2WY3B

Structure of the hcmv ul16-micb complex elucidates select binding of a viral immunoevasin to diverse nkg2d ligands
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
VDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLGSLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Hcmv Ul16-Micb Complex Elucidates Select Binding of a Viral Immunoevasin to Diverse Nkg2D Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
molecule keywords MHC CLASS I POLYPEPTIDE-RELATED SEQUENCE B
total genus 33
structure length 137
sequence length 137
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1990 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wy3B00
2WY3B
chains in the Genus database with same CATH superfamily
5BRZD 2HVBA 1EIBA 2IQ9L 1TZGL 3OL2A 2XC8A 2C1PA 3AG4B 2BP3A 1RPKA 3GMPB 3SGEH 1K5NA 3TZVB 1I85C 3K3QA 1F58L 4RGNB 1OAKL 3B37A 4RESB 1GA2A 4AIEA 5D7LD 2B4CH 3NIDF 3QJSB 4I13B 1IGTB 1X5IA 5CGBA 3MUY1 3VE0A 3OPZH 3QW9A 4JG9A 3MCKB 4PJCF 4Z7QB 2FO4A 3OXSA 2WXJA 4BFIA 5B4MD 4P2RB 3QZBA 3KPNB 5C0RH 1SLVA 4KQ4L 4QPEA 3UYOD 3EBHA 4K5MA 2ADGA 3LPWA 5E94B 5KTEH 5J57B 1J5HA 5KVEE 4G3YL 1QSEB 5F0JB 3UBHA 1QRNB 1CFSB 1A14L 4DP7X 2CGRH 2W59A 2VLME 3VXSA 1DL7H 2OMVB 4QHKJ 3LHPH 2CKBL 1ES0B 4J4PC 2RFXB 1DQLL 1W0VB 2EDRA 3CDCA 3V5DA 4PJGE 2AFNA 4PFEA 1CFQB 4FQXB 3PAYA 3MLXL 4MVBD 4GKSB 3WN5A 4ELKA 4HJUA 5EZJB 5HXMA 3O0RH 3P3RA 1DQDH 4BK4A 3RWEA 4NYLA 5D1ZI 5I6XC 1FFPB 4JKNA 3C5JA 5BO1L 4HS6B 1AE6L 3M7OA 2W07B 4F7KA 3D12B 1AO7A 4E0RB 4F5CA 1U3NA 2A77L 2CDEB 1VFAB 3QJQB 1LO4H 3MRFB 1A7RL 1MG2C 1EUUA 1JGEB 1KJ3L 5ENWB 1HQRA 4HUVB 4MAYC 1DN0A 3DK0A 3AREB 1NCBL 5IMKB 3UYPA 1N8ZA 4ZO8A 8PAZA 3IPFA 4IM8A 4UOW1 1F1AA 5F7FA 1J5DA 3T0XA 3WHXB 2FQEA 2W1NA 1FSKB 3DO7B 4TNWK 2ZAIA 1JFQH 2BVYA 1FCCA 2FD6H 4FQLL 3SN6N 3RI5K 4ZX6A 3HBZA 4KH9A 1ZDQA 3MGOB 1TDQA 3L3OA 4OT1L 5E1IA 3IRZA 5FYLD 1BVNP 2HXAA 1QWNA 5J9PA 3ESOA 5DVOA 4Y9CA 5HJ3B 3BZFA 4CSTA 3BP4A 4ADGA 2AABH 1HH6A 4AL8H 4ZXBB 2WVTA 3HPLB 1I1YA 3VD1A 2ZICA 4NUJB 5AW0B 4K5NA 5C07E 4AJ0A 1SJVA 3IEAA 4HWZA 2AXJA 2N0KA 3O6LL 3DMMD 4KKQA 1I7UB 3AB0B 5D8JL 1I3RB 3KM2A 4NBXB 5D1XD 5F71A 1BGXL 3K0YA 4W9KC 4XMTA 1NGYB 4Y5XC 2XZCH 3TO4D 4U49A 3RVTD 3K2KA 4OLYL 1ZLWK 3NPZB 4M8VA 4F1SA 5ETUA 3F84A 1AS8A 1Q9LA 2N56A 3NFPB 3G5ZA 3QZWA 1YEWA 3FHAA 3D4GA 3FXIC 3VDBA 5JUEL 1OAQH 4MZIA 3S4SB 4DNLA 1GGTA 4JY4B 4WV1C 3QIBD 3T6VA 3UG3A 4CVXA 4XAWH 3S8FB 2V2TA 3X3FL 4QRFA 2JLLA 4HS8H 4JGMA 2DMHA 2AGJL 2EIBA 2QGCA 4L29A 3G9VA 5K39B 3B8SA 3EJPA 4AOFA 2V6HA 4P5MA 3DC0A 4D8OA 1JDCA 2Y5QA 4P9HC 2B3RA 4F57H 1D5MB 4JS7A 4YDJA 4XMUA 1KLUB 1J11A 3O2DL 4L1BA 3QCTH 4N2FA 1WFMA 3U6XA 4OIIL 1KNOA 4M6ML 4XTRC 1FORL 3RY4A 1DQJB 4KTYA 3ZBMA 4N26A 4CKVX 2VH5L 4XPTL 4GKLA 5IKCA 3UTPE 2WLLB 4H8WL 1JMZA 2XWCA 5DXWA 1XB6A 1DVQA 3ZSTA 1DVFB 4Z7NB 4KXZI 2EIJB 3OAUL 5T1KB 1TQVA 4EI6A 4H26B 4JEGB 3GIVB 1VKXB 2ETWA 2FSDA 4UMGA 4N2IA 2EKSB 3NK4A 1WISA 1BZOA 1ZHKA 2PYEA 1AXSA 1EEUA 1XVSA 5B8CC 4F9PC 4B9GA 2XX1A 5J11C 1AZUA 4EAEA 5MEOA 2FHBA 4BKLA 4NO0D 1WAAE 3MJ6A 5D7IA 1MI5E 3P4OB 3FOLB 5DD3L 3SQOL 2BOCA 4JG5A 2UY6B 4HV8B 3BDYL 3BAWA 5F7DB 3WTTA 4HWBH 3L3KB 4MAYA 4A2EA 2OSWA 1YJDC 1QWHA 1URZA 5D7KD 4FF9A 1HL8A 1I7RA 3EJQA 2DQTL 1PFOA 2E47A 1A6WL 3UH8A 1G7LB 4CC0A 1VEPA 4OLVL 2OX5B 4DP1X 5FF6A 3C60C 1GY2A 3EFOB 2NDFA 1QBBA 2VMEA 3OKEA 2FLRT 5EIVA 3ROOA 1G1OA 3WNMA 2P7TB 4YBLB 1UOVA 5IV2B 3BSZH 1CLYL 2XWTB 1U41A 1BYOA 5EU5B 4TNGA 1HNYA 2BRRL 2G4GA 5EC2A 1G7JB 1MAJA 3NFPA 4CADA 5D7KE 3O9WB 1JZEA 1TXKA 2PLTA 3MRRA 4GOSA 2F7RA 3KCPA 2V7HA 1PY9A 5EEVA 3CZFB 5BQDA 5C9JB 1MW2A 5LBGA 2OKMA 2PMZA 2I5YL 4XXWC 5KBNC 1JFHA 3NZHL 4HZAA 2ZXQA 3HNSL 3HRZB 4GQRA 32C2B 2CPUA 3KL3A 4JJ5A 1N7ML 3V4PH 3WTVA 3H56A 4K73A 3S3CB 4Z7IA 4QHNA 1YVLA 3WNOA 1MELA 2DZEA 2ZYSA 2W9DH 4S1DC 4W6XB 2YD7A 2XWXA 3IWVA 3L4WA 4LHUG 3QEGH 4K3HA 2D7TH 4Q97A 2JCWA 3PAUA 4DHLA 3SYQA 1A7QL 1AZBA 1WZ1H 4KI5F 1JPGA 4OD1L 4Y1AD 4A2MA 2NY7L 4NZTL 3TNMA 1OPGH 1C16B 1U8OB 4YGAB 5CCKL 1YNLL 2HG5A 2ZG1A 3QDMB 3VGFA 5F96L 1XR8A 1TVHB 4YE4H 4OUUA 1FNEB 2EUXA 1IC5H 3Q2NA 2HKHL 4M43L 12E8L 1YEGL 1Z3RA 4JFUA 4OD2B 5T5FH 5KG9B 3QXAA 3QWOB 2VXSL 3REVA 3N41B 3C87A 3ZYIA 4RQQB 3TEUA 1ED3A 4Y2OA 1OGPA 2EDXA 2OMYB 3HN8A 5HYJB 4L8SB 4NIYE 4YC2B 2Q6WA 1F3JA 1ZT1B 3NFSH 3NJNA 4GSQA 2ZXWB 4YE0A 5E2VH 4F33B 2F7OA 4XGZA 1KTLB 4CC1A 1AQKH 1J8HE 1NFDF 1NJ9B 2EVIA 2VDOB 5KJ4A 1GOHA 3BEWB 1MN4A 3AUWB 1MQ8A 2R1WB 3BYYA 4XX1G 3MRNB 2JVUA 4TF4A 5C0CB 1NEZG 5ADOL 1GPOH 4ODSH 3Q8EA 4LP8A 4ABQA 5EUKA 3PF2A 5CU5A 2ITDA 1KG0B 2OCJA 3O81A 2H0FA 4HPYL 1O0VA 5CLTA 4EI0A 3S5ZA 1S9VA 4LNVA 4TULL 5TK4A 1RQ5A 4QRQA 1DUZB 1V10A 4L4TA 1VLXA 1JVKA 1EFQA 2QVIA 1DQIA 3WKNA 1OT4A 2DQGL 2XXGA 2F68X 2A0LD 1XV8A 1IC0A 4JREB 3I6KA 4NFCA 3D39D 3VI3B 3ZHDA 5IFHH 1X5LA 2HVJA 3QI9B 4V1DD 1WCBA 3MODL 3RTQC 5TD4A 5JLZA 4DQOH 1KDJA 3WFEL 1EMTL 1MCSA 2N1KA 2WQVA 1J1OH 1RJYA 1BAWA 6TAAA 2VR4A 1KB5L 3QWRA 4DAGH 3RZCB 3IETA 2FT8A 2AZUA 3BISA 4QTIH 4XCYB 4Y4FC 1FAIH 5MENA 2VM9A 3SBWC 2ZF8A 1CICC 4WW1A 4M3KB 4M9PA 4V1DE 3WIHA 3T3PB 3HIZA 3M8OH 1AGBB 5I1DA 2Z92A 4OFPA 4LBEA 4F3FA 4MLSA 5BPPA 3DBSA 3CHOA 4YWGH 4U1MA 1KN2L 5IEKA 3KJ4B 2J88H 5DEFB 2R0ZL 4PRID 3QXUA 4AGNA 3QDJD 2X6VA 2XUWA 5C0GA 3I2CH 3KGSA 1IBDA 1C16A 3SKNA 3ME0B 2PW1A 2WLMA 3LSOB 2NT0A 5F7EL 3UIYA 1VGEL 2CBQA 2E4TA 5AW3B 2DYPD 2FB4L 2Y2WA 4GP5B 3EDFA 2HH0H 3G5YB 3KS0J 2Q7NA 2VM3A 1XWVA 3BD3A 5B8CA 2GYSA 1KGUA 1IE4A 3LZNA 4NC1C 3D0AA 2NY0D 1GR7A 2YK1L 4M6AA 2P1YA 3QR2A 2RHEA 4LT7A 2CRYA 4KRPD 5DMKB 2CKBH 4LSUL 1CD1A 2RCSL 3WKQA 4JRYE 3ZZQA 4WI0B 2IF7A 3ECWA 4PRIE 1WAEA 1U92A 3QIBB 3TBWA 1DJIA 2Y4SA 1NLBH 4PJFF 5ITBL 1JGLL 3A6BH 1KB9K 2DF3A 3GMMB 3TXAA 1SUJA 2N7SA 4NKIL 3MHZA 5D2LF 4I9XA 2QVTA 4BCZA 3QRBA 1EV2E 1SJHA 4MNQB 2ZP9A 3SBRA 5SWZE 2QQQA 4WHCA 2G5BB 4APQA 3ZTJH 1M3JA 3N50A 4PRBA 4FYRA 1OK0A 4D2NA 1MCBA 3MN8A 4JRYD 1HC1A 3WY2A 2YEQA 4IK6A 3N40F 5DZNA 5IUSA 3UTSD 5KVGE 5MP6L 3FUHA 3IU3A 1O6SB 4FLHA 2BSRA 4G9FB 4UTBH 3LB6C 2QFRA 3VMPA 2JKWA 1P84J 5E8NB 1PFCA 3ELQA 1UFUA 2PCXA 4U6YB 5CJ8A 4IRSB 3U83A 4M6NH 4D7BA 4OLUH 1L3NA 5K9QG 4TVUA 4NKOA 2HVJB 3GBEA 4YDIH 3PJLA 3GMNA 3DXAE 5FUZL 1S9XA 4HAFA 2WV3A 3E3QC 4E42B 4MHHG 3U9PH 4DCQA 4HJEA 1U21A 4FLRA 2VR3A 4U1SA 1E27B 4UQ2A 4NZ8A 1GXEA 1F42A 1MW0A 4GO9A 1YPZE 4P3CH 3S48A 1KBGH 3O4OB 3VWJB 4RAUB 1ES0A 1TEYA 3BD4A 2UX6A 4OM1L 3QO0A 5FGRA 2AEPH 3QI9C 3X13A 1TF4A 3MV01 2HN7B 5HHXH 3P11H 2IXQB 1ZA6A 4XVSH 3V0IA 3U7AA 1DVTA 3HB3C 4Y2DC 3UTQB 2XV2A 3DV6A 2YAQA 1BFVL 2A1WH 4R0LB 3CH8A 4P46D 1ZK5A 3SKUD 4KNQA 1D5IH 3BI9X 4RMVA 3KWWB 4PYHA 4ZBJA 2XZQH 4G5ZL 4JM2A 1E2VA 4HXAL 3N42F 5IJVB 3BESR 5DJ0B 2CDEA 1E5AA 1HHHB 1CLOH 1GH7A 2WZ6A 3EHBD 4ZUTA 2DQDL 3SGKC 2Z7ZA 4M02A 4U6HA 5I0VA 3E38A 2P48B 2PWFA 4YMPA 4ZFOL 3MNWA 3NJJA 4HUNB 3QUZC 4KKNA 2C3WA 3BPOB 5GRJL 1MW1A 4FXGB 5EBWA 2PWDA 4X6DB 4Y9BA 3FMGH 5GJTH 3K7UA 3OWEA 4HIIB 1W72H 1MLBB 3MRMB 5D1ZC 5DEJA 3CZKA 3GMMA 2ZF9A 3QCTL 4G80A 5HHOB 4M7ZC 1CZ8L 3N9GH 4JZJC 3JV6B 5I1AB 2AEQH 4XCNB 3FT2A 4HKZB 5B38A 3UC0H 1JNLL 1G7QA 1Z9LA 2GTZA 5INCA 4DN3H 2NYYD 1JZDC 3U36B 3OZ9L 1I9IL 4XWGH 4Z3TA 2KYIA 4N2BA 2FWUA 1XH3B 3DGCR 4Y4KB 3QB7C 5E5UB 1CICD 4OCXL 4ES9A 5CUSL 2F8XC 4JBSA 4I0KA 1QNZL 1AY1L 4IEFA 1NGZA 1ZS8B 2Q8BL 2K7PA 3LX9A 4W6WB 5DHEA 2WQ8A 5FWRA 5MENE 2FVNA 2KERA 2Z35A 1MFEL 1UD8A 1HHGA 4CDHA 3TEXA 4I0PD 2HFFB 5CINL 4ECNA 1VZGA 3T8VA 1OVZA 2W0FA 3TX4A 3VJ6A 1TZGH 1E0OB 3AU1B 4FULA 1HYRC 3MZTA 5D7SL 1NTDA 3GBDA 4AWJC 4L2LA 1E6JH 5JXEA 4P07A 4PTTB 5E0FA 1U95B 3PQYD 2M2DA 1X5ZA 1GZHA 4GLRI 1OIOA 3MLZH 3TJEH 5HDWA 2EC9U 2WJ5A 3CMOH 35C8H 4G71B 3KYNA 4DPCX 3V6OE 2X7LB 1MCPH 4QI3A 4F7PB 1W80A 3QHFL 3ROLA 3CX2A 3V0WH 2FBJL 3QDGD 4P5TA 4QXTA 4Z77B 3RHWF 3VD5A 2ODHA 4W93A 3DDFA 1T83A 3APNA 4I5BA 4JN1L 3QUYB 2BRRH 4CSSA 4CL7A 2EH7L 4RA0C 1JF1A 1JZ8A 1A14H 2WWMD 2CDFB 1RZ7L 3EFDH 3IMUA 5SWZA 1BA9A 3FT4A 3NBNA 4JY5L 4E36A 3ARFB 3TN0D 1S9WB 3WFHB 1K6QL 2ZKHH 4F37F 2F5BL 5G4OA 3GJEB 2Y2TA 3DETC 1ZTXH 3AGWA 4FQ1H 3CN4A 5IT2H 4RAVB 2OL3L 4PR5A 4D0BB 3QG6B 3T3PE 3ULVL 5DJZA 4JRXE 4AMXA 5M7QA 1SEBB 2QSQA 4FFYH 1BVKA 3CVHB 2ZX9A 3QUXB 1DUYA 2FYYA 3LKRA 5JNYA 1AE6H 3BAEL 1MCQA 1DSFH 5T3ZE 1I1AD 3O3AA 1U8JA 4OJYA 3SYAA 1ZAGA 1MKFA 2NLJA 1H8SA 5ANMB 1NIEA 4OI7A 4L37B 1BLIA 4TRPL 3K8LA 3G04A 4NUGH 4XOCA 1S3RA 3FQTB 5JW4M 4PEEA 4LB8A 2CAKA 1LEIA 4OW6A 1GW6A 4V2CB 1XCXA 5ISZD 1ZKAA 2ZCZA 5J12B 4Y5YC 4QWWD 3CE1A 1A3RH 2EDNA 3KWXA 1GAFH 1LM8V 1N4XH 2GJJA 3PDDA 4LKXB 2ESVE 3MREA 4MYWB 3GRWH 4HH9A 3DX8B 4X99B 4OJFL 5F1OB 2UWEF 4NO2B 3ETTA 3VA2C 3RU8H 4FTVD 5I1GL 4HU8A 4KPHH 1XIWA 5J6SA 4ZW6A 3WIIH 3T6XA 3O4LB 2KLTA 1QLRA 4RGNC 2JIXD 1WZLA 2I9LB 3L1EA 3EZJB 3V9CA 3LOWA 2QSVA 4FP8H 5E03A 2LT9A 3A24A 1NICA 3NP3A 3R06A 3NTCL 4X4YA 1BGXH 1E9PB 2BCKB 4IMKA 1XFPA 2GB2A 4Z8FL 3BKCH 4HBQA 4ODHL 3B2XA 1HL4A 4FFTA 2H47C 2CCWA 5AVQB 4X98B 1MXGA 2R2BA 2NZIA 5FGCE 1ASOA 1MNUH 2EQDA 3CNKA 4FKKA 5E1AB 4QCIB 4GB9A 1PY0A 1KIPA 4F15C 2D7NA 3LNHA 3UTSB 1U8KA 1RZKC 3Q6FA 4YDLB 2DQGH 1KJ2L 4WU5A 3WJMB 1CR9H 1Q9OB 4F7MA 2F53D 4ZMNA 5BO1H 4NIKB 5KSBB 3EJUA 2HPTA 1UT9A 4OGAD 3RVUD 4YQXL 4KZDH 3SGJC 3ZQWA 4D0DB 1GS6X 5I24A 3S35X 1YN6A 3VGEA 4FQJH 4LF3B 1P5VB 3MV7E 4DW2L 4QGTA 5HI3D 2YMXH 3FAWA 3WHE1 4YHIA 2VXQH 3M46A 1IGTA 4JZJA 3VUAA 4YZFE 5GGRB 4DZ8A 3J8F7 3BAJA 1T3FB 5LCVA 4RQQA 5ICYA 4RZKA 4F2MB 1IFHH 4GUPA 2Z4QB 3BFOA 3POHA 2F54D 4LVOB 4PLKD 5AVUB 3S9DB 3S34H 5HHQB 3M8OL 3BVDB 1UD6A 1Z0NA 3WJJC 1EEYB 3ULVE 5EFIA 3VFSB 1W72B 1HS6A 2FCBA 5L4JA 5CSZB 4UDTA 1SQ2N 1WFUA 3VB8A 4FNLL 3JT0A 3FQTA 4F8QA 3DVFA 4X5RA 2XFGB 3PHAA 4FHJA 1EJFA 3MA7B 4M48L 4LPXA 3PGCA 4C55A 1IGFH 4HC1H 4XVUD 3WNNA 1T1YA 3WN5B 4ELKB 4P4KB 4G8AC 1ZGLB 3VXTB 3QHZH 4NOBA 4DUXA 4BZ2A 4FNUA 1KGWA 4NCC2 2ODIA 5C0RL 5ECGA 4HALA 4OIFA 2OK0H 1SN2A 1SPDA 4NOFA 1RHFA 2P8PA 2JKLA 3NRPA 3BDYH 4NO2A 2K3TA 3RKPA 3UZQA 5FOJA 1IRAY 1M9WA 1J86A 2A6IA 3RX7A 1PMYA 5DZVA 1GYAA 2VDML 4GY4A 1TQCC 1NCWH 3R18A 4MXQC 4NM8H 5DRNB 1WIOA 3VGHA 3IWUA 1E4HA 5EPMA 1BAFL 3U2SA 1F4WL 3EW3B 4RGNE 3AVEA 4PGDB 4A1RA 2FUQA 3L3JA 3MLUL 2MPAH 3RPIA 1SBBA 4CW1B 2ZAHA 3G5XA 4MMZC 5D93B 2NYZA 3BZ5A 4IRSC 4WI8A 3P73A 3B8YA 5DJCB 3PP4L 4KKCC 3TT3H 3G5VA 2NY4B 2EDOA 4RFOH 1X9RA 4NEHB 2ZX7A 1OWWA 1YUHB 5DSCB 2H2SC 4JVPA 2EYRA 1XGRB 3LKSB 1KCUL 4LLMB 2BSSA 5I5IA 1PLGH 2CALA 4HHAA 4Z7AA 1AHKA 1LE9A 1NCBH 4IU2A 1YECL 2CDGB 1SVBA 4IU3B 1N0XL 3R8BB 2QMJA 5GS0C 2A5UA 3B6SA 5SWSA 3ECUA 3ZDZF 1NAKL 4Z0BH 2P5EB 3HS8A 4PJHF 3FYEB 2GJRA 4RCAA 5CGTA 4G8GD 1A02N 4G1MA 5DMGC 2XSKA 4IBZA 2YQ3A 2YSTA 2DEYX 3TVMB 4K8RH 1N68A 2XTJC 1MJ8L 4J1UA 3G6DH 3EXJA 4B53A 2X1QA 3QC5X 1S7XA 4JFSA 4M00A 4QXUL 3T1FA 3T4AC 4JO1H 3OXRB 2Z0BA 5TF0A 1RVFH 4HF5H 4DEPC 2W0KA 4R3SA 2J3SA 1P6AB 1JHTA 1N8OE 5F96H 3EJTA 3H42H 4A2FA 2YD1A 2CKBB 2BDNL 1P4LA 4Y4FA 1KPVB 5FS5A 1G6RH 4X7DC 4MRBA 1HQ4A 1ZHLA 3NCXA 4NUQA 4NQQA 1CXLA 1M7DB 5HVHC 1AFVH 4AGOA 4M7KH 1WJ3A 5I8EB 4DUWA 2GVYA 4DK6A 1OGAB 3HE6D 5EOCL 1AHWA 3NFSL 1AGCB 3VDAA 5B3NA 3MRGA 1PL3A 3BP5B 2AK4A 3WTXA 1FL3A 3UBXB 4EN3B 1NWOA 4UNUA 1FV1B 4WSGA 4E9SA 5KBDA 1BCIA 3TTYA 4POYA 1WTGT 2AZAA 1NCNA 4N0UE 3C75A 2V5SA 2F58L 1OPOA 2J57A 4A6YH 2HSIA 2DBLL 2QV4A 4H44C 1AAJA 5AB2A 3BUYA 3QJTB 5I5JA 2VSKB 2EKSA 5AWNH 1EHLL 1EGJH 2EIKB 4U6XB 2P5WE 2OQJB 4QRRB 3GHEL 2DWYA 4ZFGH 4TOYH 3OC8A 3P73B 1RLBA 4BGDA 3QQ3B 4RRPA 3TIEA 5DUPH 5IF0A 1TOXA 4KJQC 3NZHH 5GGUA 1ZA6B 2X0UA 2UZYB 4GW5A 5L8JB 3CSPA 2TRHA 3Q13A 1PCSA 2DQCH 2HRPH 2C3HA 2ZOTA 4M61B 2YR3A 3KM1A 3RWCB 4LDLB 5DT1L 5ISZB 4YS4A 3JWNG 4HOXA 4I9WD 1THCA 3BZ4A 5A40E 3KYAA 4RH4A 2AMUA 5A2LH 2B20A 1JI2A 4JFPB 1BD2B 3DV4A 4YAQA 2J20A 3TNNA 5M95B 4PS8A 3HC4L 5G4MA 1M71B 3PPEA 5TGBB 1J5IA 2Y7LA 3QO1B 1FNAA 4M1CC 1T66C 1UQSA 4KK6D 5CEYA 1TYJA 3S97C 1RJLB 3BCFA 2OYLA 1IC5L 4PGEA 4EXKA 4YR6A 4ETQA 2PYFA 4EUPG 1NDGA 1Z6JT 4TS6A 1FJ1B 3F05A 1WA0X 2BM3A 3RB5A 2XY2A 1DJWA 2X6AA 4OLYH 5D96B 5KEZA 5L8KB 3V0WL 4JRYA 1RY7B 3FUNA 2O6PA 3L9RA 4ZMXA 5B22A 1YAZA 4NXKA 2VITB 3I9GL 2IWGA 3QQ9D 4WI6A 1T2JA 4JPVH 1O7SA 2KDGA 1HKLH 2C1PB 2NX5D 4Y2LA 2ZUVA 2GFBB 1V3LA 3H7BB 4BK5A 1CLYH 1KIUB 2ZXBA 1TQUA 2C8NA 1FE8L 5F7LB 1LEKA 1NLBL 3NIFB 2H45A 1YC8A 1QW9A 5D9SB 4F57L 3MV9A 4XP5H 4QLRA 5F97E 1J10A 2WLKA 2VRQA 3QH3A 1TTAA 2VR8A 4UYQA 1WLHA 3VW3L 4YHML 4S0SD 4PI2A 2VLRD 3OMAB 2NZ9D 3GHBL 3AM8A 3DJTA 2PUQT 3AITA 1TPXC 3V4PB 1IC4L 2KKQA 3II1A 5F9WC 2YD8A 4ZAKD 5EH1A 4BH8A 1J12A 3Q8CA 25C8H 3N43F 2MIZA 3MZGB 4R97B 5E95B 1FC2D 3REVB 2DWDA 1PG7H 5T3XE 3KLSA 1T89C 3JWDL 2GJPA 3BHBB 1RJZB 4MAZA 2LU3A 4PGJA 2Y5TB 5HGDA 1E28B 1O75A 2G60H 3HHSB 5ICZB 2XG4B 2KLRA 4JRLA 5DZLA 5ES4B 3LTVA 4L9LC 3OTTA 1KLFA 4BXVA 1UYWL 2G2RA 1ZT4A 1F0LA 4ATTA 2AITA 4D8PB 5KSUB 4PBWD 5EWIH 2AQNA 3TIDA 5I1EL 4X6CE 5C6WH 2OMTB 3DVGA 4HUWB 1TITA 5E8DH 5T3XD 2CDFA 5GZOD 5CJOH 4ZRGA 3A0OA 1PD6A 1OAJA 2HLAB 2Q7YB 2BIIA 4HIPA 4BRVA 5EIIA 2EVGA 1YEIH 2HTLD 1AO7D 3MRBB 3PWVB 3OG6B 4GAJL 1UD5A 1YNTB 2XPZA 1ZK9A 3HB3B 2BK8A 1FNGB 4LLVB 1EVTC 2EEFA 2VSMB 1IGJB 2X40A 5E2VL 2YD6A 5FLUA 4L9LB 3MROA 4WQOA 1XCQB 3QI9A 3W82A 1AQKL 2BHUA 4AW7A 3U7YL 5G5DB 1DJYA 4S2SB 3WKYA 5JZ7D 2RCSH 3VFVA 4DWHA 3MNDA 3NCWA 4PP1D 4NKDA 1A4BA 4Z7WE 1BJ1H 4O2CB 1DVFC 4L4VA 4TUJA 4ZXBA 15C8L 3O3UN 4EN3C 3ZHFA 5AENA 4TSCH 3OBAA 2Z8WC 4L1LA 3KXFD 2F6AA 2AV1A 1IM3B 4XNXL 3VFPB 5LLIC 2Y1AA 4F9LA 3X14B 2Y6SD 4LCCC 4FLQA 3HKZA 1BFSA 1AKJA 1L7IH 1KTDA 1JK9A 3AAZB 3GO1H 5IFHL 4W9GC 1PQZB 4M8QB 2Z93B 3L4YA 1I3GL 4G6FB 2X38A 3UYRH 4PG9B 1QWUA 3SPVA 4C58B 5B39A 1UGKA 1SZNA 3GMLA 5I75B 5JW5B 3QPXH 3A23A 3T6QC 4ZFZA 4NHUB 3DMMA 1D5BA 1FG2A 3TCLA 3VFNB 4L3CB 3S8GB 2NY2C 3KPSD 5TE4L 4JHWH 2JCCA 1O6VA 1XH1A 1B3JA 1H8LA 2I9LA 1S7VA 1MG3C 2WTOA 2P43B 2ZKXA 1KPRA 3GI8H 3K6OA 3L13A 5DJ8A 3EGSB 3W3BA 2RA1A 1FYTE 1H15B 2QQLL 5MERA 1IGFL 4HC1L 2Y5TA 3CJJA 5HGDB 2DICA 1UZ6E 5D4HA 4LASL 4BHUI 4U1LB 2PXYA 1JZHA 2ADIA 2BY1A 4U1NA 4A55A 4OT1H 4JFOB 2ZSWB 1J8SA 2XKNB 3DHPA 1SYSB 5F7UA 1MZYA 2JXMA 3CLFH 4OVUA 4IKIA 2AXFB 2IDQA 4DKEL 3FUEA 3D6GA 3OG4B 5IKCB 1P5UC 4MB1A 1MAKA 4M7LH 4PCSA 5EORL 1JXGA 5CBEA 4RZCB 3V2AR 2PCFB 3HE7C 5E5MA 4H40A 4ZNEA 3TEWA 3WOVA 3EH1A 5L0QC 4PLKC 4UAHA 4A37A 1AXTL 1SDAB 1DN2A 3JWNH 4KMTH 1TU2B 3VXMB 2A74B 2P8MB 3HRZC 4HCIA 4GEIA 1SFDA 3FN0L 2DBJA 4MD5A 1QHOA 4G3YH 1U3HD 1Z5HA 1ZHNA 3DSNB 4XPFL 5K9JL 2HCZX 4CNIA 3ARDA 2DM2A 4XB3A 3QCUH 1NSNL 4L9LA 4M1GL 4PJFB 5I66B 2WXPA 2E27L 1MI5A 1HAWA 2AJYL 3K4DA 2QLVB 4KJWC 4DO6A 1HSAA 2PP8A 3P4OA 5CLYA 3MNZB 1S7QA 2CRZA 5I8KL 1C5DB 3NYKA 1TQWA 3VRJA 4YSPA 3W2DH 3E2HC 4ZMVA 1GSMA 3DX1A 3GWJA 2VZTA 3FONB 2UY7B 4M5ZL 3RWJB 3NZ8B 1BAGA 2P24B 4Y19D 1CF1A 3TASA 4Z76A 3U0PA 3IBEA 1SLWA 1HCFX 4X6EB 4HUCA 1ETZB 4K4KA 3LQAL 1QBAA 1XR9B 3COOA 1QO3A 3CDFA 5I1CL 2VWEC 3O6FA 3IDJA 3S35L 1I9IH 4XWGL 3ZR6A 4WI3A 3BIKB 5TE7H 3C5SB 4KKCD 1H3XA 2OSXA 1JYXA 2Z3FA 3KH4A 1XGQA 3DUSB 1WYJA 1I9JL 4DO4A 5D4JA 3NCYS 2GHZA 3AM8C 2VZOA 2EE2A 1MAML 3PREA 4FXKB 5TQ0H 2VDKH 4L48A 4YEFA 2J71A 5KYYA 3RYMA 4QXUH 4WK0B 2ED7A 2HVKA 2AJVL 3K5RA 2IOOA 4AQAB 4KO5A 5KS9E 4HOMA 5LG1A 2EUZA 1UXMA 1VGEH 2Y6SC 1OP5K 5AUMA 2C9XA 1LEGA 5D7SH 1BFVH 4MJ6A 3ZPDA 5BV7B 1BF8A 1H9VA 3ZGIA 1COBA 2J8UF 2WMPB 3BP6B 2ADJA 1P7QB 1WBXB 3FQXB 5AB1A 3HVNA 4LSUH 5FO8A 2ZCHH 2RB8A 1AQDB 2F53A 5FFOA 1KV7A 3DXAB 4BQ6A 2OYPA 3RU8L 1PNDA 4L8SC 2EYRB 3LKPB 5HYSB 4XE0A 4AIZA 4JPQA 3N2JA 3BDBA 2I07B 3OJMB 5FO7B 1IZKA 2KT6A 1U8OA 2WUCH 4PSRA 3ML8A 5I8CA 3K1KC 4PCTA 3BQUC 2APFA 1XR8B 1ZRUA 1UXSA 4D9LH 1FHNA 3U4AA 1P9MA 4KROD 5F89A 4HFUL 3GXTA 4GAAA 2G2PA 3E0GA 2OPCA 5JUEH 4XOAA 5FYLE 1L6XA 2YAMA 1MNNA 1EX0A 3TCTA 3V6OA 2V7NB 5MP6H 2Z8RA 3HAEA 3F7YB 2WXGA 3ZDXB 4ICXA 4MASA 1JNLH 3RI5F 5BUAA 5IEHA 5LHDA 1JPTL 1WDAA 3VXPB 3B9AA 2R1XA 3ZKMC 3PHOA 4XGZB 2WZPA 2DWSA 3ZKND 5C07D 3QJVB 3MUGA 2YAHA 3AREC 4I2XB 4X4XA 5F3FA 1A4JB 2FJFA 2HFGL 5DEGB 1I85A 4H88L 3IS0X 4HKJB 5D1XE 5GGVY 2K45A 3KPOB 4JGNA 1UVQA 1MFEH 1N26A 4NERA 4V33A 4LPUA 5I8OL 3ULSA 1ASQA 4J8QA 1BX2A 2F7IA 1S9VB 2F19H 3B56A 4NZUL 3BE1H 3H2PA 1F4HA 3IJYA 1RZQA 1B0GA 2UXFA 1A7BA 3BAKA 3UJTH 5C6TL 2QV2A 4I5BB 5CHNB 4JZOA 1A7QH 4X8XA 1YZZA 4JFFB 5CEZH 4Z9KB 5E6IA 2YJLA 2IAAC 5D7JB 2HVKB 1BMZA 3VX0A 1BBDH 2GBUA 4PGZA 4TNWF 4XBEL 3CFQA 2M8XA 2CHDA 4FLSA 4AM0A 1XSIA 4OZ4B 4BRJA 1WIPA 3QXTA 4KX7A 4ENED 3Q48A 5A3IC 1AI1L 2VL5A 1MOEA 3DMMC 3EADA 5IHUH 5AUMB 3RVUC 5I5MA 4HCRH 3V0VB 3EKCA 4JY6A 2OTWB 1R3JB 5HVGB 4ZDHA 1B4RA 1N3NB 3WD5H 1LJMA 2G9KA 3UTPD 1FVEB 1L0QA 3CFEB 4NHCH 4DK3A 2D03L 3FRUA 1I8AA 4LP5A 5KSAC 3BSZA 4Z8FH 2GBVA 1WH0A 2OI9C 3DUUA 4FN0A 4UU9A 4F9PA 1X5YA 4JMXA 3TA4D 1TKWA 5ISZA 1CN4A 4MDIB 4FQHB 3WIFB 4GAYA 4OCMC 4PP1C 1GYUA 3ZZLA 4PVNA 3SE8H 3QXDB 1GPOL 4ODSL 1JGDA 1A22B 1B90A 1UXSB 4NCDA 5GJSL 4GG6B 4KVNH 1OSYA 3O4OC 2WQRA 5E9NA 1T4KA 2Z1PA 3EAKA 5C7ZA 4PJ7B 1BXUA 5F9DC 4LHUA 5JW3H 4PWFA 4NQSB 1YY9C 4OLWL 5DJYA 4MAYD 2G3MA 1CXKA 2V7NA 4FTVA 1R3LB 4ZW5A 43C9B 5KJRH 1CE6A 1XIWD 5FFGA 3DX8A 1U8MA 4AX3A 3DROB 1KCUH 3VWKC 2JWYA 4BZ2L 1R34A 3FQUA 1MRDH 3S36X 1IL1A 1I7ZA 3E1ZA 3HPJB 3KYKH 4LOUC 1ODUA 3U9UB 1J87A 1YECH 3PJSB 1Z9OA 4IRJD 4QRTA 4A67A 2V2TB 5HHMB 1OARH 1F3DJ 4OLXL 1P1VA 2BLFA 1OSPH 1TVBB 4YK4B 3DI3B 1OWRM 4BSVB 4K15A 3T09A 4Z7NF 3SCMB 2HX7A 3HE6A 4QHMB 2OMZA 1A9EA 4NQEE 5JIDA 4JDEA 4NSKB 2P8LB 3JQOB 4JFYB 3MRLB 4GSDH 3ARWA 5E1AA 3TEZA 2P47B 4HLJA 3BWZA 3VD7A 5CHNA 4ZFOB 2Z9TA 2NTFB 3AT9A 3MLZL 4MQ7A 4YL9A 5EBLB 3RX9A 3T0EE 3WEAA 5ANME 3QHZL 3MLRH 2ADYA 5E6ZA 5ERWA 2CH8A 3GMNB 1U3HB 4W81A 1S9XB 1CQYA 4NCC1 5FGBC 3N40P 2CO7B 3K74B 3MRJB 4IIZA 4MAUL 1XF2B 4L8CA 1YN6B 1UJ3A 3T2NH 2XTJE 2G0LA 2VSCA 5I6NA 3TN0C 2H8PB 1IVTA 4G11A 5ILTH 2AK4E 4HK0A 4F91B 3QAZC 4ZPTB 4W9DC 4KUCF 2CQVA 3P0VH 4N68A 1RKRA 1WBYA 5HDLA 3PFQA 4G7YL 4BWWA 3HG1D 3ISRA 5BXFB 1HXYA 3CK0H 2WSKA 3AWEA 1KJ2H 1FA4A 1BECA 2OL3A 1G9MC 2XV3A 1A4AA 3PU7A 2BH0A 3MV9E 2YZ1A 3GMOA 1LO2L 2VDKB 4ODXB 5CP7A 1YEHH 2YFNA 3UBGA 2ZSVB 1TKWB 4NQDB 3O4LE 5JR1H 3QNZB 3T77B 1KYOK 2JK5A 5DJ0A 1NCUA 4KBPA 5AW6B 2YMXL 4G83A 2BNRA 3NQKA 4S1SH 3IKKA 1WD9A 2EXYC 3F04A 3CQPA 4TNEA 4XZUB 1OHQA 1LD9A 4ZJ9A 5I1HL 3S37L 5DMGD 2ZUWA 3DGGB 5D93C 3V0AC 5L8LB 3VXSB 2EIZB 1HI6B 4I87A 3I02B 1AP2B 4BGLA 5TFSL 2RFXA 4HFWB 3IPBA 5B1JA 4JB9L 3UDWA 1OKEA 1NC4A 43C9A 4PI0A 4OFVA 3SE4C 2AJZB 2GI7A 1HT6A 2Z64C 4OZGE 4RMRA 3O4LD 2X6UA 1NQBA 3VM5A 5L6YH 3FQUB 3LNGA 1T5WA 3ARED 5AZEL 3EJJX 3MO1B 2IH3A 2OMXA 1K72A 2WYHA 5B38B 4K3JH 2HT3C 3O8XC 3Q44A 4KY1L 4R5VA 5F0MB 4M48H 5CEXA 1HDMA 4AENB 4ZUWB 5EPMB 5EZLB 2BVEA 2ENYA 2GTWB 3HS0B 1CYGA 1WBZA 5I1GH 1E4WH 2WBKA 4MB4A 4WJKB 3W5MA 2ZCLL 3F6JA 1XL4A 2B5IB 5EBMB 1ZGLM 1OOWA 4P5KA 4TVPH 2FIRT 1WZAA 1N8ZB 2MTPA 5F7EH 2CCVA 5T1DH 3PV6A 3D39E 1LDPL 3T5WA 1N64H 8FABB 4M4RB 2IAMA 3KLDA 4YHNA 3SY0A 2B59A 1AKJB 1MHHA 1TG8A 3N1GC 1DLFH 3SJVE 3LKSA 2AC0A 2Z93A 1NAML 3X3GL 4PB9H 5IBUG 3SBWA 3TCXA 1CICA 4XMXA 4AYGA 2CA3A 2GBAA 1HH9A 4PYGA 4UM9D 4AUYA 1CI5A 2WNGA 2DV6A 2WQWA 3K46A 3LH2H 3TNMB 3H54A 3KYMA 3GSXA 3B3IB 1NANH 3K2UL 2MCG1 4CAGA 4HISA 1KELH 1FG2B 3HPLA 4XC1L 2FH8A 3DO4A 4N2AA 2VE6A 3IJHA 1CDHA 2WD0A 4M5ZH 2CM6A 2DJMA 4Q9BA 3H3KA 3SJVD 2BP8A 2DBLH 5EUOE 1A6ZA 2YEVB 4H0HB 4OF5A 4J1UB 3HUJB 3FTWA 3W9EA 4EI5C 4IKNA 3STZB 1AD0B 1BXXA 5PAZA 1UT1A 4G6JL 3EH3B 3T9WA 3V5HB 2DKMA 3V0EA 1KTLA 4FHBD 1YMME 3GSOA 1IEHA 5LBSH 3U4EB 3L2LA 1AHMA 3ZRFC 4NI3A 2B0SL 2UWEE 1NMAH 3EO9L 5E00A 4BFNA 1S9WA 2AJVH 2JCCE 3WFHA 2V37A 3GSWA 1RI8A 2WQXA 1H6UA 4FDWA 4FQ2H 5AOMA 4NQTA 1NINA 4X7TB 1DBAL 5E9DE 5GRWA 1GC1H 2YGNA 3P40A 5CKAA 4WNSA 1KIRA 1IC7H 4ZYKA 1PZ2A 3IDXH 1U8HA 1TFHA 4QRQB 3NJKA 1FYTA 4LEOB 1ZHNB 3NQIA 2R4SH 3ULVC 1TJIL 1QTSA 2FYYB 1E5YA 1G9MH 4JO1L 1YO4A 5BVJA 3ARQA 3WE6B 3MQIA 1JZJA 1DQJA 1VEMA 3FCSB 4OM1H 1WHOA 3GM8A 2FZ3A 2VABA 1QSVA 4XNMA 1TZOA 2O4EA 2YAFA 4LSTH 4GI6A 2NY1B 3F65A 5E9DD 4CU8A 3WENA 1W6WA 4AITA 4AMKL 2NR6A 1SXNA 2W94A 3FQ4A 2P5EE 1A5FH 2Y24A 4J3OD 3RBSA 4HJ0D 3FRPA 5A2JH 4H8VA 3W57A 3WU1A 1ESOA 4LPWA 3G6JA 1WT5C 1Z3GH 3R4DA 1I7UA 3L95A 3R1GH 4PU2A 4P2OB 4Q0XL 3MNVB 1QR1B 4AQOA 2MPAL 2QBWA 3NG5A 4AYFB 4HH9B 1XAUA 3NAAL 4HEMA 3NK3A 4UQEA 4ZS7H 4HCFA 2PW1B 3LSOA 3OMIB 4FI8A 5JYMA 3QULA 4W68A 3HE7A 3O2VL 4G8EB 5DWPA 5LXGL 2VZUA 2NY0C 3DPBA 4HUMB 4RGMC 2Y07H 4TSCL 1MFAL 3L7FB 1SXSA 1NC2D 1UM5L 1TTBA 3SDXF 4QHUA 2EE0A 4MLIA 4MMYB 4NQXB 1PJWA 2ORBH 1S5IL 3QORA 3KE0A 5BCAA 4B5EA 4MCYB 3NMEA 5IJKA 1CMOA 3OKEB 1OTTD 3OKMA 3TFBA 4IW4C 2W0LA 2EZ0D 3BAEH 4FCHA 4FYQA 4I1RA 1FNLA 1Q8MA 4DFIA 1JHKL 3RL2A 1CYWA 2CG9X 4LSSH 4Z7QE 1JHLH 3ZIMA 3LZFL 3CZLA 4PJCA 3GSOB 3QEQA 2JIXA 5D72H 4CUCA 3ZMRA 1G7JA 3O45A 3EGDA 4FNRA 1H3UA 3GUTB 3U4EA 3U79A 4ATWA 1JXDA 4OGXH 2E8YA 4ZMZA 1BQHG 1QSEE 3WJMA 4F7MB 4S1QL 4AYSA 5GXBB 3DX6A 4L3ED 4XR8C 4Q9RH 3G08A 2CXGA 5TH2A 1JL8A 4YHLL 2KLSA 3PDOA 2ERJB 1A2YB 2UV3A 1OCRB 3WFZA 1KIUA 4JHZA 4IDJH 4O4YH 1PZAA 4DGYL 1HINH 3CBRA 3H6JA 5HP5A 5F89B 1P4BL 4JG1L 4LASH 2DDQL 2EO7A 4HPOL 4PLJC 4XO5A 2VXUH 3BN9C 3GJFB 5E9AA 4EE2A 1GSKA 2ZKMX 3SDCB 4G43B 3DUHA 2KQMA 1QMUA 3NPSC 3UDWC 3BUQA 3GSNB 4Q2ZA 1Q0XL 1FFTB 2I7OA 4Q4IA 3RVWD 4MJID 3US9A 4ELMB 3CVIH 3RWFA 1BDYA 3I3EA 1U2HA 4UT6A 1U4FA 2VYRE 4JHAH 1PGRB 3LEVL 3FQRB 3FT1A 4N3UA 2K9FB 2F58H 3O11A 3M45A 4ZOEA 1ADWA 3WS6A 4JO3L 1JS4A 5E08L 2WN2A 4M7JH 5DTFA 1QVOB 2SEBA 2XN2A 4EUPH 2E7LA 3D69B 5KG9A 3APFA 1R47A 4PJGA 5D7LE 1V8HA 2XG4A 5JW3L 4UT6H 4OZHA 3OX8A 3ZE2E 2P46B 4XNXH 2QL1A 4JQXC 5DHXB 1M4KA 2FT6A 3I6LE 2IH1A 3LDBB 3NIGF 1F3JB 4L8SA 4NDMB 1YYLL 2JI1A 1F56A 4GO6B 2C7UA 3MJGX 4E9XA 2NNAB 4HG4K 1IC4H 4LGPB 4I0CC 1P4UA 2Y1VA 1ZANL 25C8L 3MBXL 3RFRA 1CXFA 4E9TA 3HNTH 2HT4C 3ZXAC 2CK0H 3TBYA 1G7PB 1Q9WA 1CGVA 1YNTA 4LLVA 3I6LD 5DUML 4JJ5B 4H1LG 3RUGB 3OLEA 2BS8A 2OJEA 1M9SA 5EUOF 3T0WA 1RP8A 3W0WE 3W39A 1MIEL 4XB8A 4A6YB 1UYWH 4YGVA 5G4NA 3WDIA 4QTHA 2K8QA 4YXKH 2NYYC 3VYNA 2H1PL 4GXUN 1FIGH 2P42B 3LZOA 1TCRA 4MA3A 2MCPH 3OAWA 4O2CA 1BF2A 4GRWF 2IGFL 5HPOA 1H6TA 3OPZL 2AQRA 2C3VB 5T1LD 1U8LB 1YN7B 4N9GB 1JF6A 3B9KC 1DP0A 3F7LA 4X6FB 4RBPH 3SDXE 1CIDA 4PPTA 3QPQC 4WEMB 5F1IB 5HPMA 2AV1B 3WKMH 3UJJL 5EUOB 5GS2H 4NN6B 2HWZH 4A63A 5FHAH 1NBZB 3N85H 3RGVB 1UADC 3HUJE 1ZSDA 1JK9B 3I75B 3U4BH 2JKRM 4KDVA 4MXWH 3QJFB 5CZXC 3NZUA 5K69A 2QADB 5EO1B 2OZ4H 4QRBA 5I71C 1T1WA 3PXLA 1JUFB 4Q6KA 4WRLA 2E8ZA 5C07A 3BVXA 5HYJA 2F5AL 2ZE0A 2WAQA 2CJSA 2YPLB 4LBEB 2Y22A 1R3IH 2O5YH 1JWUB 4ISVB 2Y25A 4N90E 15C8H 2VJ8A 2VDMH 4YNYB 2AJXH 2HFTA 3DURB 2HX8A 4KTDH 4N8VG 2C1OB 5E1GA 1C7SA 2M83A 3VXUE 2GI0A 1OZTG 3ZYOA 1ORQA 4FG4A 2YIHA 1MCHA 3KVQA 3MRNA 4B7IA 3ABGA 4UV7H 4N22A 1KOAA 2X12A 1RIHL 4G7RB 1N6UA 4S1SL 1KXQE 3IMBA 3FDWA 3FO2B 1VF5C 2CIIA 2APSA 3KLAA 3N42B 1I3GH 1TLKA 2C34A 3EOAA 4YJZL 2LU4A 1MCLA 5D5ME 3CFBA 5I1JH 3Q2CA 3REWA 1ONQA 3MRHB 5CIPA 2XG5B 3LXUX 5BS0B 3P0YH 2AEIT 4KVCH 2EDLA 3GSNH 1BZ7B 4HUUA 1F4YH 2D7QA 2ZCKH 4RVBA 2R15A 3K71B 4I48A 3ENEA 1SHWA 2FJHA 4PRHD 4DF9A 3EFFA 4J6IA 1HNGA 1KPUB 4UOQA 2H2PD 2XNAA 3T1WA 1BPVA 5CMAB 3ARDD 4LCWB 4MNHA 5IMOB 2CLRA 2A6KB 5MEQB 4RSVA 2V9QA 4LOVA 3GIZH 4JQIL 3WFBH 4PRNB 2DI7A 4U6VL 1G9HA 4OCSH 5SX4H 2X89D 5J7CC 4WW1B 1K4CB 3GRBA 3STBA 2GY5A 4XPGH 5DVKA 5H35A 2E46A 4R4FL 4YVUA 5DHMC 3OJVC 1F8TL 4FZEH 2WK2A 3IF1B 3RWCA 4DIXA 1ETJA 1RMFL 4ALAC 3QRFM 2X10A 3C08H 4L37A 5C0GB 1JPST 1RK0B 3CCHB 2H3NB 4NQDA 4XCEA 3W11D 2M1KA 1UB5B 2XRAL 3WY3A 5IB3A 1PD1A 3FN0H 1HSBB 3M1BB 4Y8AA 1EHNA 4C56B 4F92B 1FDLH 1AI1H 1TFPA 2X4PB 3UXFA 2O26U 4XZUA 4LL1A 1M1XB 3L6FB 3VD2A 2BRQA 3BIKA 2FX8L 1UACH 3OLIA 4UNTA 2A9ML 1WFJA 5E7BA 1G9EA 5IVZB 4ZMTA 2H9GA 2LGNA 4DP8X 3HG4A 3O9WD 3FU0A 4N8PA 5FAAA 2KPWA 3QO0B 4HS8L 3TJPA 1T1WB 5J1SC 1JNJA 4EDXA 2A38A 4DFHA 4YR6B 4ETQB 2OM5A 3ES6A 3BZDA 3E9UA 3OVUB 1WFIA 3MLUH 1FJ1A 3WFDH 4I88A 5F9JA 3FF8A 1XB3A 2JB6B 2C1OA 2GUOA 2WUBL 3L5JA 1U33A 4A6YL 1FORH 4RX4A 5DA0B 2R4RL 1JIBA 5BOZG 1WS8A 1E30A 2J5LC 4YDVB 2EDHA 5I18L 5IM7A 4PUBL 3GI9H 4HKBA 4IBTA 1J0ZA 3M07A 1WUZA 1EAPB 3BXNA 1JK8B 3U48A 4P5KB 1XF4B 2NY5C 3T2LA 4ZO7A 2M26A 4K9EL 2IOIA 3ZSSA 5FM4A 2Z7UA 4FE9A 5TQ2L 3FZUD 4DVRH 4U2ZA 2IAMB 3MOAL 1F90H 1JJUA 4ZO9A 4Z0BL 2QKIA 2H26A 4JGJA 5DT1H 3PNWA 4LK4A 3RTQD 1DHKA 1LK2B 3QPQD 3DOIA 1OARL 3RUGF 1KY7A 3S36L 3EHBC 4AG4L 5KSVB 1GCFA 3K91A 3VFMB 2R2EB 3PNRB 4OCWH 5LO7A 4OZIE 2F8VA 4JDTH 5F7HA 5I19H 4MJJA 3ZE2B 2I32A 3OQ3B 4GSDL 3BWAA 1A7PL 1DQML 3F2LA 1NCCH 1XD1A 2VLKA 3KW7A 4FQPA 3VRLF 2W60B 3ZZ1A 1HJBC 3WDHA 2OMWA 1FL6A 1DZ0A 1G6RL 4PIRF 4P2AA 2FHCA 1KB5A 4GRLD 4BIKA 3QFJA 4WHYG 3STZA 3GFUA 3FO0L 4W9IC 1BLNB 3TWCH 2A4EA 3KPNA 4X4MA 3AY2A 2WLNA 4NRXB 4G1EA 1OM3H 2DRUA 3OSKA 1GYWA 5AVZB 1X7SA 2WNKA 2HTKC 2D0GA 2ZYIA 1X44A 3PWJA 5F1SA 5KANI 3I6GA 3PGCB 2YRLA 1AQHA 1KJMB 4GW4B 3HA0A 2OR8A 4UINH 5CZKA 2ATPA 3QQDB 5FKAB 4Y88A 4WCYH 4WGWB 2H0JA 1UJTA 4FABH 3SDAA 1EDQA 5CGYD 5AOKA 1S7RB 3Q9PA 2FR4B 5AQ0A 1BVLB 3CIAA 4MKMA 4CVUA 4Y5YB 1YSOA 2X7LA 3DYMA 4MZ2A 5G5DA 5AVRB 1JGVH 4P5TB 4TNVK 3JV6A 4YVNA 5I1AA 3VGBA 3EO0B 4D3CL 1OT1A 1PNCA 2GPZA 1CURA 1I3UA 5BZWA 1MRDL 2CUAA 5IQ9B 5IESL 5BOJA 2ZTBA 1KB9J 1J48A 5GHWH 3G5XB 3FN9A 2VXVH 1CD0A 1OSPL 4PRIB 2A99A 4FKEA 3E1F1 4NZFA 5FECB 1CGXA 3OKKA 5FCUL 4JK0D 1HHIB 2FBOJ 1C5CH 2LTQC 5AVYB 2HFFA 4DP6X 4BCYA 1LLAA 2CRMA 1F58H 2ALAA 1HK6A 1S6NA 3L1FA 3QCVH 4NRYB 1KCBA 5IJCC 5CWSA 5DS8B 4L05A 2PN5A 3NCJL 4FG0A 5HDQH 5D1XB 3ZU8A 3CPUA 4GP4B 3ILQD 3BQUD 4ADIA 1IX2A 3ASWA 3EUDA 4AH2A 3KAAA 4XBGB 1QUPA 2R0LH 3S88H 1EXGA 5DQ9A 1NZRA 5DJYB 4NQXA 2VDQB 3WUWG 5D5MB 4XP9L 1U3JA 3ILPA 4LOEA 3WL9B 2X4QA 2VR5A 1TSRA 5JNYB 1OB0A 3D1MC 2A6JB 3DI2B 3J7HA 3O3BB 4J2XA 4I9WE 1NGYA 3NCYP 1AXIB 2MJWA 5D2NB 3KS0H 2A3TA 3HI6H 4DO5A 2K0RA 1KFAH 2AQQA 2DKUA 2JXMB 3BPLB 4OAWA 3TEYA 1RLWA 1FZJA 1E8ZA 1I31A 1QI3A 3K2UH 5E99H 1T5XB 4GRWB 3ETBF 4KVNL 3B7YA 5DVMA 1WP6A 1JZIA 3IGFA 4XCCL 3MC0A 4PCYA 2R51A 3LNDA 2J12B 4HMCA 1VACA 3NSFA 4XP5L 6PCYA 3LEXB 4KROC 3FYIB 5FA4B 1QBLL 3EJSA 3DX6B 4ORZC 1IAIH 1ZHLB 3MBXH 4B97A 4FFWC 1I8UA 2E3VA 3WFEH 1X7QB 1UENA 3F5WA 4I7ZC 4S0HA 3ZO9A 1I3VA 2CU9A 2VAJA 1A6UH 1P1ZA 3PGDA 4YK4C 1R1CA 1WSST 1BMGA 3QUXA 5I8OH 1WGOA 3LKRB 4KKAC 2CHXA 4MQ7B 3GJFA 2ATKB 5BRQA 2V2XA 2DLTA 3Q2VA 3I50L 3M6DA 1UB6A 4BFIB 5ERWB 2YKLH 4G43A 3VH8B 2J6EL 3F58H 3RA7L 4GKNB 4LEBA 3BUDA 1EVUA 2O5NA 4LCCB 5B21A 2O5XH 5DR5L 1UJ3B 4OQTL 4PREA 2XWDA 1T7ZA 5T3ZH 4AKQA 4XTRD 5B3SB 4XB7A 1KN2H 4FFYA 4G6KL 2P24A 2R69H 3HG1A 3KPQA 3FNKA 3VGAC 3QE5A 4UQ9A 4ONGL 3INOA 4EJ1C 3D3VB 1AYRA 4H5SA 4KTGA 3GI8L 1EEZB 1NBVL 5I71B 2LLLA 1LEIB 4JHUA 3L4CA 3ULVF 3A67H 2VJ0A 2X0VA 4AUJA 5D1ZB 2ICEB 4KDTC 1IKOP 2N59A 1A6AA 2CMRL 4KU1A 1KGYE 2ZCLH 4UNIA 3U46A 1LO3L 3MACL 3O8XB 3EDKA 3BLKA 43CAB 4OIAA 3NCMA 3HE7D 5IB4B 5EDXA 2LAGB 2HTKD 3QNZA 3KJ4C 4P48A 3FQ1A 3HJ0A 1JYNA 3GRWA 1UC6A 3HUJF 2D2CC 4I3SL 4DEUA 1IT9L 5JOPE 1S7UB 2AJXL 4LQ1A 1A1NA 2GG1A 1UZ8B 3PPSA 4LNRB 1SM3L 5SV3A 1DQLH 1M71A 5T33L 2YAOA 3A47A 3QO1A 4XNUL 4Z5RB 3VQ2C 5KBPA 5GJSH 3RRQA 2G5UA 1MFCH 1RIHH 1C12A 3CLEH 3H85A 1NSNH 4PJ7F 3ECBB 3SYPA 5DYFA 3DO7A 1LO2H 2E27H 4N5ED 2HMID 1J1XL 1MDTA 1P7KB 4NO5B 3MO1A 4AZ8B 4TQHA 2FGWH 5JOPD 2ROYA 4OAWB 4DN4H 3BKMH 1JWSB 4ZZKA 3T3ME 3HI1A 4KVCL 4JFEA 1MQKL 2E59A 3FRPG 1F4XL 1X5FA 2VDQL 3FFDB 1O7DC 4FYSA 4R7VA 4XMKH 4HGMA 1K85A 5DK2B 5FO7A 1WBZB 3Q3GB 4R97C 5DU7A 5FC9A 5KS9F 3V52H 2DL9A 3VWJC 2QPSA 2ADFL 2IAMD 1QHPA 3GDCA 3JTSB 3OB0K 4MS8C 3R0NA 1PX3A 4UT9A 3ULUC 5LUMA 5HYQA 2DM3A 1EEQA 2R9HC 4G82A 1LO5B 2CLVA 1EAOA 1N10A 2DKSA 2VMCA 1LWRA 4GSXA 4KV5F 2XJKA 4FQLH 5HI5C 4OB5L 4CBPA 2R8SH 4L4VD 4P2QB 1ZV5A 4G9DA 3LZFH 4XMPL 3OAUH 3FBQA 3MV9B 2WO4A 4RFNC 3EYQC 4NP9A 4AGMA 3LHAA 3KNBB 2QQLH 5HHXL 2GC7C 3V0HA 1NCTA 3QZWB 4EF3A 2JJWA 3DDGA 3LPFA 5GGSA 4L0ZA 4MQXD 4ODTL 3DURA 2I7SA 2XT1B 3BLBA 1IVLA 2IBZY 5B7FA 4JY4A 5DHDA 5I23A 4DP2X 2E7HA 4U1KA 3BT2L 1S4IA 3CLFL 4M29A 4ZTEA 2IH8A 1U8QB 3V0GA 5SWSB 2VQ1A 3AXLA 3L48A 3ZJAA 4NX0A 3M86A 4FG6D 2VXUL 2XZCL 4J23A 4IHOB 3B34A 1QFPA 3MLWL 5JXAH 3OF6A 1W0WB 2BSTA 4N2KA 5KUKA 4OV6F 5GRJH 2CGZA 4PJIB 2VR7A 4BUHA 1R4XA 1OB1B 1Q94A 1NLDL 2BVQB 3LZLA 2Q6WB 2N4IA 3R1GL 5CJXC 3E8UL 5K93A 3SYCA 5FDYA 2EYSA 1KLGB 5F72S 5IB5B 2QEJA 2IALB 4PJDE 2OJZH 4X6CF 4AKOA 4XHJC 1JPSH 1U8PB 7CGTA 5AZ2H 2ED9A 1EA9C 5IY5B 1N5YH 2CXKA 3CPLB 3DETD 3ZUCA 3ZDXF 3IM1A 2X6CA 4MBRA 4OJDH 1JZGA 3L5IA 3NSDA 5C0CA 1DR9A 3C8DA 3PP3H 3O2VH 3D39B 3NDYE 4CVWA 2IGTA 1BQUA 3EH5B 2A6KA 1CE1H 4JY6B 1R3HA 3NOIA 3GSUA 3L3JB 3PQYE 5KN5A 3PCYA 3IJSB 2O6CA 2ZX8A 1FGVL 4LQFH 2MMXA 4YO0A 1SMDA 4UQDA 3UL4A 1AIFB 3FSWA 3UC2A 2CWRA 3CX5K 3S35H 3QDGE 4ZSOE 2NZ9C 2BFVH 3RVXC 3DX0A 3NIDB 4HV8A 3RY6C 4DERA 4C83B 1KEMH 5F7DA 2D9CA 2D0FA 3MFGB 1JCKA 5CINH 1CDIA 3LS4H 5BV7H 1LP9A 1MPAL 1RZKL 4TTDC 2EEDA 2BXYA 4BQ8A 4K71B 2MTAA 3WNIA 3ARGB 2ICWJ 3VFPA 5AL0A 4EIUA 5EOQH 2FT7A 1FUNA 4RFEB 2VUOA 3B2VL 1B3IA 1ZJAA 1QPPA 4PJAB 4R4BB 3O6MH 4PJBF 4P2YA 1V27A 1B0IA 2K9UA 1FZKA 3LXCA 2P9RA 2ICES 1D7FA 4JR9H 3I6SA 4Y19A 5T1DL 1CLZL 1FIGL 1CF8L 1FFQA 2UZYA 4GW5B 2ESVA 3FO1A 1U8CB 3GNMH 1PBYA 3LEYL 4KITB 2A4ZA 4C8XA 1WK0A 3K4ZA 3LVEA 3TCLB 4K71C 4LHUD 5TTRA 1JYVA 1BM3L 4RWYL 5JIQA 1S2EA 4GXUM 3BP7B 5DURD 1JHTB 2KZ1B 1M1SA 7PAZA 1ADQL 3JWOH 2ROXA 4PJ5B 5AD0B 3RFZB 1A6TA 2CKBA 5DCCA 5EULV 1GW0A 3D4ZA 3C9NB 5L9DH 3LQAC 3AJ7A 3ZTDC 4HLEA 5MERB 1Y0LB 4GG6F 4JY5H 4UINL 2CR6A 3VXUA 1BHGA 2YEZA 3WNJA 3JUYA 3O0LA 2FEDC 4JZNA 1H8NA 4RAHA 4HJJH 5AW1B 2ICWB 5KYUA 5JOEA 5C0IB 4LFHG 4B6ZA 2R23A 4LCUA 4A7QA 3BP5A 4PY8I 3B9KD 2LE9A 1L9SA 5T1KD 2JH2A 3BN3B 5IFJA 2D4DA 2ZXDA 4KJYB 3US0A 3NN8B 3WHE0 3JXAA 5GS1A 5B4MC 1J0KA 2KBGA 2D0HA 4J8RA 1IGYB 1F2XK 2N1TE 3CH1A 4ZPTA 4NNYA 3MMEA 2BVPB 5C70A 4HIJB 4TRPH 4Z3EA 3JVFC 4JM4L 5AOJA 3N55A 3T0VA 3ZX1A 1LE5A 5IQMA 3DNKA 3EH4B 2Z8VC 5I1KL 2VZ3A 4PSPA 4X5PA 4YSEA 3DRTB 5GIRA 4DAGL 5I2IB 5A3ID 2FGZA 1M6UA 5A2CA 5EF2A 5HDOA 2CIKB 3PIQB 3WTYA 2VB5A 4KK6C 4N86A 4RRPG 1QRNE 4E42A 4OLXH 1YPZF 2R1WA 3QCVL 5J5EA 2H1PH 2YMTA 2ZPKH 5HYEA 4LPTA 2ZXGA 1BJMA 4NAQA 5ESAB 2E75C 1INDH 3I6GB 2H32A 5DJ6B 3DKHA 4XI5C 3PE9A 5GQBA 2V5RA 4PJGB 2WZPD 4WV1A 3QG7L 1INEH 2NOYA 1ND0B 1L9QA 2DQTH 1BIHA 1A64A 1X9LA 3BHBA 4L4TB 4QO1B 1KIQB 4XP9H 2IH1B 1S9KC 3HHSA 2F15A 1ZEAH 4PTUB 4U3CA 4UM8B 1LK3L 1TNNA 3D08A 2DWEB 4ODHH 5DRZB 2RGSA 2HT4D 3N44F 4JHAL 4P9HH 4XNZC 1ECZA 1MFMA 4KKLD 3MRQA 4HGKC 1U91A 4JM2B 1U3ZA 5CEXB 1FDLL 1PYWB 4MRCA 2EVFA 5D6DA 3N1QC 4UDUA 3WS3B 1ACYL 1JZFA 4I89A 2H2PC 4O58H 4ELDA 4R84A 2GSGB 4JKKA 1JD7A 1UWGH 3GINA 4N5UA 1V55B 2J1WA 5G55A 4FQJL 4PJHE 2E9GA 1YYLH 5EBWB 2GJ6A 1CVSC 1BBJB 4IBSA 4Q6IC 4QF1A 3UTTA 4PH8A 4LCUB 1RL1A 1XCQA 1P4IL 2XN9B 1UHVA 3S3SA 1OAXL 2F74A 2XQYK 1AQMA 2Y6TE 4BZ1A 4WUKH 4QHMA 2WWKT 3QH3B 3ABZA 5BRZB 1H8OA 2A77H 1SEQH 1U58A 2EXWD 4WI5A 5F1IA 3GI9L 1XEUA 4ZUSB 3RGVA 3MMEB 5C0DA 3BMWA 4JB9H 3CFDB 4BFKA 4E9RA 5IVXA 3UACA 1RZFH 3CHQA 2NXZD 3A21A 3FT3B 4PRDA 3JV5A 1RULL 3KBHE 3QFJD 4Z95L 3SKOA 2HJKA 4NGHL 4X5XB 4O4YL 3FU7B 1RZGB 2XFXA 4FQIL 4PJ9A 3W9EB 3DRTA 4UQ3A 3ZW3A 2MCPL 1R19A 3CUPA 1N19A 3NGBC 3SE9H 1FP5A 3QJXA 4U6VH 1G94A 1I8KA 1MVUA 4XVJH 3F64A 2W0FB 4HK3J 1IGMH 2IPKB 2QQKH 4JPIA 2RR3A 1KCRH 3K6NA 4N0YL 1NDMB 2DMCA 3D18A 4FD0A 1FQ9C 4HMEA 5EA0H 2H6PB 1N59A 4BZ1L 4XPAL 5FB8B 1N6QH 1W9XA 4YLCA 1G0XA 2DLEA 3DTXB 4ORGB 5EC1B 3ZDYB 4UTAH 1F3DH 1IU1A 4WWOA 3O6LH 5C3IA 2JKSA 5ACMA 3QUYD 2QZQA 1BQKA 4I77H 4JNXA 2F5AH 1J5OH 1XB8A 2JTDA 3F5WB 1BF5A 3BKYL 3QDGB 4ZSOB 5IBTH 2ADIB 2R2HA 2L7JA 1DZBA 5CR1A 3AB0C 1SYSA 1ZXQA 4ZS6D 3EFFB 2YS4A 1BXAA 4X9FA 3V7AG 1S78D 1XDTT 4F7CA 3RZCD 1PG7X 4FERA 4WF7A 1XAKA 4AGPA 4HSQA 2XWEA 2K70A 4LSPH 3MRIB 5MEQA 1JVLA 3X3FH 1IIKA 1YEHL 3ZHNA 4OJAA 4PRNA 4FFZL 1MVFA 1RZJC 3VXOA 4Z7VA 2JKIS 4EZLA 1VADB 4FXLA 4GW1A 4I4WB 3KG5A 4YZFF 5HY9A 2EDYA 3HNTL 2V5TA 1EHXA 1KJ3H 5L7XL 4XRCA 1NAKH 3CFEA 1ORSA 2NY4C 4BK8A 4YXHH 4MB5A 3N1FC 3QJUB 4MCZB 4R0LA 5KSAB 1FO0L 2XTJD 4YOKA 5IB4A 1UUSA 1BYPA 2X88A 3AWFA 4XH2A 3KWWA 1HIMH 3O3EB 5A43C 3UTOA 4L23A 4HDIB 3G6DL 4WKZB 3QXDA 2H7WA 1KCSH 1JGDB 1MY5A 2GQHA 1QRNA 2LTQB 1T80A 1T7XA 3PHSA 4L3CA 3G04B 1T0NB 4POZD 4Z76B 3MRCB 3HG1E 4QYOA 4EI5D 5EZOL 3HC0B 5IQLA 1JCVA 3BPNB 1OAYL 4PVBA 2WOBA 1Y18B 1W0VA 1U8NB 2WINA 4Z5RA 1FVDA 4Y4HB 4C4UA 2Y36H 4FTVB 4FZEL 4QOKB 1C12B 1JNNL 1I9RL 3NA4A 5BS0E 2FATH 1TETL 4FFZA 5C09B 2C9QA 1KF9B 5LG6A 1XGQB 4RISL 5AVWB 3BH8A 4PJCB 1EO5A 5C08D 1FBIH 4KKBC 3WBDA 1HCZA 1FNSH 3O45B 1YEEL 3EGDB 3U9UA 4N2MA 1CK0H 4PQXA 3RWHA 2APBA 1ITCA 5KAQF 1NLDH 5IMMA 3QORD 2IWFA 1J8RA 1IAIM 3HFMH 3JV0A 3QQNA 3D2UD 5CN1A 4F2EA 1AKPA 1JGLH 3O4LA 5ELIA 3B5GA 5EZIH 3TBTB 2E9IA 1SF3A 2J8UB 3OV6A 1E3XA 2XHNA 3B7TA 3AREA 1Z9SB 2AQTA 1QSFB 3U1SH 2R29L 1FFNB 5BZZA 3FT9A 2IMNA 4CNIB 3C2AH 3ZL2A 2XA3A 5EHFA 3CLWA 4NI6A 3GZQA 3BUBA 2Z31D 5KYXA 2WUBH 4FTDA 3MGOA 1YC7A 2WWNA 5AAMA 5L0QB 2EC9T 2WCGA 4P06A 3HW7A 4WNQA 2UY7A 4KVPA 3CDZB 4H0IA 1QNZH 1L4IA 1MF2H 2PO6B 2Q2EB 3MLYL 3EYSH 3QAZB 4JO2L 3F7VA 1BEXA 1WS7A 2L8AA 1NIDA 3Q5OA 4HWZB 4JDZB 3U9PL 1HOCB 1QO3B 2JQMA 2GC4C 2PTUA 2ZP0T 4NQCB 4MJIA 1SN5A 2BC4A 3RWIB 5FYJL 1AG6A 1SXAA 4JZJB 1LWJA 4OZHB 2COVD 4NBZB 2EUWA 1UWXH 4R6UA 3QIBC 5D96C 3HAEB 4XCFH 1V7NL 1UWYA 5GRUH 3S96A 3L08A 3TURA 1XSOA 1KYUA 1D9KA 4YSDA 2J1ZA 3U9WA 4ZXBC 5ALBL 1R24A 1TJIH 1YLBB 1BZ9B 3HZYA 4IGBC 1UKSA 4RMSA 5JIIA 1KC5L 5AFAA 3SGJA 4UDTB 4MFHA 4ONGH 2MCAA 5J6GA 4YPGB 2EYTA 5CBAB 4LLQB 5IZ7A 4ZD3H 5DLLA 4X8JB 4IDJL 3SQOH 2PKDA 4WTXA 2WLYA 4LSTL 4FYTA 1XSKA 3BEVB 1CLOL 5F7KC 1JNHA 3MLVH 1T1YB 3LRLA 2CJ3A 3BGMA 4LE8A 1QFWM 3ULSB 3KDPB 5EU7C 3CMOL 3V6BR 5KN5B 3QA3A 4B41A 1DUYB 3LZQA 1KJVB 4TXVB 1EFXD 4ODBD 2TRYA 1N5AA 4J2QA 4LGSB 1CFVL 4YHYC 3I9IA 4L9DA 4ODUB 4XO4A 3NTCH 2QPDB 2VDPB 4U1GC 1NEUA 2K6ZA 2BHYA 4N9GA 1SM3H 5FX3A 5JQIB 3H2QA 2VJXA 4S1RL 1S5HA 2OTUA 3BSZL 3HS0C 4GJTB 3UC0L 4DN3L 1OTUD 3VD3A 5GGTA 3SDYL 5I18H 2Y23A 1ZHBB 1ZSDB 1AO7E 3GUFA 1HE7A 3HMWL 1MFAH 2FBRA 2PYEB 4GMSH 3CVDA 3FQNA 4OIBA 1F18A 4V1DB 4YPJA 1N18A 3IAQA 4MDJB 3RL1A 1X5XA 1JD9A 4PP2A 5EF0A 4JO4L 3JWDH 1HH9B 4KZ0A 2XCMC 4HWUA 3VG0H 4F58L 5IEHB 3FOLA 5HI4D 2R1XB 4XMKL 3VVWA 2OYMA 1IAKA 1Z9MA 5E70A 1RCYA 2DEXX 3V8CA 4KHTL 2CNYA 4FG2A 1VAHA 4TUOA 5CZRA 4R8WH 2E9WA 4AM0Q 4E9VA 1A4JA 1XF5A 2WYZA 1F1GA 3IJHB 1SRDA 2HT3D 5EWIL 2WGXA 4G7VH 3MBEC 4GRLB 5DYOA 1BOYA 3S36H 3GPEA 3TBVA 2XJLA 4P5MB 1HESA 3HG2A 2K4WA 4EKJA 4J39A 1JRHL 2NW3B 4JFXB 2YEZB 3KJ6H 3CGTA 2FLBT 4N0RA 3MV8B 3UG5A 1E4KC 4AC4A 4M6OL 3DROA 2FTAA 2C4FT 4JG1H 3F3HA 4PV9B 4ETYA 2BY2A 4F7EB 3MJ7B 4XNQB 1C1EL 5DJ2A 3FO0H 4YZWA 2XNAB 4YPGA 5CBAA 4ZMAT 1JZ4A 5E00B 3V5KA 2X4UB 4JKWA 2OZ4A 3TBBA 5JYLA 4OLEA 4X8JA 1ZTXE 2YA0A 4FL4B 4E5XB 5ID0B 3W81A 2VL5B 4I3SH 1KIRB 4ZYKB 4QDGA 4EN3D 3S5LA 3S6CA 2EDQA 1QKZH 4RMUA 1XCWA 4TUUA 2EDEA 1G0YR 1K5NB 3RG1C 4WFEE 1TJMA 4NFDA 5BVJB 3D85B 4MNQD 2BWQA 2XTLA 5FYKL 5B1JC 1BAFH 1M7UA 3TYGL 4GRWH 2FYVA 3VFGL 1S7WA 2VABB 1MJUH 2JELL 4L3EE 3OJDB 5GGTH 1NUDA 3A6BL 3GBML 2EDBA 4WFGE 5INDB 5JORA 4ABUA 4KK8D 1V05A 1WHPA 1QBLH 4XMVA 4N0FA 1SJXA 2FGWL 3AQYA 1S5HB 5FIEA 3IN2A 4HMDA 5DFAA 1Y1UA 3J27A 2EXYD 2VT0A 3LN5B 3MUUA 4J3UA 1CE1L 2VDQH 4OCRH 2X2YA 1XTLA 2VWEE 4PLOB 3APMA 3AADB 5DS1A 1A6AB 2IGLA 5ADPL 3C60B 4MGXA 43CAA 2DLGA 2PO6C 3LRSB 5ICXB 4BFBD 1N0XH 1CE6B 3WEXB 3BQUB 4R7DA 5EO9B 3UERA 1XXFC 3CDGA 3KBFA 3NESA 4MNGA 3U30C 2D7MA 3NJFA 1NBYB 2YJQA 4A2DA 3EYFB 4AYEC 2CHNA 1GAFL 1N4XL 2R69L 4GIOA 4MHHI 4F24A 5JHDD 1A1NB 1DO5A 5AAPA 1MCRA 4BD4A 4Y19E 5D2LE 1EWHA 4JFQB 5I28A 3MV7B 1T03H 3AABA 4OGYH 5EUKB 2ITDB 2W38A 3G7TA 3I2CL 1D2OA 4X6DE 1R5IA 4TLSA 3ZGHA 1NEPA 1MJJA 1PS3A 1XZ0B 2FK9A 3G5VB 5EO0B 2EDWA 5KS9A 4XVSL 2BX5A 1RJLA 4PBVC 3L3DB 5JHDE 4EQ2A 2F7PA 3GBLA 3JYBA 3VFTA 1JWSA 1G7HA 3UTTB 3R4RA 4WUUE 2NTFA 5EBLA 1I7TB 1T66D 4RGOH 5LAXB 3WKPA 4DPAX 5E24E 3CDYA 5E8OA 3ARSA 1CT8B 4HHAB 5KW9L 4ELMF 3LYRA 4Y2DB 2OMUB 4P23B 2PPFA 2YC1A 4ZUWA 5E99L 5L9DL 4X6BB 3VFRA 1A2YA 2VDRL 2FX8H 1FI8C 3S3PA 2MEJB 2YWZA 3FFCB 1C5BH 4B9YA 3ILEA 4NQCE 5F7NC 5GS3A 3ZY7A 4CGUB 3FUJA 4BCXA 1X3DA 4LEEA 2PPCA 2L4OA 1D6EA 1K8DA 1YMHA 1NM9A 3RTQA 5HTSA 3H7BA 4I0PA 4WUUD 4E41B 3FUMA 5H4YA 3PWUB 1J0HA 3F01A 4PJEE 5HI4C 2E9JA 4PJ8A 5BXFA 1EAJA 1MLCA 5F9WB 3BUPA 4QNPF 4Y1AA 3MR9B 4HJGB 3GZOA 1DYZA 5DEFA 1BLNA 3F00A 1HEZA 1CDCA 4QJ3B 3WXVL 5J3HD 5DMIL 4UILH 4NQCD 1E40A 5DUPL 3TZVD 5KUMA 1L0XA 5JPMB 1VJSA 3P2BA 4WTWA 4HHWA 4OQTH 1A7OH 1N59B 2PCYA 1KPVA 5C0AE 3LH8A 4OY9A 3EYVA 3D69A 3ZZSA 1YHPA 4K0OA 2EE3A 4NKMB 2FR4A 5H37A 4WK4B 3MJ9A 3VDCA 1MFBL 2ENQA 1DUZA 2GJZA 4UOW0 4IBYA 5D7HA 3FU5A 1I9RH 3CSBA 4YX2L 4AT6A 3IXTA 4WVRA 3UPRB 1LP9F 2WHVA 3MCLL 2DYRB 4K5LA 1MUJA 3BT2H 5ESVB 2UZIL 3BAIA 4GBXC 4J3OF 5LXVA 1NFDE 2VOTA 4BE6A 4A04A 5C0BB 3T65B 1G1CA 2I9TA 4LSQH 3PWNA 4LRIC 2WSDA 3OHXA 3VH8G 3OKDA 4OH2A 4IOIA 4XMLH 1QTYT 2Q7YA 1A7PH 1DQMH 4FNQA 5LN4A 4JFWA 4JRXB 3OKOA 5C0EB 2JFCA 1CXEA 2BSRB 4G9FA 4GG8A 8FABA 2MPVA 5ENWA 4HUVA 3QC6X 4U6YA 1AXSB 1XL6A 3MTXA 1RURH 4KHXL 3WE6A 5DQJB 2XA8H 4U1MB 1OM3L 4K3GA 1URIA 1U8LA 1YN7A 3CFMA 4C4KO 1Q38A 2BOCB 2X89A 3O3EA 1R5WB 4W9JC 3B83A 4KMQA 4Q6IB 1R17A 3E80A 3FB8A 3GC3A 4O58L 4JFPA 4LLYA 1VFUA 4RFEA 2HRHA 3FFCA 2VRAA 5FYJE 4QRPB 2VAAB 3LN4B 4HQQL 5EDSA 4PJ9D 4IIQB 1SDDA 2F8OA 3QJZA 4G6FD 4PRPA 4JREC 2HJLB 5ACZA 1OGAE 4QRUA 5GSVA 1U92B 4PLJD 1DSFL 4NN6C 4X0KA 3DO3A 1SY6H 1IQDA 4IIQC 5E4IA 4QJ5B 5J0BA 3QDJA 4JM4H 5DS2A 1F6AB 5GRVK 4W9LC 5CR8A 5IVXE 4XMPH 1V54B 3FUIA 4ICWA 4AYFA 1SEQL 5IK3B 5FOBB 4JN2B 3V4LA 4LSVH 5FYJD 4N0UB 3GGWB 3PXJA 4NBYB 1SJHB 2DYPA 3QNYA 2PW2B 4EEEA 3JV4B 3MJ8A 2QDWA 3WNLA 3IGLA 1A6VL 3O6ML 3QISA 4AEIL 3CZFA 2Y1ZA 2GW5A 1KCVL 3FO2A 1II4E 3G5ZB 4F37K 5GHWL 4Z7OE 2P5WB 3SPHA 2GFBA 2WLHA 5DJ8B 5JMRA 1Z9SA 2GY7B 3B9KA 4PV1C 1TSHA 4PMEA 3REWB 2BOBA 4X6DA 3SE9L 3MLVL 5BS0A 5EZPA 3MCG1 4KKBD 4LLDB 2P4AB 3ZMNA 2A83A 3L7EA 4JDTL 5J4MA 3IJEA 4MBOA 3T04D 3S3BB 2CZNA 1ZJBA 2JIXB 1C8QA 1IGML 2QQKL 4KJYA 3S5YA 4MCMA 1DJSA 3EYOB 4M5YL 4WI4A 3TPUA 1NEZA 3ARFD 4TNVF 4X7EC 2YKKA 1IGYA 5E2TL 1K4DB 4NNYB 3U7YH 4IRZA 2NT1A 3C8KB 1K8IB 1QFUL 2WXFA 2DQ6A 4HZLB 4P59L 2DTSA 4OUUB 1F45A 4JRFA 4D0CB 4UANA 1QUNA 1WEJH 3AW5A 4M8UA 4AZUA 3AC0A 1AANA 2LFGA 3NSCA 5AAWC 1P53A 2WY3B 2J8OA 4UV4L 2GKIA 3QWOA 2F54A 4XPHL 3U0TB 2W91A 4XXDB 4KKZA 1MI5B 4IMKC 3DPDA 1WC7A 1JG9A 3LKQA 5I17A 5I0DA 1FN4B 1MCEA 4Q2ZB 3LQZA 1P5UA 5B1KA 5D2LB 2H3NA 1QW8A 1VPOH 1T21A 1SYVB 1S7QB 3VRJB 4F33A 1JZ3A 1JTPA 3EYUL 4C56A 3V79C 2VL4A 3C60D 3BRGC 4XAKD 3AU1A 3Q8FA 3HR5A 5IJBC 3OM3B 3HNVH 2DWXA 3LS4L 4UIKL 3U0PB 5J6GB 3QQ4A 4AJYV 1UATA 5I1KH 1ETZA 4NB7A 4PTTA 5EIIB 1IO4C 5I5RA 1KG0A 5DQDL 5L7XH 1KTRL 3QP3A 4H8HA 1E8XA 2Y2YA 5AW7B 3ZDYF 4R2GB 4TNFA 2DN7A 1P6WA 4NYLB 4Y16C 4JQVA 1JZ5A 3BFQG 3QAQA 1KBWA 4YIQA 3KHOA 4FJYA 1XZWA 3HI1B 3M1CA 1OP3K 1J8HD 1F00I 2ZPKL 2G4EA 4PWKA 4XMZA 5C9KA 3SEPA 5IV2A 3JV4A 1INDL 3MJ8B 2YGQA 3GNML 4KO6A 3AXIA 5EU6D 2JKXA 4RNRA 1P7QD 5LGKA 1D5ZA 4EIBA 4BFRA 1ZVSB 4FQXC 1IGIL 1AGDA 1EO8L 1OSEA 4IEFB 3ZLQC 4U05A 4MJ4A 1JP5A 2FATL 1RPUA 2BOBB 4XPAH 1GGBH 4RMTA 4X2UA 1RSFA 1A65A 1PQZA 4M8QA 1U30A 3DVIA 3FQNB 2OS7A 1A3LH 4V1DA 4XN2A 5BVPL 2BOLA 5FO8B 2IBGA 4PP2B 1QNIA 32C2A 3GMLB 1FE8H 1HFUA 4JFTA 4UWQB 1TCRB 5GRZA 5L2KD 3QWQB 3OHXC 5BJTA 1MFNA 2UWEB 4OFKA 2XQBL 2C3VA 2QHRH 2WKOF 3BZFB 3VI3F 1UWXK 4KRNA 2JCCB 2CUHA 2C5DC 4J3TA 4NENA 4QXVA 3D0VB 4TQEL 2ZX6A 3H55A 4U1HB 4PRDB 3CC1A 4HC1A 3CLEL 4L1HA 3OR7B 2XPGB 1AGFB 4QKTA 3QNFA 4X5XA 5DC2A 2Q0ZX 3QNXB 4LSPL 3FU7A 3TM6A 3U82B 1BZ8A 3UYRL 3QJFA 2XETA 4NXSA 4PWEA 5L2KE 4P57A 5AAMC 5C07B 2IDUA 4DW2H 2N3JA 5C0FB 4BFFA 2X9ZA 3L5XL 2J72A 2ALWA 3MPCA 1XF3A 3O3DB 3QPXL 2VSDA 4GT7A 5DC4B 5A7EA 2YMOA 1KLGA 4YHYB 5GGQH 4FFVD 4Z7WB 1J9RA 5C0BE 3SKJL 2Q3AA 2WANA 4YUEL 2ADFH 3N44B 4I2XA 4GQ9H 3FT4B 3MLYH 5C0CE 5JPNA 5JXED 2WTRB 2G5BA 4APQB 3GMQB 1A9VA 1H3VA 3N41F 4TPRL 1M56B 2IVFC 1U9KA 2HLFC 3CFJA 1QLFB 4U33A 1LQBC 5DR5H 5JDJA 3FTGB 2AJ3A 1NBCA 3PWPB 1A7NH 2OXHA 5EF3A 5AOZA 1EDHA 2Q20A 5F88B 5CJOL 2OJEB 4XCFL 2B1HL 5CNHA 3D85A 4MDRA 1NL0H 3QEUA 5IMLB 1WFNA 4HUUB 2WLJA 3QWRD 1WF5A 1JNNH 3W9DA 4BZ1H 1PEZA 3IB4A 1HNFA 4I48B 5SWZD 4L8BB 3IPEA 4RISH 1PKQA 3FB7A 1T6BX 4PB9L 4UQAA 2DIJA 1QD0A 5F93C 3TN0A 3T2QA 3U2IA 1J18A 1XGYL 2OK0L 2ZX5A 1U3YA 4X6EA 3VFUB 1ZVSA 4JUSA 1U8IA 2AJUL 3FBKA 4KXZH 1QYGL 2QR0A 3GSQB 1PZDA 3ZHLA 3JVGA 3WLBB 3ARBC 3SQRA 4DP5X 2MNUA 4M1GH 4KZEH 4NM8L 1J0YA 3RPKA 1K4CA 1I1AA 4AEEA 3TGXA 1O7VA 1Z9PA 3ET9F 4HW6A 4L8DB 3NEXA 3JSSA 1UKTA 3TJHC 3RILA 4J3VA 2Z4QA 3MLSH 4GEJA 1NC2B 3G6JE 1H0DA 5HHQA 3ARBD 2V5MA 3D05A 5KJ7E 3QYMA 4IRJC 2UWEA 5KYYB 1E8YA 4UU9B 1PLBA 3RIFF 5BW7C 1EK3A 3EYFA 4M3JA 2XVBA 4DGWC 4UNVA 1A8JH 1KV3A 4K7PL 5AW8B 4ABWA 4TL4A 5TF1L 4PAZA 3C9NA 2YUXA 1U0QA 4G8GB 5C08A 2H3XC 2YBGA 1A7OL 2WTPA 3GHEH 1ZGLA 1FGVH 2VLLA 3FKUS 4M93B 1TLMA 2N01B 1RZFL 3DRQB 3CFBB 1E42A 1L9RA 4HVBA 4Y7MA 1HIML 1GL4B 4HG4J 1S7TB 2WNWA 4KAQL 2YSSA 1XF3B 3IDXL 3O3DA 4HAKA 4UAOC 4XNZB 1FGNH 3QEQE 1BD2D 2R4SL 3UTSA 1CGWA 3P3SA 2Q10A 3B2UC 2ZOLA 4KOCA 2BY3A 3FB5B 2V7HB 3VSTA 3LV3A 2FSEA 5EU3B 1VHPA 1HHJB 3Q5TA 2AANA 2J8UA 2UZIH 3GMQA 2NX5A 2XQYG 4LEXH 1XQ4A 3GB7A 5EIQA 4PY7A