB 2J6EH 5EU6B 2X4OB 1NANH 2HKHH 2WLNA 4HBCH 4XX1E 1CICA 2VRQA 4FG2A 3VXMB 2KDYA 1Z32X 1KIPB 4KHTL 3G6JE 3GMMA 3ATEA 3CH8A 3IT8D 3N42F 4OGZA 3VWJD 2NZ9C 3DX8B 4OLWH 3K46A 1A6WL 1DEDA 1JXGA 2R0LL 1HXYA 2VW7A 3U25A 4ZFFA 1EJ6A 2NNAA 2ITDB 3WS6A 5FYLL 1M71B 3IGFA 4Z78B 5IB2B 3AREA 4YAQA 1BVLA 5J11B 3QEQA 4GSRA 2P80A 2BH0A 4YBQD 1NFAA 5GSRB 2XTSA 1ZSDA 4G6KH 3NRFA 2FGZA 4LCCB 2JCCE 3WDJA 5MI0B 3WSQH 3VFGH 1SJEA 4PJBF 1B6UA 1NKRA 3U4AA 2PR4H 3CFKB 4E9TA 1GPOH 3Q6GH 4TULH 1DQML 1KPVA 5JO5B 1CXKA 3UG4A 3HPLB 1HYSD 3FTGA 1E2ZA 4IRSD 1CICC 1U95B 3PCYA 3N85H 1RVFL 3U82B 2VQ4A 2VC2H 2XBDA 5D4HA 5DYOA 3IRCA 4W9EC 3MRPB 1SEQL 4NC1C 3MQIA 3BP4B 3NYKA 2N7SA 4PJEA 4F57H 4ZMQA 4GI6A 3W3BA 4DNLA 1T7ZA 1AD0B 3AREC 4YQXL 3EYUH 2X4UB 1IL1A 1GGYA 3KPLA 2V37A 3E0GA 3D2UB 3C6LD 1EWHA 1JGEA 3WXVH 4XPBL 1TQCC 2FD6L 3BIKA 4UANA 4HIJA 1QMUA 2XQYG 5IBTL 5FHBL 4TTDC 1SY6L 1BX2B 2Q8AH 1FNLA 2Y69B 4M1DL 3ISYA 2R8SL 2FBJH 4YL9A 1JHLH 2GHZA 4NENA 3F12B 4IBSA 1KXQA 5AZ2H 5EZLA 4HIXL 2H0EA 4ATWA 1E4WL 2LAGB 1KTRL 1KLGA 2ZXBA 1CGUA 3WIIH 3KD4A 1ZA3B 5E9AA 4PAZA 1A4AA 4HJSA 2CG9X 2AQQA 3BHBA 4YHPA 3V6OC 2XTJB 2N0MA 3BAWA 5B7EA 3L48A 1CK0H 4LCIL 4RGMB 5EZOL 5ISZB 1AKPA 3S3CB 1RIVH 3KCWA 5D7IE 1ZJBA 1FGNH 3DOSA 3GSQB 4RFNC 4FKKA 2C5DC 4O4YH 4AQAB 3H0TB 4PJAA 3P9MB 3V0IA 3P4NA 5D1QE 4A39A 4UDTA 3ALWA 3RVWD 1EGJA 3ZO0A 3W38A 1WP6A 2JH2A 4NZRH 4WHDA 3DX9A 2NY7H 2ZXQA 1OF2A 2X12A 2YEZA 4NNPH 1WS7A 4X6EB 1B4JL 4PRBA 2BC4A 1AD9B 1S7VB 1UB6B 3BCDA 3BGMA 4IGBB 4YXKH 4DZ8B 3HA0A 5GRWA 2NR6A 1D7DA 2DMKA 3GHEH 1JV5B 5DMIL 4Z3TA 4K3HA 3L95B 1NCBH 2OP4H 1SXSA 2AK4E 2OMUA 3N91A 2ED8A 1Y18A 1HOEA 3DYMA 3P73B 4LIQL 2IGTA 2WSDA 4N6QA 5IBUB 1OP3H 4Z7OB 4NQSB 5E4AA 3BWAA 4WEMB 1MW0A 4XAKD 2YUVA 5GS0C 3BH8B 3CIAA 2OZ4H 1AQKH 3MRCB 4F8TA 2YBRA 2GUOB 4JJ5B 5AWNH 4J3BA 4GRWB 4P4KC 1UXSB 1YEHL 2JJTA 2B4CH 2VDRL 2Z0BA 3RWFB 3EG9A 4DIXA 1ZGLM 4IJ3C 4UILH 2BHZA 1IC0A 2FL5B 4PRHD 1YECH 1QFUL 2Y5QA 1DVYA 4CJ0A 4M43L 1NTDA 4Z7QF 2OTUA 3U7YL 5KWYC 1X5FA 4A6YB 4GXVL 1ZHBB 3ARDD 1I9RL 2ARWA 5GQBA 2KH2B 4CC4A 3BRGC 1BQHA 1X7QA 2CLRB 2DD8H 4OQTA 3K2MC 3NCBB 3OAZK 1I8IA 2CGRH 3QCTL 4LQ1A 5HYQA 2WK2A 1F00I 3T3PF 4F91B 5BV7B 1IBGH 3EFFA 2ZUQC 4JVWA 4ZFGH 4KI5F 4YSRA 3NCCB 4XBGA 5E99L 3Q48A 1UWXK 4J6IA 2A6JA 3KHQA 2AABL 4Y2LA 1TYRA 5CMAB 5IFAL 4BWUA 2JJTC 3FONB 3QCVH 3UBXI 2EYTB 3SE4C 1A2YA 3WNIA 2XKNA 4WW2A 2YGQA 3RX8A 4PY8J 5DD0L 4BA8A 5CZVL 4PV8B 4TLSA 3HE7A 3S2CA 2CDFA 3FO0H 3MDJA 3L3JA 1IGJB 3CNKA 4XVJL 3UYRL 2V0AA 5E08H 4GW5A 3TJEH 4F93B 4AYMC 5LCVL 4Y8AA 4CU6A 1QASA 2ZCLH 4Y4FC 3GIVB 5LNEA 4PP2B 5K1NA 3P4MB 1KCSH 2X9XA 1QKZH 1A9BA 3K74B 1DEEA 1F4HA 1VB9A 5EO1A 5AKRA 1LK2B 4N1HB 3C2AH 3AXLB 5E8OA 3ULAB 2EC8A 3EGDB 5C7ZA 3S98A 3GSUA 4XNAA 3ILPA 3WFZA 3BDYH 4MCYB 1DUYB 1OE1A 2WQAA 3G04A 3Q9PA 1AXSA 2DKSA 3VGBA 5D1XC 1YEFL 1E40A 2P8PA 1J5CA 4OI9A 1G9NC 2QGDA 4M62H 1MFBH 4RA0C 4MJ5B 3F2LA 3T6QC 4A2FA 3H1ZA 3KYMA 2EO7A 3DYPA 5I5JA 4ZOAA 1MFEH 2PYED 3ZN6A 2FEDD 1AGCA 3DVGB 3B5GA 2V6HA 2WQWA 3KDMA 3IETB 4X99B 5GPRA 3L4VA 4W9DC 5FM8A 3HMXH 2J71A 2FTAA 4UI2A 4HALA 4AWJC 5BUPA 1JSYA 3OKEA 1J9TA 2APFA 3LZRA 1YSOA 1J9QA 5C0CE 4B9FA 1EJOH 4ZFOA 1H15B 2VDPB 2FR4B 5D7LD 3LXBA 3AACA 4KKQA 2ZP8A 4XVSL 1JPGA 3WFDL 2MNJB 4H1LH 1J1PL 4PLNC 4JE4B 5JHDE 2VUOA 1VFBB 1LM8V 2V17L 3GI8H 4Y4KB 4G8EA 1QHQA 1ZVHA 1A5FH 1K72A 3BE1L 5CLYA 1J05B 4EEEA 1ES0A 2H26B 5DJXB 5JW4N 2X9WA 5GJSL 4HPYH 2ZICA 4WJ5B 4GJTB 2PWHA 3QDMA 1ZD6A 5FB8A 4UTBL 5F0PB 2Y7MA 4Y16B 1T1YB 3MA9H 2IO5A 2FIKA 4WGVB 2BSBA 4O5LH 1FYHB 2N1KA 1S7QB 3WMQA 1HHIA 2UYLB 3BD5A 4HLZG 2WQRA 4NERA 8FABA 2P5EB 3DX7A 4FNUA 2QQNH 3F7LA 5DD3H 4OZIB 3RTQA 5I0ZA 1AYRA 2AFNA 1QQDA 1ACCA 3BXNA 5HVWA 2FJFB 3HC2A 3HUJE 4KDTA 3P3YA 4HWBA 4PLKC 2IH3A 3HNTL 3QUGA 4BZ1L 3NJKA 4LRNL 1WITA 4XMKL 3SO3C 5BO1H 3ZL4H 4C83A 2WTRB 4W70A 2O72A 1CQKA 3MJ9H 2YSSB 4XHJC 5FUOH 1WCBB 5GGVY 4LCYA 4Q74A 2OW6A 2KI6A 4JM0A 3SO5A 1G43A 1OALA 3DOHA 4JPIA 1CDJA 4MQ7A 3QUZD 3W5NA 1JZDC 1DO6A 5CEZL 3MV01 5SWZA 4E9XA 4F80A 5IT2H 1OGAB 4NKMA 3HMWH 2LLGA 4DK6A 2P45B 4A37A 5D2LA 5C0GB 4E42A 2DMHA 3RTQC 1N59B 3UYPB 1LP9E 3MNDA 4QHNB 4PCYA 3MJWA 5FYKU 2WVSA 3I3BA 3FTYA 5CFAA 5KVFH 2OAAA 3V4VL 1A3LL 4CN1A 3P0VL 1QYGL 2CDEB 4L2LA 4KQ4L 3LH2L 1HDMA 4UOJA 1T0NA 3QXWA 4E0RA 1TTBA 1EUUA 1QAWA 1V7ML 5LBSA 4HCRL 4XXWA 2YKLH 4O00A 2BVOA 3DMMD 4KKBD 4DO6A 1TZIA 4XP9H 1A4KA 3VQ2C 4Z7VA 1Z9OA 1KIUA 2IOIA 4URKA 1AZUA 3VM5A 3BSHA 4R2GD 5E6UB 3CFEA 4KKAC 4HDIA 1R0AH 4D3CH 1X5HA 3L45A 1RUKH 3NSDA 2FBOJ 4IOIB 1WBZA 4HLJA 5ESVB 4CKVX 2A1WH 2BIMA 3D51A 1S46A 3HFMH 2Q5BA 5F9AC 3WN5A 4XMLH 3ZRCC 4UNTA 1TZHA 3ESUF 5DA0B 5HYEA 3K2KA 2HX8A 2CJSA 4H8VA 1MHEA 2O5ZL 4XXWC 5MENA 1R5WB 2J21A 3W2DH 2G0LA 5JW3L 5F0LB 3F85A 1CGVA 1OTTC 2AJZA 1MFCL 2F54E 2X3AA 4YX2H 1WAAA 3H7BB 4QRRE 2PUQT 1QW9A 4X4MA 1HHKB 4M61B 3FQYA 1IT9L 5KN5B 4HS3B 5J12B 4PJHA 1QNZL 4WFFE 3KPNA 3OWRA 4GAGH 2VM4A 3DO3A 4PV9B 4JFQA 5CGYC 3BKCH 1G1KA 4Z0BH 3T65B 5JHLH 4TVSa 1DLFH 1P9MC 4NQDA 4CVXB 2WXGA 4NQXA 1DJGA 2DQUL 3ZX1A 2FECI 1L0PA 1IBDA 2G5BB 4K71C 4X7SL 4NWUH 4ZMYA 1TENA 3QIBC 4O9HH 1AHWB 1A22B 1IILE 3LSOB 2AJSL 1RPQA 4BINA 4N68A 5CEYA 5EU6A 3KBHE 4K8RL 4U1HA 4XCYB 2X4OA 2IAMC 3QNZB 1AO7B 1HEHC 4NFDA 5IB5B 2ESVD 3TFBA 3VXMA 5DHDA 5K93A 1KIPA 4IDLA 4FABH 4KGJA 2ERJC 4FF9A 2XPYA 4U1SB 3SDAB 4AYFA 5DMKB 1YUKB 3DX8A 1IQWH 3CHPA 2N56A 1G7PB 3IDGA 5TDNB 4XRCB 2ITDA 5T5FA 1M71A 3CAFA 4JM2B 4ODXB 4QXTB 2YXFA 4Z78A 5IB2A 4KOCA 2Q20A 4NZUH 4G8GD 5GSRA 3CFCL 1WTLA 1YY8B 3VI3F 4BE6A 1B2WL 1OPGH 1F56A 4LCCA 1G6RB 2BWIA 4PMFA 4JFDB 5CJOH 1OCZB 1U8IB 2AEQL 5E6IC 5ABZA 1NOFA 5JO5A 3HPLA 5CNHA 2FO1A 3O2VH 4PJIE 1YYML 1U95A 2OMVB 2EP6A 2LV4A 3RNKB 3VX0A 2VDOL 2VZSA 3Q13A 3K8KA 3MV9B 4BWTA 3PQYD 1TNNA 3MRPA 3BP4A 1AG6A 4Q0XH 1P4UA 2H8PB 4LPCA 3RNQB 4K3JH 3LAFA 1IARB 1WV7T 3LPFA 3VWJC 1AD0A 4IBLT 2NY6B 2X4UA 1E6OL 3D2UA 3B56A 2EVFA 4L9DA 3LXUX 1E4JA 2DQEL 4OVVA 1GY2A 4RMVA 4YDLB 4LMQE 5SX5K 4NBZB 5LGHH 2BRRL 3DWTA 1A4CA 3TNMB 3KYNB 4WCYH 1FIGL 1BX2A 1IC4H 4I48B 1YG9A 4AYGA 2YN5A 4FTVD 4KX8A 3F62A 4GNKB 1YNLH 3GHBH 4U2ZA 5C2UB 1AS8A 3ARQA 3F12A 3G5ZB 4LEXL 1OD7A 5AOJA 4LLDB 1JWMB 4ZD3L 2BS9A 1LD9B 2P28B 3CLEL 3N40P 5I8OH 3IJYB 4IRSC 4LSPH 4BGDA 3QDJD 1BFVL 2X1OA 3B5TA 2D3JA 2C1OB 3OKYA 4PRIE 1N5YL 5HYIA 2CLVB 1ZA3A 4K3EH 1OM3L 3IS1X 1SXNA 4OZFB 3RWIB 3M46A 3BUPA 2DLHA 2AS5M 1VENA 3H85A 5FGSA 1YN7B 3F84A 4OKVB 5AAMA 3NZ8B 3Q8CA 4P5SA 5ISZA 4D9LL 5KS9E 2Y6SD 3WS3B 3GSQA 2FUQA 1YUHB 4FRWA 3TN0B 4M93B 4TXVB 4XMPH 4AQAA 3H0TA 4Y19B 4MJID 5GZOA 3P9MA 4W9ZA 3IBOA 4J5VA 4OIAA 2EXWD 4H8HA 5FW7A 1U0QA 1D6VH 1VZHA 1K3IA 3T0DA 1I82A 3OL2A 1OSPH 4X6EA 3BOVA 4U3SB 2X4QB 4EIGB 1AD9A 1S7VA 1UB6A 2XDHA 3K2IA 4IGBA 4K73A 4DZ8A 3O81A 5J6HB 1JV5A 5GRUL 4X6DE 2HT3D 2P5WE 1BREA 1FFRA 4EN3B 1ADQL 3AUWB 4UTAA 4I3GA 3P73A 4NQCD 4BQ6A 5CM1A 5FEBA 1NINA 4OLXH 2QSQA 5BRQA 4NQSA 1KCKA 1XB8A 5AAMC 1BYOA 2F5BL 3FU9A 4RGMC 4HXAL 3BH8A 1ASQA 2VDRB 2BWQA 1N7ML 1MIMH 1PKQB 3MRCA 4ENED 2GUOA 1A6TA 2FGWH 4JJ5A 5CIPB 2FE0A 5E0FA 3RBGA 4WSGA 1UXSA 1L0YA 3S96B 4HULB 1KJ2L 1D5BB 1QSVA 5DJ6B 3RWFA 3P4LA 4HLEA 2FL5A 3FFCE 4GW4A 1JVLA 4QOKD 4PGDB 4WTXA 4N4YB 3ZUNC 4G7VH 2C9PA 4O58H 5L8LB 2FH8A 2ICEC 4KY1H 1IAMA 3U0TB 2YC1B 1CD1B 4A6YA 2VMDA 5IHLB 5DD6B 1ZHBA 3AS2A 3RVWC 1DVUA 3X14B 1PW3A 1WZ1L 2X7LB 4Y1AD 2CLRA 4UNVA 4IRZA 5CJXA 4J28A 3B7UX 2MPAH 3OMAB 4UAOC 3GBMH 2X4TB 1RZKC 5FW8A 5ICXB 1BZOA 4NAQA 1XAUA 1OWWA 1G84A 5AOIA 4OGYL 1RURH 1JTTA 3ZR6A 1R3IH 1JVKA 5CMAA 4JMXA 3LN5A 1WGVA 5ACZB 3FONA 4HKJB 4EBQH 2EYTA 2Y5TB 3MRNB 4C56B 5DHXB 5DS8B 4PV8A 4X4YB 3B1TA 4KC3B 4JKKA 2VR7A 2E75C 3SPVB 1P4BH 1IGJA 3KLDA 3LZQA 4WEBL 3NZUA 4A66A 2A9ML 4BCZA 3T0EB 3RUGB 3LKOB 3VTAA 3WD5L 1KIRB 1CGSH 4U6YB 3VVVA 2DYPB 3GIVA 3KJ6H 3ARDC 4PP2A 2IDCA 3P4MA 5D72H 3OQ3B 4BA0A 1ACXA 3SDYL 2XWRA 4MB5A 2ROYA 3FUMA 5BV7C 1XF3B 1G7JB 5DU7A 4LDCA 2OQJB 3AXLA 4P3CL 4W4OA 3FZUC 3EGDA 1FL5B 3KLKA 4N2GA 1NCHA 3I50H 2IPKB 4NKIL 2GC4C 4MCYA 1DUYA 5LN8A 4GG6B 4ZNCD 4PRPB 1R3JB 3IRZA 2VDLL 3CC5B 1N68A 2YUWA 4YUEL 4MJ5A 4AL8L 5ID0B 2KQMA 4XBPB 3L1GA 4DGYH 4NM4L 1RMFH 3DVGA 3LNFA 4Q52A 4IMKA 3IETA 2PWDA 3N1PC 4X99A 3BIBX 3D18B 2OTWB 4GEJA 3DBXB 2EILB 1DSFH 4KQ3L 3G6JB 3WY1A 3FUIA 3ETBJ 2XUWA 1H15A 4PW9A 4CMHB 4KTEH 2FR4A 1NCDH 3FTZA 1ZLUK 1GR7A 1BD2E 2BLFA 3CE1A 2EDBA 4PG2A 2KLSA 3NRPA 3U46B 1A6VL 2DMCA 4IIQB 1W72L 4TUKH 4LL4A 3UJTH 3IDXH 2A7BA 4G6FB 1VFBA 1X7SA 3KVDD 2LFGA 2VITB 4HKBB 4OZFG 4W6YB 5BCAA 2ZYSA 3QRGL 2YKKA 3SE3A 4RDQG 2JCCB 1J05A 2QELA 1Q4NX 2NT0A 4QUOA 3PGCB 4CAGA 5DJXA 1NC2D 1O7DE 4IMKC 3QZPA 4WJ5A 3A3YB 1IGIH 3V0AC 3VXPB 3IDYB 2DYSB 5E03A 3IFNH 1NPJA 4Y16A 5F6IB 5D6DA 3TJHC 2OSXA 5L7XL 2FHBA 5CHNB 2NNRA 3VFOB 5E2TH 4KAQH 1FNEB 2PTTB 3G6DL 1S7QA 4XP4L 2HX9A 2XVLA 3QJSB 3T4AB 2P5EA 4R5VA 1K5WA 4PG2C 4QHMB 2J6EL 1GYVA 1QRND 2YFNA 1CXLA 1QBMH 2HKHL 2UXTA 4HBCL 4HF5H 1S6NA 3IWVA 4OZIA 2YAQA 4L1SA 1KYAA 1NCTA 2FJFA 3STZB 3SE3C 4DP6X 4PWGA 2JB5L 2QDWA 3MV8E 2YZ8A 3H3PH 1JPSH 3ULVE 5GGQH 2E59A 2ZKYA 3HRPA 1QBLH 2WTRA 2H45A 3KPTA 1YEWA 5CUSH 2YSSA 1F6LL 1WCBA 1AQDB 2YD4A 3DETC 3HG0A 1ECZA 4J3XA 4OQ1A 1WUNT 3WSQL 5MHSD 2PR4L 1ECYA 1OQOA 3Q6GL 4MLSA 2LABA 4L23A 3RRQA 1D5IH 4TULL 4D0DB 4EQ3A 1OGAA 2VLMD 3NACH 3ZOAA 3ZIMA 4GBXB 4KVNH 4M3JA 5C0GA 1MUJB 2E47A 2YPVA 3V4VB 1N59A 1XGZA 3UYPA 4PRAB 2E4TA 2E7LA 2VC2L 4FLOA 3SDDB 3CVCA 2A0LD 5D7IB 4BQ8A 1CZ8H 2CDEA 3DHMA 4QTHB 4ZMPA 1U30A 4LSSL 2G0KA 4QLWA 5E2VH 3OD3A 5D1QB 2CO4A 3ASNB 3WELA 3RKDD 4NFBA 4GSDH 2VL4A 2ATKA 1OY3B 3FJTA 5DF0A 2R4RL 3CUPA 4MJ4A 4N2HA 1FH5H 4GO8A 1VHPA 3OV6A 4QJ3B 1MFDH 3NFSH 1N18A 1BVKB 1BXUA 3JWDH 4NZ8A 2Q8AL 3RX9A 4YSCA 1SOQA 2FBJL 1CDUA 2AK4B 4HCGA 1KZYA 3BDBA 1NFIB 4JKPH 1DVQA 3MLUH 4IOIA 2E7LC 2EXYC 3RTLA 5ESVA 5EEZA 3QIUD 4NCC2 1E6JH 1JXKA 4WHTB 3RZWA 3K3QA 2MCG1 3TM6A 5K59F 4IMLB 3WIIL 1QBAA 3SPIA 3EO1B 4G82A 3VA6A 3BRFA 4UOW1 1WVZA 4RBPK 2VN6A 2CA3A 1EBPA 5KVFE 1KCVL 4XAWL 4YL4A 1R5WA 1QWHA 1CK0L 3HG3A 1F3RB 3OPZH 3PAZA 1PL3A 4NP9A 1RIVL 3QEHA 5T3XH 1FGNL 4JFHE 4WUKH 4KI1A 4R4BB 4P2QD 2XZCH 3H7BA 4O4YL 4HWEH 3V9EA 2RH0A 5F7FA 2GTZB 2VQUA 4QTFA 4YLQT 3JT0A 1HHKA 4PJ8D 2Z34A 4M61A 3OXRB 1YNTF 4Z9KB 4XX1G 5J1AB 1TJXA 3U6RB 5KN5A 3UAJD 4NZRL 4HS3A 2DIAA 3MLYL 2WXJA 2NY7L 2Q2EB 2WXPA 2DQHH 4L29A 4PV9A 4R2GC 4NNPL 3T65A 2DL2A 4V1DE 2V7HB 4HJ1A 2WZ0A 1QI3A 4YXKL 4CVXA 1WTGT 3SHSA 5A3ID 3E7JA 1O5DT 2G5BA 3IAGC 3RY5A 4GINA 1W0VA 1NCBL 3AWFA 3MNZB 2OP4L 5C7XH 5LDSA 3IGKA 3HC4H 1AHWA 4HH9B 2V9TA 3LSOA 2XN9D 3QO1B 4RMWA 4ZX4A 5KSBF 3DJ9A 4XCYA 1DBKH 2OZ4L 2YMOA 1AQKL 3C5SB 3TO4D 3D4YA 2KBGA 1AO7A 1MW1A 3BZFB 2X6MA 2YPLD 1HU8A 3QNZA 5IB5A 2D7OA 5AWNL 3PWPE 4QXWA 3F6LA 5E95B 3SDAA 4U1SA 4RMQA 1WPCA 1EDHA 5DMKA 1FWXA 4UILL 4J23A 2OSLB 4JRLA 3S5ZA 1YECL 5J12C 1ZVYA 2M2DA 4N8CH 5TDNA 1CL7H 1M42A 3NA4A 5EEYA 3WKMH 3OB8A 4JM2A 4ODXA 4QXTA 4NUPA 1X9LA 4JUTA 1FVEB 4D8PB 3OZKA 3PDGA 3QH3B 3RE0A 5T1JA 4FQXB 2MQGA 4FL4B 2DD8L 1KNOB 3RFRA 2ZZUT 2YJQA 5F8RC 5C0NC 1YY8A 2A3TA 2CGRL 3ZZQA 5IMMB 2K4AA 3M1CA 1QABA 2O4EA 4YZFF 1RZQA 2O61B 1G6RA 4LO9A 3RVUC 3NABH 1O0VA 3P9WB 4ZFGL 4K4KA 4JFDA 5G5DB 3UJIH 4L8SC 1U8IA 4NRZA 5LBGA 1BP3B 1C5DB 2D2CC 2G9KA 4IEFB 4G9FE 2OMVA 2YA1A 2CJ3A 3ARGD 3HI6H 2J56A 3MFFB 3RNKA 2PO6B 3QCVL 2HH0H 3MV9A 4BZYA 4NXSA 3M1OA 5C0CB 4UINL 1YMMD 2H8PA 3RNQA 3KEDA 3FO0L 4N2FA 4D9RE 4YJZL 4I18B 4ENZA 4W9CC 3TJEL 2PCYA 5IQOA 4ZXBB 1J87A 2FQGA 2ZCLL 5JHDB 1MCHA 1SY6A 2H2PD 4J39A 3B83A 4G6JH 5HJBA 1TPXB 3W39A 4FA6A 1KCSL 1QKZL 1Z5HA 2A6DB 5CKGA 1DBJH 3FQTB 3TNMA 2YRBA 3KYNA 3SYPA 2EUVA 5K9JH 4R97C 4I48A 3C2AL 3V0DA 1RHHA 1BSIA 3PGFL 1KN4H 3N41F 4LFHG 2B2XH 3G5ZA 3QUMH 1JK9B 4LEBA 3MTXA 1JWMA 1ITCA 1ZOXA 3QJUB 1LD9A 4PW4A 1YVLA 5D71H 2PP7A 4DPBX 3IJYA 5CLZA 3NJFA 2BY2A 3BWSA 4M6OH 4FG0A 2C1OA 1MFEL 4KRPB 2CLVA 4JG1H 2NY6C 4OZFA 3RWIA 1H5BA 4Z7QE 5ADOH 3HMXL 3MLVH 1YN7A 1ULVA 4OKVA 3NZ8A 4U0RC 3SJVE 1NQBA 3ARFB 1F18A 3SB3A 3MVSA 3WS3A 1LMKA 2NSMA 3TN0A 1YUHA 3HUJB 1EJOL 3PS6A 1FDLH 3KL0A 4Y19A 1RZJH 3BQUD 4GT7A 3ZTDC 2ETWA 3II2A 3WENA 4Z7WE 4XNXL 3DX0A 1NUNB 4DWHA 4NQVB 1MCWM 1WHOA 5DEJA 3ULUH 2J5LC 1KENH 1KCLA 3ULVL 1OT4A 4CVZB 4U3SA 5I82A 2X4QA 1A5FL 4ODUA 2XV6B 4JKWA 5FKPB 2X89A 3QE5A 5J6HA 3EYOB 5F93C 1T89C 3BP7B 5KSAB 3O4OC 4NGHL 3C5ZB 2Q1EA 3QJHB 1PZBA 1BVNP 4EN3A 4TUUA 1MRDL 4HPYL 2XU9A 1H5BC 3W0WD 3QA3B 3A67H 2WKGA 1D6EB 2WGNB 2ZX5A 1A65A 1TQUA 3NSYA 4OFYA 4LLYB 3TN0C 4O5LL 3DOIA 1OHQA 5CIPA 1MCKA 3V2AR 1RZFH 4PUBH 3S96A 3VG0L 2Y6SC 4EAEA 4JN2B 1D5BA 5DJ6A 2NQ3A 5IB4B 4GQQA 4PREB 1AS6A 4PGDA 1JYVA 2BPBA 1OCWH 2QQNL 4JFUA 5C09E 3VD7A 4PN6A 5DD3L 5LNGA 2CR6A 2WP3T 3U0TA 2YC1A 1CD1A 4WTZG 5DD6A 1TMQA 2EXWC 2I07B 2X7LA 1SFDA 3RGVB 4AT6B 2D9QB 1CF8H 4ZMVA 4EN3C 5FO7B 2X4TA 5FV2A 5ICXA 5B1KA 3ZL4L 2ED7A 3A24A 5T3ZH 3QXDB 1DQDH 3CN3A 3LQAH 3MJ9L 2V5YA 5FUOL 2PW1B 1K5NB 1NGYB 2YLHA 3OLGA 3F7PC 4AK1A 1WH0A 3BAXA 4N9OB 3BP6B 3ZMNA 4BK8A 4QHLB 3F58H 4PS7A 4BFIB 5ACZA 2ZX8A 4HKJA 4J3TA 3MRNA 2Y5TA 1QSFD 4C56A 4FXGC 5IT2L 1TVBB 3GRWH 2VSCA 5DS8A 1TJIL 1MREH 2HB0A 5DUMH 4ZTEA 4X4YA 3NJNA 2O5YH 3D0AA 1MPAH 3SPVA 5CU5A 5LCVA 4JO1L 4XN1A 3S9DB 1U42A 3CLFH 3T0EA 3RUGA 5KVFL 3LKOA 4GAAA 1FI8C 1VFUA 3IPEA 1KIRA 1KB9K 2F54B 4HC1A 4PCSA 4QRRB 1MI5E 4POUB 4U6YA 2DYPA 4XVUD 1IM3D 5I8KH 5DZNA 3UG3A 4KJYA 3QG6B 1XF3A 2GTQA 2YKLL 1G7JA 3L54A 4C4BA 1HNYA 1TLKA 2OQJA 2V8LA 5CZRA 4RRPG 4XP9L 1FL5A 3V0FA 4HOMA 5L6YH 2IPKA 3GXPA 2VDLB 4GG6A 5J13B 3IJ8A 1RULH 4PRPA 1R3JA 1D7CA 1VZIA 2WXIA 3CC5A 5K9QG 4WK4B 3HHSB 5ID0A 4AV0A 2ZUSA 1CXFA 2ARJB 2H47C 4XBPA 4UDUB 4Z7AA 1R0AL 3LYRA 4Z23A 1HZLA 5GRJH 3P3SA 1I4FB 1BZEA 4MMYB 5DS1A 3T0EC 2IBZX 3L3DB 3HFML 3M7FB 3D18A 2OTWA 1VDGA 2W9EH 3DBXA 3TWCH 3K0YA 4XMLL 3CV5A 3G6JA 4RMSA 2I25N 3QQ4B 3ATBA 3MUJA 2Q3ZA 1W72B 2R0KL 2WV3A 1NSNH 1WFNA 4EIBA 3EJTA 4JUSA 4PBDA 3W2DL 4PS4H 1MWAL 3U46A 2NY1B 4IIQA 3GLEA 2MCAA 4YX2L 5CN2A 4G11A 2J20A 4HKBA 4PJFE 5CCGE 4LCUB 2VITA 3KW8A 4U05A 4YSDA 2VXUH 2JCCA 1OP5H 3WTSA 4QHKI 4GS7B 3PGCA 2Z8WC 4GAGL 4Z0BL 1EHKB 4UTBA 5JHLL 5J6SA 2Q86B 3D0LB 4R0LB 5ANHA 3VXPA 4PJIB 1Z2KA 3OJMB 1QFWI 3ARWA 4J3OG 5DEGA 3D69B 4NWUL 5CHNA 2CBMA 2CM6A 3V5KB 5I5IA 3ZMEA 3VFOA 5IFHL 5LGJB 5I0VA 3UBHA 1FNEA 2PTTA 2CMRH 5IHZB 2E9JA 1MQ8A 2X4RB 2CD0A 1TG8A 4JRFA 3T4AA 1WBXB 1EXHA 4QHMA 1UVQB 2A77L 4PLJD 4XNUL 3TEXA 5AOLA 1DN2A 5A2JH 1FN4B 3UTOA 4D2NA 5DXWA 1FRGH 4BZ1A 3L3IB 4LP4A 5FUCE 3STZA 3L4CA 2JJUA 4BZ2L 1IQWL 5KYUB 4PWKA 2OI9B 2J7LA 1WIOA 5FYJU 1AZVA 4OJDH 4WEEA 4OGXH 5INDB 1ZLWK 2B08A 4NZFA 5L2KD 5BS0D 3IDYC 4NQDD 1I7RB 1AQDA 1HE7A 1OPGL 4YR6B 5ID1B 4PYGA 4ECNA 1TT6A 2D03L 2JFCA 4UB0H 5C07D 5IBLD 4XNZC 1MVFA 4KV5E 4UM8B 3T4AC 3L08A 4GMTH 4PRIB 2VW4A 4D0DA 3FOMB 3FFDA 2VC2B 4N0YH 4GBXA 1GTFA 3G3LA 3O2VL 1MUJA 2MKLC 3V4VA 3LEVH 4ELDA 1EO7A 5KS9B 4PRAA 1MJ8H 3F65A 4JEGB 1EAJA 1CB4A 3VXMD 3SDDA 2XWBB 3QZOA 5D7IA 3ZGHA 2AQTA 4QTHA 4ES9A 3FYIB 2K1MA 1KXTB 1LWJA 3T2LA 4HCRA 4M7JL 4XPAH 1SLXA 2DQFB 1NL0H 1FCGA 3UTPD 3OMNB 4I77L 3OJ2C 5D1QA 1ZDSA 1Z9SB 5GRXG 1EFQA 4MYWB 2SODB 2CNYA 32C2B 3R1GH 5DZOA 1E30A 2MRYA 2Z6FA 2NY0D 1PLCA 5LGHL 3SBWA 1NLBH 2IXQB 4I3RL 4JFXB 4P3WA 4WCYL 4X6DB 1BG1A 2P5WB 2F68X 3LEXB 1BVKA 4XOBA 5A16B 3JV5A 1YNLL 2AK4A 1L9RA 3GHBL 2MPVA 3KYAA 5SX4H 1NFIA 4OCMC 4H8UA 1GA2A 2E6PA 2GBAA 3FAWA 3P30H 2X9YA 3X2QB 4KO7A 3SDDC 3MAWA 4DEUA 4DGWC 5I8OL 2EH8H 2A74B 4LSPL 4WHTA 3D39E 4O2FB 3BGAA 1XSJA 2ZYRA 4IMLA 4H40A 2A0LC 4K3EL 4U6TA 2DI8A 4P5TB 5D1QC 2AANA 3DROB 2APSA 2EIJB 1XXDC 3D2UD 2MOQA 4BHUA 3MRBB 1XGTB 4NBYB 4NO5B 4PJAF 4R4BA 3SBWC 3QSKB 5T1MA 4XMPL 2WCGA 2GTZA 2BK8A 1CLZL 3OXRA 4M4PA 3GSVB 3U6RA 5JIHA 3CFMA 1FLTX 1KBWA 4PBVC 2I9LB 1RSFA 2VLRD 4K3DL 2LU4A 2BIPA 2DMBA 1JE6A 4I3SL 4E2OA 4WNQB 1XEDA 4K2UH 5BRZE 3QIUC 3MNZA 1UADC 7PAZA 3IGAB 1VCAA 4G8IB 4WTZA 5JHAA 4HH9A 4OLXL 3K6NA 4QRUB 3QO1A 2XTJD 3TH4T 4A2LA 1RLWA 3GF8A 2Y1YA 3K1KC 3VXRD 3C5SA 4YHMH 1MIML 3BZFA 2FGWL 5CD5C 5DVOA 3NAAL 3EGXB 3H8NA 3K2UH 2G5UA 1EHLH 1J5IA 2VJ8A 3AITA 2OSLA 5T3XE 1JDCA 4FG6D 1A7NH 2JKTM 4G7VL 3L3OB 4O58L 2HMIC 1FZMB 4PJ8C 1X5IA 5CLWA 1HTYA 1N8ZB 4C55A 4DP9X 1FVEA 4D8PA 3QH3A 3UAJC 1OE2A 1RLBA 4FQXA 4PMEA 4AYID 4JFTA 1JXJA 1KNOA 3IRPX 3CZJA 1MHPH 2E6JA 1ZHKB 5IMMA 2O61A 1MCSA 1RZGB 2I85A 5FR3A 2YPKB 2H41A 1B3IA 3QRLA 3WTYA 5G5DA 4X0NA 4YFDB 2BVQB 2ZTBA 2IANE 1PY4A 1C5DA 1RURL 3MCG1 1J5DA 3AM8C 5JZ7D 3DDGA 4IEFA 4FNSA 5L4IA 2XQBH 3GMLB 3MFFA 2CK0H 2PO6A 2XXGA 1VSCA 3NK3A 4M7KH 3V4UH 3QULB 4NO0D 1CVRA 5C0CA 4APQB 4ZT1A 4QYOB 1AKJB 2HP4A 2QQKH 1P4BL 4Z7UE 3DHUA 1SHSA 4FMFA 1NGQH 2PTVA 4BRJA 4I18A 2Z8SA 2C26A 3OHXB 3RIKA 4ZXBA 1C1EL 3QUKB 4D0CB 4LLQB 1CGSL 2AC0A 2WZ6A 4BIKA 3KJ6L 3KPOA 4HSCX 4FA8A 5JHDA 2JB6B 3GSWB 5D72L 4K3GA 5E5MB 2WXKA 4ILDA 4L3FA 1NFKA 2A6DA 4HG4K 1J5OL 1MXDA 4NN7C 1IKFH 1NIBA 1E4XH 3NIDE 3OQRA 2BNRD 3BAYA 1N10A 3EKCA 2G75B 3VAEA 3I50L 2EUXA 3DUHA 1JK9A 2C3GA 2WP3O 4F33B 3IPBA 4F5CE 2NX5E 3ILDA 1D9KD 4LLUB 2X1PA 3H4FA 2ADJB 5DJDB 2APBA 4FEMA 4DGYL 2Y2WA 6FABL 1EQWA 2CUAA 1RMFL 4I18C 4DTGH 4K5OA 3ZSSA 3RIAF 4XT1C 3T1WA 1UFGA 3ARFA 1O7VA 3SY0B 3BP5B 5E23A 3UGXA 4ZG1A 5SV4A 3HUJA 5TF1H 3WHE1 3NN8B 1IM9B 4BM7A 5KAQG 1NPUA 3MV8B 2A6KB 1NCDL 4OD3H 3F64A 4H1LB 1HAUA 2J1WA 4YO0B 2H4EA 2LFEA 2O30A 2WYZA 5GRZA 4NQVA 4TUKL 1PNCA 2JIXB 3UJTL 1UCBH 3FCUB 4WWNA 1MRFL 3IDXL 3UG5A 4NRYB 4HA1A 4CVZA 3ETSA 4FFWD 5AB2A 1ADQA 1OCOB 2H9GB 4NQEE 5FKPA 3EYOA 2YMTA 2YRLA 3BP7A 1VERA 3C5ZA 3QJHA 3ECUA 3IFLH 4XI5D 5B38B 1MCPH 5I73C 5ALBL 1AQ8A 2WJ7A 4NM8H 4GXUM 4Z3JA 1NAML 3QA3A 3MMEB 1D6EA 2XA3A 3IFNL 4ORGB 2J88H 3KCPB 3IMRA 1KJ2A 4OCLC 5GGSB 2OL3H 4LLYA 3H9SE 4KAQL 1P53A 2DEXX 5IB4A 4FG4A 4JN2A 3P3TA 1JS4A 3BISA 3KL3A 4LT7A 3BPOC 3X3FH 5ECJE 4J3OC 4B7LA 4PREA 1ODUA 4JFEE 1QBML 3LIZA 1H3VA 1MKFA 1R19A 4S1QL 3BQUC 4HF5L 4HHGA 4LLAA 3TWYA 1EV2E 4M5SA 2I07A 3DJSA 4Y4KD 1KT2B 3IFOB 3RGVA 4AT6A 1DTUA 1SN0A 3ULUE 1PZAA 3H3PL 1JPSL 4TNWK 5CSGA 5FO7A 4G8FB 5GGQL 1S8DB 3NGBC 1SVBA 1QBLL 4LASH 2ZXDA 3QXDA 1AY1H 1HHJB 5CUSL 3LMJL 4DFHA 1U8NB 1K5NA 2PW1A 1NGYA 4X5LA 5F9JB 2CO1A 3BP6A 5BO0D 3ARBD 3D3VD 4QHLA 1VADB 1E28B 3ESPA 4S1RH 4BFIA 3ZYOA 4J4PD 1Y6NR 1ZPLA 2RQEA 4YSQA 2HVBA 3BLBA 1CDCA 3N42B 1PLAA 4DP4X 1D5IL 5D2LF 2WLJA 4G6MH 3I9IA 3NACL 1TVBA 4KVNL 4ODWB 5DTFB 1WG3A 5CGBA 4MNQD 4JREC 1F3DH 1OO2A 5I5MA 2BXYA 2EDWA 1JI1A 2YA2A 3TL5A 4L37B 2BSED 3RGVC 2F54A 3FO9B 5I17B 2YAEA 3HR6A 4QRRA 2V7NB 1RHFA 2CLZB 2C9QA 5E2VL 1XR9B 1EJFA 2C7UB 3QJOA 4PJBB 5FFOA 3QG6A 1R5VB 2FBRA 5J89A 1V3LA 1E8WA 4GSDL 5AL0A 5F7HA 3OJVC 5I19H 2FAUA 1W6WA 1YNKL 4V1DB 1FH5L 1SHWA 1XX9C 1UACH 3H2QA 5I74C 5T3ZE 1FYTE 3QYMA 2YQ2A 1WF5A 2BVUA 1LEGA 2IQ9H 3JWDL 1LE5B 1P7QB 1ILSA 1P1ZB 2BX5A 2NMSA 3HHSA 3RILA 1DVTA 4UDUA 1I4FA 2O6DA 1F13A 4ODTH 3MLUL 5FA4B 3MACH 5HI3D 4MMYA 4NQTA 1G7QB 3L3DA 2HRGA 1F11B 5B3NA 4LF3B 1AR1D 3PWPB 5E5LA 2QGEA 3QFJE 2F8VA 3K81A 1ZS8B 3QQ4A 4G5ZH 5HPOA 4N8VB 4XB8A 3C75A 1RPUA 2O6EA 4H44C 1W72A 2BIQA 4XVUC 3QR2A 4ABWA 3OPZL 1IZKA 5T3XL 1Q0YL 4FQHB 4WUKL 4K5PA 2XZCL 3UMTA 4AL8C 4RSVA 1JZ2A 4LCUA 5E8DH 1FL3B 5BOZG 2QKSA 1V54B 2I32A 3HBPA 4WI5A 5BOJA 2R9HC 4PJHF 1ZT7A 2XSKA 4BUQA 4NO2B 3NDZE 1KCWA 3Q5TA 1TTCA 4BGLA 2DQHL 3S34L 1X5ZA 4YDNA