2WY3B

Structure of the hcmv ul16-micb complex elucidates select binding of a viral immunoevasin to diverse nkg2d ligands
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
VDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLGSLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I POLYPEPTIDE-RELATED SEQUENCE B
publication title Structure of the Hcmv Ul16-Micb Complex Elucidates Select Binding of a Viral Immunoevasin to Diverse Nkg2D Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 33
structure length 137
sequence length 137
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1990 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2wy3B00
2WY3B
chains in the Genus database with same CATH superfamily
1NC2A 1J1OL 2UY6B 2ZAGA 1T2QH 4ZFFB 1KPRB 3ZDYE 3NIFB 3CFEA 5F1OB 4KKLC 3TCLA 1AZVA 4GAYB 5DEGA 3IPEA 5IZ7A 4KZ0A 2OAAA 3LQAH 1RZIB 3QQ4A 4FQPA 4LLWA 1A4AA 2BSSB 4LL1A 3HAEH 1SBSL 1WC7B 4Y4KC 5B1JA 4DPAX 1BYNA 5DD6B 9CGTA 3RILA 4JDZA 1NMAH 2YD0A 5HHQA 2ZKWA 3KEHA 1XSOA 5F71A 2VMEA 4LCWE 4OVUA 3L4XA 3MC0A 3K8MA 3NYKA 5HJDA 1JV5B 1QNZL 4X6CA 5DJ8B 5J6SA 1MCNA 2EYTA 3WFDL 1JWSA 2NX5D 3HBPA 3MACL 3IMTA 2EDJA 3DVGA 2EO7A 5G55A 3I2CH 2KPNA 3A6BH 1MRCH 2J43A 2LU3A 4YIQB 1TTRA 1T1XA 5IIEB 1ZOXA 43CAB 3BEWA 1HOEA 1KJ2H 1ZS8A 4ZX3A 2A5UA 2WINA 1A8ZA 1CXKA 4LOUC 3LH2L 3RB7A 4MA8L 4LKCB 5DHXB 2IBGA 3VXUB 2C9XA 4XH2A 3RVXD 4IQHA 1B6DA 1QG3A 1XCXA 4N9GA 4NT6A 3MLTB 3KYNB 4LVEA 3II2A 4I0KA 1O7DE 1A7NL 2ZUXA 3TBWB 3REWA 4EBQL 3IXTA 1I8AA 2AQNA 4D3CL 1UXWB 2AQQA 2ZNWA 2EYRB 1DLFH 3RWIB 3RWGA 3A23A 1M53A 2ZCHH 2J4WH 3HE6A 3RY5A 3T3MB 2WXLA 3APMA 4KTEH 2J88L 1QUNA 1YEHL 3BDYH 3BVUA 5GGTH 1KB5H 3D08A 2N0MA 4ZUVA 2XPZA 1J86A 2IDUA 3QR0A 5SWQB 2JCWA 2BVPA 1KJVB 1ZSDA 4V11A 3DXAE 3DA0A 1KACB 4HIEA 1OAJA 5JHAA 1GGTA 1KTLB 2W5PA 3F6JA 3NN8B 3ECBA 3MRGA 3DTXB 1M7DA 1VGEL 3MGTB 4ZD3L 3FU6A 5HDWA 3MLXH 3NABL 2OMXB 1Y6NR 2YPLD 4M03A 1W6LA 4BFRA 1BXXA 3WS3B 3CVHB 4F33A 4J7RA 5D96C 4YUEL 5C9JA 4IU3A 4G2AA 4J28A 5EORL 5I1GH 2VDML 5DHMC 4ZAKC 1JN6A 2BVQB 3QDME 1QR1B 1T0MA 2WLZA 3DC0A 2LW3A 2H3XC 3SDYL 2DTMH 1FVDA 3ZVVA 2AANA 2QVFB 4P57A 1UB6A 2HKFH 4NHCL 1AS7A 1DSFL 2DM4A 3X11A 1TO5A 4AV4A 5CF3A 2EADA 3QHTC 3HI6L 1VFUA 4PEEA 4RETB 4FULA 1YUHA 2A3TA 4PCTA 1NFIA 5FKPA 3LV3B 1T1YB 2CNZA 1E5YA 1F58H 3N43F 5DD5L 4BK4A 2CO6A 4MCMA 1J5OL 1P5UB 5CFHA 5TDNA 1OAQH 4RDBA 4YX2L 4V2CB 1FIGH 4PB9H 1I75A 1N7MH 4PYHA 4YGAB 1JRHH 3RURA 3TXAA 3VXMA 1WWWX 3UTSB 3NIDE 4ZRGA 2IANA 5BNXD 3SPCA 3MOBH 3QPKA 4R7DA 1FWXA 1DN2A 3E3QE 3DYMA 2VDMB 1CDIA 4DHLA 4YSAA 1IAKA 5DK3A 1EZLA 3MJ9H 3BPLB 1ZD6A 4PFEA 2PR4H 1Y1DA 3N3EA 1MCSA 1UB5A 2WCSA 3QIBC 4L3EB 5KVEE 5DURB 3TIEB 4CSTA 4PRIE 5K1NA 5G5DA 5IJKC 3UO1L 2WLHA 4Y8AA 5AVXB 4A38A 5I0YA 5LGHL 3GS7A 4HUUA 3TNMB 5IW6B 4ORGA 3TCXA 1PLGH 4NQQA 4ODBD 3Q05A 2D7OA 3VFOA 2MCPH 4H26B 1MCOH 3O45A 4L0YA 4PJCE 2MNUA 2GB2A 5KG9B 3ULUD 3WHE0 4GEIA 1NUGA 2WSKA 3AT8A 2AV7A 1TCRB 1ZDQA 2XWEA 4OGYH 1R17A 5B1JC 3KM1A 3VFRA 4QKTA 3V0JA 4PGBB 1MEXH 4QHPA 4WTZA 4D9RE 1HHKA 3GSUB 2Y2TA 4LE8A 5IQ9B 3HNVL 4U6YA 4NP9A 5F7NC 3NJMA 2WXQA 4YH6A 1NL0L 2YBRB 2IFGA 4RMTA 1WTGT 4MGXA 3GBEA 4NGHH 4D9LL 4PHZA 5CJOH 2WZ6A 5I1HL 1ZJBA 3HUJB 3T0XA 3NMEA 5LBSA 1FP5A 2NNAA 5E5UB 4G42B 4GOSA 2IWGA 4JFDD 4MZIA 1ZLWH 3OKNB 1D5IH 4G6KH 3QFJE 4E0RB 1QRND 3VG9C 3MLWL 2BCKB 3EO0B 4X4XA 3QXAA 1WZ1L 1IEAA 3OKDA 2VL4A 4CN1A 2D7TH 1QFWL 1U8HB 2J1ZA 4M7LL 4Z7OB 4FI7A 1PX8A 1T7WA 1E9OB 3R7RA 4YBLC 3AGWA 3P11H 5CBEB 2P5WE 2BY3A 1MLCB 2FWLB 4X9BA 2A0LC 2X2IA 2J2ZB 4HU2A 5K39A 1J5CA 4EN2A 1GGBH 2KBGA 5JQHC 3HE6C 1DHKA 3SDAD 1SLXA 1FG2B 1Y07A 2VLRD 3ARFD 3IDXL 1UT2A 1JK8B 4B27A 5B7MA 5BUGA 4Y1SA 5AW2B 1BWMA 3BESR 4HS6B 1A4BA 2EIDA 4HT1H 4XVJL 2LE9A 5T3ZH 4NUGL 4XPHL 3S34H 2I9LB 2DLFL 2J1YA 3Q1SH 4WI8A 2BLFA 5JQ6L 4PY7B 1F02I 5ETUA 1SHMA 1NKGA 3ZSSA 1R3KA 2HJKA 3NIGE 3X13B 4MKMA 2FX9H 1NBYA 1S3RA 3PQYD 5AWNL 1UD4A 1JZ5A 4YAQA 3D12B 2KS0A 1U8JA 4FQXA 4E42B 4AQEA 3L6FA 4UV7L 1ES0A 1NCGA 4OGAD 5ABZA 3VRIA 3H9ZA 3TJPA 5DZ9A 4HS3A 3V5KB 4J2XA 1QSEB 1OAKH 4YZFE 1BXAA 1FH5L 2DMHA 3PWNB 3QRGH 3R1GH 4RA3A 5AB1A 3TEXA 1S7QA 3NSYA 1FNEB 4QRAA 5KVDH 4LL9A 5BOPA 5L2KD 3VU1A 4AK1A 5IV2B 1P4LA 5D7IA 3BD4A 1B0RA 5D5ME 1Q1PA 2AVFA 3V4PL 4JPKH 4Z77B 4U1KA 5AG9A 3QC6X 5IHHA 1A7RH 2YXFA 1GAFH 1B2WL 2JVUA 2YAEA 3UTPD 2VABB 4LHJB 1DANT 4CMMB 4I1PA 4BSJA 2HX9A 2GTZA 1E6OL 4WSJA 1FFNA 3HG5A 3MGOB 2H5UA 4B9CA 3NPSC 5I1IL 1S7UB 1VZIA 4NZDA 3LRGA 4NKOA 3JXAA 5FGBA 2EXTA 2XV2A 3G6AB 4NNXA 1BBDH 4A7QA 5J1SC 1A66A 2VXUH 1ANUA 1LO3L 2DLTA 1NIDA 4B7IA 2OL3L 1XGYH 1MXGA 2FJGB 5C6PB 3TURA 3CXHJ 2F5AH 2VMDA 5E00B 1IC1A 4F93B 5CZVH 3O4OB 2NCEA 4CKVX 2N3JA 1JVOA 4JFPA 5CEZL 4FQHA 5I18H 3H42L 3WE1A 4JM2D 2IDCA 2RQEA 1M2VB 2XWBB 1P6AB 5F93C 2JCCE 4JFDA 1JHKL 4ZJ9A 3QUYB 1FLRL 3RX5A 4BWUA 2QQNH 3GHPA 1KMGA 4JRYB 5B8CA 4OFVA 3IKKA 3SDDA 2UY7A 4A1RA 5IQ7L 1ILUA 2BMKA 2O5ZH 4JEGB 4CBPA 4AKOA 5I19L 4ZMQA 4F24A 2X88A 3MSPA 4YSPA 1AQHA 1MIMH 3O11A 3GRWL 2Q0ZX 3P9MB 2QSVA 2NTFA 4UTCA 5EUOF 4U6VH 2OTUB 3MRJA 1OM3L 4B3VA 3Q6FB 4G8IB 3OMNB 5JIIA 2ZXQA 3TTSA 2EEXA 5ALCL 3BXNB 4HZLB 1JFQL 5ESVA 1YEFH 3K72A 3LJ3A 2Y23A 2OS7A 3LKOB 4QUOA 4JFZH 3IPFA 4CSSA 2EO1A 2O61B 2R2EA 4NO2A 3ARWA 1HINH 5IG7B 4LEXL 2IH1B 4BFJA 3D4CA 3FFCB 3GF8A 3JV6B 2AEWA 1U8OB 1ICTA 1VJSA 3MNZB 4OD1L 2X7LB 2F7RA 1UATA 5FHAL 1B0IA 2RFXB 2X87A 4M93C 2B2XH 3T8VA 1E27B 4M02A 1CICA 3WY2A 4UIMB 5EIIA 3EJCA 3TO4A 4QLWA 4ZQKA 1SUHA 1T21A 3ZKXC 1WZKA 3JV4A 5DT1H 2G4EA 3VXUD 4ISVB 3QH3B 1T2QL 4CGUB 3LDBB 2GAZB 2VSMB 1Q0YH 4OFIA 3DPBB 5DJAB 1U0QA 3ISYA 4OGQC 2OR9H 3PABB 1GOHA 4JFQB 4KU1A 3LQAL 3MA7B 4HCRH 1AD9B 2IXQB 4BRJA 4UNVA 5K9OA 1MFMA 3F8UB 3QNYB 4YPGA 2MRYA 2XDHA 3BJ91 5GZND 3SYAA 2I85A 5FW7A 5HI5C 2YMTA 5DD3H 3QWQB 1AR1B 1A0QH 2X4RB 5F1SA 4MDJA 5DLLA 1NMAL 5C0NC 4YFDB 3PL6B 3KLQA 4N5EC 2BY2A 1HSBB 3L5HA 3HS0B 2V4LA 3AU0A 5I74C 3I2CL 3A6BL 2WXPA 3BEVA 4LBAA 3VFUB 3VXRE 1MRCL 3UCQA 1A14H 2EDNA 3QWOA 1RLBA 1X5KA 4DZBA 3TEZA 1FIEA 4TLTA 2NRDA 2OI9B 1KJ2L 5EFIB 4OZIF 2GC7C 4FQXC 3MOAH 3ZL2A 4LSTH 4W9ZA 3KPPA 3D0LA 5EC2A 3EDKA 3LQMA 3FCBA 4LLQB 4X4KA 3CK0H 6TAAA 1TTFA 1ZV2A 4XZ4A 4NPYA 4PJFB 1S7TB 1ZT1A 2V33A 4L37B 1UEYA 3RBSA 3HAEB 4KGJA 1DVYA 4Y1TA 1DLFL 2KQNA 3T3PB 4Z7WE 1EO5A 3P77B 2Y9RT 2ZCHL 1HCZA 2J4WL 1CGXA 4KTEL 5EN3A 3C8KB 3VO0A 3BDYL 3C9NA 4FNUA 1KB5L 4JHBA 4Y16A 5D1QA 2IIJA 5GGTL 1KPRA 4NZUH 1Y6MR 3V55A 4ZFFA 3SGDI 1TZHB 4DP7X 2X4UA 1CFQB 3ETBJ 3FONA 4OCLC 5EZOH 1CGYA 4K73A 2VZSA 3CFUA 2L7EA 4WDIB 3FPYA 1CLCA 2ICEA 2WWMC 4CSZA 4HH8A 4XI5C 1BLNA 1YYCA 4Y9EA 1L9NA 3N40P 3UTSD 1HU8A 5FGBC 5KS9E 3IAGC 1AD0B 1IAIM 1R24B 2CUIA 2K6YA 3DUSA 3MLXL 2LFGA 5DJDA 2W80C 3A4FA 4HV8B 4NCC1 3ECUA 1IGCL 2VLKB 2GJZB 5DHVB 1NICA 1NPJA 1X4YA 4MMZB 3ZYJA 5EOQH 3T0EA 2X1XR 1JF6A 5I1GL 3ZTJH 2V5TA 3L3GA 3IDGA 4R5VA 3FQ1A 5DJ8A 2ZE0A 5D7LA 2DTML 3L13A 2DQ6A 4A37A 4L3ED 2WANA 1BYPA 5DURD 3C87A 5FO8B 3FU7B 1EPFA 3WNLA 5KSVA 5L8JB 1N6UA 2MNJB 2X12A 3JWNC 3WEXB 3MKKA 5BW7A 1PZCA 2H2SC 3ML8A 5IQLA 5CM1A 4NJAH 3TFKD 5D7EA 4P2RE 4ZYKB 4N24A 3DV4B 4LB8A 4AV0A 5B8CC 2YKKA 3CMGA 1BP3B 1F58L 1KYOK 1KB5B 3QT2A 3SDDC 4AEFA 1CTMA 4OCWH 5DS8B 1BM7A 4M5SA 5ALBH 1DO5A 3MLTA 5LUMA 4OI8A 3D3VB 4BFKA 2PW1B 4PIBA 1J1XL 1FIGL 4PB9L 1N7ML 1RPUA 3AGVA 3NSFA 1JRHL 4OZHE 4GH7B 1HILB 4GT7A 4MJIE 3RGHA 2VAJA 3RWIA 3OGCB 4IU2B 2CKBB 1C7TA 3MOBL 4PJBA 4M3KB 2YD1A 4ZMPA 1VEMA 3I6LE 4J23A 4KVCH 4TLKA 1NCWH 3MJ7A 3O3EA 1OP3K 4K7PY 3CFBB 1QI5A 4GY4A 4EN3A 4QNPE 3MJ9L 1ESOA 4U31A 4WI7A 2PR4L 4M5TA 3V6BR 4HGMA 3ZTJG 3BAKA 1CICC 3LRKA 3TO4C 5L4MA 3ESUF 3GSNB 3T9WA 3UGUA 1X3DA 3A3YB 2VLJB 5FK9A 4NENA 4TUOB 1IJ9A 1RHFA 2PW2B 4KO9A 1PLGL 1K3ZA 4HEME 5C0IB 2OR8A 2MCPL 4ETQB 1MCOL 4ZSOA 1WVZA 3EOAA 3WNKA 3UJJH 4XBGB 1MCKA 4ZTPH 5EBLB 3W1ZA 1HXMB 3BPNC 4WI0B 2V5YA 1BZ9B 2WNGA 3FT1A 4OGYL 1FZKA 3ERXA 4NNYA 4BFEA 4AYDC 4NN7B 3MQIA 4FFWC 1NCUA 1Q9LA 1MEXL 1YN6A 4NI3A 3TJEL 4JKPH 4JFUA 5FWQA 3LV3A 4K7PH 3AQZA 1UYWH 4QPEA 4W9GC 4B9GA 3REVA 5HVHC 1M05A 4RFNB 2JI1A 3U46A 3LKQA 3P0YH 4NGHL 3V52L 3U0WH 1GZPB 3G08B 4KXCA 5CJOL 5EOTA 2Q86A 3ESVF 4BBWA 1KULA 5C0CB 2QFRA 1NDTA 4GW1B 3ZTCC 2H3NB 2YGPA 1G9HA 3KWUA 3CN4A 4F27A 1J5DA 2C1OB 3H3KA 2QTVA 3FTZA 1CLZH 1HWGB 4U3SA 4Y19A 4EVNB 5B22A 4F8QA 1QSED 5E1AA 1UJ3B 1P2CB 4BH8B 3MCYA 4WENB 3KWWB 1SXBA 5FB8B 2HN7B 1OCZB 4LSSL 3D2UB 4YDKH 4X5WA 4LDCA 3BGMB 4X99B 3SOBH 4DESA 3LPPA 4D2NA 4OV5A 4X4ZA 1WHOA 3NJLA 2AJVH 4X7DC 5L2JB 2FHBA 1K9TA 3RPKA 5D1QC 4Y16C 3K1DA 3FSVA 1TJIH 3AU1A 3JT2A 3V6ZA 4FKHA 3PREA 5BS0B 2BS8A 4HT1L 2EKSA 2FIKA 5CO1A 5T3ZL 4ACTA 5IMLA 4YNYB 2ICEC 3Q1SL 3FCTA 2WBJA 2P9RA 5DFVC 1HCFX 1DDHB 1T4WA 2DL9A 2LTQB 3RTLA 3U4AA 3IJ8A 4G9FB 2R0LH 5TD4A 2FX9L 1FL5B 1IFGA 1WAEA 1IRAY 3T0EC 2H2PD 5IQ9A 1G7LB 3IRPX 3LN9A 1JK9B 4L0PB 4BFOA 1HSAB 3OB8A 4R7NA 4WK4B 1OAKL 2DH2A 1NLDL 3E9UA 3ZDYF 3R1GL 2YR3A 3GJFH 3QRGL 4OD3H 5L0QC 1U92B 4XWOD 4JO4H 1E2WA 3GBLA 1EA9C 1AIZA 3WN5A 1WA2X 3QFJA 2R2BB 4R4ND 5TH2B 3P4MB 3T8MA 5BW7C 3QUYD 4JRYD 3OKNA 4HH9B 3KXFB 4NO3A 5HYEA 1E42A 4JPKL 4XE5B 2BCKA 2ESVB 3LEVH 3UZQA 3KD4A 2Y72A 1F86A 1A7RL 1MG2C 1GAFL 1A2YA 1DQQA 3BP6B 4UI2A 2C3WA 5GGVH 2NYKA 5A6LA 1JGVH 2VISB 4M7KH 4NM4H 5KWYC 3S5LG 1G6VK 1NMBH 3QAZB 5F7AA 5E5LA 5KJ7E 4K8RH 4ELKA 5IVOA 3W5NA 1E0OB 1SJXA 1DVQA 3W9EA 2J2ZA 1JNJA 4IK7A 5I1DA 5KYUB 1BBDL 3OL2A 1G7HA 3MBWB 3PWPB 4K3JH 4I3SH 1EHXA 2VXUL 2DAVA 1LHZA 2UV3A 4XC1L 1LWHA 5IFHL 1CXHA 4G7YL 1VGKB 1XGYL 3MJ8A 1ETZA 4JFEB 2G2RA 4XN9A 2H1LM 3FFCD 4E9VA 3FTVA 2HVKA 2F5AL 3C8DA 3IN0A 4EN3C 2EDRA 4PGZA 3WL9A 3R7QA 1QFUH 5CZVL 1C5BH 3LKSB 1PG7X 3SGEH 4UBDC 3TLRA 1OF2A 5I18L 3NSDA 1J12A 4O2FA 1NINA 1AO7A 1IBDA 2CIIA 4UINH 3NQIA 1CFNA 2A73A 3WTTA 1XSJA 3AMKA 3BKJH 5JHDB 5C92A 5KBKA 3QQ9D 1JRHI 1RJLA 2AJSH 2X4TB 3QO1B 2VC2L 3QG6A 1QEXA 1AGEA 5J5EA 2C4FT 4WKZA 9PCYA 3MV8E 1RU9H 4TSBH 1MIML 1HQ4A 1NOAA 1AZCA 3D34A 5I23A 2OTWB 1S9YA 4U6VL 2BHUA 4IJ3B 2FO1A 1AR1D 5T33H 4A2FA 4QR7A 1ZLSH 1RI8A 5T1MA 2ZJSH 2QKIB 3PL6D 1G5AA 1NGWB 2JSFA 1KGWA 4JFZL 4K9EL 4WKXA 1WAAE 1Z5YD 1T6VN 2X9YA 3HR5B 5I30H 2NYYC 2OCCB 4F20A 4R7LA 1D3CA 3U0PB 1HINL 3K46A 2NR6D 4A67A 5A3IC 4RMVA 1E8ZA 5LLIC 1S78D 3H6JA 1XF4B 2IDSA 3UZVA 3MGOA 1WGOA 5I76B 1ZA3B 1E4KA 1B4TA 3K5SA 2B2XL 3JWDC 2O30A 2QGEA 2V5MA 3EO1B 3ARRA 4FL4C 4KTYA 1KOAA 1LP9B 3PAUA 3QUGA 2Z4QA 4YFLF 5BZWA 1TJXA 2WKOA 1GS8A 2WZPA 3M8OH 1M7IB 2FJGA 4ZUUA 2B9AA 5CEXB 2DJSA 2F1AA 1AIFA 2AJ3A 2V0AA 4QRQA 4QAMB 3D2TA 2IADA 4HCRL 4F8TA 1KCUH 2J6WA 5KYNA 3LZQA 2R59A 3GTTA 3KWTA 5DD3L 5A7BA 2ERJC 4YDVA 1A0QL 5E6IA 4N0CD 3V4PA 2BY0A 3BZ4B 3BPCA 1FCGA 4K3HA 3RVTC 4B5EA 5FECB 2O6FA 4JRYA 2X4NA 3NIDF 1AHWC 1KCLA 2KZKA 1PD6A 5C09B 1JF1A 3E6FA 3JBG7 4JANA 5JDJA 3BWAA 3CH8A 4NIKB 3G04A 1I3RB 2D9QB 1MRDH 3ARBA 2WBJC 3UBXA 1T0OA 4RGNE 4S1QH 2OMUB 5ILTH 1X5MA 1PEWA 2Y7NA 1O9WA 4GAJL 3SPIA 2OXHB 2OJZH 1EHAA 1A14L 2FECI 2VLKD 4JFFB 1EHLH 1PKOA 2ZUTA 3QZBA 1JE6A 4U1GC 1PEZA 2QSCH 1TQBC 4IOFD 3US1A 3MOAL 3LKOA 3OX8A 2HT2C 4LSTL 2O61A 2OL3A 4HCIA 2CDGB 4IIQA 1PY9A 1E28B 3DVNA 5I6PA 3UJTH 1JS4A 1L4IA 2BSTA 4JFTA 2YD7A 5IG7A 1Z5LB 4TTDC 4OF0A 1CD8A 5HDBB 3RL1A 1F18A 3WN5C 1OCRB 2X7LA 4PJCF 5ENWB 1SFHA 3QXUA 7PAZA 3VX1A 2A74B 3PS6A 3TVMA 3QWRA 4IBWA 2MOGA 4GT0A 4WWID 1QLFA 3MPCA 4NZUL 3D3VD 3IDYC 3NK3A 4BCZA 1DQKA 5DJAA 2BSEA 2X2HA 3IBEA 2LU7A 4FYRA 3C6LB 5J56B 5CEYB 4RDQF 3C5ZA 3GRWA 4MHHI 4F2MB 4LSVH 4G59C 4JM4H 1KF9B 5CHNB 4GXVH 3WD5L 5GRXG 4IEFB 1FNGB 1TU2B 3BVNB 4YMPA 1A7BA 1R5VA 1CFVH 3V0IA 1NMCB 2PYFA 1RK7A 2OZ4L 3U6RB 2ZXGA 3L9RB 1PKQA 4O2EA 4H1LH 2GFBB 4YHYC 3ABKB 3HS0A 4XNXL 2FATL 2F1EA 2GSIA 1U8LA 3NEXA 5DYOB 4OBSA 5HD8D 3WS6A 4BH7A 4HC1H 2GI7A 2VLJD 2RACA 4FXTA 1N8ZA 4IDLA 3OB0H 4NJAL 7CGTA 2NY6C 5D7KD 6FABH 4GIPD 3FULA 1ACYH 2QDVA 3OKMB 4JKNA 4YDJB 5AD0B 3ZBMA 2JTDA 1QBLH 4OCWL 1NGYB 3KS0J 2DD8H 3OV6A 4I13B 4P48A 3MAWA 3OKEB 2ZWLT 2Y4SA 3D18B 3NSXA 4XNBA 5L7XH 4MB4A 1F42A 2VZ3A 1J18A 2YD8A 4UNUA 3HHSA 1JPEA 5GZOA 3G6DL 4QRFA 5H2BB 3MRLA 4J3UA 2NX5E 2JQZA 4CNIA 2WO4A 3S3SA 1AGDA 3O2VH 3C8KA 2BNUA 3LXCA 4MD4A 2W0LA 1RURH 4QHUB 3PWJB 1EDYA 1TTAA 4KVCL 3BP5A 1HNYA 4NQUA 3V7AG 1NCWL 3FUNA 4PJGE 5EPMA 5C0CD 5JOFA 2YAFA 4BM7A 5TFSH 2W07B 3Q5TA 3HCVB 2PCFB 3HG3A 1CT8B 1LMIA 1E4KC 3L48A 4I3GA 2DQFA 4TRPH 4YZFF 4UM9B 5DQ9A 2NY7H 3KYAA 4H1LG 4H0LC 1KJ2A 1HCVA 2NW2A 4GIAA 1JYWA 2EUVA 2VR4A 2VLKA 4RAVB 3S6CA 2BXYA 4Y5XA 3P4OB 4RFOL 3CPUA 2WUBL 1YY9C 3D2UD 1EJOH 1WEJH 1HXKA 5ERWB 4X0KA 2A4CA 4BFBD 2X4SB 5LN4A 1G4RA 5DRWB 1MHPH 3OZLA 3UJJL 2HZHA 3N1QC 3FN3A 4ZMVA 4ZTPL 2IO5A 3FU7A 3P3SA 3FYEB 1U8NB 3PJSB 4L5FE 2Z0BA 4XBEH 5E6ZA 5FA3A 4DQOH 5E6IC 5EC1A 5EU4A 3NGBB 5CWSB 1ZHKA 3CH1A 4ZOEA 3GSQA 4JKPL 3ABGA 4ZW6A 5BS0D 3HI1A 3DV4A 5E8DH 5CCKH 2BNRB 4K7PL 4ZPTA 1UYWL 4I85A 3CVBA 2YPLE 1UCTA 3ARBC 2OMYA 2ROYA 3HB3C 3MODH 3P0YL 1T1WB 2XIDA 3L3DB 3QDJB 4OZHA 4X9GA 4G9FD 3U0WL 5DUPH 4ZS7H 1PX4A 2DICA 5D2NE 5AUMB 1OGAA 4DP2X 4NIYE 2RTTA 4FQJH 3VU2A 2QR0A 1F6LL 4R0LA 2BHZA 4XPFH 3OGCA 1C1EL 5I5MA 2D0FA 2V9TA 4G43B 2PTTB 4IIQC 2JCCF 3CC5B 4PGCB 2GBAA 2C3GA 2NT0A 2R69H 5EV7A 5GRWA 4HJSA 4YDKL 3QEQB 2BX5A 3GMLA 1V3JA 3OMIB 3E6HB 3Q06A 3S48A 1R3HA 4M62H 2CDFA 3SOBL 5FGCE 5I9QB 3KXFD 3VI3E 2ESVD 5DMKA 3TEUA 2FEEL 4G8GA 1T3FA 3TVMC 4U0QB 3PYCA 5C0EA 1TOXA 2VLJA 4JRWA 4TUOA 4MD0A 1XZWA 1TJIL 1CFTB 2YKLH 3CN3A 1H9DA 3EBIA 2A83B 5C0IA 4KBPA 1IEHA 3LNFA 3S36H 2NY2B 1FL6A 3X1NA 3C5ZC 1EJ6A 5A1AA 4G11A 2P46B 3WIFB 1P7KA 3ZN6A 2VDOH 5EBLA 5F7DB 5EU3B 3QFDA 3PWPD 4CVZA 3RZWA 1PD1A 3G6JA 4UIKH 3BT0A 2YBGA 1ND0B 4DZ8A 1OM9A 2DV6A 1EBAA 2UWEE 2FO8A 4JFED 5HDOA 4L8DB 3VGAC 1KDIA 2ZOLA 2OYKA 1B4LA 4XMXA 4W9HC 5EMYA 2ATPB 5AKTA 2H8PA 2VERA 3O41A 5DC2A 4F58H 1P7QA 1OV8A 4OD3L 1CXLA 3VD3A 4JO4L 3TF7C 1OQXA 3ZYZA 1DVFB 3BPOB 3Q0HA 4MQTB 3WS6C 1TEFA 2YXMA 5B7FA 5JHDD 5JW4N 5FGRA 2Q6WA 4KH9A 4S11A 5DS1A 4FXGA 4A66A 1P1ZA 3CDCA 3O8XA 4KV5E 4LRNH 1ZVNA 1DDTA 3S5LB 4J8RA 1TQVA 1SZNA 4ZMAT 5IUCA 5MP6H 1JXFA 5JR1H 1IKFH 4TUUA 1MW2A 2W0KA 2HUEA 2EDDA 5GGVL 1JGVL 1GW0A 3F7YA 4M7KL 4NM4L 3VFGH 5JIDA 2XRAL 1NMBL 1L3WA 3LQAC 2XY1A 4WUUA 4WW2A 2GW5A 4LLYB 4MAUH 5IJDC 1MKFA 5GZOC 5IMKB 5EO9B 2OFQA 4PP1C 3BOVA 1UD6A 2A6KB 3DOSA 3I74A 1MLBA 3HW7A 4I3SL 4E41B 1FYTB 5K9QG 5L2JA 1HAUA 4UYQA 2VDPH 3L1FA 1D7CA 4U4BA 2B14A 3E8VA 1MHHA 5I26A 2Q7AA 1QRNE 2WZAA 5CJQL 3M46A 1M9WA 5F7WC 1C5BL 4N3TA 3GJFB 2VSDA 5D93C 4L9LB 4U3CA 1PBYA 5DK0B 4ZS6C 3WFHB 1AGCB 1AJ7H 2JJWA 1J0YA 1KLGA 4R9HA 3FTUA 1Q94A 5JPNB 3BKJL 1TETH 1Z9SA 4MXQC 4QIRA 3PY9A 4Y5XC 2AJSL 3Q5OA 2NY3C 3FQNB 2FEDD 4YHKH 4Z7WF 4PWEA 3DHPA 1OWRM 3R8BB 4CUCA 4TSBL 1RU9L 3RWFB 2VLRE 4X6DA 2AMUA 3HC3H 1S8DB 5FYKU 4PRBA 1DEEB 2VLMD 1TPXC 5T33L 5HYSB 1ROWA 1BFOA 1ZLSL 1TQUA 3H2PA 2ZJSL 2EDWA 3F00A 1MRFH 4NERA 5C0DA 4AYEC 3EUDA 4DT2A 2A9DA 5KS9F 3LPOA 2IC2A 4JO2H 3L95B 1XWVA 3I50H 5C09D 2UZXB 1OE1A 4B9KC 2LFEA 3VWJC 2VUKA 1L0PA 5I30L 1X9UA 3PQYE 2JKSA 3CHPA 3S37H 1JCVA 1MVYA 2Y1YA 1QEWA 3P2DA 3SD2A 4JFFD 4JFWA 3SYCA 3HN3A 3ECQA 3M1OA 4HJJL 2JB6B 3OXSA 4GXUM 5E1QA 3B9KB 4MNQA 4Y1AA 3O4LB 2YD9A 4Z3IA 4R0LC 2WB1A 4WUKH 1IKOP 4JKKA 4GRWE 2EUXA 4P04A 4JFXA 4KMTH 1B0GB 5LXGH 4JE4B 4ZUTB 5L2KE 3M8OL 4UCFA 2CDEA 4L1BA 5H35B 1FNFA 2ZD0A 4N90D 1Z0NA 1M7UA 1R5WA 1R75A 3DMMA 4TQHA 1PSKL 4H40A 1XSIA 1JP5A 1NCTA 3KWXA 3UTPE 2VERN 1KCUL 4I48B 3GMRA 1BWWA 3M7FB 3QDGB 1GR7A 1C8PA 1A1MB 1QWHA 4OZHF 1CF8H 4H88H 2JJVA 2YD5A 2Q87A 2WXRA 4TVSa 1G7IB 4HIJA 4IMLB 3FF8A 4JDEB 2LLLA 3C6LD 2D03H 1TZIB 2VDLL 3N9GL 1OHZA 3Q6GL 3ABZA 1KUMA 1MRDL 2NSQA 2QPEB 5ILTL 2PCXA 3EH3B 1G6RH 2OJZL 2BP8A 3HC0B 4LPTA 1QFOA 1FDLH 4N0YH 4XNMB 4XZUA 3VFNB 2Y5QA 3EH5B 1EHLL 4XCFH 3CLFH 3UGXA 4M8RA 2WXHA 1SN2A 2OSYA 2CLRB 2QGDA 5AB0A 2QSCL 3LZLA 5IB1B 1MJUL 4Y9GA 1NKRA 2APSA 5C07A 4YHMH 1RKRA 3IAPA 4JFSA 3ISWA 2VDKL 4NQCA 2ZXCA 4S1DC 3UJTL 4XNYH 3U2JA 3CFKA 2C9VA 4RNRB 3NIFE 1IBHA 3FOLB 3I6GA 1Q8MA 5IB2B 2Y7QB 1XF4A 1T66C 2LABA 2KDYA 1X5YA 3DX3A 4FXGC 5DUMH 3O8XC 2FB4L 3RYMA 3I75A 3V5HA 1UFUA 1ID5I 4G7QB 1AE6L 2VWEC 2A9BA 4PV8B 4TTGA 1LP9A 2QSQA 3LPGA 5C0RH 2X41A 4XC3H 3L9EA 5ESAB 4HKZA 4Z95L 1QR4A 1ZGLP 4ALAH 1MHCB 1OKEA 4WW2C 2FLRT 2ATAA 5FYJD 4LSVL 4JM4L 2O6PA 1BG9A 3PWUB 4GXVL 3CQPA 4G80A 1R3JA 1Z7JA 3KPOA 4PJXA 1CFVL 1F4YH 3QUKB 2YPKB 1C5CH 2XBZA 1RIUH 1OAYL 1Z9NA 3M86A 5FECA 1CBVH 2H41A 3DX8B 3MRCA 4XR8C 2DS4A 3RWHA 4DP0X 4G8AC 1LO5A 3UC0H 3NA4A 1OAXH 4FNSA 4D94A 4AZ8B 3IGAB 3K81A 3VXUE 5EO0B 3T1WA 1L9OA 2P43B 1KB9K 2WWKT 4K3DH 4U6XA 4UM9D 1WJ3A 4YXKH 3I3EA 1H8LA 2PPCA 3DGGB 4HC1L 4EZKA 1JZ3A 3D6GA 5IEHB 3BDXA 3FQTA 4GB9A 4UWQB 3RNKB 5I17A 3SCMA 3CSFA 2VQUA 4TSAH 1ACYL 2WJ7A 5FOBA 3A67H 3VQ1C 5D7HA 3T3ME 3WO3B 2H6OA 3VX0A 2DD8L 3MZTA 5F7YC 3ZGIA 5CGMA 3PPSA 3DTDA 5GS3A 3SBWA 4GBXB 5JIPA 1N2RB 2VO5A 4XCYA 5FDWB 3EO9H 3K91A 2FT6A 5EBGA 5C0BB 2ZCLH 5L7XL 3ZRFC 4Q9RH 1R1CA 5DJYB 1LWJA 3W39A 3DIFA 5KSUA 5C08A 3WEAA 2X6AA 3BUYB 5ADPH 1WITA 2GJ6B 3P3UA 3AM8C 2BNRD 3OLGA 5A2LH 2J8HA 3SGEI 3T8XA 2A74A 1HZKA 4OM1H 2YGOA 3QUXA 2LLNA 4B7LA 5LO7A 1RURL 1NIBA 3QDJD 3GXUB 4Y4HA 4P23C 4PJEA 1E6JH 4H1LB 5GS1B 3Q43A 1P4IL 5TFSL 3GO1L 1U58A 2GUYA 2WXMA 4FG0A 1SLUA 3D39B 4OM0H 2Q20A 3HLAA 2NY7L 1UD2A 1MWOA 3L1GA 5EU5B 1A21A 2ZF9A 1FZOB 3IWUA 4FNLH 5E2TL 3DROB 4N8VG 1IAOB 4MS8C 5GPRA 5JOEA 1PLBA 4C57C 4Y5VA 4UQ3B 3UTTB 5HYJB 1SOXA 4S1RH 3QEQD 1EJOL 1ML0A 1WEJL 2GT9A 2YRBA 4NAJA 3VXTA 3PGCA 3DMMC 1MHPL 1XGPB 3TBSA 5DYOA 3SE9H 3RWEA 1BSIA 1KTJA 1O6VA 2ATKA 4N9OB 5KEZA 2APVA 1UM6H 4XBEL 4DQOL 1G87A 1OF0A 4H25A 2X05A 4JDTH 2HFFB 1EXGA 3BH8B 3OR7B 3KDPB 3UYRH 3UTSE 5CCKL 1NBCA 1XF3B 2JKJA 5E8DL 3DBSA 1KLUB 3FB7A 2CRZA 2NY2D 2YGNA 4QRUA 4LO9A 1Q9WB 1HQRB 1TEGA 3RTQA 4PVMA 4NQEB 4EIGB 1UA7A 3KGTA 4NBZB 3MODL 4YEFA 1JJUA 5DF0A 5DUPL 3FB6A 2RGSA 4ZS7L 3DSFH 3VUAA 1H8OA 1F2QA 2UZYA 3FQRB 4N0UB 2KUTA 4FQJL 4LEBA 4TS6A 3BAWA 3WIIH 1QQDB 3QISA 4PBDA 4UQAA 3VXQA 2FJUB 2C9UA 4L3EE 2E9JA 2ZQKA 2G9HA 1G7PB 3AWGA 4JN2B 5F7KC 2OZ4A 4NDMB 4A7TA 1TJGH 1QFHA 1X4XA 4FZ8H 1GZQA 3WLWC 3ESMA 2R69L 1XTMA 1DVFD 4QF1A 4UQ2B 4NXSA 2OK0H 4M62L 3ZHLA 1WZLA 1ZHBA 2AMGA 1U30A 3NZ8B 4QOKB 3UFIA 2R2HA 4HXBH 1BOGA 2JK5B 2KMWA 4PLOB 3HPLA 2XTJE 2IG2H 4JG5A 4WEEA 5IOKA 3SDCB 1LJMA 4X5XA 1BFTA 3FO2B 3EIFA 2IJ0C 2YKLL 3P4OA 4QCIA 5JO5B 1KXTA 3QYCA 5LGKA 4WVRA 1WAAF 3KL0A 3S36L 2DI8A 2J73A 3Q5YA 1D2OA 1KFGA 1GVIA 2VDOL 2X0VA 2RALA 4JW3A 5CJ8A 3HUJE 2ZAIA 4E41D 1FYTD 1LGVA 1FNHA 2J72A 4HSQA 4DP1X 1U8NA 4MJ2A 3KDMA 5I16A 4UIKL 3RL2A 3IGFA 2GIXA 3IGLA 4R4FH 3U2SA 4OCXH 4K9EC 2N7SA 3UADA 2XICA 3L7EB 3WTWA 5HSFA 5E5MA 3SO3B 1M1XA 3ATBA 4F58L 5MENA 4Z7OE 3BMVA 1T04A 4N8PA 5KJ4A 1OSPL 3U30C 3X1EA 4IKIA 5CGBA 1A4JA 1R3IH 3P1VA 4XCNB 3SPJA 2ITCA 1OTUD 2CR6A 5AVQB 4MS6A 2DBLH 4PS8A 4PN6A 3SCMC 4RAUB 1I7TB 3IJYA 1WHPA 5MP6L 3QEHA 1IKFL 2ICWI 4YEEA 3RDTA 3FXIC 1DFBL 2Y1VA 2F2HA 1INQA 3BP7B 1YAIA 1PAZA 1MCRA 3SBWC 5E2VH 4K8RD 4PJDA 3VFGL 5EZIH 2P8MB 4MAUL 3ZDWA 5C6WH 3FRPG 1BAGA 1CG9B 2VZ1A 5I8CA 1OPGH 1YNTF 2L7UA 1F1GA 5AYUH 4F7PA 3QUXC 4X9YA 5IGXH 1N4XH 3FNKA 2GHZA 5BV7H 5BXFA 1E40A 2VDPL 4WSKA 3UPRA 4P3DB 4Y4HC 3OC5A 5FDYA 4A2LA 2A83A 4F92B 4IGBB 5AW7B 5CP7B 1UZ6E 2G30A 3QS3A 4Y5YA 1RFDL 4XVUD 1K8DB 1QSEE 3B9KD 3RY6A 3RIFF 3O4LD 3VYNA 1HE7A 5FYLD 3C09C 4UQBA 1AJ7L 5EWIH 4Q6IB 5DJ6A 3SZ6A 2WTRA 2X4QA 4U0RB 1CQKA 4KVPA 1TETL 2I7SA 3KYOA 4M56A 4ADIA 4Y5VC 3UTQB 2XACC 2BP0A 2W91A 5LKNA 5I71C 5FO9A 4ZZKA 1MJ7H 1ZSHA 3ATAA 4YHKL 4ZK8A 3MYJA 1QHQA 1ET5A 4ODWA 4F8PA 3ZTNH 1YNKH 2ICES 4DK3A 3MCLH 1MUJA 3ZMRA 3HC3L 1KXHA 1SF5A 3P0VH 4KK5D 3QDGD 2GHWB 2E9BA 5JW4M 3QORA 2BNQA 1MRFL 3GSXB 4C4BA 1EAQA 4JO2L 5DO2D 4EI5B 3G5ZB 2ZYIA 1U6AH 3I50L 5LDSA 4LDEB 2VDPB 1MZZA 2XFGB 4W9LC 1U3ZA 3RTQC 1ECZA 3D69A 3S37L 4P5KB 1E3ZA 2ED6A 3HC2A 1BMZA 1JUFB 2BINA 3HI5H 4DCQB 1FYHB 1DLHB 4QHKI 5IBTL 3WDJA 2VKWA 2QV4A 5DMGD 5EU7C 5IR1B 3FL7A 4X6BA 3G5VA 5IMKA 2W9EL 1DQVA 4DPRA 3TJHD 4WUKL 4J3OD 4KMTL 3FT4B 4WU7B 3TH3T 5LXGL 4HS8H 2RH0A 5I66A 3F12A 1RUKL 3EXLA 4UOW1 5CIPB 4QT5A 3EHBB 1M7XA 3U48A 5EB9A 4ELMB 4PTTB 1A6PA 1AVAA 1F6AA 1EMTH 2X89D 3MV7B 5DK0A 4U1JB 5FXCH 3ZX1A 2ILLA 4HSAC 1C7SA 3I9AA 3IKCB 1CMOA 1U95B 4P06A 1H9VA 1BQSA 1KIUB 1CF8L 4H88L 4RMRA 4JL2A 1LD9A 2DWSA 5IWLA 1JZIA 1XB8A 2WVSA 1ZLUK 5HBBA 2D03L 3VD5A 4LVOB 2C3XA 2QGBA 4JPIA 1CS6A 3AROA 3S3PA 3T6VA 3T0AA 3RWFA 1QSZA 2JMRA 2VJ0A 4FMVA 3CHRA 4PJGF 2XTLA 3FFCE 1SOQA 4N0YL 3X1FA 1L7TH 2ZX5A 2A2QT 2AHIA 2HVBA 1A6AB 2ISDA 4QJ4B 1TNMA 3CLFL 4JG9A 4KRPC 2XXCB 4NQDA 1CE6B 5E4IA 4ABWA 1XXFC 5AOLA 4N2EA 4YHML 1EEQA 2OCFD 2BWIA 2YAMA 4G6MH 3TYFB 4UDTA 1S4IA 4XNYL 2CIKA 3ZIMA 1FO0H 3DHUA 2AXFA 3S5ZA 2PPAA 3KPRA 5FC9A 2ZUVA 5HI4D 1H19A 3NCWA 3ULVH 4ODTH 4XAKD 4N0FA 2ID5A 2VMFA 3BSHA 4X6FA 3IDIB 4PIRF 5DUML 5FUOH 1BAFH 4AMWA 1YZZA 2DYSB 1RUQH 1TYRA 2HLFD 2R4SH 3RDTC 1IM9B 2YUZA 4X7FC 3PG2A 3WJMB 4K5LA 1RZJC 1FC2D 1MCWM 1P4UA 1URIA 4GBXD 1NGZB 5C0BD 3UX9B 4AYMC 4AENB 1KPUB 5FUCC 1E8WA 4ALAL 2Y7MA 4P2QA 2UZIH 5IW1A 1KWKA 3O6MH 2GJ6D 4AOFA 1G6RB 3KYMB 4U1HB 2FSEB 3MNVA 1MZYA 3AQXA 3DX7B 3UROR 4W6XB 3LZRA 5MEQA 3VSUA 1F4YL 1OOWA 2X4PB 3B7YA 8PAZA 1RIUL 1CBVL 5E9AA 4BSVA 1QABA 2R39A 2PYEB 2B9BA 3OM3B 4HEPG 4WAFA 2NDGA 5HVWA 4Y5YC 4YDZA 1F4HA 3OWEA 3D39D 3LXBA 5DK2A 3RY6C 3WNPA 4K3DL 4BGDA 5E24E 3JUYA 4YXKL 4QWWD 1I1FA 3MU3A 1MY5A 5CZXD 1TJMA 1R3LB 2DMBA 3HC0A 2Z64C 4W9KC 3AG2B 4PJFE 3UTTD 5FF6B 5HYJD 2WWKO 1KYOJ 1QP1A 4TSAL 3T3PE 2YUVA 1TSRA 3VI3F 2JWYA 1PMYA 3A67L 3C5JB 4ZOAA 3SN6N 4LIQH 1AXIB 3DK2A 1JGEA 3LXAA 1G9MH 5DJ2B 2PXYB 3FT3A 5I75C 3MBXH 4HJ0C 4XRCA 5IVZA 2AK4B 3TNNA 2YRZA 3EO9L 4UT6H 2AFNA 4XMKH 2ZCLL 3Q8EA 4XAWL 4EIZC 4Q9RL 2OJEB 4NFCA 3EH1A 3QORC 4NAMA 4HBCH 2YQ3A 2ZSWA 3C5SA 4QRRB 5DRNB 5GISH 4AXWA 5ADPL 4HWNA 2IQ9H 4OM1L 4PV8A 3EG9B 1MCPH 1IMHC 3PXJA 4HD9A 1YCSA 4NQED 4I2XA 4R4BB 1FN4B 2IH9A 2HRGA 5E6UB 4YQXH 3B6SB 2UWEF 3OAYH 4AKQA 5CLWA 1NWOA 1BQHG 4O51A 4ANKA 2R2CA 1T20A 2G60H 3GZPA 5J11C 1NGQH 1FF5A 1JZ6A 4HUWB 1KIQA 3LYRA 4PSRA 1SVCP 3B8SA 2W8CA 4OM0L 1BV8A 3ZKSD 3V9FA 3MUJA 3FU0A 1ZEAL 4N3UA 4H2AA 4JZNA 5KSBE 2HTLD 5HHOB 3DX8A 4S1RL 4YSCA 3GS0A 3QEUB 1X9QA 4JAMB 4KV5F 4ZOCA 5KW9H 2WK2A 1LE9B 3C60A 1LVEA 2HPOA 1MCFA 2Y69B 4N8CH 1YEWA 2NUTB 4JO3H 1M6UA 3LOWA 3MRHA 4QOKD 3KHQA 1F45A 2Z93B 3STLB 3HZMB 4HIIB 2GK2A 1AGBA 3D3VE 4U7MA 3SE9L 3VFTB 1I3UA 4MJ5A 3SDCD 5IB3A 1QACA 3PHSA 1UM6L 2Y6SD 4HIHB 4IOIB 3L45A 3OAZK 5J6GB 4JDTL 3B8YA 2O5NA 1WPCA 1U8MB 3UYRL 1XH2A 3AG4B 5IWLC 5BZDB 1WIOA 4BD4A 4X8JA 5EF0A 1FZJA 2V7HB 5J9PB 1NA8A 2APXA 1QHOA 2QELA 4IRZH 1KBGL 5GGSA 3V9EA 3GQFA 3WAJA 3Q3GA 3WIIL 4FABH 3GMOA 4PWJA 4HMEA 2MKWA 1CYWA 3CN1A 3ZKND 1T5XA 1KT2B 2EXYD 5TE4H 3VM5A 2H9GB 2WSPA 1OXYA 3QDAA 2DOCA 1AH1A 5BRPA 4HLEA 3CG8A 3WKMH 2CNYA 2WB7A 3EBAA 4JGJA 4R97C 4AJYV 4Z23A 5D7KE 5KYYA 1KIPA 3O3AB 4HMCA 4QTIL 3SEPA 2CKNA 4JRXB 2GVYA 5INDB 2HJFB 2OK0L 3C6SA 4W9EC 3CNKA 4WO4B 5FHBH 4A2MA 4XNDA 3PHQA 5LWYH 4HC1A 4HXBL 5JMOC 3O6FB 4O2CB 3WFCH 2IG2L 2AXGB 2K8QA 4R7XA 4C59B 1IAOA 3D87B 1VAHA 3MO1A 3R06B 4QY8A 1LK2B 2HLAA 1R5IA 1RJYB 2CMRH 2FYYA 3JQOB 5IB4B 3A5VA 1DQLH 4N86A 1HWWA 5A6MA 3L3JB 1IAMA 3KZ8A 4QRSB 3MV01 1U93B 1OLZA 4CU8A 1W0VB 2XQ0A 3LNHA 5C0CE 5ECGA 4KOCA 1H5BA 1CE1L 4CJ1A 5B1KA 4JO8A 5DSCA 5DZAA 4FS0A 1OD7A 2ZAHA 4PRPB 4IGBD 1LQSR 4OZFH 4M00A 1KZYA 3UYOD 2DF3A 3CFIC 4GRWF 1VHPA 2VE6A 1EJFA 3QRFM 1HQRA 3LB6D 3OJVC 4WK2B 3FW6A 5CR8A 3K3QA 3LPWA 2K4WA 4OR1A 3DX6A 5DS2A 5BZXA 4EZJA 2WLJA 5F88A 2LU5A 1KYDA 2R9HC 1IV8A 4N1HB 2DBLL 4X7TA 4UNTA 4H5SB 3WIHH 2X53A 1IQWH 2F61A 3S0PA 4BK5A 3ZYIA 1JZHA 1IEBB 4NDMA 3BN3B 1DJGA 3P3TA 1TTBA 4PRNA 1NEZB 4XGZA 5E2VL 2VR8A 2WYZA 3VMNA 5BS0E 5EZIL 3M88A 1TTCA 3VQ2C 1RZ8B 1QI4A 4IBYA 1OPGL 1KV7A 3SY0B 4EI5D 4G9FE 5AYUL 2CGZA 4OZGA 5IGXL 4ZO6A 3G5YA 2CO4A 2WBXA 5BV7L 3FO2A 4HGWA 4IKNA 2H0JA 2BVYA 4M7JL 3ZT6A 1MI5A 1BX2B 5GRZA 4JM2F 3IFPB 1QO3B 4OZFG 2XKNA 4KWUA 4XB7A 3GD1C 3NIFF 3H85A 4P5RA 1KYUA 2HAZA 2ALWA 2W95A 4LESA 5TE6L 1WCBB 2WIIA 2EH7H 4L8SB 2CHDA 3EHBD 3NJXA 3KXFE 2V2WB 5CSZB 2ESVE 1MJ7L 3C60C 5EUKB 4D8OA 4WFGD 1FFRA 4AKPA 4MA3A 5JNYB 1AS6A 5KAQG 2R69A 2ZNXA 3ZTNL 3IYLW 3MV7D 1YNKL 4Q6KA 3RAJH 4DWHA 3MCLL 3QJHB 4FEMA 3S7GA 1DQDL 1MDTA 4TUJB 3P0VL 5IOPA 3FRUB 3FQWA 1WBXA 3ARVA 5T5FH 3X12A 4DIXA 1UQSA 3GSOA 4YHLH 2VN3A 2H6PA 3VD4A 5ICXA 4NZ8A 5IF0B 4POYA 2R8SH 3EYVB 1U6AL 3PWPE 3EJYC 3LZNA 1E9QB 4Q8BA 1XT5A 1MFUA 3LKRB 4PJ7B 2MQ0A 3P73B 2E4FA 5DZOA 4KX7A 4JFEE 4ZTOH 3FH7A 3K8KA 2X28A 5CD3B 1CGTA 5JHLL 4UZGA 2L04A 3S98A 2E7CA 5EF1A 4UTBH 3OSKA 4XHJD 5FA4B 3T0DA 1XQ4A 4NKDB 4F80A 3TONA 5KVDE 1RK1B 3ARDA 2AXWA 2E76C 3UG5A 2KYIA 2WVVA 2JF1A 4YHOH 4DTGH 3PAVA 3HJ0A 4B53A 5JHDE 1ZVHA 1XBDA 3FAXA 4HS8L 4BDVA 3RVUD 1BVLA 2PCPA 2IDTA 1WFNA 3KBEA 1SRDA 2EINB 4KXBA 3T3MF 3WY4A 3ROLA 1MCDA 5F97E 2BC4A 3QJRB 2ADYA 1EMTL 1JPGA 4Y7MA 1DN0A 1UKSA 1U4EA 5A2AA 4EEEA 5ACLA 2AJUH 1TYEB 2E5EA 1IM9D 2FTAA 2F7OA 4E5XG 1GJIA 3RA7H 5DA4A 1A6TA 2A9NH 4LCUB 1EHKB 1E7VA 4LL4A 4QDGA 5KSAB 4M1CD 3VDBA 1SUJA 1CDYA 1LQBC 2YRPA 4S2SB 3NA9H 2I9TB 2MOQA 1QFPA 3EBGA 1IGFH 2GUOA 2NZ9D 2VR5A 2XVKA 2R1WB 3I6KB 3MZGB 3QIUC 4XNAA 5C0JB 4L1SA 5DZNA 1EXHA 4JHZA 3RU8H 4G5ZH 3DETC 4P5MB 1D6EA 1L7TL 3MV9B 3D0AA 1NIEA 1H5BC 4FA6A 1KFAL 2PYED 4WHDA 1A9BB 3FU5A 1MCQA 4YHPB 4G6ML 3IPBA 4Z76A 1NAMB 3AG3B 3SJVE 1FO0L 1SQ2N 1HOCB 4M8UA 4LCIH 4NZTH 3SIKA 3ULVL 4ODTL 1BG1A 2F54A 1B9ZA 4G1MA 2CXKA 1I53A 2H32B 3BGFC 2BVTA 1FFPB 3NH7H 4BK5C 1RUQL 3RWJB 2R4SL 3GJEA 3PUUA 2PXYD 2VAAB 2VLME 1Y18A 1OT4A 2XETA 3L4TA 3MI6A 4NRXB 2PKDA 2W0PA 4ZFGH 2AK4D 1KY7A 3P69A 5G4NA 3UXFA 5IJCC 2WLLA 4PTTA 5C09E 2IWFA 4QRTA 1KZQA 5KYWB 2ODIA 2BOBB 4QRRD 2ZSVB 1PZAA 2GCYB 2XTJC 5DO8A 2VR9A 2C7FA 5F21B 5D6DA 3TH4T 3UAJC 2V7NA 1BD2B 1LDPH 4JFFE 4ZUWB 4DJMA 3IDJB 3Q1EA 2FX7L 3PDGA 1YEEH 2EH8H 5F1NB 1PZ2A 4LFHG 1F11A 2F19H 2ZUSA 3QNZB 3WUWB 4F7CB 2KH2B 1WBYA 1O9ZA 1FO0B 1QMUA 1RJZA 2K6WA 3B2UD 4GP5B 2X9ZA 4EMZA 2OMZB 4Z0BH 1WV7T 5HDBE 4N90E 1T89A 5D6CB 2C4XA 2XN9A 5HHOD 2W38A 2OYPA 3V0EA 5L8LB 5HPMA 3U9UB 3IT8D 3EDDA 4XP4H 1UOLA 1OT1A 4LIQL 4X4YA 4ABVA 3D4YA 4X0NA 1N0LB 5M94B 1VFBA 5E08H 2EDHA 3MBXL 3KS0H 5C2UB 1K3IA 3EYSH 4K55A 1Q90A 3ZQXA 4UT6L 2P5EB 4XMKL 4YBHA 5IKCB 1L6ZA 5JA8B 3ZDXB 3DI3B 3EYOB 1TFPA 4P4KB 3EFOA 3KPNA 3IEAA 4M8VA 1VERA 3SKJH 1X4ZA 4K23H 4F2ME 5C3LD 5J1TC 3GXPA 5GISL 12E8H 3UL4A 5DJXB 2IQ9L 3HUJF 1MCPL 4V1DB 2VN7A 2IPUG 1IM9A 4L48A 3WJMA 4Y89A 3P9LA 3L2MA 4OJYA 4QYAA 4YQXL 3MRDA 2XWJB 3R19A 1VEOA 4PJIA 3Q01A 3TYGH 2G60L 3L16A 2XKUA 3MROA 2KZBA 5E1HB 1NGQL 2E6JA 3STBA 3K6IA 3IDMB 4Z7OF 5FV2A 4Y7OC 3ARDC 5I0WA 2B5IC 5I8EB 5T3XH 2WQ8A 2HG5A 4M5YH 3NFPB 5FM8A 3W5MA 4IRSB 1K4CB 2DIJA 2VW7A 2BSRB 5EZPA 5KW9L 4W1TA 4JRXD 4EI6A 4N8CL 2HA1A 2VJXA 4JO3L 4HSCX 3AB0B 4WO4D 1HI6A 2EICA 2X4OB 4R3SB 2X6MA 4OVVA 4TSCH 2DQIH 3O6FD 3M1BB 3FB5B 3QUZA 4F7KA 4Q52A 2XXMB 4ZXBB 3T4YA 3KCWA 1VACA 4ZO9A 5F8RC 3X1BA 1U8KA 1UURA 3VH8B 4OD2A 5FYJE 1TEYA 2VN6A 2AK1H 3WNNA 5FEBA 3RGVB 1CGSH 5DD0H 1BFSA 2NXYC 3RKPA 3P30H 4EIBA 1RVFL 2P8LB 5EBWA 4HUVB 4L1TA 3VFSA 4IRZL 1NC4B 4P2YA 1UZ6F 2OJEA 1B4JH 5HYQA 4MAYA 5M95B 4FABL 4PRPD 5DRNA 3D0VB 4MLSA 1TZGL 5AEAA 3BN9D 4F3FA 2EIZA 4MBRA 3HFML 2R0KL 3WTSA 1TIUA 4R4BA 2GG1A 1U8PB 4Z7AA 4RBPH 1KEGH 3WKML 2BCMA 2C1PA 3HMXA 1MJ8H 4QKXB 1NBZA 2VM9A 2YC1B 4XHQA 1B9KA 1W6WA 4K5MA 4N8VA 1OE3A 5EBMB 5FHBL 5LWYL 4WY7H 4OCRH 2MQCA 1PYWA 3WFCL 4M7ZC 3KH4A 1Y0LB 4PRDB 2Q3ZA 1MCEA 4YR6A 4C4KT 4AUYA 1NIFA 3CFJB 1II4E 5KUKA 3DSNA 2CMRL 3QJQB 2BNRE 1LE9A 4WEUD 2OBGA 1DQLL 2R51A 3EFFA 3MUZ1 4XP6H 3ZL4H 3TZVB 4XP5H 4YXHH 4Z7UB 3STLA 5BJTA 3QDJE 1XD0A 4U6HA 4WO0A 2CBPA 3KPMB 4HIXH 5D6DC 3MMEA 1WFOA 1DYZA 3QO0B 1K2DB 4E9YA 2VW4A 1FH2A 2JIXB 1FVEB 2F68X 3QPQD 1XHHA 4LXFA 2EE6A 4RQQB 5HGAB 1I1AB 1EXUB 3KR3H 4LLMA 3FOMB 1D5ZA 3SOTA 5BZDA 5E23A 4LZKA 1X5IA 3GM0A 2AV1B 2P28B 5IBLC 4B5ZA 3QEQE 1T89C 3PP4H 4NQXB 5K1VA 4MZ3A 1LXMA 2COQA 4XCEA 5HHNB 4LP8A 1CFSB 1IQWL 2B1HH 3KBHE 4L8BB 2H9GA 3PHOA 1I1YA 2YSTA 3FQXB 4AJWA 1JL8A 4FERA 1H8SA 3K2IA 2YSSB 1OAUH 3O9WB 3IVKA 4J6RH 1XEDA 3S8GB 3FBKA 1XGQA 3EF4A 4NO5B 3C8HA 1IL1A 1SMAA 2YUXA 2JLLA 5IMMA 3ESNA 3ML9A 2XIBA 4FRWA 3FH8A 3CZFB 1S9KC 2UUDH 4WK0B 2Y5TA 1YYMH 1BBJB 1VRSA 4OF6A 3PE9A 3S96A 4W9CC 4IKKA 5JIHA 4G9DB 3NBNA 2D3JA 3MRFA 3SSGA 2IPKB 1S7XA 3QSKB 1DUZB 4FD0A 1J8SA 4KI5C 2DJ4A 2O4EA 3UOAB 5FUZH 1SF3A 3NDZE 1QAWA 3D1MC 4H8VA 1A4KA 1XSKA 5I28A 4PP2A 2EH7L 4EDXB 5C7ZA 1M3JA 1DE4B 2FJHB 1BVKA 1KCRH 3HN5A 2HMID 4AIZA 2V2TB 1QBBA 2N01B 4OB5H 3QBTB 3SE3A 3M7OA 2BP3A 3FT9A 1UXSB 1OTSC 5LVEA 3O2WH 3RAJL 1G1OA 4OLEA 4NUPA 3AC0A 2B3RA 4BFFA 1JV2B 2J8UA 1FFQA 3QUZC 5T5FL 3WBDA 4BZ1L 1LL1A 4PV9B 2BOCA 1S3KH 4UOZA 5LGJB 4LMQI 1YEKH 4YHLL 1CZ8L 4X98A 4RRPG 5KSAD 1Z32X 3H7LA 1QLRA 1HHGB 2R8SL 4AL8H 3RI5K 1KTKE 2EC8A 1BF5A 4N8UA 2ZZUT 1XCQB 4E41E 1OW0A 4PMEA 1FYTE 4XXDB 1G1CA 2O6EA 4QGTA 4YL4A 4RAHA 4KZDH 1HYRC 2K45A 2VQ4A 3FRPA 3TBTA 3D50A 2ZUQC 3OXRB 3T0WA 4ALAC 4ZTOL 4LLVB 1KGIA 2NSMA 3MV9D 4AC2A 5HHPA 3FO1A 4UTBL 4GQQA 1CO1A 1DSWA 1NSNH 1LK3L 1OSYA 2R1YB 4MAYC 3H9SE 3LN4B 1CI3M 4GW5B 2VITA 4MASA 4R83A 4EDWH 4OIFA 1U91B 5E9DB 1KCVH 2HYMA 4XPBL 3MBEA 2JXMA 1N59B 2FH6A 2DWDB 2X1QA 1T1ZA 4K7FA 4DTGL 4RCAA 4PJFF 3VE0B 5IQMA 1CB4A 1UTDA 1OP9A 3N1FC 2VQ1A 4I9XA 3H4FA 3HG1B 4ZUSA 3T3PF 2ITEA 2P7TB 2WQWA 5H94A 5GXBB 3D8MA 2AQRA 3ZYOA 3IFPA 5ITBL 4FDWA 2R23B 3IU3B 3GIVA 1QO3A 2QKSA 5DEZA 4C55A 1P7HL 1QVOA 2A6IA 2Q2LA 3QUMA 3VD7A 1ZV9A 4GKLA 3DRQB 2DLEA 2VT0A 1J8KA 1BZOA 5K9JH 2NT1A 3K2UH 3RA7L 1KN2H 5I2IA 4JK0D 3WXWL 2X9WA 3OF6D 5TDPA 5IT2H 3JYCA 2K0RA 1THAA 3BJLA 3NAAH 5C0GA 4BHUA 1N5YH 2MQGA 3FQUA 4GSUA 4IK6A 1DJZA 5J13B 1CD1B 5E8EA 1G9EA 2ZX8A 1IGFL 1UT1A 3WYRA 3L4UA 5AKVA 4TVPH 5IVNA 3S3CB 3FRUA 1NANH 1BD2D 4G5ZL 3VI4A 3AWFA 4LVNB 4MB5A 4BE5A 4LSQH 3ARGB 5IW3A 5DDHB 2Y1AA 3TBCA 5C8JB 3UO8B 3EJZD 1UA6L 4KKAC 4MNHB 2YD4A 1WE5A 3O4LE 5IEKB 1BHGA 5FYLE 5BO1H 3KPQA 5C7XL 4U1MA 4MNGB 4FFZH 2N59A 4Z7VB 4BINA 2AJZA 2D0GA 3LKRA 4GW4B 4BZ2L 3N91A 5KSBF 3ULVD 2IAMA 4LCIL 2CBTA 1E4XI 3M17A 1SYSB 4I18B 4XXCA 2W9DH 4ODXB 3BX7C 1JWMB 2XY2A 2E6QA 4PRHB 3OAWA 3RZCB 4AWJC 3CSYA 3NH7L 4MLIA 2GEQA 1ZT4A 3IE4A 4B9PA 4LNRA 3MCKB 4YXLL 3AXIA 3QDGE 4YC2B 2B77A 2P24B 3UGEA 5EN2B 1WUNT 3HZ3A 2R15A 1JNHB 1OP4A 2P5ED 2W1NA 2XN0A 4G8FB 4DGIH 1XF2B 3RRQA 4C4UA 3KJ4B 4P4KD 2F53E 2JLPA 2YMXH 3K4DA 4F1SA 5JW3H 4HQQH 4FYTA 2RQ8A 4JFYA 4ZX6A 2E6PA 4V1DD 1LDPL 3GYRA 1NCNA 5TPWL 4P8QA 2BJMH 2B4CH 4RMBA 2Z34A 3LN5A 4B0MB 3VRJB 1YEEL 2NUPB 2EH8L 3MNMA 2F19L 3ME0B 2VGLM 1EEYA 4KRNA 4UZUA 3VTAA 4GXFA 4JDVB 5HY9A 3FU3A 5JHLA 4YBQC 3DX0A 4Z0BL 3LD8C 4IRSD 5IVXA 1OSZA 4J3SA 5DEFB 2BSCA 5GJTH 1J5IA 1I85A 1TMQA 3T2QA 5I82A 4GRMA 3LH8A 3OHXC 4X8CA 2DQJH 4O02B 1PJWA 4XP4L 3FS9A 1P6WA 1C16A 4KK8C 4N1CA 2NLJB 3SE3C 5IHUH 2DYPA 4HW6A 2D3VA 2EXSA 3H7BB 2IMNA 5E08L 3PFQA 2UXTA 4PGDA 4CRPA 1ZV5A 3EYSL 4AEIH 1HE8A 4ZXBD 2YOAA 1ZAGA 4S0SD 1PLAA 2I25N 4AYFB 4Y4KB 5AKRA 3SKJL 3FYIB 5CBAB 4K23L 4ONOA 4ZO8A 1XV8A 5DQDH 2IBZY 12E8L 4AYSA 1FE8H 5JIQA 3RGVD 4UUJA 3D85A 4FQCH 3DURB 1OW0C 5J3HD 4UB0H 3BD3A 4DEPC 1UVQB 2ZTBA 3SBPA 3W11D 2UXVA 1ERNA 4KUZH 5J1AA 2XA3A 1NC4D 2W65B 4POZC 3DX9A 2WSDA 2CLVB 2KT6A 3TFBA 2CCWA 4L0ZA 3F5WB 3K74B 4W9FC 1XF5B 4U1SB 3UCRA 5T3XL 1KC5H 3MBEC 2E75C 4HEPA 1DFXA 4M5YL 2CCVA 2AEPH 4ZUWA 5DZPA 4BSWB 4XAKE 3BP4A 4TUKH 1Q9OB 1EEZA 1ZE3H 4DNLA 4WFFE 1IBGL 3Q8BA 4KPHL 4CVWA 1HXYB 3TN0C 4N85A 2DY2A 1J9TA 3MLYL 4JFOA 1I7RB 4DP8X 1I7UB 2HRHA 3NJVA 1HEZB 4GFTB 1EGJH 3JWNH 2DQIL 3BLPX 4TSCL 5F6IC 4HK3J 5FYKH 5C0BE 1AQ8A 2CO7A 4QJ3B 4ZFZB 1AXSA 1BOYA 2GJ6E 2AK1L 25C8H 3CZSA 4XNUH 3ZMEA 2K8MA 4NC1C 1PW3A 1ASQA 1CGSL 4WW1B 4IOSD 3TZVD 2J71A 3RWDB 1AKPA 4O58H 5ISZA 1IGTB 4K4KA 3V4LA 2CAKA 4APXA 1R33A 5LAXB 2MCAA 4DETA 1K5NB 1JVLA 2PTVA 5DJZA 5AVVB 2JIXD 1B4JL 2PP8A 3D39E 4ONHA 1I8KB 4XO3A 4FFTA 2CA4A 1I1AD 1BF8A 3DO7A 3G5XA 5D96B 1DO6A 4NS0A 1BQHA 5BV7C 1PIGA 4F7EA 2BO0A 5D4IA 3I6SA 4WRLA 3SHSA 3LZPA 3MRQA 3UTTE 5HJBA 1KEGL 5HYJE 2CPCA 1A9VA 4NYLA 1ZTXH 2IAMC 3BHBA 4LSDA 1MJ8L 5F9JA 4WNJA 4LGRB 4PJAE 5CU9A 3BKYH 3L4WA 3RLSA 3W57A 3LEXA 4YFEA 1L5GB 1PZ5B 3LQZA 3TOPA 3V4UH 3GLZA 3BVDB 1A7PH 2NMSA 4WY7L 5FO7B 3TC9A 3OLIA 4OCRL 2FL5B 4X42A 4EUPG 1HIMH 3JWNG 2BSRA 3D48R 5F1IB 1X7TA 1J0KA 3O9WD 3ZLQC 2QQLH 2FNBA 4HKBB 1X44A 4PY8I 1N10A 5T1LB 3ECWA 4NQEE 4XP5L 2EIBA 4YXHL 2OP4H 4UT6A 5AB2A 1A4CA 1DQJB 2N7AA 4UM8A 1FL3B 4JO5A 3E2HC 3UERA 3O3UN 4EF3A 4N0UE 4PJ8A 1O6TA 4LF3B 2ZYHA 1YECH 2C9AA 2K3HA 3KR3L 3PGDA 4ZMTA 3KLKA 4OUUA 4FG6D 3SE6A 2OQJB 2B08A 4XVTH 3PNWA 2XG5A 3QQ3A 5CD5C 1CL7L 1NC4A 1RLWA 4LSPH 4TMPA 3K71B 3QIBB 2M8XA 2NY0C 4NPYB 1CK0H 4WHTA 1MW3A 5DU7A 1NC2B 3VNYA 4B6ZA 4RH4A 4QOKE 3D0VA 2B1HL 4L1DA 2BM3A 3SDXA 2OMWA 3OZ9H 3CFEB 3TASA 1EZUA 2OSLA 1P69B 5DEGB 5T1DH 2HTKD 1F0LA 3NCJH 3QQ4B 3VGEA 1OAUL 2J21A 2C26A 2FQFA 2YC1A 4LLWB 4M4RA 4Y8DC 1L9PA 3RVVD 4J6RL 1TCMA 3TCTA 4AM0A 4C56E 3WO4C 3FTXA 3CFMA 3N6YA 3L1OL 3QC5X 3NACH 2B16A 4JDZB 4F2FA 5AFAA 2VZOA 5HHQB 2KLTA 4FHBD 1P0SE 4N87A 4A55A 4PRDA 2JB5H 2MOVA 3JTBA 4RZKA 3UAAA 1LEGA 2EYTB 1YYML 5F9OH 1JWSB 3DVGB 1D2PA 2XVGA 4TQEH 2ENJA 1MQKH 1S2EA 5F3HA 1QSFA 4X5QA 1T1XB 5E9DD 4PR5A 4KKNA 1ZS8B 2Y1ZA 5FFGA 2E8ZA 2HRPL 2WINB 1F00I 4WNQA 2DIBA 3H2QA 5FUZL 5ABAA 3VG9B 2WQSA 1RZKH 2FZ3A 1FVCA 2YAPA 4CKQA 1SOKA 3HG1D 1FVEA 5LBVA 4XH2B 3HRZA 4RQQA 4YSQA 1KCRL 4N9GB 4NT6B 2EDMA 3WLBA 4MKTA 4OB5L 2Z31A 4YBLB 3O2WL 3IXTB 2XWTB 1RUPH 3QEGH 1VENA 5DJ0A 1S6NA 3V6OA 3RWGB 4C58B 1S3KL 1W0WA 1YEKL 3HE6B 4W4OA 3ZE0B 1QUNB 3B3BA 2QFPA 1A1OA 4ZUVB 4PJ9A 3VXNA 4AL8L 4XBPA 1JHLH 1AQDA 2BVPB 1I31A 3MR9A 1ZSDB 4D0DB 4E9WA 3QR1A 5AOZA 4FADA 4KZDL 2VDNB 4HIEB 3EYQD 1PZUB 1SVBA 1M9SA 1JTTA 2D73A 3MRGB 2NY1C 1M7DB 2ALAA 3ARGD 1WD8A 1NSNL 1HH6A 4NO5A 4F33B 1KCVL 4DKAA 5C0FA 5HDBF 2F7QA 2HCZX 5C9JB 2EDTA 1EK3A 4OTXH 3AAZA 1NFDA 1JN6B 1ECYA 5I5JA 4OZFA 4IYKA 1T0MB 4PG2A 1DVUA 3U6XA 1FVDB 4RMWA 4P57B 1UB6B 1XH1A 5FS5A 3X11B 1F3JB 1KCWA 1H3GA 2F9BT 2CUHA 1QOKA 2EZ0C 4PRHD 3RZCD 2FQEA 2DI7A 1S7WB 2E4TA 4K0OA 1TNNA 4OKDA 1I3VA 4JHUA 4OJAA 4FI6A 3LRSA 1RV6X 5K9JL 1NFIB 5FKPB 3LH2H 2YOCA 2CO6B 2LT9A 5DEJA 1KXQE 2NZ1A 1CF1A 4D9QD 1RQ5A 5IT2L 4WTWA 4ZPVA 3NAAL 1U3NA 1N5YL 5TDNB 3S97C 1JDDA 1MELA 1NEUA 4ZT1A 4X8XA 5CJ5A 2RBLA 4RMSA 5AL0A 1IC4H 2M83A 4TVPL 3NPSB 5E94A 4D3CH 1C9SA 1M2OA 4LFHD 4HULB 4W68A 2AW2A 3VXMB 1JGIA 2IANB 2G5UA 4LSQL 5KANG 5LGJA 2HX7A 4PJ8C 4PSPA 3SZKC 4R7DB 1YEHH 2V6HA 2BRQA 1VADA 5BO1L 2PO6A 5ID0A 3QXTA 4R8WL 1XCQA 2C3HA 3NP3A 1NGPL 4FFZL 2EVFA 1IAKB 1N70A 3O0RH 3QULA 3T65B 2QVMA 3NEOA 4KJWD 2ZX6A 2B8OT 2VSKB 4O4YH 5JLZA 5FWRA 5E6RB 4P59L 2IPUK 1VGEH 4ELME 1UB5B 1S7VA 2W9DL 2FGZA 1YN7A 2J1WA 3JWDH 1X5ZA 4K3GA 4WFGE 5A2BA 1K5WA 5G5DB 3T0BA 1CURA 3MV7E 1IM3B 2D9CA 4W9DC 4AGQA 2ZPKL 3TA4D 4A6YH 4HUUB 4YUEH 4ORGB 2GITA 2OJ1A 3QZWA 1W8NA 3VFOB 2H0PA 1AQKH 3P4NA 3O45B 5E4OA 3U4BH 3CVCA 3QHFH 4CC1A 4DGIL 1NCAH 3GC3A 4BZYA 3KPSA 1DSFH 2AV7B 4E5XA 4Y4KD 1KYAA 2YMXL 3TV8A 1CLVA 5JW3L 2HT3C 4ZTEA 3VFRB 5E6SB 4DGYH 3HI6H 3X17A 2GJJA 5T5FA 4S0TD 4BZ1A 3QGVA 4EE2A 3ARTA 2Q3XA 1NZRA 3IJHB 4U6YB 5I1JH 2B4CL 1Q4NX 2WLNA 1XX9C 2X3CA 1U3JA 4XTRC 1SEBA 4JVPA 1D5MA 4P5TA 2WIMA 5EU6B 3AXHA 2J6EH 2ZG1A 5AW9B 1ORSA 4GG6A 3HZKA 2WLIA 3LMJH 2NNAB 4OKVB 1JDAA 1UM5H 3QIWA 1G0YR 3IJSA 4RMQA 4L29A 4M93B 4GRLA 4UTBA 2YA0A 1H3VA 3UC2A 1JF5A 4LOUD 3Q2WA 4WEBH 5GJTL 1MIEH 3ARGA 4X4XB 3ZKXB 2NY5C 5AKSA 3QXAB 1IEAB 3OKDB 2XLLA 3HRZC 4R26L 2YN3A 2N1KA 3WEBA 5F0JB 2CA3A 2Z31C 4X5LA 2WGXA 2Z3FA 1Z1WA 4XCCL 1U2CA 1JPTH 4UMGA 3RKDC 4AEIL 4L4VB 3V6OC 2BW5A 4F9PA 5K39B 1TKWB 3BDBA 5ANMA 4A7VA 4MQXC 4Y9FA 2VRKA 4W4OC 1VFOA 2CO1A 4PWKA 4UQEA 1JZDC 5D2LA 1HJBC 1FHGA 4PJ9C 1YPZA 1S9XA 1YC8A 1RSYA 4UB0L 4KROC 1IGYA 3TIDA 4KUZL 1JZ8A 5B4MC 1OP3H 3IAQA 3BQUA 3VM7A 1BPLB 2PYEE 5I74B 4FQIL 3BUIA 4Z7IA 1R3KB 5KVFL 2HJKB 1WP6A 5T3XD 2DM7A 1NBYB 3TH2T 1G7JA 1XH3A 4YAQB 1HEJC 1KC5L 3HE7A 1U8JB 4DVRH 4FQXB 4AQEB 2XWZA 2AEPL 1T5WA 3OKKA 3HA0A 1ES0B 1BPVA 3VRIB 4QEGA 4TUKL 4HS3B 4PG2C 3MRNA 4RDQG 4D9LH 4LHUG 4BZ2A 1S7QB 5TE7H 1I9RH 3PV7A 1EGJL 1GY2A 4LLAA 4Z7NB 2AK4E 1EFQA 1P4LB 1NWPA 2I07A 3KL5A 1B0RB 1TT6A 4YDMA 4KXZH 3MLWH 4U1KB 1G7QB 5IB5A 2K9FB 1QWUA 3GKWH 4QRRE 3TESA 2YD3A 25C8L 4XNUL 1QZNA 3FTGA 1HL8A 3AITA 4KJPC 1EBPA 2GTZB 5F3BA 5T1LD 3ESOA 1PFOA 1JPFA 4JBSA 3US0A 2X1PA 1O5DT 4O58L 1VIWA 3EF7A 3S35X 1FFNB 3FSAA 3NCYS 3MUGA 4ZX4A 5G4OA 1RD6A 4NKOB 4KAQH 1TZOA 1CDBA 1AC0A 3QB7C 4NNXB 4AYFA 5CGYC 5AL8A 3BSZH 1JMZA 4MJ4A 4UILH 4E68A 1IBZA 2PO6C 1RH8A 2DRUA 2JJSA 4XN7A 1ZANH 2JNZA 2L4OA 2ZP9A 3EAKA 4G6JH 4ZNEA 2CUAA 5HHOE 2DLFH 3MXWL 3PXHA 1ZTXL 4JFPB 1J0JA 1KLFA 3QIBD 2CLVA 5D7JA 3BKYL 2ADFH 1SDYA 4XODA 1NC2D 2FBRA 2Y7LA 4N68A 3V4UL 3UZEA 1A7PL 1X5HA 4U2YA 1B6UA 2VMJA 5TGBA 1XR9A 4HVBA 5HVFB 4Z18A 4J2QA 3DOIA 1I4FA 1NANI 3L54A 5B8CB 5C3IA 3Q2LA 4O9HH 3SDDB 2UY7B 3WHXA 2BMKB 3H55A 4N28A 4YWGH 2GYSA 2Y07H 3FZUC 5JUEH 1M71A 2Z92B 1CD0A 5F2FA 2QVKA 3NCBB 3O11B 5SWSA 3L2NA 1GCFA 2NTFB 5D1XE 2BIIA 1UD5A 3MRJB 3QNFA 2OSWA 1M6OA 2OP4L 2X70B 3TEYA 5EIVA 4M8QA 3STZA 4X83A 1KPVA 4NFDA 1H3PH 3K72B 3TP4A 3NSJA 2EXWC 2BZCA 4HDIA 1DCEA 1B2WH 2R2EB 1A8JH 1P84K 2YN5A 4BFGA 4U1LA 5H8DA 4P5TC 5J13C 4AY0A 2QVIA 4ATWA 3OKLA 2YARA 1EX0A 3N04A 2COVD 5K69A 4P2OA 3QIWC 4CU7A 5TQ2L 3BWZA 5GSRA 4GRLC 1KG0A 4HFUH 4Q9CA 4LSPL 1CICB 4JRXE 3TO4B 4ZQKB 1T21B 3JV4B 1CK0L 4GAAA 1TLKA 2V17H 3JV5A 1HC1A 3M45A 2D4DA 4PI0A 5E2UH 3OZ9L 3Q2CA 3PWLA 5J6HA 1HHIA 4PS4H 3O3BA 5T1DL 4A2HA 2A0LD 5C9KA 3NCJL 3T4AC 1H6UA 4YPGB 4F9PC 4UOW0 3K6SA 3BPNB 5F1KC 3HE6D 2OZNA 3D09A 2HKHH 8FABA 1DBKL 4BCXA 3SQOH 5DUJA 3ZKMC 3NACL 3CN2A 4XOBA 1I7ZA 2Q7YA 1SXAA 2R7EA 2B3IA 3N44B 5HHVL 1O7VA 2JB5L 5F1IA 4G6AC 3SYOA 5HVHB 4PRPE 1R0AH 4DPCX 1LEIA 3BQUC 3GRWH 5ACZB 1S5HA 4TQEL 3BEVB 5FM5M 1MQKL 3TBYA 3QWOB 4YDNA 2XQYG 5I5IA 1G7MA 5ALCH 2ZOOA 1Q9KB 3KH3A 3HE7C 3GXIA 4HZ1A 3TF4A 4HJ1A 1RZKL 4AV5A 3KPPB 5CN3A 3D0LB 1J0IA 5EC2B 3VFWA 4KOBA 1DJWA 2ZX9A 4IBZA 3MJ6A 2FQDA 1J8HA 4LEXH 5ICZA 2PLTA 4QHNA 4HIPA 2OQJA 3AXLA 1ZT1B 2MKLC 1RUPL 3QEGL 4JKWA 5K59E 3ZRCC 2NY4C 3GS4A 2GIMA 4HJEA 2VZUA 1JVKA 4R6UA 1SNRA 2JKIS 4DGVL 3R4RA 2EEDA 3T1FA 4J3TA 5HP5A 3C9NB 5D1QB 5C0AA 1A7OH 4Y16B 4X7CC 4EO5A 4FMKA 4NKIL 2X4UB 3FONB 3JWOH 4I88A 1JHLL 5DC4B 1F56A 2FYVA 2D0HA 3LRHA 2ICEB 4K3EH 5ID1A 4UDUB 4PJ6A 3VXMD 2BZDA 1BLNB 1KCSH 2IAND 3CX5K 5DJDB 3DUSB 4NUQA 4OT1H 5E4AA 4J3OF 1T2JA 3GGWA 3EGXA 2DQHH 3LCYA 2LAGB 5K33A 3GBDA 1L0QA 5LJYH 4RGMC 2Y24A 4K71C 3T0EB 3QUHA 4JKLA 2JJSC 4P9HH 3SQBA 4L4TA 4OTXL 1TTUA 3VW3H 3VDAA 4OLYL 2E8YA 3L3GB 3IDGB 1BIHA 5D7LB 2ETWA 4DOHB 3NP4A 4OH2A 2WW8A 2IMMA 3MDJA 2XNAA 3SKUD 5L0QB 2KDGA 4BQ9A 2EUZA 5D7JC 3FN9A 2WMPA 5KSVB 3J07A 2A9AA 4AUJA 2BDNH 1IM3D 3F05A 3UZEC 3S4SA 2GSGA 4ZMWA 2XT1B 3OJMB 2MPAL 2Z7YA 4GIOA 5I15H 3WEMA 4GO9A 4URTB 5FPIA 4OCSL 5CILL 5J4MA 2OX5B 2EVIA 3AS3A 1DQTA 2WO3B 1RZ7H 5D4QA 2NNXA 3N40F 1ULVA 4OLVH 1CXEA 4ILDA 4PG9B 4QHLA 4GP8B 4PJ7E 1IC4L 1QA9A 2XWTA 4RRPA 1W80A 4HYTB 2P42B 1UH3A 3DUHA 4DP4X 4G1EA 4PYGA 1Q38A 1A3ZA 1M42A 1SJHA 4PJ5A 3Q7JA 5E6YA 1MH5A 2CK2A 4PJBB 3FH5A 5EU6D 1WQVT 4NEHB 4U2ZA 3VA6A 3OR6A 3MJ7B 3O3EB 4D0DA 4O5LL 2YXWA 3O0RL 3GZKA 3UTZB 4EN3B 2N56A 1QW8A 4P2OC 5DTFA 3GXFA 3IBOA 2DKMA 4O4YL 1GGYA 2LGNA 3ZE2B 4UF7C 2VLLA 1UOVA 4JQIH 4IM8A 3IFNH 2A9MH 4DFIA 1WFMA 1A6WH 3JWDL 1V10A 3TPKA 3DOHA 4JZJC 2AQ1A 1IGCH 5FK9B 4NENB 2G0KA 3DWTA 3QDMB 4A6YL 5FFOA 3Q48A 4I0CC 2R83A 4M1GH 5BZZA 2YPVL 1AQKL 4ZSOB 2Q8BH 3U4BL 4YSSA 3QHFL 3TO2B 4L4VD 3EOAB 2XQBH 5F9WC 1NCAL 3I85A 1C08A 2CHZA 1IB5A 1SJMA 1F3JA 3GXMA 5HI5D 4GMTH 4CVUA 1JXGA 1N26A 2UYLA 4Q2ZA 5EEUA 1FZKB 2JV6A 4DGYL 1S7WA 4NNYB 5MEOA 1FHNA 1MY7A 1Q9LB 5C0ND 1YN6B 1IC7H 5LNGA 3MV9E 4N5ED 5CLYA 3UG4A 3REVB 5I1JL 1ZPLA 1M05B 3R18A 3U46B 3LKQB 4LPYA 3U36B 3T6QC 4PREA 2W0FA 2Z7UA 5EOTB 2J6EL 2ITDA 2Q86B 4QI3A 1HWHB 5E4EC 4QHMB 3U4EA 1J1XH 3LMJL 4LPVA 1UM5L 3NIDB 3K6OA 5TDOA 4OFKA 4FQXD 3VFVA 4WEBL 4PJAF 4QRBA 4FL4B 1MIEL 4PCSA 1L0XA 1LM8V 3VGBA 4PWFA 4Y19B 4U3SB 4ODUA 3ROOA 5EUOA 5E1AB 1IBFA 1J9RA 1AHKA 4KDVA 3ES6A 1CCZA 3WELA 2IWEA 5INCA 4X5WB 3KPTA 4HOZA 5DHYA 4WF7A 3T65A 3OMZA 1VEPA 4H8HA 1JPTL 1PZ3A 4MWFA 1H3WM 1X5AA 4OV5B 4M61B 4MSWB 2ERJB 3WNJA 2TRHA 1IM3A 3MVSA 4D8PA 3W0WA 3V6ZB 3K0WA 3AU1B 1BD2E 4I9WD 2KZ1B 3FO9B 5F7FA 1E8XA 1IARB 1AHWB 2EKSB 2FIKB 2WWMD 4AQZA 1KBBA 3DRTA 1RK0A 5IMLB 4PTUA 1YC7A 4XI5D 1SJEA 3V0HA 3FCTB 5ACMA 2WBJB 3PWVB 4I1RA 4WFEE 4PGEA 1ZLDA 1HHJB 2CALA 3KG5A 2GEEA 3LAFA 3MREA 3CV5A 3EYFA 3TT3H 2EDYA 2Y3AA 1AOHA 3TBVA 3DBXA 3B43A 2WZ5A 4U1GB 3TJEH 4YHIA 4DVRL 1TQBB 3GB7A 4BIKA 5JPMA 3IJHA 1Z3RA 4AVIA 1OE2A 3LVTA 2YEVB 3MFFA 4Q56A 4XO4A 3WV0A 1JPSH 4R7NB 5KVGE 1KENH 4JQVA 4FFZA 5DJCA 5EU6A 3V52H 1ZLVK 3GMPA 4PWGA 4PWHA 5TE7L 5FYKD 3WN5B 4OKVA 2H2SD 3QFJB 2ADJA 1I9RL 2PABA 4OF8A 3H56A 2V37A 2J5LC 3U1SL 2ZWKA 4ODSH 2P5EE 3CIQA 4G70B 2W92A 4NO3B 4RA0C 2CLZB 3ZDXE 2XJKA 3UZQB 3SDDD 4YPJA 1PNDA 3MN8A 4YJZL 1A2YB 4GSDH 1DQQB 1KDJA 3GKWL 4CW1A 4F7TA 5HGGS 4J3XA 2OKMA 3IDYB 4P4RA 4LSSH