2WYFA

Crystal structure of pa-il lectin complexed with agal12bgal-o-met at 2.4 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Role of Water Molecules in Structure and Energetics of Pseudomonas Aeruginosa Lectin I Interacting with Disaccharides.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2wyfA00
4LK7A 1UOJA 2O14A 1WMXA 3F95A 4LKEA 4YWAA 4YW6A 3ZYFA 4BQ5A 4CPBD 1GWMA 1WZXA 4CP9B 3ZYHA 1W8TA 4AL9A 2LRPA 1WCUA 4LKDA 1GWKA 2JWPA 1W8UA 2VXJA 4LK6A 2C24A 4CPBA 1OH3A 3ORJA 4BQ3A 3ZYBA 4YW7A 4BQ2A 1W8ZA 4CP9A 1V0AA 3UT0A 1HN0A 1OKOA 4LKFA 2WYFA 2K46A 2Q1FA 1GWLA 4LJHA 2KR2A 4A6SA 2LROA 1W8WA 1W90A 4BQ4A 5D21A 1L7LA 1W9FA
chains in the Genus database with same CATH superfamily
5F8PA 4IV3A 5KHJA 1DLCA 1R1ZA 1COV1 4XFHA 1LGCA 4LMFA 4HVOA 3AZWA 1FAYA 3OGJA 4PIYA 4AHZA 1JODA 4IE5A 4CEYA 3MV11 4RQPC 4Q0SA 1K5MA 1UZWA 1W9TA 2A75A 2WS92 4R9BA 2B5HA 4LA3A 5FKBA 4QWNA 4DXSA 1VBE2 1BVVA 1UY0A 2K46A 3VBFB 2VZVA 1CAXB 1NZCA 3WW4A 5KHKA 2O8QA 1JXNA 2QVSB 1DZQA 2VPVA 1D7PM 1JH5A 5BY5A 3WW1A 4OYUA 4WM8C 3ZPYA 4RS5C 1WA6X 3VBFA 1RUI1 4LBQD 1CAXA 3HVDA 1AYM1 2XHNA 4A4AA 1QNWA 2VNGA 1UX6A 4XJZA 1VALA 2TUNA 4BK5A 3ZYIB 4FFFA 5L7OB 3I59B 4D8MA 1DFQA 2ZGUA 4Y1ZA 3GXUA 4PDWA 1JYTA 2I45A 2XUEA 1LHUA 1PZ9A 4AWDA 2A6VA 4X8NA 1AR71 3I59A 3LEIA 2E32A 2J1EA 2ZAAA 5DN2A 2P5BA 4JRAA 1HV1A 1ALYA 4CUAA 5M0TA 1HB4A 1AVBA 4L8QA 3IT8A 1NCQB 1FOD2 1W6PB 2GZWA 3WINE 4C1XA 4DS0A 1LHWA 3USUB 4N9HA 1JHJA 2YV8A 4ES9A 3RYRA 4RSUA 4UWDA 3NV1A 1H0BA 3M3IA 3DPRC 5K0UC 3POEA 5J1XA 1NCQA 1W6PA 3CHXA 5HXVA 3AL6A 1RC6A 3USUA 4FTBA 3N7JA 4NHKA 5IK5A 3ILNA 2JXAA 1C8M2 4PQ9A 2WJSA 4SBVA 2Y38A 1KS5A 2UWBA 2R073 2OUJA 4Q4Y2 4RS5A 2IXLA 4AEDB 5CIRA 3ITQA 4PF1A 1JUIA 1UY2A 1ENQA 1H8TB 3AMNA 1AR82 2QQWA 4YW3A 4A7ZA 1CR7A 2LS6A 3KS7A 3IZOA 2CGPA 4AGRA 2VUCA 5A7PA 1CAWB 1YJLA 3NV4A 2E53A 2PN5A 2K9ZA 1HQNA 1OUSA 2ZTNA 5DAVA 3ROUA 4PJYA 5J96B 3PVOA 4P08A 4Y26A 3RZMA 4NWWA 1VRBA 2NYYA 2MEV1 2VUJA 1N1TA 5FZ6A 2PHWA 4ISQA 1QDOA 2DCKA 4QHZA 5A6XA 1ENXA 1RUH1 1ENSA 5G04L 4DOUA 5A3MA 4B1MA 1CAWA 1IQAA 1UQXA 1RYYA 1Z7S3 4FOQA 1YI9A 1BK1A 4AAPA 1GZCA 1WW7A 1CN1A 5FOJB 3H8XA 4YZ3A 4D0QA 4QU2A 5D2AA 4NHMA 4LBNA 1Q8OA 3G7DA 3TB0A 5CU1A 3O1MA 3R6SA 1HQWA 1UU4A 2JD4A 5JXIA 5K0UA 2D44A 2D98A 4YVWC 5A1AA 2VNRA 4FQ4A 4IEOA 4HL0A 1GWMA 4LHNA 4WVWA 4XABA 2YPDA 4I01A 1DHKB 4R8HA 4D6QA 4R4ZA 1G86A 1W6QA 4IEWA 5FPBA 2HBUA 1CWPA 4B3NA 3PMSA 1R092 4HK9A 1IPJA 2E51A 1GQHA 1NCRB 3N9NA 4DB5A 4ZXKA 3ZFGC 2B45X 1O4YA 1O7FA 2DYCA 1YXWA 2JE7A 2OZ6A 3KHCA 5FO9B 3G6JB 1RVF1 5FMCA 3ZKUA 3BTXA 1NCRA 5C4WB 2HWE3 1LU2A 2D3SA 4Y4RA 1W03A 3B94A 3P6BA 2BPA2 3CO2A 1L7LA 2Q30A 2PMWB 3WQ1A 3M4FA 3J26N 2FZ2A 4QPWA 5C4WA 2W1UA 1QXRA 2JECA 1BHGA 1OOPB 2XG3A 2PHFA 4M01A 1JYNA 1SCRA 5LW9A 5FZOA 1GU3A 4Q5OA 1CIWA 1RUF1 2I2SA 4BOWA 4RYDA 4EN0A 3BIEA 4XUOA 3VBHC 3J8F1 1OI6A 1QXPA 2BWCA 3O1VA 1O3QA 2R043 1OOPA 2ZEYA 3QH7A 2GMMA 2IVJA 1V6OA 4GMP3 3WOGA 4LO6B 1ND3C 3I2KA 2G4IA 3S7IA 5EQUA 4CSWA 1LOGA 1RUC1 4CPBD 3E1F1 1DYKA 2OKXA 4FPOB 2HLEA 4AG4A 5CB7A 4D7TA 1PMHX 1WLDA 2HEYF 1POV0 4IERA 1TMF2 2VOXA 1FV2A 2JWPA 1FI2A 4E8CA 5JOYA 5JZGB 1YWKA 5JPNB 2FZ1A 4BK4A 3PDQA 5CFDC 1W04A 4LO8A 3VBSB 4YYOA 1JZ3A 4XDPA 4AEKA 1S0EA 4J1WA 3WDUA 5FWJA 4KL1A 5FYBA 2LW8A 1Q8SA 2G9GA 4QM9A 3LFIA 4TYSA 3T0BA 4A44A 1RJ7A 3RZKA 1QJU3 1GICA 5KXCA 1GV9A 1EUTA 4KWLA 3WZ1A 2UY8A 3LAGA 4BJ0A 4MX3A 4LK7A 4NE9A 1RMU2 2DWRA 4WVMB 2BBAA 2I07B 2NMNA 1WBLA 3HAGA 2WN2A 1M4WA 3AP7A 4OI2A 4QU1A 5AC92 1D0GA 4MV2A 2IC1A 1GNYA 4UW6A 4QXHA 5D8AA 1QOSA 5DG1A 2E31A 2EIBA 2V73A 4YW7A 2P6HA 5FYYA 2YYOA 1B35C 4DQAA 2YPJA 1LR5A 2Q8OA 5JXGA 5GLZA 5GM0A 1Q3EA 1MQTB 4XFFA 3RVHA 3U07A 2D3PA 4CXYA 1X9PA 3LFMA 3FFZA 3VDAA 1ZZBA 2W1WA 1ULPA 3POWA 3KCXA 5IATA 4Q29A 2RM22 3B00A 1IKQA 3RI8A 2WUHA 2R062 3LOBA 1MQTA 3AMHA 2D6NA 2VBBA 2D6LX 4CXXA 5CFDA 2WQ8A 2PFWA 3H7YA 5KWRA 2PHUA 1A6CA 5A7SA 4I3GA 1ZM1A 3BPZA 2G9FA 1EAH2 5FY8A 2DCYA 1RXGA 3CJIB 4JTNA 3CLPA 4OUSA 2WABA 2A71A 5I0UA 4PI0A 4DEQA 5L73A 1AR62 2YBKA 1NY72 1DDLA 1HRV3 3LA7A 4D6RA 3V0BB 3HT1A 3S6PA 1UY3A 3JBG2 4MSVA 3CJIA 3WV6A 3MFAA 4XUTA 4OI1A 5FWEA 3KZ4C 3RMYA 3S5QA 2WO3A 5I8TA 4LBQB 2VE1A 3N3HA 1WA4A 2RG4A 3NMBA 1JZ4A 3TBDA 1I5ZA 2WRAA 2GALA 4PLMA 1UIJA 3V0BA 4GKYA 1JW6A 1KGYA 4U36A 3AJZA 4UFJA 3C7HA 5BNNB 1R1A3 2JDAA 2LRPA 3PHMA 4LBQA 4Y3OA 2Z42A 4HFSA 4XFIA 4OUEA 1POV1 1ULFA 5JMOA 1GQGA 4B4QA 1XPWA 1SDWA 2P3YA 2WINB 1HJGA 2DCTA 4LO5B 3M3CA 2IXCA 3N9MA 5DDJ2 1U5XA 2ERFA 4P9XA 5IK7A 5LA0A 1CAUA 1OVPA 2WT0A 1NE6A 3LDBA 5FY9A 1NKGA 1WW6A 4LHKA 1G9BA 1ZBE3 2HWD3 3PUAA 3B3QE 2ES3A 2YG0A 3LWCA 1PIV2 4AGVA 3ZXDA 1LU1A 2XJSA 4GZ9A 5C8WA 1BBT2 1SQ4A 2B8MA 1G6NA 3OPTA 1I6XA 2DF7A 5LB6A 3MIEA 1H8VA 1DQ0A 4NROA 1EV13 1REDA 2QQOA 1RXFA 3S30A 3WCRA 3ZSEA 3T2TA 1H2NA 5CVRA 1OFNA 3POGA 4YM0A 3RWKX 4BQ2A 2HWC3 2Q8EA 1PHMA 1S0JA 2DURA 2SLIA 1UU6A 4UFKA 1ZBA1 2F4PA 4YARA 1Q8VA 2JDYA 2R0FA 3E5UA 5FFOC 1KFXL 5ABJB 4S2GA 1RUJ1 3B9IA 4Q4W2 4BIFA 2VECA 2PHXA 5H9SA 3T2PA 1OURA 2VCBA 4GMP0 1F9KA 1X8MA 3O1SA 3VZJA 1UXZA 1TNRA 5ABJA 3NV2A 4FPFA 5L19A 1M06G 3B9CA 1KJLA 2RJLA 4K21A 1QDCA 3N9QA 1HXS2 3GZTB 1VLNA 3IBMA 2W3JA 3SLIA 1VBB3 5DUVA 4HZFA 4JKKA 4SLIA 2VXRA 3HBKA 4UFHA 4A42A 3IWZA 3NWKA 4CA9A 1OLMA 2XBO3 3SCFA 2NPIA 5C9AC 3S5AA 2AGSA 2TNFA 3D5OA 4XURA 2BOIA 5FZ9A 4ZHNA 3ZSLA 3NNFA 4QX2A 3ZFEB 4BMBA 3KCYA 1ZRCA 1Z7S1 1ZRIA 1JYXA 1SPPB 4DIQA 3WW3A 4CDUC 4PF5A 5EZWA 3KMHA 1FNYA 3AYEA 5H9RA 1VBC2 2ORXA 2OT7A 2XQRA 4ZKTB 5B4XA 1WKYA 2CDPA 4E27A 1ZRDA 1E5RA 2VH9A 5GZGA 1SPPA 3LIGA 2QJVA 1CX4A 4MYEA 1UYYA 4Q4W1 3LOIA 4N43C 3SCHA 1XU1A 2XWBB 4P5HA 3RGBA 3IIIA 1H2LA 5FZDA 1U0AA 3K3OA 2DVGA 1MS0A 4XJ9A 3VBRC 1S0FA 4MH0E 1L3JA 3AZYA 3HQRA 1UF2C 2DVBA 2GC3A 3PVEA 2X5IC 3V64A 3VHPA 3GZAA 2NZ9A 3WUCA 1IPSA 1H4GA 1K45A 2E7QA 2QQNA 4MLOA 1US3A 3IB3A 4QPGB 3BTYA 2VOTA 2FDKA 1VBD2 2RS12 4FPKA 3WP4A 2JB8A 3ZN5A 3ON7A 5IHRA 5F5AA 2VQ0A 4IEXA 4H3WA 4QKDA 3M1HA 1BLZA 5DAXA 5FXZA 2JKBA 1RITA 2ZZJA 4AZZA 4EWAA 4KG0A 2GH2A 4FAGA 2H6BA 2ZHLA 4N53B 1K42A 4K1ZA 4HKOA 1W06A 1U5YA 2XJTA 4XZUG 3WHUA 1W8FA 3DXTA 2OXBA 2WNUB 1BYHA 3OPZA 4Y20B 2C24A 4K8FA 4N53A 1S0BA 4EN8B 1BMV2 2OVUA 3SISA 1RUG2 3GZEA 1V0AA 1YC61 2A3WA 4QGLA 1HRI2 3MDPA 5T55A 1VB4A 2KXLA 2XL7A 3N9PA 2WNUA 1K3IA 4Y20A 5GZCA 4MOAA 4I0AA 4N43A 2DVDA 1TZOA 1OSGA 5CFCB 3O1UA 2J22A 3GDBA 5IJRA 2YC0A 1ZZCA 4Y1YA 4HOOA 2ZX1A 2C26A 2W2IA 1DU3D 1NZIA 4GMP1 3VD9A 2DCJA 5C5TA 3ECQA 4TN7A 1KEXA 2Y6GA 5CFCA 1X7NA 5FYSA 1DLLA 3LCPA 3I4IA 1QNYA 4HLTA 3ZYPA 4XXPA 5F5IA 4YFWA 1AR73 1V6LA 3WCSA 4K1YA 2VMIA 5IFTA 3CL1A 3HR9A 4GA9A 4GWJA 2XWJB 3E6DA 3ABZA 2VOKA 3IDCB 5JWPA 1VBE3 2BTVC 4BCUA 4BQYA 5C3QA 2FDJA 1RUG1 4XCAA 1ENRA 5IAVA 2CGOA 1GUIA 1QJU1 3N36A 3OGVA 2WA3A 2GU9A 3A4UA 4XFAA 4MGKE 5ANNA 4YW6A 2JDPA 4CYDA 4NAMA 4CP9B 4HPKA 4KG8A 4DUXA 2D40A 2PHDA 1S0CA 4Q4X2 1GWKA 2WLQA 3B93A 1OD3A 4IE0A 2ZXQA 2V09A 2ZEZA 2WIIB 2JG9A 1IHMA 4MXVA 1MS8A 4ATFA 1F2NA 3ZYBA 4C91A 3BYWA 5FJKA 4CP9A 2IVIB 3WHTA 2NN8A 5E1RA 1GOHA 1NUKA 3BGAA 4DRVA 4CDWB 1NLRA 4AE2A 3M7AA 4AGGA 1O8PA 1MZFA 3GBGA 2HYXA 3POBA 1H1IA 3ZN4A 1P8JA 2W5FA 3WQBA 2YZ4A 1JI6A 5FMBA 3THTA 1UOJA 1GNZA 2MEV3 1DZRA 5FPZA 4CDWA 1QH7A 5FO7B 1RUH3 5A1LA 1FOD3 2JDUA 3UETA 1PX3A 1PGL2 4YZ1A 2BBVA 4FP3A 1C4RA 4YG0A 5FPVA 1SCSA 2VXJA 5FZIA 1SMVA 4H14A 1WLCA 4Q27A 5TSWA 1V9U1 4XQWA 5FPXA 4CCJA 4NR1A 4CCKA 4X6RB 4OUMA 1LOCA 4MGSA 1PVC2 2VOVA 4LITA 2P3IA 1XJAA 4EQVA 2ZGMA 3RYPA 2FDGA 1UZYA 4COUA 4GJZA 1C8M3 3POJA 1UYPA 1HDKA 4Q4Y3 3USSA 2Y0IA 2LM3A 4HT1T 4XBLA 4YZ5A 1A8MA 4GALA 5IWFA 4JTOA 5FOBB 5JVVA 1AR83 2QDRA 4XEZA 4AQ6A 3ZMOA 5T5LA 4BMEA 2CU5A 3WQ7A 3KF3A 1SBEA 4HSJA 4UFMA 5EHDA 3NNMA 3QACA 3N7MA 4PBOA 2VNVA 3OBAA 2ATFA 1OXCA 4LKSA 5FLJA 1R082 3KF5A 5LASA 3VN4A 5FZGA 2AENA 2YY1A 5FMOL 5FRAA 4LEJA 2D7FA 2WYFA 1NOVA 3AP4A 3FHQA 1KDKA 2VULA 2VQUA 2YUEA 4IV1C 3U4SA 4GH4B 1AYN1 1UL9A 1UU5A 5IK8A 3NNJA 3OCPA 1OT5A 2L9LA 4OHWA 5FXVA 4COWA 5JI9A 4I0WB 4ZS2A 3PUSA 1ZBE1 1AX0A 4E2GA 2ZGOA 1AZDA 2ZS6B 4CU7A 2XJQA 4DNYA 5BNOC 1NQDA 4TZDA 4AW7A 1NT0A 4NIHA 2P17A 2IUWA 4TWTA 2WNVC 1RUF3 5FUNA 1YRZA 4Q0QA 5DAWA 3BPSA 1LECA 4ZZ5A 4XIOA 3GBFA 1JOPA 1EV11 4QQ2A 3AMMA 1EYBA 1QH6A 2VO5A 4RGGA 1R093 2LALA 1BEV2 3T08A 1UIKA 1TME2 3WG1A 2XKOA 1D4M2 2ZZQA 4M0HA 1Q5OA 4YM2A 1AJOA 4CP2A 1WCSA 5ANQA 2FMYA 5FY7A 5A3OA 3IN9A 1AX2A 2GNMA 1BK0A 3TEYA 4R9AA 1ZZ7A 3CBNA 3ZXAC 1X8EA 2Y8KA 4I3PA 4J6GA 3LEKA 2BFUS 1VAVA 3J9SA 4GB32 4NHYA 2V4VA 3E6BA 5DXDA 2WZR1 5DZEA 4FVVA 4AVBA 4OQ8A 2YBSA 1DQ2A 3HWJA 3UJOA 4IEVA 3RZHA 2GC0A 1VRH2 1JTZX 1PO12 3PJYA 4LIVA 4RD7A 4AOCA 1AF9A 5A3TA 4H7MA 5B2GB 3VKLA 2CAUA 1SLAA 1ULEA 4RHV2 5A7OA 3BN6A 2QDNA 4Y1XA 1HN1A 1Y4WA 4A2UA 2XBO1 4CU6A 1YO8A 1E57A 2D6MA 2A70A 4GXLA 1D2SA 2D6KA 5E6HA 4A41A 4CRQA 5BNOA 3V0AB 2Y6KA 3TNPB 1A8DA 2DVFA 1W2AX 3OBRA 4QKFA 5JAXA 2BP6A 5CYYA 1OKQA 5EYYA 2G9ZA 4QD2A 1FPN2 2W94A 3ZKYA 2ZGLA 5DAQA 5KHIA 3A22A 2IXIA 3V0AA 3I3EA 4Q8KA 4XDOA 4KWKA 3WP5A 1UO9A 2DVAA 4CCCA 4AQTA 3O1OA 1O3SA 1V6JA 1JZ5A 4LK6A 4YRDA 1PZ8A 1G8WA 3SITA 1OQ1A 1OPMA 4PIXA 4A3XA 1HB1A 1DQ6A 3PIGA 4C0HA 4IW3A 1MS1A 1W8OA 5GZEA 4IV3B 4QAWA 2WO1A 3KV5A 3RDIA 3VZKA 3NJVA 1ULDA 2WFF2 4FFIA 2RS51 3JD72 4LUMA 4NHLA 4URTA 2BEOA 3VL9A 2EXHA 1MZ5A 2WZ8A 3ZFFC 4CEYB 5A70A 1K5MB 5C3PA 2YDEA 1AR92 3MLJA 2NQYA 4JKMA 3RSJA 3EHKA 5A33A 1RJ8A 4FOVA 4QQHA 5FZEA 4CTEA 4O9EA 1LCLA 1RB8G 4XHBA 3SNMA 2RR11 4CCMA 4JQTA 2R6QA 2W39A 2WZPP 1HN0A 5AC93 3VBOA 1S1AA 2Y6FA 4A3ZA 2YMZA 4YNIA 4ASLA 3HNYM 3AVSA 2HWF2 4BIOA 3AFKA 1OMIA 4XILA 1S2KA 4AEJA 4XOGA 5BNPC 3ENRA 4CCNA 5JMCA 2RS32 2Y6HA 4J1XA 2WWJA 5C8CC 2VVEA 2ZX0A 4JHTA 2QQJA 4PDWB 5GZDA 5F5CA 5LBEA 2V5YA 2R063 4AEMA 1POV3 5A3UA 3H9AA 1FX5A 1YFYA 1VBA1 3I8TA 5EJ3A 1DP0A 3I54A 3I49A 2ARCA 3VD5A 2JX9A 1FMD2 1LHVA 1W9SA 1QHDA 4K7JA 3T4VA 4DY3A 4CEWC 4A7KA 3QD6A 4KU8A 4CVUA 5BXXA 4RQPB 1WCQA 5IT6A 4K9SA 1AR63 2HJIA 4JV4A 4AXOA 3CU7A 4Q8LA 2NLRA 2WS91 4HONA 3TNQA 3AP6A 1HQLA 1C8NA 1XNDA 3I3DA 3U78A 3JBG3 1VBE1 4RQPA 4UW3A 4LKEA 2ZAHA 4NUBA 5FZMA 1D2QA 3H0OA 3D3AA 2FQPA 3MPBA 4IGQA 3I2JA 3TYJA 2RV9A 2DCZA 3O5SA 4RS5B 4WM8B 4LE4A 5EFUA 5C3RA 1XSRA 2HH9A 1MS9A 1ZBA3 1H8TC 3PTRB 4EN9B 2ZGNA 4AFCA 5FY1A 5J37A 1QJY2 1RUJ3 3PL0A 2VQTA 5T5OA 2AH2A 2BVVA 4WM8A 4BM8A 1TEIA 1YIFA 5C8CA 3H1WA 4F7ZA 3WX5A 3T0DA 2IFWA 3HPNA 4GULA 5DDJ3 5BUVA 4AYUA 5FZLA 1QF3A 3IM0A 3OPWA 3T1LA 2HKXA 4Q4V2 1OC1A 3WF2A 1PIV3 2GP3A 2JB4A 3EXUA 3S0MA 3IAPA 1IS6A 5JSOA 1BBT3 3K2OA 2UWCA 2FHRA 3PU8A 4QX0A 5SV5A 4CP0A 5I0SA 5FZ0A 3LPFA 1FOD1 4V1PA 3WF4A 2UY9A 2MPFA 4YW4A 3LDKA 1XYPA 1GKBA 5DPNA 3DPRB 4OHZA 4BE3A 5F3IA 5K0UB 3RZGA 3JQXA 5EWSA 2WNOA 2VNOA 3VKOA 5FYCA 4OLLA 3PURA 5CG9A 4XF9A 3M70A 1LOFC 4MZUA 5CG8A 1QY4A 4RGAA 4MGYE 3WY6A 4AI2A 2GC2A 3DPRA 1W6QB 1CPMA 3VDCA 4Q4W3 3VV1A 1C1LA 2YXSA 1IGOA 1LHNA 1C8M1 1WMFA 2JDMA 4HETA 2PAKA 3GJAA 4NAOA 4QHOA 5L36A 4Q4Y1 1G9FA 2XL9A 4LBMA 4O9GA 3UJQA 1NA1C 4NIAA 3ILFA 3K75B 1S2EA 2BV4A 4W6WA 4UYBA 1AR81 1RGSA 1SHWB 2F4LA 4OVEA 4PI2A 1HXS3 3ZLIA 1PO22 2OW4A 2Y0OA 2HEWF 1XNAA 4YM1A 3O7OA 3O1TA 3GALA 4FPCA 3P5BA 4GQ7A 1HX6A 1XOYA 3FUQA 4OFGA 2JDNA 4WBBA 4XUQA 3OUJA 3THDA 4CP1A 2VM9A 4HXCA 5LCWL 1N3PA 2JDKA 1NG0A 3RG0A 1MS5A 1DGRA 2RHPA 4DXTA 3NAPC 5L9RA 2XHKA 3WP3A 3ZX7A 3WF1A 4RA0A 3UKVA 2YB7A 4NHXA 5A6QA 1GBGA 1VBC3 3K77A 3MLKA 5FZOB 4D94A 5IW0A 5IVYA 2CWSA 2VMEA 4YVWB 5E8AA 3HIFA 4PLOA 1QJX2 5A7WA 3HOBA 3WNXA 1YNAA 2XUMA 2VJXA 1NQJA 3ELNA 5DG2A 2MNGA 1WMDA 3EMRA 4XBNA 2OS2A 1LESA 2A6XA 1QOTA 1MPXA 4XC9A 4YVWA 4FPGA 1W05A 2XDVA 1W99A 3IIAA 4Z2AA 1RHI2 3ZFGB 3KWVA 1UD1A 1R091 5T5JA 1UN1A 4ES8A 4YM3A 1VBD3 4NPLA 5C71A 3AC0A 1YYNA 2E7TA 1G9DA 2VMDA 4BQ5A 1QQP2 4WVVA 3VBSC 2JIJA 3ZFGA 4CDXC 5JIUA 5FPAA 2E6VA 3RZZA 1AJKA 4EYUA 1H4HA 4G4FA 3OG2A 2XXZA 4PIZA 4Z8BA 2QQPA 2ZX2A 3B69A 1NX9A 3E5QA 2XVGA 3THCA 4Z2WA 2TEPA 1EUUA 4I2OA 3LD8A 3WNPA 3KCCA 1O6UA 3WD5A 3L9JT 4WM7C 5HV0A 1RUG3 3KD4A 5F7UA 1HRI3 1QJX1 1CAVA 2XJRA 4UFIA 4CDQC 1XRUA 2LROA 3VBHB 2P37A 1NLSA 1AL0G 1DCSA 4AHXA 3ACGA 3H8OA 3FLTA 5FUPA 5D8AB 3SHRA 2W68A 4LLOA 1GP4A 4M4PA 5F2SA 1E5IA 3GZUC 4QDRA 3VBHA 1ND3B 4ET7A 3R05A 4XXAA 5I93A 2HYKA 2HWB2 3DYOA 5J98B 4ASKA 1OH3A 3ZSMA 5F6LB 3WNMA 1QOOA 4KMQA 3WDXA 1JMUB 2R1BA 3KGLA 1ND3A 3V65A 4JDMA 2TBVA 5K9YA 1G7YA 4IL7A 4NWVA 1GP5A 1Y9MA 1TMF1 4UAPA 5LA2A 3HBZA 1BZWA 5EJ1B 1DGWX 3ZDSA 5CFDB 3FMGA 3VBUC 4UI9L 1A34A 1W0OA 3WDVA 1LEDA 4IGPA 2RDRA 3VGIA 3OOXA 1ZZ9A 1ZRFA 3SC7X 4HVRA 2P3JA 1DYPA 1WWYA 4AQ2A 4B4RA 1YQ5A 1V9U3 1REFA 2W95A 1OLQA 3SCGA 1WD4A 1NE4A 3A21A 4AVVA 2YGMA 4GAZA 2P4EA 1W2OA 4OULA 5LY1A 2DBNA 3EB7A 3FN9A 3I7DA 4KH9A 4XHXA 1RMU1 1X82A 1UKRA 4JRLA 4PQQA 3AB0A 2DUQA 4XTMA 2QZ2A 3UNPA 3HQXA 4EZHA 2ZEWA 2Q1FA 2J7MA 2ZOEB 4R9CA 3VKNA 5AC91 1VMFA 1GMMA 1B35B 3PIJA 3CKHA 1LJ7A 2VZPA 1UY1A 3UGFA 3IDBB 3BOPA 4JX0A 3FFQA 2CGNA 3ZXKA 1K12A 1PNGA 2W91A 2QBXA 4M0NA 1B35A 3H1MA 1XE0A 3LEGA 3WG4A 3ZXLA 2JJ6A 3EO6A 4QPIC 2FDFA 2RM21 3AKRA 3N9OA 1CAUB 4JDOA 1NXD1 1CGPA 2R061 3J4UH 2R30A 2ZACA 2N7GA 3M8LA 1QXJA 1AYN3 4BA6A 5FY4A 5LBCA 3WDYA 3GHMA 5FV3A 4UF0B 1GP6A 2H0BA 1LAJA 3ETPA 2PQQA 3SQOA 1PVC3 2YC2A 1JUHA 3C7GA 1EAH1 3JUUA 4XAAA 1W90A 1QIQA 1CZVA 3C2UA 4P5YA 4W6XA 5K7PA 1IQDC 1PX4A 1XNCA 3ACFA 4NN0A 4UF0A 4W4ZA 1AR61 3F95A 1NY71 5FKCA 3WUDA 4BPZA 3AKPA 1W3XA 3BALA 3IPVB 4G9SB 2QNKA 4QDQA 1SZBA 2YC4A 2CHHA 5FZ8A 2A6WA 4AI3A 4CUCA 2DUOA 3JBG1 1N47A 2W52A 3I3QA 5C3SA 2YFZA 2R072 1YQ8A 3ZIXA 2PHTA 4UW5A 1KS4A 4Z1VA 1OPOA 3LGRA 3IPVA 5LK7B 1OF3A 3OUIA 4XQDA 1R083 2PQSA 1XYOA 3I2DA 4R4XA 1WLWA 1CIYA 4I30A 3O14A 4Y1VA 1Y9GA 3OB8A 1PGW2 4QXKA 4C1WA 1YLLA 3BB6A 3K3NA 2J1SA 1HJFA 1JYCA 5FP7A 2WZR3 1F4HA 5DDJ1 1QJEA 2XLGA 5F39A 1WCUA 3RI9A 5EIYB 2OA2A 4XW3A 4CU8A 2VZ3A 1GR3A 1PIV1 1Z78A 3M2MA 3M3OA 2WO7A 3VDDC 3ST7A 1V6IA 1NAEA 5DUWA 5LATA 2B7YA 1ZZ6A 1BBT1 5HBAA 3VHNA 3UGHA 4Q1PA 1TVGA 5HCAA 4H2AA 1F35A 3RJ2X 2W87A 1F31A 2IXJA 3VKMA 3ZO0B 3MIGA 3BVCA 1MR5A 5GKAC 2D6PA 2JD9A 4DRRA 5JSRA 2AZ5A 4S2HA 4Y22B 2FCUA 4M3CA 4YWAA 3BTAA 2JKXA 1J84A 2JG8C 3A7QA 1XXNA 3B7MA 3DYMA 2X10A 1DGLA 1S0IA 5C6CA 2BVBA 4K40A 5APAA 3WP6A 1Q8PA 5KBFA 4Y22A 4GB33 1U5IA 2C9KA 2PAEA 4LOSA 4F83A 1UZ0A 2AUYA 4AHYA 2IXKA 2XQXA 2HWE2 3A23A 1RUE2 4E2SA 4XFBA 4DPNA 1HXS1 2WQZC 1IOAA 4OCTA 4YVSC 3HT2A 1PM4A 2JE8A 2RS53 1O3TA 4CZSA 4JGZC 4RHV3 5GZFA 3SKJE 4DMIA 2E33A 5C9AB 1Y43B 3MIDA 5D21A 4IE6A 1QWRA 2VZSA 4YLZA 5F3EA 2A7AA 5EJZB 4RFRB 2V72A 1Q56A 2P6CA 3TN92 2VBPA 2W08A 5C9AA 2RR13 1S0DA 2PLV2 4HVQA 3I2IA 5I8YA 1FPN3 2R042 4CUBA 1VBC1 2D97A 2D3RA 4TSVA 4IESA 1MZ6A 4CDUA 3ZMNA 1O3RA 3MF9A 4Y5Z0 3LIHA 4CUGA 4N43B 3DXUA 5JIAA 2F6BA 5I0TA 1I3HA 4FPJA 2CV6A 1QEXA 4AFBA 2YU2A 3VBRB 1WGPA 2YFUA 2G19A 2ZHMA 3RWNA 1ODNA 2X5IB 1ND2C 3MIHA 2BGOA 4GKXA 3HEIA 2AYHA 4B7KA 3BCWA 1WUVA 4FCAA 1XNTA 4P00B 3KT7A 3VBRA 4AI9A 2FDHA 1N1YA 5FZ3A 1JZ6A 1MS4A 3FJSA 1LRHA 2GNDA 3O0XA 5FK7A 1VBA3 1DG6A 1W9YA 2X5IA 2WFF3 1ACCA 1VBD1 2RS11 2BERA 3JD73 3WDWA 1GLHA 1O8SA 1HLCA 4YVSA 4CPBA 1RL3A 4RGKA 3PLQA 5FYVA 2BU9A 1H30A 3AM2A 4Q1RA 2ZBJA 3PVBB 3I3MA 3OGGA 2XPJA 2CNAA 5AVPA 4ZY9A 4HK8A 3DYPA 5AFBA 1OLME 2CWMA 2Y64A 2WBKA 3J7LA 4IQPA 4DZGA 4ZU7A 1XC6A 2JENA 3B01A 4JC1A 5KXBA 5GJ6A 5L9VA 2WS93 3W59A 1ZA4A 2OPKA 4Q0PA 4B8EA 3EBRA 1ODMA 1YFXA 3OYWB 5J36A 3D6EA 3CZJA 2QQUA 4HPKB 4ARXA 5CBLA 3LSDA 1BMV1 5JDBA 1TE1B 4PCRA 3I97A 2HWF3 5KC5A 5FZ7A 3ATGA 1HRI1 2VCAA 2JG9B 3JQWA 3OYWA 4WV8A 4DINB 3P3PA 1H2MA 1PVXA 1DZTA 1SFYA 2WSVA 4XBQA 1FXZA 4LLFA 4RN5A 4XF3A 3D0JA 2RS33 3IAQA 4MADA 5J7MA 3AMPA 5FO8B 4OHVA 4XIKA 5A3PA 2B9UA 2WAOA 2ET7A 1YFUA 3MICA 3O1PA 1SFPA 3FLRA 4GWNA 2C6SA 2W9XA 1DIWA 1FMD3 1JU4A 3LA2A 1VJ2A 4XE9A 4XTPA 5C3OA 4LULA 1IG3A 3LZZA 3T3YA 3JZVA 2VCMA 3FE5A 4MXWB 1J83A 1CJDA 4AVCA 3ACIA 4MVTA 4LIUA 1I9RA 1MACA 4UBGA 5D1IA 5A7QA 2RMU2 4XACA 2WNEA 5LK5A 4Y5TA 3RRDA 3ES1A 2G1MA 4PT6A 4AI8A 1JHNA 5JSPA 1LOBA 5IAXA 1LTEA 3KV6A 4MXWA 1FV3A 4NO4A 1HRV2 4FOWA 1C5IA 4W65A 2E26A 1PNFA 3BI3A 2GSYA 3AVRA 4N7UA 3MF6A 2ARAA 2BRTA 2Z4FA 3H8UA 4Q4X1 3WEZA 3CJXA 2PELA 1EPZA 3R4SA 2O8OA 3WLUA 1RUD2 1ASJ2 1QJY3 2FCTA 2WL1A 5L9BA 3N35A 1W2NA 1N3OA 1D0HA 3Q8EA 3LPGA 1R1A2 2R7EB 4YG6A 3U75A 1UW8A 2AC1A 3LQCA 1H6YA 2GNTA 5FAXA 3RJRA 2VG9A 2WDBA 4C8DA 2Q1ZB 5C70A 1RUNA 4NJ4A 4RR3C 2Q0AA 3H42B 3EYPA 4FTSA 1LENA 5A32A 4XFCA 5T50A 4GH4C 4N9IA 4KWUA 5F5QA 1GZ9A 4XDQA 2PYTA 1O5LA 4N8MA 5LY2A 4N7IA 2HWD2 3MPPG 4HSLA 1SLTA 4L92A 3NL1A 3HNMA 3GM8A 4C90A 1PGL1 1AHSA 3NRUA 3ZR5A 4OI0A 2VOWA 5FP4A 1V70A 1YQ2A 2ZABA 4EN6B 4LBOA 1KJRA 1W9FA 1VE0A 4QXCA 2WN3A 1PVC1 2J1AA 4QQPA 1XSQA 3ZYFA 1UZVA 5HCHA 4L97A 1WZXA 4KI5M 4JAAA 3OGSA 3ETQA 4QKBA 3I2FA 2ZGPA 4EJRA 3BODA 5CA6A 5FXWA 3KVBA 4XPVA 5FP8A 1YQCA 1O91A 1AL22 2JIGA 3ZVXA 3WR0A 4IEQA 2CTVA 4MGTA 1MEC2 3DEMA 3WVJA 1LODA 3BIWE 4XYXA 1X33A 4AVAA 3QCWA 1RINA 1PO23 1YHFA 2O0OA 5AFEA 1AXYA 2ZPXA 4E4ZA 1OA2A 5FPUA 4CCEA 4LNVA 1R081 1VBB2 2XONA 3CIHA 1OHFA 2RJKA 4IV1B 3P3NA 5FYIA 3D82A 5E89A 2D43A 2QQIA 4JGYC 3KB5A 1X9TA 1ZNPA 4BQ1A 3MIFA 4LORA 1RTVA 5CNAA 4NPMA 3SEEA 3C7EA 2XLFA 2OPWA 4IV1A 1L7QA 3SH4A 1A78A 5BNOB 1CPNA 1OKOA 4FOYA 1ULCA 4Q0UA 2VMGA 1QJX3 2WNVB 5FZ1A 4AVTA 3HMYA 4ITCA 1LGNA 3P1IA 2KA3A 1IPKA 3KV9A 2EIEA 2ZX4A 2JE9A 1K5JA 4JDNA 4ARYA 1W0PA 3LKJA 4DUWA 2WNVA 1J59A 2DU0A 4XMIA 3H50A 4FBFA 4ISRA 3BKZA 1RHI3 4V2VA 3N7LA 1PK6C 1SFNA 1VB2A 1BEV1 2GDFA 2Q1MA 3MEPA 3VHOA 4OHYA 3S57A 1TME1 4NMIA 3WNNA 1PMIA 1D4M1 4DUVA 4LTAA 4IV3C 1VPHA 3AZVA 3PNAA 3UYJA 1SLIA 5T3NA 1QMJA 5F3GA 3KQRA 1W6MB 1URXA 3BU7A 2ARBA 5FUIA 3SEPA 1TMF3 2A1XA 1COV2 4KBZA 1SBFA 4M4RA 4GB31 1GOGA 2F17A 5FYMA 3URFA 3K51A 1GWLA 4NPRA 5ACA2 2EALA 2D6OX 2ZGSA 4L99A 1W6MA 3AKTA 1VRH1 1XB9A 5A33B 1PO11 3KVAA 2V4AA 2GC1A 2OX0A 3Q8FA 3KLSA 1F5JA 2XVKA 5KXEA 2C5DA 1W28A 4BQXA 2A5ZA 4RHV1 2D5HA 1NLQA 4UXAA 1H1MA 4FPLA 1U12A 4DEVA 3WQ0A 2QZ3A 4UBHA 3POFA 3OJBA 4E4SA 1CONA 3VZMA 1ULGA 2NM1A 3VBOB 3VBFC 2JDZA 3VUOA 5T54A 1RMU3 1J58A 1EPWA 4AQSA 4D69A 3R4DB 5BNQA 2B39A 1UOBA 4OMDA 3S7EA 1RUI2 2GAUA 1S4CA 3U4XA 4CCOA 1FPN1 1CJPA 3KHBA 2HWB3 4LKFA 4Y4YA 1UX7A 1AYM2 3UGGA 3UK9A 3RQ0A 4AHWA 2UYBA 4HBNA 4AFMA 2WLPA 3BOWA 3LSEA 3DN7A 4NIIA 5I0RA 3ZYGA 4BDVB 5FMOS 4X6QB 1H9WA 1F4AA 3KSCA 2R0HA 4IE7A 1BXHA 2EICA 3HQUA 2XJVA 1XNBA 5L7OC 4JQRA 5EP9A 3ZSKA 2DBIA 5HCBA 2V5DA 4S2FA 2RM23 1AR72 1AUYA 2OYZA 5ACA1 2YHJA 4MO3M 2WQ4A 4XF1A 4JHZA 4NVPA 3ZFFB 3AKQA 4EN7B 2WFF1 3JD71 4EZ4A 4YW2A 5LA9A 1ONAA 5LRRA 1NXMA 4AF9A 3TRSB 1OH4A 1UOGA 1AR91 1NCQC 2WA4A 3ZFFA 3ZXJA 1A3KA 1EAH3 4LR4A 3NVCA 3B5LB 4BISA 2EXJA 2J1TA 3VD7A 1OF4A 2GN3A 4WVZA 3C7FA 5K8SA 1OUXA 3KGZA 3Q8AA 4BLJA 5A3WA 5FZHA 1JU3A 5LBBA 3V56A 3I2GA 4META 2VU9A 5FCCA 2QCSB 3T2QA 5FR3A 2HWF1 3A0KA 4ZZ8A 5KC6A 1RIRA 3IKWA 5BNPB 4AEDC 4QB2A 2E63A 1UMIA 4B1LA 4WZCA 5F3CA 2FBEA 1JS9A 2ZHNA 4QQOA 4L0PA 5C8CB 1BQPA 2PAMA 2Y60A 4HN1A 3TOJA 4GJYA 2RS31 1J3PA 1EY2A 5L7OA 3JXSA 2C1FA 3MHZA 4ONUA 4LPLA 4YFZA 1YI7A 5FY0A 5BNPA 4Y24A 3OGRA 3KM5A 3FBYA 4L2NA 4G3YC 5G05L 5GLWA 1LB2A 1WCDJ 2MEV2 1S55A 1ZRRA 4UOJA 5BPXA 4CEWB 2BWAA 3OD4A 1CD3G 1RUH2 1YEWA 3ACHA 3GNEA 3GHNA 3K46A 1FMD1 1VAKA 4J25A 2BQPA 4IUGA 4EWDA 1XYNA 4LO7A 3JB8A 2R49A 1VR3A 1WMXA 4K20A 2YU1A 4JZRA 2WR9A 5KHHA 1DQ4A 4Q26A 1J1TA 1YJKA 2B42B 4ZU4A 4CEWA 3OD0A 4YW5A 3RNSA 4LOTA 5LWBA 3SMHA 3U10A 4LKDA 4QQLA 4BLIA 1W2TA 2J1UA 5LRSA 3AL5A 2BZDA 4LHLA 2BOJA 1DF0A 2DFBA 5FTTC 2J42A 2QQKA 3JB4C 4CCDA 4R9DA 5KR7A 3DKWA 2ZKNA 5FLIA 4Z92B 3T1MA 1VMHA 2GP5A 5JXHA 5C33A 5A6YA 3AP9A 1MVQA 3E6CC 2RDQA 2KR2A 5A6ZA 1OFSA 1Y3TA 3HN3A 4ZU5A 5LEJA 3DECA 3NNLA 3VLBB 1KRIA 4AEDA 1W6OB 3U14A 1L7RA 3VZNA 1QJY1 4XUPA 1UCXA 1UKGA 3W5MA 2BJSA 2VZOA 1NCRC 1H8TA 1RUOA 1HB3A 1UY4A 1U5ZA 5CEHA 4D7YA 1RVF2 4QB1A 3AP5A 4FP2A 5HI0A 1YQ6A 4Z82A 4LBKA 1W6OA 2Y6LA 4KGQA 1W8NA 3ZYJB 2ZCWA 2XH6A 3FBMA 3GCWA 3KQ4B 2XKPA 1F5FA 4P9GA 1QGLA 4Y1UA 5C4WC 3I2OA 1DBNA 3LB9A 2K0GA 1TG7A 2DDUA 2VCCA 4Q4V1 3DKQA 3U37A 5CADA 4NIGA 3BU0A 2KD7A 1GFF2 1V6KA 4TLGA 5CKNA 2P1BA 3K48A 2BW8A 1OOPC 1RUF2 3LE0A 5A7WB 1W8HA 1IS4A 3J8F2 3EQEA 2IFRA 3ASIA 4YW1A 1S2BA 2EAKA 4XVHA 2CY6A 2XLAA 3U11A 2DU1A 2DUPA 4DXZA 1BVP1 4C0BA 1YCIA 2YGLA 5E16A 1W39A 2IXHA 3T0AA 4BQ3A 4KBBA 4BH9A 5IVBA 1LOFA 2ZX3A 2HBTA 1NA1B 1RUC2 2ORZA 1SBDA 1WD3A 2VMCA 3NKGA 4YGBA 5FIXA 5CAZA 2UWAA 3CF6E 4CXWA 2W92A 4FQZA 4XQ4A 4RFT0 3C7OA 4YGDA 1T2XA 1RUE3 2AACA 5GLVA 3W58A 2YROA 4A6SA 4XF4A 5F2WA 3E5XA 1IS5A 1NA1A 1PO21 3LDRA 3AXDA 3MYXA 3MW3A 2RS13 2ADEA 2Z2SB 5JZGC 2PA7A 2ZHKA 4URAA 4BWOA 4ZS3A 5DMYA 2W0XA 4EV0A 3NAPB 2BYVE 5BYNA 3H8RA 2Q5TA 1KQRA 2QQLA 1ZX5A 1OQEA 2B46X 5A1FA 3DUIA 1OA3A 3M3QA 3TN93 4FXGB 4DFSA 3UKNA 4IEPA 3X29B 3D4KA 3ZR6A 3WF0A 1CAVB 1UYXA 2PLV3 1DYOA 3NAPA 1LOEA 2BNOA 2WWSA 1J3RA 1STMA 4XZPA 2E9QA 2EIGA 4IXLA 2WKKA 5D8AC 4LJHA 5I8SA 5F37A 3GF6A 3GGLA 3VZOA 3PTYA 2WZEA 3UESA 1H2KA 1ZA7A 4NOTA 2AEYA 2ETEA 3ZXGA 1MZEA 1WCKA 2AR6A 2O14A 3MLLA 2WSUA 1UNBA 4LQRA 3DGTA 1MQTC 3WNOA 1RHI1 5FBJA 4ZONA 5DQ0A 5FYUA 2EA7A 4PBPA 2YBPA 1V6MA 1O5UA 1KXGA 5IVVA 4CDXB 1QQP1 1HW5A 2LTNA 1JBCA 1GNHA 1VIWB 5JZGA 1JYVA 1T6BX 1UAIA 3T2OA 5K4LA 3UV9A 4F3JA 3J7MA 2ZA9A 5AVAA 3VBSA 3WDTA 1OD5A 2X09A 5KXDA 3H3ZA 2VC9A 4CDXA 3PVNA 4YGCA 1GYKA 4AAXA 4BYYA 1KD7A 5LZ6A 4WM7B 5IK4A 3CJIC 2XJPA 1CQ9A 1NYWA 2X53S 4CDQB 3ZSJA 3AX4A 4BQWA 3MFCA 4R52A 2OQ7A 3IDEA 4L9BA 4QB6A 1LKNA 4WVMA 4WM7A 2O1QA 1WMEA 4Q4X3 1JN2P 2A6YA 4FFGA 4CDQA 1T6GC 1PMJX 4KU7A 5IVFA 2R1DA 2WO2A 3NV3A 3C3VA 3EJKA 4LXLA 4BB3A 1WLTA 3N7KA 4IEUA 4IEZA 4H7LA 2HWB1 5JR2A 3K4AA 3Q9OA 5BNNC 1W8WA 4BQ4A 1MS3A 3R0RA 3VHRA 3AJYA 4IETA 1HB2A 4FPEA 1C3HA 3F2ZA 1POQA 2DFCA 2VQAA 2Q8DA 3VBUB 2ZMKA 3MUY1 3FHIB 4AFAA 4COVA 3NJZA 5J09A 2Y6JA 5GLUA 1JOBA 2RMU3 3OEBA 1ZVFA 4W8JA 2MHFA 5FZCA 2ZGTA 2W1QA 3RZLA 2RVAA 3T09A 4O65A 4M3CF 2VR4A 3QBQA 4LO4B 3SXWA 3VBUA 1GSLA 2AREA 3ZIWA 5A7NA 5JOXA 2I74A 3OTFA 5HXMA 4JVAA 2FD8A 5IVJA 2IZWA 5F1RA 5FBZA 3RFRA 2Q4SA 4Y5SA 3D8CA 4AI1A 2DV9A 4QGNA 2EAAA 5EYXA 5DZFA 4KGGA 1RUD3 1ASJ3 4XF0A 2LUWA 2VZTA 3RMXA 4COZA 1ZREA 2WAAA 1ZBA2 1XBFA 3FWEA 3JU9A 1JOJA 1Q8QA 4OQ9A 2GH8A 1W8TA 2ZMNA 1RUJ2 4FTEA 3HJRA 1W8UA 5ABJC 3LA3A 4MGIE 1VP6A 3U1XA 3MZHA 3UL2A 4B29A 3MO4A 3A0NA 5BNNA 2ZGKA 2XVLA 4CE8A 5JOZA 3VDBA 5FLHA 4QPIB 1LHOA 2RJ2A 2VTFA 3AYCA 4AR2A 5T5PA 4XUNA 4HG6B 3WF3A 4I0BA 2W46A 4HN0A 4YG3A 2JDHA 2VTXA 4OZXA 3TEWA 1LEMA 1DQ5A 4QPIA 4QKNA 4E9KA 3MBWA 3H3UA 2Z79A 1C57A 3JCIA 2C4XA 1WBFA 3NSTA 1JZ8A 3PMEA 2K2SA 1B09A 1Z7S2 3J7HA 4FFHA 3NO8A 1V00A 3INAA 4Z07A 3ZFEC 4EE2A 4CCLA 3VB9A 1F8VA 1J1LA 1CVNA 5T52A 2C0ZA 4W50A 5IFPA 1W8ZA 4ORFA 1IS3A 4D6SA 2VW0A 4HKLA 3LEMA 3DV8A 1TNFA 4FT8A 2CL2A 4OMCA 4F8AA 1AL23 4PLNA 1UYZA 4OHXA 3THPA 1CZTA 1MEC3 3MW2A 4I02A 4M3CB 3AFGA 5JUVA 2R071 2RDNA 3FUOA 3FZ3A 2CYFA 3MGUA 3MUZ1 1HV0A 3L2YA 5FYTA 1BEV3 3PUIA 4MGZE 5J48A 3B02A 2GN7A 1TME3 4FPYA 1D4M3 2CAVA 2OQ6A 4N90A 5CKQA 4ASMB 4A6OA 5FYHA 4AI0A 3AMQA 2EVXA 3ZDVA 2ZGRA 4QPGC 3GBWA 5FYZA 2XR4A 3CNAA 1PGW1 2A73B 4I09A 5FXXA 1LNSA 1Y7BA 4NIDA 1LGBA 5C5UA 3UT0A 4XJ8A 4A7YA 1EP0A 2XGXA 5LBFA 3T30A 4QX8A 1BJQA 4QHBA 4YZ4A 5I91A 1WW4A 1VRH3 3ZN6B 1PO13 2J1VA 3MV01 3OF1A 1UZZA 1W2UA 3POSA 4N53C 5FZFA 3PU3A 4YPJA 5SV8A 3VDDB 3VD4A 3APBA 4E4DX 5FZBA 5JCTA 3ZFEA 3TEZA 3AKSA 2WNUC 2QQVA 3HNBM 3OBTA 4UFLA 3W9AA 3CDZB 3ZN6A 5DAPA 5F6KA 5FPLA 4CDUB 3MI8A 3VDDA 1YUDA 2QTWB 2WC2A 4QMAA 1ST8A 1UPSA 1X36A 4OI4A 2Q8CA 4QX3A 3ZXEA 3NQHA 4BXSV 4UW4A 3QH6A 4E8DA 1FATA 3NJYA 2JG8B 3ZXFA 5CFCC 1N1VA 5FK8A 2PHLA 1FYUA 3FL7A 4DXRA 3TWIA 2VMFA 2QKDA 3H3LA 2A3XA 2C9AA 2Z69A 4V2WA 5HCFA 4AVSA 5LEKA 1UXXX 4Y33A 3D0SA 3ES4A 4MUVA 4P9WA 1COV3 4TXWA 1LULA 4LA2A 2JG8A 2BGCA 4QPGA 1E5HA 2OUHA 4U2AA 4LT5A 1XNKA 4EROA 1QJZA 4MGQA 4YVSB 1UMZA 5ACA3 2HWE1 2VW1A 1OVSA 1RUE1 4IDZA 3OUHA 4LBJA 1UMHA 1Z0HA 4FPHA 4JGZB 4QM8A 4QX1A 5FY5A 5JR7B 4AFDA 5C7GA 4W6YA 4FI9A 5KHGA 2XJUA 4HANA 5A80A 1OLRA 4NRPA 1KFUL 2ENRA 1AR93 3N9LA 4LE3A 5CZKA 5FP9A 4JGZA 4JKLA 5JXJA 2RDSA 1QJU2 4DO0A 2A3YA 2QQMA 1IZ3A 1S0GA 3AK0A 3QLQA 3TN91 1XQNA 2JG9C 1W9WA 3OBZA 4Q0VA 3R4UA 4B4PA 5JOWA 1OA4A 1RUI3 2PLV1 4X8PA 1KDMA 4LUKA 1DGRN 1MVEA 2PTMA 2R041 1AYM3 1PM7A 4GIQA 3T4HB 2P3KA 2VBDA 1JYWA 4MHRA 4BU2A 2UU8A 3WSOA 3J7NA 4WZFA 1GZTA 5JI7A 1ND2B 3NJXA 3W20A 3U0ZA 4XJUA 4K8RB 4M3CE 4NRQA 4P9LA 4XETA 3SH3A 3WG3A 4YGEA 4BXFA 1JZ7A 2BDRA 4IGOA 3POIA 4CDWC 4QPYA 4AK3A 1G9AA 1ND2A 4O7XA 1C28A 1Y9QA 4L11A 4P9JA 1D4VB 2P2KA 2VMHA 2WT2A 3AXEA 3OEAA 4XJAA 2BGPA 1PZ7A 4JCKA 4M00A 2W1SA 1LOAA 1ULOA 2BFUL 1KITA 3FLPA 4ZXEA 1SG3A 3GJBA 1FT9A 1V9U2 4EWEA 4BZ4A 2DTYA 5DABA 3ZOIA 4UT5A 2WYSA 3DCQA 1YFWA 2BNMA 3AZZA 3OSDA 2FMDA 2D5FA 4DY5A 3ZYHA 1XE7A 2WWUA 4H55A 1O4TA 2E7AA 4A45A 5ERLA 1I5PA 1E5SA 2ID4A 3Q8CA 5DUUA 2X05A 1REEA 3O0VA 3IDAA 5FREA 1G9CA 1QJFA 3VZLA 4NRMA 2NMOA 3QOPA 4MHUA 4S2DA 1GQPA 1XU2A 1UPIA 3RS6A 2GNBA 2VL4A 2ZGQA 4QX5A 2VGDA 2FDIA 1CX1A 2ADDA 1H9PA 5HV4A 5A32B 3FHAA 5FZ4A 2VUAA 1AXKA 1YIPA 1AYN2 3Q8BA 4KNCA 1O59A 1O4ZA 2R32A 2B4KA 4Q4V3 2XOMA 4BHPA 4HMZA 3ORJA 4ZPIA 2BNNA 2QFEA 4IE4A 3W21A 3BTZA 2P34A 5IUQA 3GCXA 2RMU1 1AXZA 1WW5A 1ZBE2 3H7JA 4PHZA 4GWMA 3IMMA 2PXJA 1H6XA 3K4DA 5I0DA 5FMDA 3M3EA 2VY0A 4E4HA 1CESA 1HRV1 1DGWA 1HIXA 3O0WA 5DUXA 1C5HA 2Z5WA 3K4ZA 4XCBA 5LA1A 1N1SA 1SACA 2ET1A 3GYDA 4QDSA 2ARXA 5GLTA 4K3UA 3HD8B 1N3QA 2VVDA 4IEYA 1EV12 3RZJA 3VL8A 2ILMA 2PHRA 2OIIA 3CZUA 5ISLA 3UKTA 1PGSA 5HPOA 3RYKA 2HWC2 1RUD1 1ASJ1 1VMJA 3FX3A 4QGMA 2QUOA 5FP3A 1QKQA 5J3UA 1BKZA 1R1A1 4RL7A 5A3NA 5EXOA 2FCVA 1RVF3 2EIDA 4RR3B 3WNKA 5FDBA 5B4NA 3W5NA 3SH5A 2W47A 5EPAA 1CZSA 1US2A 3MW4A 4GWIA 1FNZA 3WT3A 2WZR2 3LF7A 3ALQA 1ZYBA 4FO9A 2VTXJ 4RR3A 3WXPA 1SLLA 3MIBA 4QT6A 2GMPA 2H6CA 4COYA 1AX1A 2HWD1 2Y34A 3NNGA 4GH4A 2GMEA 1V6NA 1IKPA 1OBNA 2VZ1A 3PUQA 3I3BA 2Y26A 1SEFA 1JYIA 3HN1A 5H9PA 2XBO2 2VD7A 4YZ2A 1SDDB 2VVFA 3ZM8A 1BCXA 3WW2A 5E88A 2VAUA 3ME2A 1I1EA 1X50A 2ZMLA 3J8F3 2UURA 3TEXA 1W6NB 3E97A 5BV6A 3TAYA 2ZKLA 3FC0A 4ATEA 2VZRA 2SBAA 4QXBA 4XAEA 4LBLA 3I2HA 5CKMA 3AZXA 1J3QA 3ZPOA 4CU9A 4OZOA 4FAHA 1HKDA 2NP0A 2WFPA 3KT4A 1Q43A 5FJHA 2HWC1 1W6NA 5CISA 3H1YA 3KV4A 3ACLA 1JZ2A 1RUC3 4XMAA 1VAMA 2A6ZA 3NKTA 5FZKA 2Y33A 3L2HA 1TQ5A 1AL21 5A3LA 3CEWA 2VZUA 3OY8B 5GALA 4HKWA 1MEC1 4KWJA 2UYAA 3POYA 4XFGA 1H1AA 4INDA 5IVEA 4TTGA 2HEVF 5FZAA 4GD4A 3WG2A 4AL9A 2JEMA 3C8XA 3ZYRA 2XB6C 1OQDA 3N4MA 4D7SA 3OY8A 4P02B 2RE9A 4JGYB 1IG0A 1QQP3 1VBB1 2IWGB 3DL3A 4Q2FA 4KQ7A 1APNA 2RS52 4MG2A 1UWWA 5DZGA 3DF0A 2J1RA 1GZWB 2OZJA 2X8KA 4O61A 2JICA 2CSGA 2EF6A 2X29A 4P14A 1W3VA 3ILRA 5EV7A 5F32A 2B9VA 2WT1A 1K5MC 4JGYA 4CEYC 4FSJA 1C1FA 4K6BA 1W0NA 2QE3A 2VW2A 3WNLA 3O1RA 3AYAA 1DQ1A 1SLBA 3VBOC 2RR12 1GZWA 2ZEXA 4FXKB 2D93A 3CMGA 2DTWA 5JLVA 2EXKA 5IVCA 4E2QA 3NW4A 4P9IA 2VUDA 2CDOA 3VKFC 5H9QA 4QX7A 3RPQA 1ZZ8A 3PJQA 4XJWA 3O12A 1F15A 2ZJCA 1GOFA 1PK6B 3AYDA 2H0VA 5IYYA 4D3WA 5FQ0B 3IMNA 1GANA 1R64A 1SLCA 2AEZA 3VD3A 2R16A 4B7EA 2KM2A 4TLFA 2EXIA 1QU0A 5JPMB 2VZQA 3BUCA 4LHSA 3SKVA 4PDWC 1PK6A 1UOFA 1VBA2 5F9TA 3KT1A 2XMLA 3CQOA 3PUHA 4P9YA 4YSFA 5FQ0A 1XE8A 2BUKA
chains in the Genus database with same CATH topology
4LK7A 1UOJA 2O14A 1WMXA 3F95A 4LKEA 4YWAA 4YW6A 3ZYFA 4BQ5A 4CPBD 1GWMA 1WZXA 4CP9B 3ZYHA 1W8TA 4AL9A 2LRPA 1WCUA 4LKDA 1GWKA 2JWPA 1W8UA 2VXJA 4LK6A 2C24A 4CPBA 1OH3A 3ORJA 4BQ3A 3ZYBA 4YW7A 4BQ2A 1W8ZA 4CP9A 1V0AA 3UT0A 1HN0A 1OKOA 4LKFA 2WYFA 2K46A 2Q1FA 1GWLA 4LJHA 2KR2A 4A6SA 2LROA 1W8WA 1W90A 4BQ4A 5D21A 1L7LA 1W9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK7 A;  1UOJ A;  2O14 A;  1WMX A;  3F95 A;  4LKE A;  4YWA A;  4YW6 A;  3ZYF A;  4BQ5 A;  4CPB D;  1GWM A;  1WZX A;  4CP9 B;  3ZYH A;  1W8T A;  4AL9 A;  2LRP A;  1WCU A;  4LKD A;  1GWK A;  2JWP A;  1W8U A;  2VXJ A;  4LK6 A;  2C24 A;  4CPB A;  1OH3 A;  3ORJ A;  4BQ3 A;  3ZYB A;  4YW7 A;  4BQ2 A;  1W8Z A;  4CP9 A;  1V0A A;  3UT0 A;  1HN0 A;  1OKO A;  4LKF A;  2WYF A;  2K46 A;  2Q1F A;  1GWL A;  4LJH A;  2KR2 A;  4A6S A;  2LRO A;  1W8W A;  1W90 A;  4BQ4 A;  5D21 A;  1L7L A;  1W9F A; 
#chains in the Genus database with same CATH topology
 5F8P A;  4IV3 A;  5KHJ A;  1DLC A;  1R1Z A;  1COV 1;  4XFH A;  1LGC A;  4LMF A;  4HVO A;  3AZW A;  1FAY A;  3OGJ A;  4PIY A;  4AHZ A;  1JOD A;  4IE5 A;  4CEY A;  3MV1 1;  4RQP C;  4Q0S A;  1K5M A;  1UZW A;  1W9T A;  2A75 A;  2WS9 2;  4R9B A;  2B5H A;  4LA3 A;  5FKB A;  4QWN A;  4DXS A;  1VBE 2;  1BVV A;  1UY0 A;  2K46 A;  3VBF B;  2VZV A;  1CAX B;  1NZC A;  3WW4 A;  5KHK A;  2O8Q A;  1JXN A;  2QVS B;  1DZQ A;  2VPV A;  1D7P M;  1JH5 A;  5BY5 A;  3WW1 A;  4OYU A;  4WM8 C;  3ZPY A;  4RS5 C;  1WA6 X;  3VBF A;  1RUI 1;  4LBQ D;  1CAX A;  3HVD A;  1AYM 1;  2XHN A;  4A4A A;  1QNW A;  2VNG A;  1UX6 A;  4XJZ A;  1VAL A;  2TUN A;  4BK5 A;  3ZYI B;  4FFF A;  5L7O B;  3I59 B;  4D8M A;  1DFQ A;  2ZGU A;  4Y1Z A;  3GXU A;  4PDW A;  1JYT A;  2I45 A;  2XUE A;  1LHU A;  1PZ9 A;  4AWD A;  2A6V A;  4X8N A;  1AR7 1;  3I59 A;  3LEI A;  2E32 A;  2J1E A;  2ZAA A;  5DN2 A;  2P5B A;  4JRA A;  1HV1 A;  1ALY A;  4CUA A;  5M0T A;  1HB4 A;  1AVB A;  4L8Q A;  3IT8 A;  1NCQ B;  1FOD 2;  1W6P B;  2GZW A;  3WIN E;  4C1X A;  4DS0 A;  1LHW A;  3USU B;  4N9H A;  1JHJ A;  2YV8 A;  4ES9 A;  3RYR A;  4RSU A;  4UWD A;  3NV1 A;  1H0B A;  3M3I A;  3DPR C;  5K0U C;  3POE A;  5J1X A;  1NCQ A;  1W6P A;  3CHX A;  5HXV A;  3AL6 A;  1RC6 A;  3USU A;  4FTB A;  3N7J A;  4NHK A;  5IK5 A;  3ILN A;  2JXA A;  1C8M 2;  4PQ9 A;  2WJS A;  4SBV A;  2Y38 A;  1KS5 A;  2UWB A;  2R07 3;  2OUJ A;  4Q4Y 2;  4RS5 A;  2IXL A;  4AED B;  5CIR A;  3ITQ A;  4PF1 A;  1JUI A;  1UY2 A;  1ENQ A;  1H8T B;  3AMN A;  1AR8 2;  2QQW A;  4YW3 A;  4A7Z A;  1CR7 A;  2LS6 A;  3KS7 A;  3IZO A;  2CGP A;  4AGR A;  2VUC A;  5A7P A;  1CAW B;  1YJL A;  3NV4 A;  2E53 A;  2PN5 A;  2K9Z A;  1HQN A;  1OUS A;  2ZTN A;  5DAV A;  3ROU A;  4PJY A;  5J96 B;  3PVO A;  4P08 A;  4Y26 A;  3RZM A;  4NWW A;  1VRB A;  2NYY A;  2MEV 1;  2VUJ A;  1N1T A;  5FZ6 A;  2PHW A;  4ISQ A;  1QDO A;  2DCK A;  4QHZ A;  5A6X A;  1ENX A;  1RUH 1;  1ENS A;  5G04 L;  4DOU A;  5A3M A;  4B1M A;  1CAW A;  1IQA A;  1UQX A;  1RYY A;  1Z7S 3;  4FOQ A;  1YI9 A;  1BK1 A;  4AAP A;  1GZC A;  1WW7 A;  1CN1 A;  5FOJ B;  3H8X A;  4YZ3 A;  4D0Q A;  4QU2 A;  5D2A A;  4NHM A;  4LBN A;  1Q8O A;  3G7D A;  3TB0 A;  5CU1 A;  3O1M A;  3R6S A;  1HQW A;  1UU4 A;  2JD4 A;  5JXI A;  5K0U A;  2D44 A;  2D98 A;  4YVW C;  5A1A A;  2VNR A;  4FQ4 A;  4IEO A;  4HL0 A;  1GWM A;  4LHN A;  4WVW A;  4XAB A;  2YPD A;  4I01 A;  1DHK B;  4R8H A;  4D6Q A;  4R4Z A;  1G86 A;  1W6Q A;  4IEW A;  5FPB A;  2HBU A;  1CWP A;  4B3N A;  3PMS A;  1R09 2;  4HK9 A;  1IPJ A;  2E51 A;  1GQH A;  1NCR B;  3N9N A;  4DB5 A;  4ZXK A;  3ZFG C;  2B45 X;  1O4Y A;  1O7F A;  2DYC A;  1YXW A;  2JE7 A;  2OZ6 A;  3KHC A;  5FO9 B;  3G6J B;  1RVF 1;  5FMC A;  3ZKU A;  3BTX A;  1NCR A;  5C4W B;  2HWE 3;  1LU2 A;  2D3S A;  4Y4R A;  1W03 A;  3B94 A;  3P6B A;  2BPA 2;  3CO2 A;  1L7L A;  2Q30 A;  2PMW B;  3WQ1 A;  3M4F A;  3J26 N;  2FZ2 A;  4QPW A;  5C4W A;  2W1U A;  1QXR A;  2JEC A;  1BHG A;  1OOP B;  2XG3 A;  2PHF A;  4M01 A;  1JYN A;  1SCR A;  5LW9 A;  5FZO A;  1GU3 A;  4Q5O A;  1CIW A;  1RUF 1;  2I2S A;  4BOW A;  4RYD A;  4EN0 A;  3BIE A;  4XUO A;  3VBH C;  3J8F 1;  1OI6 A;  1QXP A;  2BWC A;  3O1V A;  1O3Q A;  2R04 3;  1OOP A;  2ZEY A;  3QH7 A;  2GMM A;  2IVJ A;  1V6O A;  4GMP 3;  3WOG A;  4LO6 B;  1ND3 C;  3I2K A;  2G4I A;  3S7I A;  5EQU A;  4CSW A;  1LOG A;  1RUC 1;  4CPB D;  3E1F 1;  1DYK A;  2OKX A;  4FPO B;  2HLE A;  4AG4 A;  5CB7 A;  4D7T A;  1PMH X;  1WLD A;  2HEY F;  1POV 0;  4IER A;  1TMF 2;  2VOX A;  1FV2 A;  2JWP A;  1FI2 A;  4E8C A;  5JOY A;  5JZG B;  1YWK A;  5JPN B;  2FZ1 A;  4BK4 A;  3PDQ A;  5CFD C;  1W04 A;  4LO8 A;  3VBS B;  4YYO A;  1JZ3 A;  4XDP A;  4AEK A;  1S0E A;  4J1W A;  3WDU A;  5FWJ A;  4KL1 A;  5FYB A;  2LW8 A;  1Q8S A;  2G9G A;  4QM9 A;  3LFI A;  4TYS A;  3T0B A;  4A44 A;  1RJ7 A;  3RZK A;  1QJU 3;  1GIC A;  5KXC A;  1GV9 A;  1EUT A;  4KWL A;  3WZ1 A;  2UY8 A;  3LAG A;  4BJ0 A;  4MX3 A;  4LK7 A;  4NE9 A;  1RMU 2;  2DWR A;  4WVM B;  2BBA A;  2I07 B;  2NMN A;  1WBL A;  3HAG A;  2WN2 A;  1M4W A;  3AP7 A;  4OI2 A;  4QU1 A;  5AC9 2;  1D0G A;  4MV2 A;  2IC1 A;  1GNY A;  4UW6 A;  4QXH A;  5D8A A;  1QOS A;  5DG1 A;  2E31 A;  2EIB A;  2V73 A;  4YW7 A;  2P6H A;  5FYY A;  2YYO A;  1B35 C;  4DQA A;  2YPJ A;  1LR5 A;  2Q8O A;  5JXG A;  5GLZ A;  5GM0 A;  1Q3E A;  1MQT B;  4XFF A;  3RVH A;  3U07 A;  2D3P A;  4CXY A;  1X9P A;  3LFM A;  3FFZ A;  3VDA A;  1ZZB A;  2W1W A;  1ULP A;  3POW A;  3KCX A;  5IAT A;  4Q29 A;  2RM2 2;  3B00 A;  1IKQ A;  3RI8 A;  2WUH A;  2R06 2;  3LOB A;  1MQT A;  3AMH A;  2D6N A;  2VBB A;  2D6L X;  4CXX A;  5CFD A;  2WQ8 A;  2PFW A;  3H7Y A;  5KWR A;  2PHU A;  1A6C A;  5A7S A;  4I3G A;  1ZM1 A;  3BPZ A;  2G9F A;  1EAH 2;  5FY8 A;  2DCY A;  1RXG A;  3CJI B;  4JTN A;  3CLP A;  4OUS A;  2WAB A;  2A71 A;  5I0U A;  4PI0 A;  4DEQ A;  5L73 A;  1AR6 2;  2YBK A;  1NY7 2;  1DDL A;  1HRV 3;  3LA7 A;  4D6R A;  3V0B B;  3HT1 A;  3S6P A;  1UY3 A;  3JBG 2;  4MSV A;  3CJI A;  3WV6 A;  3MFA A;  4XUT A;  4OI1 A;  5FWE A;  3KZ4 C;  3RMY A;  3S5Q A;  2WO3 A;  5I8T A;  4LBQ B;  2VE1 A;  3N3H A;  1WA4 A;  2RG4 A;  3NMB A;  1JZ4 A;  3TBD A;  1I5Z A;  2WRA A;  2GAL A;  4PLM A;  1UIJ A;  3V0B A;  4GKY A;  1JW6 A;  1KGY A;  4U36 A;  3AJZ A;  4UFJ A;  3C7H A;  5BNN B;  1R1A 3;  2JDA A;  2LRP A;  3PHM A;  4LBQ A;  4Y3O A;  2Z42 A;  4HFS A;  4XFI A;  4OUE A;  1POV 1;  1ULF A;  5JMO A;  1GQG A;  4B4Q A;  1XPW A;  1SDW A;  2P3Y A;  2WIN B;  1HJG A;  2DCT A;  4LO5 B;  3M3C A;  2IXC A;  3N9M A;  5DDJ 2;  1U5X A;  2ERF A;  4P9X A;  5IK7 A;  5LA0 A;  1CAU A;  1OVP A;  2WT0 A;  1NE6 A;  3LDB A;  5FY9 A;  1NKG A;  1WW6 A;  4LHK A;  1G9B A;  1ZBE 3;  2HWD 3;  3PUA A;  3B3Q E;  2ES3 A;  2YG0 A;  3LWC A;  1PIV 2;  4AGV A;  3ZXD A;  1LU1 A;  2XJS A;  4GZ9 A;  5C8W A;  1BBT 2;  1SQ4 A;  2B8M A;  1G6N A;  3OPT A;  1I6X A;  2DF7 A;  5LB6 A;  3MIE A;  1H8V A;  1DQ0 A;  4NRO A;  1EV1 3;  1RED A;  2QQO A;  1RXF A;  3S30 A;  3WCR A;  3ZSE A;  3T2T A;  1H2N A;  5CVR A;  1OFN A;  3POG A;  4YM0 A;  3RWK X;  4BQ2 A;  2HWC 3;  2Q8E A;  1PHM A;  1S0J A;  2DUR A;  2SLI A;  1UU6 A;  4UFK A;  1ZBA 1;  2F4P A;  4YAR A;  1Q8V A;  2JDY A;  2R0F A;  3E5U A;  5FFO C;  1KFX L;  5ABJ B;  4S2G A;  1RUJ 1;  3B9I A;  4Q4W 2;  4BIF A;  2VEC A;  2PHX A;  5H9S A;  3T2P A;  1OUR A;  2VCB A;  4GMP 0;  1F9K A;  1X8M A;  3O1S A;  3VZJ A;  1UXZ A;  1TNR A;  5ABJ A;  3NV2 A;  4FPF A;  5L19 A;  1M06 G;  3B9C A;  1KJL A;  2RJL A;  4K21 A;  1QDC A;  3N9Q A;  1HXS 2;  3GZT B;  1VLN A;  3IBM A;  2W3J A;  3SLI A;  1VBB 3;  5DUV A;  4HZF A;  4JKK A;  4SLI A;  2VXR A;  3HBK A;  4UFH A;  4A42 A;  3IWZ A;  3NWK A;  4CA9 A;  1OLM A;  2XBO 3;  3SCF A;  2NPI A;  5C9A C;  3S5A A;  2AGS A;  2TNF A;  3D5O A;  4XUR A;  2BOI A;  5FZ9 A;  4ZHN A;  3ZSL A;  3NNF A;  4QX2 A;  3ZFE B;  4BMB A;  3KCY A;  1ZRC A;  1Z7S 1;  1ZRI A;  1JYX A;  1SPP B;  4DIQ A;  3WW3 A;  4CDU C;  4PF5 A;  5EZW A;  3KMH A;  1FNY A;  3AYE A;  5H9R A;  1VBC 2;  2ORX A;  2OT7 A;  2XQR A;  4ZKT B;  5B4X A;  1WKY A;  2CDP A;  4E27 A;  1ZRD A;  1E5R A;  2VH9 A;  5GZG A;  1SPP A;  3LIG A;  2QJV A;  1CX4 A;  4MYE A;  1UYY A;  4Q4W 1;  3LOI A;  4N43 C;  3SCH A;  1XU1 A;  2XWB B;  4P5H A;  3RGB A;  3III A;  1H2L A;  5FZD A;  1U0A A;  3K3O A;  2DVG A;  1MS0 A;  4XJ9 A;  3VBR C;  1S0F A;  4MH0 E;  1L3J A;  3AZY A;  3HQR A;  1UF2 C;  2DVB A;  2GC3 A;  3PVE A;  2X5I C;  3V64 A;  3VHP A;  3GZA A;  2NZ9 A;  3WUC A;  1IPS A;  1H4G A;  1K45 A;  2E7Q A;  2QQN A;  4MLO A;  1US3 A;  3IB3 A;  4QPG B;  3BTY A;  2VOT A;  2FDK A;  1VBD 2;  2RS1 2;  4FPK A;  3WP4 A;  2JB8 A;  3ZN5 A;  3ON7 A;  5IHR A;  5F5A A;  2VQ0 A;  4IEX A;  4H3W A;  4QKD A;  3M1H A;  1BLZ A;  5DAX A;  5FXZ A;  2JKB A;  1RIT A;  2ZZJ A;  4AZZ A;  4EWA A;  4KG0 A;  2GH2 A;  4FAG A;  2H6B A;  2ZHL A;  4N53 B;  1K42 A;  4K1Z A;  4HKO A;  1W06 A;  1U5Y A;  2XJT A;  4XZU G;  3WHU A;  1W8F A;  3DXT A;  2OXB A;  2WNU B;  1BYH A;  3OPZ A;  4Y20 B;  2C24 A;  4K8F A;  4N53 A;  1S0B A;  4EN8 B;  1BMV 2;  2OVU A;  3SIS A;  1RUG 2;  3GZE A;  1V0A A;  1YC6 1;  2A3W A;  4QGL A;  1HRI 2;  3MDP A;  5T55 A;  1VB4 A;  2KXL A;  2XL7 A;  3N9P A;  2WNU A;  1K3I A;  4Y20 A;  5GZC A;  4MOA A;  4I0A A;  4N43 A;  2DVD A;  1TZO A;  1OSG A;  5CFC B;  3O1U A;  2J22 A;  3GDB A;  5IJR A;  2YC0 A;  1ZZC A;  4Y1Y A;  4HOO A;  2ZX1 A;  2C26 A;  2W2I A;  1DU3 D;  1NZI A;  4GMP 1;  3VD9 A;  2DCJ A;  5C5T A;  3ECQ A;  4TN7 A;  1KEX A;  2Y6G A;  5CFC A;  1X7N A;  5FYS A;  1DLL A;  3LCP A;  3I4I A;  1QNY A;  4HLT A;  3ZYP A;  4XXP A;  5F5I A;  4YFW A;  1AR7 3;  1V6L A;  3WCS A;  4K1Y A;  2VMI A;  5IFT A;  3CL1 A;  3HR9 A;  4GA9 A;  4GWJ A;  2XWJ B;  3E6D A;  3ABZ A;  2VOK A;  3IDC B;  5JWP A;  1VBE 3;  2BTV C;  4BCU A;  4BQY A;  5C3Q A;  2FDJ A;  1RUG 1;  4XCA A;  1ENR A;  5IAV A;  2CGO A;  1GUI A;  1QJU 1;  3N36 A;  3OGV A;  2WA3 A;  2GU9 A;  3A4U A;  4XFA A;  4MGK E;  5ANN A;  4YW6 A;  2JDP A;  4CYD A;  4NAM A;  4CP9 B;  4HPK A;  4KG8 A;  4DUX A;  2D40 A;  2PHD A;  1S0C A;  4Q4X 2;  1GWK A;  2WLQ A;  3B93 A;  1OD3 A;  4IE0 A;  2ZXQ A;  2V09 A;  2ZEZ A;  2WII B;  2JG9 A;  1IHM A;  4MXV A;  1MS8 A;  4ATF A;  1F2N A;  3ZYB A;  4C91 A;  3BYW A;  5FJK A;  4CP9 A;  2IVI B;  3WHT A;  2NN8 A;  5E1R A;  1GOH A;  1NUK A;  3BGA A;  4DRV A;  4CDW B;  1NLR A;  4AE2 A;  3M7A A;  4AGG A;  1O8P A;  1MZF A;  3GBG A;  2HYX A;  3POB A;  1H1I A;  3ZN4 A;  1P8J A;  2W5F A;  3WQB A;  2YZ4 A;  1JI6 A;  5FMB A;  3THT A;  1UOJ A;  1GNZ A;  2MEV 3;  1DZR A;  5FPZ A;  4CDW A;  1QH7 A;  5FO7 B;  1RUH 3;  5A1L A;  1FOD 3;  2JDU A;  3UET A;  1PX3 A;  1PGL 2;  4YZ1 A;  2BBV A;  4FP3 A;  1C4R A;  4YG0 A;  5FPV A;  1SCS A;  2VXJ A;  5FZI A;  1SMV A;  4H14 A;  1WLC A;  4Q27 A;  5TSW A;  1V9U 1;  4XQW A;  5FPX A;  4CCJ A;  4NR1 A;  4CCK A;  4X6R B;  4OUM A;  1LOC A;  4MGS A;  1PVC 2;  2VOV A;  4LIT A;  2P3I A;  1XJA A;  4EQV A;  2ZGM A;  3RYP A;  2FDG A;  1UZY A;  4COU A;  4GJZ A;  1C8M 3;  3POJ A;  1UYP A;  1HDK A;  4Q4Y 3;  3USS A;  2Y0I A;  2LM3 A;  4HT1 T;  4XBL A;  4YZ5 A;  1A8M A;  4GAL A;  5IWF A;  4JTO A;  5FOB B;  5JVV A;  1AR8 3;  2QDR A;  4XEZ A;  4AQ6 A;  3ZMO A;  5T5L A;  4BME A;  2CU5 A;  3WQ7 A;  3KF3 A;  1SBE A;  4HSJ A;  4UFM A;  5EHD A;  3NNM A;  3QAC A;  3N7M A;  4PBO A;  2VNV A;  3OBA A;  2ATF A;  1OXC A;  4LKS A;  5FLJ A;  1R08 2;  3KF5 A;  5LAS A;  3VN4 A;  5FZG A;  2AEN A;  2YY1 A;  5FMO L;  5FRA A;  4LEJ A;  2D7F A;  2WYF A;  1NOV A;  3AP4 A;  3FHQ A;  1KDK A;  2VUL A;  2VQU A;  2YUE A;  4IV1 C;  3U4S A;  4GH4 B;  1AYN 1;  1UL9 A;  1UU5 A;  5IK8 A;  3NNJ A;  3OCP A;  1OT5 A;  2L9L A;  4OHW A;  5FXV A;  4COW A;  5JI9 A;  4I0W B;  4ZS2 A;  3PUS A;  1ZBE 1;  1AX0 A;  4E2G A;  2ZGO A;  1AZD A;  2ZS6 B;  4CU7 A;  2XJQ A;  4DNY A;  5BNO C;  1NQD A;  4TZD A;  4AW7 A;  1NT0 A;  4NIH A;  2P17 A;  2IUW A;  4TWT A;  2WNV C;  1RUF 3;  5FUN A;  1YRZ A;  4Q0Q A;  5DAW A;  3BPS A;  1LEC A;  4ZZ5 A;  4XIO A;  3GBF A;  1JOP A;  1EV1 1;  4QQ2 A;  3AMM A;  1EYB A;  1QH6 A;  2VO5 A;  4RGG A;  1R09 3;  2LAL A;  1BEV 2;  3T08 A;  1UIK A;  1TME 2;  3WG1 A;  2XKO A;  1D4M 2;  2ZZQ A;  4M0H A;  1Q5O A;  4YM2 A;  1AJO A;  4CP2 A;  1WCS A;  5ANQ A;  2FMY A;  5FY7 A;  5A3O A;  3IN9 A;  1AX2 A;  2GNM A;  1BK0 A;  3TEY A;  4R9A A;  1ZZ7 A;  3CBN A;  3ZXA C;  1X8E A;  2Y8K A;  4I3P A;  4J6G A;  3LEK A;  2BFU S;  1VAV A;  3J9S A;  4GB3 2;  4NHY A;  2V4V A;  3E6B A;  5DXD A;  2WZR 1;  5DZE A;  4FVV A;  4AVB A;  4OQ8 A;  2YBS A;  1DQ2 A;  3HWJ A;  3UJO A;  4IEV A;  3RZH A;  2GC0 A;  1VRH 2;  1JTZ X;  1PO1 2;  3PJY A;  4LIV A;  4RD7 A;  4AOC A;  1AF9 A;  5A3T A;  4H7M A;  5B2G B;  3VKL A;  2CAU A;  1SLA A;  1ULE A;  4RHV 2;  5A7O A;  3BN6 A;  2QDN A;  4Y1X A;  1HN1 A;  1Y4W A;  4A2U A;  2XBO 1;  4CU6 A;  1YO8 A;  1E57 A;  2D6M A;  2A70 A;  4GXL A;  1D2S A;  2D6K A;  5E6H A;  4A41 A;  4CRQ A;  5BNO A;  3V0A B;  2Y6K A;  3TNP B;  1A8D A;  2DVF A;  1W2A X;  3OBR A;  4QKF A;  5JAX A;  2BP6 A;  5CYY A;  1OKQ A;  5EYY A;  2G9Z A;  4QD2 A;  1FPN 2;  2W94 A;  3ZKY A;  2ZGL A;  5DAQ A;  5KHI A;  3A22 A;  2IXI A;  3V0A A;  3I3E A;  4Q8K A;  4XDO A;  4KWK A;  3WP5 A;  1UO9 A;  2DVA A;  4CCC A;  4AQT A;  3O1O A;  1O3S A;  1V6J A;  1JZ5 A;  4LK6 A;  4YRD A;  1PZ8 A;  1G8W A;  3SIT A;  1OQ1 A;  1OPM A;  4PIX A;  4A3X A;  1HB1 A;  1DQ6 A;  3PIG A;  4C0H A;  4IW3 A;  1MS1 A;  1W8O A;  5GZE A;  4IV3 B;  4QAW A;  2WO1 A;  3KV5 A;  3RDI A;  3VZK A;  3NJV A;  1ULD A;  2WFF 2;  4FFI A;  2RS5 1;  3JD7 2;  4LUM A;  4NHL A;  4URT A;  2BEO A;  3VL9 A;  2EXH A;  1MZ5 A;  2WZ8 A;  3ZFF C;  4CEY B;  5A70 A;  1K5M B;  5C3P A;  2YDE A;  1AR9 2;  3MLJ A;  2NQY A;  4JKM A;  3RSJ A;  3EHK A;  5A33 A;  1RJ8 A;  4FOV A;  4QQH A;  5FZE A;  4CTE A;  4O9E A;  1LCL A;  1RB8 G;  4XHB A;  3SNM A;  2RR1 1;  4CCM A;  4JQT A;  2R6Q A;  2W39 A;  2WZP P;  1HN0 A;  5AC9 3;  3VBO A;  1S1A A;  2Y6F A;  4A3Z A;  2YMZ A;  4YNI A;  4ASL A;  3HNY M;  3AVS A;  2HWF 2;  4BIO A;  3AFK A;  1OMI A;  4XIL A;  1S2K A;  4AEJ A;  4XOG A;  5BNP C;  3ENR A;  4CCN A;  5JMC A;  2RS3 2;  2Y6H A;  4J1X A;  2WWJ A;  5C8C C;  2VVE A;  2ZX0 A;  4JHT A;  2QQJ A;  4PDW B;  5GZD A;  5F5C A;  5LBE A;  2V5Y A;  2R06 3;  4AEM A;  1POV 3;  5A3U A;  3H9A A;  1FX5 A;  1YFY A;  1VBA 1;  3I8T A;  5EJ3 A;  1DP0 A;  3I54 A;  3I49 A;  2ARC A;  3VD5 A;  2JX9 A;  1FMD 2;  1LHV A;  1W9S A;  1QHD A;  4K7J A;  3T4V A;  4DY3 A;  4CEW C;  4A7K A;  3QD6 A;  4KU8 A;  4CVU A;  5BXX A;  4RQP B;  1WCQ A;  5IT6 A;  4K9S A;  1AR6 3;  2HJI A;  4JV4 A;  4AXO A;  3CU7 A;  4Q8L A;  2NLR A;  2WS9 1;  4HON A;  3TNQ A;  3AP6 A;  1HQL A;  1C8N A;  1XND A;  3I3D A;  3U78 A;  3JBG 3;  1VBE 1;  4RQP A;  4UW3 A;  4LKE A;  2ZAH A;  4NUB A;  5FZM A;  1D2Q A;  3H0O A;  3D3A A;  2FQP A;  3MPB A;  4IGQ A;  3I2J A;  3TYJ A;  2RV9 A;  2DCZ A;  3O5S A;  4RS5 B;  4WM8 B;  4LE4 A;  5EFU A;  5C3R A;  1XSR A;  2HH9 A;  1MS9 A;  1ZBA 3;  1H8T C;  3PTR B;  4EN9 B;  2ZGN A;  4AFC A;  5FY1 A;  5J37 A;  1QJY 2;  1RUJ 3;  3PL0 A;  2VQT A;  5T5O A;  2AH2 A;  2BVV A;  4WM8 A;  4BM8 A;  1TEI A;  1YIF A;  5C8C A;  3H1W A;  4F7Z A;  3WX5 A;  3T0D A;  2IFW A;  3HPN A;  4GUL A;  5DDJ 3;  5BUV A;  4AYU A;  5FZL A;  1QF3 A;  3IM0 A;  3OPW A;  3T1L A;  2HKX A;  4Q4V 2;  1OC1 A;  3WF2 A;  1PIV 3;  2GP3 A;  2JB4 A;  3EXU A;  3S0M A;  3IAP A;  1IS6 A;  5JSO A;  1BBT 3;  3K2O A;  2UWC A;  2FHR A;  3PU8 A;  4QX0 A;  5SV5 A;  4CP0 A;  5I0S A;  5FZ0 A;  3LPF A;  1FOD 1;  4V1P A;  3WF4 A;  2UY9 A;  2MPF A;  4YW4 A;  3LDK A;  1XYP A;  1GKB A;  5DPN A;  3DPR B;  4OHZ A;  4BE3 A;  5F3I A;  5K0U B;  3RZG A;  3JQX A;  5EWS A;  2WNO A;  2VNO A;  3VKO A;  5FYC A;  4OLL A;  3PUR A;  5CG9 A;  4XF9 A;  3M70 A;  1LOF C;  4MZU A;  5CG8 A;  1QY4 A;  4RGA A;  4MGY E;  3WY6 A;  4AI2 A;  2GC2 A;  3DPR A;  1W6Q B;  1CPM A;  3VDC A;  4Q4W 3;  3VV1 A;  1C1L A;  2YXS A;  1IGO A;  1LHN A;  1C8M 1;  1WMF A;  2JDM A;  4HET A;  2PAK A;  3GJA A;  4NAO A;  4QHO A;  5L36 A;  4Q4Y 1;  1G9F A;  2XL9 A;  4LBM A;  4O9G A;  3UJQ A;  1NA1 C;  4NIA A;  3ILF A;  3K75 B;  1S2E A;  2BV4 A;  4W6W A;  4UYB A;  1AR8 1;  1RGS A;  1SHW B;  2F4L A;  4OVE A;  4PI2 A;  1HXS 3;  3ZLI A;  1PO2 2;  2OW4 A;  2Y0O A;  2HEW F;  1XNA A;  4YM1 A;  3O7O A;  3O1T A;  3GAL A;  4FPC A;  3P5B A;  4GQ7 A;  1HX6 A;  1XOY A;  3FUQ A;  4OFG A;  2JDN A;  4WBB A;  4XUQ A;  3OUJ A;  3THD A;  4CP1 A;  2VM9 A;  4HXC A;  5LCW L;  1N3P A;  2JDK A;  1NG0 A;  3RG0 A;  1MS5 A;  1DGR A;  2RHP A;  4DXT A;  3NAP C;  5L9R A;  2XHK A;  3WP3 A;  3ZX7 A;  3WF1 A;  4RA0 A;  3UKV A;  2YB7 A;  4NHX A;  5A6Q A;  1GBG A;  1VBC 3;  3K77 A;  3MLK A;  5FZO B;  4D94 A;  5IW0 A;  5IVY A;  2CWS A;  2VME A;  4YVW B;  5E8A A;  3HIF A;  4PLO A;  1QJX 2;  5A7W A;  3HOB A;  3WNX A;  1YNA A;  2XUM A;  2VJX A;  1NQJ A;  3ELN A;  5DG2 A;  2MNG A;  1WMD A;  3EMR A;  4XBN A;  2OS2 A;  1LES A;  2A6X A;  1QOT A;  1MPX A;  4XC9 A;  4YVW A;  4FPG A;  1W05 A;  2XDV A;  1W99 A;  3IIA A;  4Z2A A;  1RHI 2;  3ZFG B;  3KWV A;  1UD1 A;  1R09 1;  5T5J A;  1UN1 A;  4ES8 A;  4YM3 A;  1VBD 3;  4NPL A;  5C71 A;  3AC0 A;  1YYN A;  2E7T A;  1G9D A;  2VMD A;  4BQ5 A;  1QQP 2;  4WVV A;  3VBS C;  2JIJ A;  3ZFG A;  4CDX C;  5JIU A;  5FPA A;  2E6V A;  3RZZ A;  1AJK A;  4EYU A;  1H4H A;  4G4F A;  3OG2 A;  2XXZ A;  4PIZ A;  4Z8B A;  2QQP A;  2ZX2 A;  3B69 A;  1NX9 A;  3E5Q A;  2XVG A;  3THC A;  4Z2W A;  2TEP A;  1EUU A;  4I2O A;  3LD8 A;  3WNP A;  3KCC A;  1O6U A;  3WD5 A;  3L9J T;  4WM7 C;  5HV0 A;  1RUG 3;  3KD4 A;  5F7U A;  1HRI 3;  1QJX 1;  1CAV A;  2XJR A;  4UFI A;  4CDQ C;  1XRU A;  2LRO A;  3VBH B;  2P37 A;  1NLS A;  1AL0 G;  1DCS A;  4AHX A;  3ACG A;  3H8O A;  3FLT A;  5FUP A;  5D8A B;  3SHR A;  2W68 A;  4LLO A;  1GP4 A;  4M4P A;  5F2S A;  1E5I A;  3GZU C;  4QDR A;  3VBH A;  1ND3 B;  4ET7 A;  3R05 A;  4XXA A;  5I93 A;  2HYK A;  2HWB 2;  3DYO A;  5J98 B;  4ASK A;  1OH3 A;  3ZSM A;  5F6L B;  3WNM A;  1QOO A;  4KMQ A;  3WDX A;  1JMU B;  2R1B A;  3KGL A;  1ND3 A;  3V65 A;  4JDM A;  2TBV A;  5K9Y A;  1G7Y A;  4IL7 A;  4NWV A;  1GP5 A;  1Y9M A;  1TMF 1;  4UAP A;  5LA2 A;  3HBZ A;  1BZW A;  5EJ1 B;  1DGW X;  3ZDS A;  5CFD B;  3FMG A;  3VBU C;  4UI9 L;  1A34 A;  1W0O A;  3WDV A;  1LED A;  4IGP A;  2RDR A;  3VGI A;  3OOX A;  1ZZ9 A;  1ZRF A;  3SC7 X;  4HVR A;  2P3J A;  1DYP A;  1WWY A;  4AQ2 A;  4B4R A;  1YQ5 A;  1V9U 3;  1REF A;  2W95 A;  1OLQ A;  3SCG A;  1WD4 A;  1NE4 A;  3A21 A;  4AVV A;  2YGM A;  4GAZ A;  2P4E A;  1W2O A;  4OUL A;  5LY1 A;  2DBN A;  3EB7 A;  3FN9 A;  3I7D A;  4KH9 A;  4XHX A;  1RMU 1;  1X82 A;  1UKR A;  4JRL A;  4PQQ A;  3AB0 A;  2DUQ A;  4XTM A;  2QZ2 A;  3UNP A;  3HQX A;  4EZH A;  2ZEW A;  2Q1F A;  2J7M A;  2ZOE B;  4R9C A;  3VKN A;  5AC9 1;  1VMF A;  1GMM A;  1B35 B;  3PIJ A;  3CKH A;  1LJ7 A;  2VZP A;  1UY1 A;  3UGF A;  3IDB B;  3BOP A;  4JX0 A;  3FFQ A;  2CGN A;  3ZXK A;  1K12 A;  1PNG A;  2W91 A;  2QBX A;  4M0N A;  1B35 A;  3H1M A;  1XE0 A;  3LEG A;  3WG4 A;  3ZXL A;  2JJ6 A;  3EO6 A;  4QPI C;  2FDF A;  2RM2 1;  3AKR A;  3N9O A;  1CAU B;  4JDO A;  1NXD 1;  1CGP A;  2R06 1;  3J4U H;  2R30 A;  2ZAC A;  2N7G A;  3M8L A;  1QXJ A;  1AYN 3;  4BA6 A;  5FY4 A;  5LBC A;  3WDY A;  3GHM A;  5FV3 A;  4UF0 B;  1GP6 A;  2H0B A;  1LAJ A;  3ETP A;  2PQQ A;  3SQO A;  1PVC 3;  2YC2 A;  1JUH A;  3C7G A;  1EAH 1;  3JUU A;  4XAA A;  1W90 A;  1QIQ A;  1CZV A;  3C2U A;  4P5Y A;  4W6X A;  5K7P A;  1IQD C;  1PX4 A;  1XNC A;  3ACF A;  4NN0 A;  4UF0 A;  4W4Z A;  1AR6 1;  3F95 A;  1NY7 1;  5FKC A;  3WUD A;  4BPZ A;  3AKP A;  1W3X A;  3BAL A;  3IPV B;  4G9S B;  2QNK A;  4QDQ A;  1SZB A;  2YC4 A;  2CHH A;  5FZ8 A;  2A6W A;  4AI3 A;  4CUC A;  2DUO A;  3JBG 1;  1N47 A;  2W52 A;  3I3Q A;  5C3S A;  2YFZ A;  2R07 2;  1YQ8 A;  3ZIX A;  2PHT A;  4UW5 A;  1KS4 A;  4Z1V A;  1OPO A;  3LGR A;  3IPV A;  5LK7 B;  1OF3 A;  3OUI A;  4XQD A;  1R08 3;  2PQS A;  1XYO A;  3I2D A;  4R4X A;  1WLW A;  1CIY A;  4I30 A;  3O14 A;  4Y1V A;  1Y9G A;  3OB8 A;  1PGW 2;  4QXK A;  4C1W A;  1YLL A;  3BB6 A;  3K3N A;  2J1S A;  1HJF A;  1JYC A;  5FP7 A;  2WZR 3;  1F4H A;  5DDJ 1;  1QJE A;  2XLG A;  5F39 A;  1WCU A;  3RI9 A;  5EIY B;  2OA2 A;  4XW3 A;  4CU8 A;  2VZ3 A;  1GR3 A;  1PIV 1;  1Z78 A;  3M2M A;  3M3O A;  2WO7 A;  3VDD C;  3ST7 A;  1V6I A;  1NAE A;  5DUW A;  5LAT A;  2B7Y A;  1ZZ6 A;  1BBT 1;  5HBA A;  3VHN A;  3UGH A;  4Q1P A;  1TVG A;  5HCA A;  4H2A A;  1F35 A;  3RJ2 X;  2W87 A;  1F31 A;  2IXJ A;  3VKM A;  3ZO0 B;  3MIG A;  3BVC A;  1MR5 A;  5GKA C;  2D6P A;  2JD9 A;  4DRR A;  5JSR A;  2AZ5 A;  4S2H A;  4Y22 B;  2FCU A;  4M3C A;  4YWA A;  3BTA A;  2JKX A;  1J84 A;  2JG8 C;  3A7Q A;  1XXN A;  3B7M A;  3DYM A;  2X10 A;  1DGL A;  1S0I A;  5C6C A;  2BVB A;  4K40 A;  5APA A;  3WP6 A;  1Q8P A;  5KBF A;  4Y22 A;  4GB3 3;  1U5I A;  2C9K A;  2PAE A;  4LOS A;  4F83 A;  1UZ0 A;  2AUY A;  4AHY A;  2IXK A;  2XQX A;  2HWE 2;  3A23 A;  1RUE 2;  4E2S A;  4XFB A;  4DPN A;  1HXS 1;  2WQZ C;  1IOA A;  4OCT A;  4YVS C;  3HT2 A;  1PM4 A;  2JE8 A;  2RS5 3;  1O3T A;  4CZS A;  4JGZ C;  4RHV 3;  5GZF A;  3SKJ E;  4DMI A;  2E33 A;  5C9A B;  1Y43 B;  3MID A;  5D21 A;  4IE6 A;  1QWR A;  2VZS A;  4YLZ A;  5F3E A;  2A7A A;  5EJZ B;  4RFR B;  2V72 A;  1Q56 A;  2P6C A;  3TN9 2;  2VBP A;  2W08 A;  5C9A A;  2RR1 3;  1S0D A;  2PLV 2;  4HVQ A;  3I2I A;  5I8Y A;  1FPN 3;  2R04 2;  4CUB A;  1VBC 1;  2D97 A;  2D3R A;  4TSV A;  4IES A;  1MZ6 A;  4CDU A;  3ZMN A;  1O3R A;  3MF9 A;  4Y5Z 0;  3LIH A;  4CUG A;  4N43 B;  3DXU A;  5JIA A;  2F6B A;  5I0T A;  1I3H A;  4FPJ A;  2CV6 A;  1QEX A;  4AFB A;  2YU2 A;  3VBR B;  1WGP A;  2YFU A;  2G19 A;  2ZHM A;  3RWN A;  1ODN A;  2X5I B;  1ND2 C;  3MIH A;  2BGO A;  4GKX A;  3HEI A;  2AYH A;  4B7K A;  3BCW A;  1WUV A;  4FCA A;  1XNT A;  4P00 B;  3KT7 A;  3VBR A;  4AI9 A;  2FDH A;  1N1Y A;  5FZ3 A;  1JZ6 A;  1MS4 A;  3FJS A;  1LRH A;  2GND A;  3O0X A;  5FK7 A;  1VBA 3;  1DG6 A;  1W9Y A;  2X5I A;  2WFF 3;  1ACC A;  1VBD 1;  2RS1 1;  2BER A;  3JD7 3;  3WDW A;  1GLH A;  1O8S A;  1HLC A;  4YVS A;  4CPB A;  1RL3 A;  4RGK A;  3PLQ A;  5FYV A;  2BU9 A;  1H30 A;  3AM2 A;  4Q1R A;  2ZBJ A;  3PVB B;  3I3M A;  3OGG A;  2XPJ A;  2CNA A;  5AVP A;  4ZY9 A;  4HK8 A;  3DYP A;  5AFB A;  1OLM E;  2CWM A;  2Y64 A;  2WBK A;  3J7L A;  4IQP A;  4DZG A;  4ZU7 A;  1XC6 A;  2JEN A;  3B01 A;  4JC1 A;  5KXB A;  5GJ6 A;  5L9V A;  2WS9 3;  3W59 A;  1ZA4 A;  2OPK A;  4Q0P A;  4B8E A;  3EBR A;  1ODM A;  1YFX A;  3OYW B;  5J36 A;  3D6E A;  3CZJ A;  2QQU A;  4HPK B;  4ARX A;  5CBL A;  3LSD A;  1BMV 1;  5JDB A;  1TE1 B;  4PCR A;  3I97 A;  2HWF 3;  5KC5 A;  5FZ7 A;  3ATG A;  1HRI 1;  2VCA A;  2JG9 B;  3JQW A;  3OYW A;  4WV8 A;  4DIN B;  3P3P A;  1H2M A;  1PVX A;  1DZT A;  1SFY A;  2WSV A;  4XBQ A;  1FXZ A;  4LLF A;  4RN5 A;  4XF3 A;  3D0J A;  2RS3 3;  3IAQ A;  4MAD A;  5J7M A;  3AMP A;  5FO8 B;  4OHV A;  4XIK A;  5A3P A;  2B9U A;  2WAO A;  2ET7 A;  1YFU A;  3MIC A;  3O1P A;  1SFP A;  3FLR A;  4GWN A;  2C6S A;  2W9X A;  1DIW A;  1FMD 3;  1JU4 A;  3LA2 A;  1VJ2 A;  4XE9 A;  4XTP A;  5C3O A;  4LUL A;  1IG3 A;  3LZZ A;  3T3Y A;  3JZV A;  2VCM A;  3FE5 A;  4MXW B;  1J83 A;  1CJD A;  4AVC A;  3ACI A;  4MVT A;  4LIU A;  1I9R A;  1MAC A;  4UBG A;  5D1I A;  5A7Q A;  2RMU 2;  4XAC A;  2WNE A;  5LK5 A;  4Y5T A;  3RRD A;  3ES1 A;  2G1M A;  4PT6 A;  4AI8 A;  1JHN A;  5JSP A;  1LOB A;  5IAX A;  1LTE A;  3KV6 A;  4MXW A;  1FV3 A;  4NO4 A;  1HRV 2;  4FOW A;  1C5I A;  4W65 A;  2E26 A;  1PNF A;  3BI3 A;  2GSY A;  3AVR A;  4N7U A;  3MF6 A;  2ARA A;  2BRT A;  2Z4F A;  3H8U A;  4Q4X 1;  3WEZ A;  3CJX A;  2PEL A;  1EPZ A;  3R4S A;  2O8O A;  3WLU A;  1RUD 2;  1ASJ 2;  1QJY 3;  2FCT A;  2WL1 A;  5L9B A;  3N35 A;  1W2N A;  1N3O A;  1D0H A;  3Q8E A;  3LPG A;  1R1A 2;  2R7E B;  4YG6 A;  3U75 A;  1UW8 A;  2AC1 A;  3LQC A;  1H6Y A;  2GNT A;  5FAX A;  3RJR A;  2VG9 A;  2WDB A;  4C8D A;  2Q1Z B;  5C70 A;  1RUN A;  4NJ4 A;  4RR3 C;  2Q0A A;  3H42 B;  3EYP A;  4FTS A;  1LEN A;  5A32 A;  4XFC A;  5T50 A;  4GH4 C;  4N9I A;  4KWU A;  5F5Q A;  1GZ9 A;  4XDQ A;  2PYT A;  1O5L A;  4N8M A;  5LY2 A;  4N7I A;  2HWD 2;  3MPP G;  4HSL A;  1SLT A;  4L92 A;  3NL1 A;  3HNM A;  3GM8 A;  4C90 A;  1PGL 1;  1AHS A;  3NRU A;  3ZR5 A;  4OI0 A;  2VOW A;  5FP4 A;  1V70 A;  1YQ2 A;  2ZAB A;  4EN6 B;  4LBO A;  1KJR A;  1W9F A;  1VE0 A;  4QXC A;  2WN3 A;  1PVC 1;  2J1A A;  4QQP A;  1XSQ A;  3ZYF A;  1UZV A;  5HCH A;  4L97 A;  1WZX A;  4KI5 M;  4JAA A;  3OGS A;  3ETQ A;  4QKB A;  3I2F A;  2ZGP A;  4EJR A;  3BOD A;  5CA6 A;  5FXW A;  3KVB A;  4XPV A;  5FP8 A;  1YQC A;  1O91 A;  1AL2 2;  2JIG A;  3ZVX A;  3WR0 A;  4IEQ A;  2CTV A;  4MGT A;  1MEC 2;  3DEM A;  3WVJ A;  1LOD A;  3BIW E;  4XYX A;  1X33 A;  4AVA A;  3QCW A;  1RIN A;  1PO2 3;  1YHF A;  2O0O A;  5AFE A;  1AXY A;  2ZPX A;  4E4Z A;  1OA2 A;  5FPU A;  4CCE A;  4LNV A;  1R08 1;  1VBB 2;  2XON A;  3CIH A;  1OHF A;  2RJK A;  4IV1 B;  3P3N A;  5FYI A;  3D82 A;  5E89 A;  2D43 A;  2QQI A;  4JGY C;  3KB5 A;  1X9T A;  1ZNP A;  4BQ1 A;  3MIF A;  4LOR A;  1RTV A;  5CNA A;  4NPM A;  3SEE A;  3C7E A;  2XLF A;  2OPW A;  4IV1 A;  1L7Q A;  3SH4 A;  1A78 A;  5BNO B;  1CPN A;  1OKO A;  4FOY A;  1ULC A;  4Q0U A;  2VMG A;  1QJX 3;  2WNV B;  5FZ1 A;  4AVT A;  3HMY A;  4ITC A;  1LGN A;  3P1I A;  2KA3 A;  1IPK A;  3KV9 A;  2EIE A;  2ZX4 A;  2JE9 A;  1K5J A;  4JDN A;  4ARY A;  1W0P A;  3LKJ A;  4DUW A;  2WNV A;  1J59 A;  2DU0 A;  4XMI A;  3H50 A;  4FBF A;  4ISR A;  3BKZ A;  1RHI 3;  4V2V A;  3N7L A;  1PK6 C;  1SFN A;  1VB2 A;  1BEV 1;  2GDF A;  2Q1M A;  3MEP A;  3VHO A;  4OHY A;  3S57 A;  1TME 1;  4NMI A;  3WNN A;  1PMI A;  1D4M 1;  4DUV A;  4LTA A;  4IV3 C;  1VPH A;  3AZV A;  3PNA A;  3UYJ A;  1SLI A;  5T3N A;  1QMJ A;  5F3G A;  3KQR A;  1W6M B;  1URX A;  3BU7 A;  2ARB A;  5FUI A;  3SEP A;  1TMF 3;  2A1X A;  1COV 2;  4KBZ A;  1SBF A;  4M4R A;  4GB3 1;  1GOG A;  2F17 A;  5FYM A;  3URF A;  3K51 A;  1GWL A;  4NPR A;  5ACA 2;  2EAL A;  2D6O X;  2ZGS A;  4L99 A;  1W6M A;  3AKT A;  1VRH 1;  1XB9 A;  5A33 B;  1PO1 1;  3KVA A;  2V4A A;  2GC1 A;  2OX0 A;  3Q8F A;  3KLS A;  1F5J A;  2XVK A;  5KXE A;  2C5D A;  1W28 A;  4BQX A;  2A5Z A;  4RHV 1;  2D5H A;  1NLQ A;  4UXA A;  1H1M A;  4FPL A;  1U12 A;  4DEV A;  3WQ0 A;  2QZ3 A;  4UBH A;  3POF A;  3OJB A;  4E4S A;  1CON A;  3VZM A;  1ULG A;  2NM1 A;  3VBO B;  3VBF C;  2JDZ A;  3VUO A;  5T54 A;  1RMU 3;  1J58 A;  1EPW A;  4AQS A;  4D69 A;  3R4D B;  5BNQ A;  2B39 A;  1UOB A;  4OMD A;  3S7E A;  1RUI 2;  2GAU A;  1S4C A;  3U4X A;  4CCO A;  1FPN 1;  1CJP A;  3KHB A;  2HWB 3;  4LKF A;  4Y4Y A;  1UX7 A;  1AYM 2;  3UGG A;  3UK9 A;  3RQ0 A;  4AHW A;  2UYB A;  4HBN A;  4AFM A;  2WLP A;  3BOW A;  3LSE A;  3DN7 A;  4NII A;  5I0R A;  3ZYG A;  4BDV B;  5FMO S;  4X6Q B;  1H9W A;  1F4A A;  3KSC A;  2R0H A;  4IE7 A;  1BXH A;  2EIC A;  3HQU A;  2XJV A;  1XNB A;  5L7O C;  4JQR A;  5EP9 A;  3ZSK A;  2DBI A;  5HCB A;  2V5D A;  4S2F A;  2RM2 3;  1AR7 2;  1AUY A;  2OYZ A;  5ACA 1;  2YHJ A;  4MO3 M;  2WQ4 A;  4XF1 A;  4JHZ A;  4NVP A;  3ZFF B;  3AKQ A;  4EN7 B;  2WFF 1;  3JD7 1;  4EZ4 A;  4YW2 A;  5LA9 A;  1ONA A;  5LRR A;  1NXM A;  4AF9 A;  3TRS B;  1OH4 A;  1UOG A;  1AR9 1;  1NCQ C;  2WA4 A;  3ZFF A;  3ZXJ A;  1A3K A;  1EAH 3;  4LR4 A;  3NVC A;  3B5L B;  4BIS A;  2EXJ A;  2J1T A;  3VD7 A;  1OF4 A;  2GN3 A;  4WVZ A;  3C7F A;  5K8S A;  1OUX A;  3KGZ A;  3Q8A A;  4BLJ A;  5A3W A;  5FZH A;  1JU3 A;  5LBB A;  3V56 A;  3I2G A;  4MET A;  2VU9 A;  5FCC A;  2QCS B;  3T2Q A;  5FR3 A;  2HWF 1;  3A0K A;  4ZZ8 A;  5KC6 A;  1RIR A;  3IKW A;  5BNP B;  4AED C;  4QB2 A;  2E63 A;  1UMI A;  4B1L A;  4WZC A;  5F3C A;  2FBE A;  1JS9 A;  2ZHN A;  4QQO A;  4L0P A;  5C8C B;  1BQP A;  2PAM A;  2Y60 A;  4HN1 A;  3TOJ A;  4GJY A;  2RS3 1;  1J3P A;  1EY2 A;  5L7O A;  3JXS A;  2C1F A;  3MHZ A;  4ONU A;  4LPL A;  4YFZ A;  1YI7 A;  5FY0 A;  5BNP A;  4Y24 A;  3OGR A;  3KM5 A;  3FBY A;  4L2N A;  4G3Y C;  5G05 L;  5GLW A;  1LB2 A;  1WCD J;  2MEV 2;  1S55 A;  1ZRR A;  4UOJ A;  5BPX A;  4CEW B;  2BWA A;  3OD4 A;  1CD3 G;  1RUH 2;  1YEW A;  3ACH A;  3GNE A;  3GHN A;  3K46 A;  1FMD 1;  1VAK A;  4J25 A;  2BQP A;  4IUG A;  4EWD A;  1XYN A;  4LO7 A;  3JB8 A;  2R49 A;  1VR3 A;  1WMX A;  4K20 A;  2YU1 A;  4JZR A;  2WR9 A;  5KHH A;  1DQ4 A;  4Q26 A;  1J1T A;  1YJK A;  2B42 B;  4ZU4 A;  4CEW A;  3OD0 A;  4YW5 A;  3RNS A;  4LOT A;  5LWB A;  3SMH A;  3U10 A;  4LKD A;  4QQL A;  4BLI A;  1W2T A;  2J1U A;  5LRS A;  3AL5 A;  2BZD A;  4LHL A;  2BOJ A;  1DF0 A;  2DFB A;  5FTT C;  2J42 A;  2QQK A;  3JB4 C;  4CCD A;  4R9D A;  5KR7 A;  3DKW A;  2ZKN A;  5FLI A;  4Z92 B;  3T1M A;  1VMH A;  2GP5 A;  5JXH A;  5C33 A;  5A6Y A;  3AP9 A;  1MVQ A;  3E6C C;  2RDQ A;  2KR2 A;  5A6Z A;  1OFS A;  1Y3T A;  3HN3 A;  4ZU5 A;  5LEJ A;  3DEC A;  3NNL A;  3VLB B;  1KRI A;  4AED A;  1W6O B;  3U14 A;  1L7R A;  3VZN A;  1QJY 1;  4XUP A;  1UCX A;  1UKG A;  3W5M A;  2BJS A;  2VZO A;  1NCR C;  1H8T A;  1RUO A;  1HB3 A;  1UY4 A;  1U5Z A;  5CEH A;  4D7Y A;  1RVF 2;  4QB1 A;  3AP5 A;  4FP2 A;  5HI0 A;  1YQ6 A;  4Z82 A;  4LBK A;  1W6O A;  2Y6L A;  4KGQ A;  1W8N A;  3ZYJ B;  2ZCW A;  2XH6 A;  3FBM A;  3GCW A;  3KQ4 B;  2XKP A;  1F5F A;  4P9G A;  1QGL A;  4Y1U A;  5C4W C;  3I2O A;  1DBN A;  3LB9 A;  2K0G A;  1TG7 A;  2DDU A;  2VCC A;  4Q4V 1;  3DKQ A;  3U37 A;  5CAD A;  4NIG A;  3BU0 A;  2KD7 A;  1GFF 2;  1V6K A;  4TLG A;  5CKN A;  2P1B A;  3K48 A;  2BW8 A;  1OOP C;  1RUF 2;  3LE0 A;  5A7W B;  1W8H A;  1IS4 A;  3J8F 2;  3EQE A;  2IFR A;  3ASI A;  4YW1 A;  1S2B A;  2EAK A;  4XVH A;  2CY6 A;  2XLA A;  3U11 A;  2DU1 A;  2DUP A;  4DXZ A;  1BVP 1;  4C0B A;  1YCI A;  2YGL A;  5E16 A;  1W39 A;  2IXH A;  3T0A A;  4BQ3 A;  4KBB A;  4BH9 A;  5IVB A;  1LOF A;  2ZX3 A;  2HBT A;  1NA1 B;  1RUC 2;  2ORZ A;  1SBD A;  1WD3 A;  2VMC A;  3NKG A;  4YGB A;  5FIX A;  5CAZ A;  2UWA A;  3CF6 E;  4CXW A;  2W92 A;  4FQZ A;  4XQ4 A;  4RFT 0;  3C7O A;  4YGD A;  1T2X A;  1RUE 3;  2AAC A;  5GLV A;  3W58 A;  2YRO A;  4A6S A;  4XF4 A;  5F2W A;  3E5X A;  1IS5 A;  1NA1 A;  1PO2 1;  3LDR A;  3AXD A;  3MYX A;  3MW3 A;  2RS1 3;  2ADE A;  2Z2S B;  5JZG C;  2PA7 A;  2ZHK A;  4URA A;  4BWO A;  4ZS3 A;  5DMY A;  2W0X A;  4EV0 A;  3NAP B;  2BYV E;  5BYN A;  3H8R A;  2Q5T A;  1KQR A;  2QQL A;  1ZX5 A;  1OQE A;  2B46 X;  5A1F A;  3DUI A;  1OA3 A;  3M3Q A;  3TN9 3;  4FXG B;  4DFS A;  3UKN A;  4IEP A;  3X29 B;  3D4K A;  3ZR6 A;  3WF0 A;  1CAV B;  1UYX A;  2PLV 3;  1DYO A;  3NAP A;  1LOE A;  2BNO A;  2WWS A;  1J3R A;  1STM A;  4XZP A;  2E9Q A;  2EIG A;  4IXL A;  2WKK A;  5D8A C;  4LJH A;  5I8S A;  5F37 A;  3GF6 A;  3GGL A;  3VZO A;  3PTY A;  2WZE A;  3UES A;  1H2K A;  1ZA7 A;  4NOT A;  2AEY A;  2ETE A;  3ZXG A;  1MZE A;  1WCK A;  2AR6 A;  2O14 A;  3MLL A;  2WSU A;  1UNB A;  4LQR A;  3DGT A;  1MQT C;  3WNO A;  1RHI 1;  5FBJ A;  4ZON A;  5DQ0 A;  5FYU A;  2EA7 A;  4PBP A;  2YBP A;  1V6M A;  1O5U A;  1KXG A;  5IVV A;  4CDX B;  1QQP 1;  1HW5 A;  2LTN A;  1JBC A;  1GNH A;  1VIW B;  5JZG A;  1JYV A;  1T6B X;  1UAI A;  3T2O A;  5K4L A;  3UV9 A;  4F3J A;  3J7M A;  2ZA9 A;  5AVA A;  3VBS A;  3WDT A;  1OD5 A;  2X09 A;  5KXD A;  3H3Z A;  2VC9 A;  4CDX A;  3PVN A;  4YGC A;  1GYK A;  4AAX A;  4BYY A;  1KD7 A;  5LZ6 A;  4WM7 B;  5IK4 A;  3CJI C;  2XJP A;  1CQ9 A;  1NYW A;  2X53 S;  4CDQ B;  3ZSJ A;  3AX4 A;  4BQW A;  3MFC A;  4R52 A;  2OQ7 A;  3IDE A;  4L9B A;  4QB6 A;  1LKN A;  4WVM A;  4WM7 A;  2O1Q A;  1WME A;  4Q4X 3;  1JN2 P;  2A6Y A;  4FFG A;  4CDQ A;  1T6G C;  1PMJ X;  4KU7 A;  5IVF A;  2R1D A;  2WO2 A;  3NV3 A;  3C3V A;  3EJK A;  4LXL A;  4BB3 A;  1WLT A;  3N7K A;  4IEU A;  4IEZ A;  4H7L A;  2HWB 1;  5JR2 A;  3K4A A;  3Q9O A;  5BNN C;  1W8W A;  4BQ4 A;  1MS3 A;  3R0R A;  3VHR A;  3AJY A;  4IET A;  1HB2 A;  4FPE A;  1C3H A;  3F2Z A;  1POQ A;  2DFC A;  2VQA A;  2Q8D A;  3VBU B;  2ZMK A;  3MUY 1;  3FHI B;  4AFA A;  4COV A;  3NJZ A;  5J09 A;  2Y6J A;  5GLU A;  1JOB A;  2RMU 3;  3OEB A;  1ZVF A;  4W8J A;  2MHF A;  5FZC A;  2ZGT A;  2W1Q A;  3RZL A;  2RVA A;  3T09 A;  4O65 A;  4M3C F;  2VR4 A;  3QBQ A;  4LO4 B;  3SXW A;  3VBU A;  1GSL A;  2ARE A;  3ZIW A;  5A7N A;  5JOX A;  2I74 A;  3OTF A;  5HXM A;  4JVA A;  2FD8 A;  5IVJ A;  2IZW A;  5F1R A;  5FBZ A;  3RFR A;  2Q4S A;  4Y5S A;  3D8C A;  4AI1 A;  2DV9 A;  4QGN A;  2EAA A;  5EYX A;  5DZF A;  4KGG A;  1RUD 3;  1ASJ 3;  4XF0 A;  2LUW A;  2VZT A;  3RMX A;  4COZ A;  1ZRE A;  2WAA A;  1ZBA 2;  1XBF A;  3FWE A;  3JU9 A;  1JOJ A;  1Q8Q A;  4OQ9 A;  2GH8 A;  1W8T A;  2ZMN A;  1RUJ 2;  4FTE A;  3HJR A;  1W8U A;  5ABJ C;  3LA3 A;  4MGI E;  1VP6 A;  3U1X A;  3MZH A;  3UL2 A;  4B29 A;  3MO4 A;  3A0N A;  5BNN A;  2ZGK A;  2XVL A;  4CE8 A;  5JOZ A;  3VDB A;  5FLH A;  4QPI B;  1LHO A;  2RJ2 A;  2VTF A;  3AYC A;  4AR2 A;  5T5P A;  4XUN A;  4HG6 B;  3WF3 A;  4I0B A;  2W46 A;  4HN0 A;  4YG3 A;  2JDH A;  2VTX A;  4OZX A;  3TEW A;  1LEM A;  1DQ5 A;  4QPI A;  4QKN A;  4E9K A;  3MBW A;  3H3U A;  2Z79 A;  1C57 A;  3JCI A;  2C4X A;  1WBF A;  3NST A;  1JZ8 A;  3PME A;  2K2S A;  1B09 A;  1Z7S 2;  3J7H A;  4FFH A;  3NO8 A;  1V00 A;  3INA A;  4Z07 A;  3ZFE C;  4EE2 A;  4CCL A;  3VB9 A;  1F8V A;  1J1L A;  1CVN A;  5T52 A;  2C0Z A;  4W50 A;  5IFP A;  1W8Z A;  4ORF A;  1IS3 A;  4D6S A;  2VW0 A;  4HKL A;  3LEM A;  3DV8 A;  1TNF A;  4FT8 A;  2CL2 A;  4OMC A;  4F8A A;  1AL2 3;  4PLN A;  1UYZ A;  4OHX A;  3THP A;  1CZT A;  1MEC 3;  3MW2 A;  4I02 A;  4M3C B;  3AFG A;  5JUV A;  2R07 1;  2RDN A;  3FUO A;  3FZ3 A;  2CYF A;  3MGU A;  3MUZ 1;  1HV0 A;  3L2Y A;  5FYT A;  1BEV 3;  3PUI A;  4MGZ E;  5J48 A;  3B02 A;  2GN7 A;  1TME 3;  4FPY A;  1D4M 3;  2CAV A;  2OQ6 A;  4N90 A;  5CKQ A;  4ASM B;  4A6O A;  5FYH A;  4AI0 A;  3AMQ A;  2EVX A;  3ZDV A;  2ZGR A;  4QPG C;  3GBW A;  5FYZ A;  2XR4 A;  3CNA A;  1PGW 1;  2A73 B;  4I09 A;  5FXX A;  1LNS A;  1Y7B A;  4NID A;  1LGB A;  5C5U A;  3UT0 A;  4XJ8 A;  4A7Y A;  1EP0 A;  2XGX A;  5LBF A;  3T30 A;  4QX8 A;  1BJQ A;  4QHB A;  4YZ4 A;  5I91 A;  1WW4 A;  1VRH 3;  3ZN6 B;  1PO1 3;  2J1V A;  3MV0 1;  3OF1 A;  1UZZ A;  1W2U A;  3POS A;  4N53 C;  5FZF A;  3PU3 A;  4YPJ A;  5SV8 A;  3VDD B;  3VD4 A;  3APB A;  4E4D X;  5FZB A;  5JCT A;  3ZFE A;  3TEZ A;  3AKS A;  2WNU C;  2QQV A;  3HNB M;  3OBT A;  4UFL A;  3W9A A;  3CDZ B;  3ZN6 A;  5DAP A;  5F6K A;  5FPL A;  4CDU B;  3MI8 A;  3VDD A;  1YUD A;  2QTW B;  2WC2 A;  4QMA A;  1ST8 A;  1UPS A;  1X36 A;  4OI4 A;  2Q8C A;  4QX3 A;  3ZXE A;  3NQH A;  4BXS V;  4UW4 A;  3QH6 A;  4E8D A;  1FAT A;  3NJY A;  2JG8 B;  3ZXF A;  5CFC C;  1N1V A;  5FK8 A;  2PHL A;  1FYU A;  3FL7 A;  4DXR A;  3TWI A;  2VMF A;  2QKD A;  3H3L A;  2A3X A;  2C9A A;  2Z69 A;  4V2W A;  5HCF A;  4AVS A;  5LEK A;  1UXX X;  4Y33 A;  3D0S A;  3ES4 A;  4MUV A;  4P9W A;  1COV 3;  4TXW A;  1LUL A;  4LA2 A;  2JG8 A;  2BGC A;  4QPG A;  1E5H A;  2OUH A;  4U2A A;  4LT5 A;  1XNK A;  4ERO A;  1QJZ A;  4MGQ A;  4YVS B;  1UMZ A;  5ACA 3;  2HWE 1;  2VW1 A;  1OVS A;  1RUE 1;  4IDZ A;  3OUH A;  4LBJ A;  1UMH A;  1Z0H A;  4FPH A;  4JGZ B;  4QM8 A;  4QX1 A;  5FY5 A;  5JR7 B;  4AFD A;  5C7G A;  4W6Y A;  4FI9 A;  5KHG A;  2XJU A;  4HAN A;  5A80 A;  1OLR A;  4NRP A;  1KFU L;  2ENR A;  1AR9 3;  3N9L A;  4LE3 A;  5CZK A;  5FP9 A;  4JGZ A;  4JKL A;  5JXJ A;  2RDS A;  1QJU 2;  4DO0 A;  2A3Y A;  2QQM A;  1IZ3 A;  1S0G A;  3AK0 A;  3QLQ A;  3TN9 1;  1XQN A;  2JG9 C;  1W9W A;  3OBZ A;  4Q0V A;  3R4U A;  4B4P A;  5JOW A;  1OA4 A;  1RUI 3;  2PLV 1;  4X8P A;  1KDM A;  4LUK A;  1DGR N;  1MVE A;  2PTM A;  2R04 1;  1AYM 3;  1PM7 A;  4GIQ A;  3T4H B;  2P3K A;  2VBD A;  1JYW A;  4MHR A;  4BU2 A;  2UU8 A;  3WSO A;  3J7N A;  4WZF A;  1GZT A;  5JI7 A;  1ND2 B;  3NJX A;  3W20 A;  3U0Z A;  4XJU A;  4K8R B;  4M3C E;  4NRQ A;  4P9L A;  4XET A;  3SH3 A;  3WG3 A;  4YGE A;  4BXF A;  1JZ7 A;  2BDR A;  4IGO A;  3POI A;  4CDW C;  4QPY A;  4AK3 A;  1G9A A;  1ND2 A;  4O7X A;  1C28 A;  1Y9Q A;  4L11 A;  4P9J A;  1D4V B;  2P2K A;  2VMH A;  2WT2 A;  3AXE A;  3OEA A;  4XJA A;  2BGP A;  1PZ7 A;  4JCK A;  4M00 A;  2W1S A;  1LOA A;  1ULO A;  2BFU L;  1KIT A;  3FLP A;  4ZXE A;  1SG3 A;  3GJB A;  1FT9 A;  1V9U 2;  4EWE A;  4BZ4 A;  2DTY A;  5DAB A;  3ZOI A;  4UT5 A;  2WYS A;  3DCQ A;  1YFW A;  2BNM A;  3AZZ A;  3OSD A;  2FMD A;  2D5F A;  4DY5 A;  3ZYH A;  1XE7 A;  2WWU A;  4H55 A;  1O4T A;  2E7A A;  4A45 A;  5ERL A;  1I5P A;  1E5S A;  2ID4 A;  3Q8C A;  5DUU A;  2X05 A;  1REE A;  3O0V A;  3IDA A;  5FRE A;  1G9C A;  1QJF A;  3VZL A;  4NRM A;  2NMO A;  3QOP A;  4MHU A;  4S2D A;  1GQP A;  1XU2 A;  1UPI A;  3RS6 A;  2GNB A;  2VL4 A;  2ZGQ A;  4QX5 A;  2VGD A;  2FDI A;  1CX1 A;  2ADD A;  1H9P A;  5HV4 A;  5A32 B;  3FHA A;  5FZ4 A;  2VUA A;  1AXK A;  1YIP A;  1AYN 2;  3Q8B A;  4KNC A;  1O59 A;  1O4Z A;  2R32 A;  2B4K A;  4Q4V 3;  2XOM A;  4BHP A;  4HMZ A;  3ORJ A;  4ZPI A;  2BNN A;  2QFE A;  4IE4 A;  3W21 A;  3BTZ A;  2P34 A;  5IUQ A;  3GCX A;  2RMU 1;  1AXZ A;  1WW5 A;  1ZBE 2;  3H7J A;  4PHZ A;  4GWM A;  3IMM A;  2PXJ A;  1H6X A;  3K4D A;  5I0D A;  5FMD A;  3M3E A;  2VY0 A;  4E4H A;  1CES A;  1HRV 1;  1DGW A;  1HIX A;  3O0W A;  5DUX A;  1C5H A;  2Z5W A;  3K4Z A;  4XCB A;  5LA1 A;  1N1S A;  1SAC A;  2ET1 A;  3GYD A;  4QDS A;  2ARX A;  5GLT A;  4K3U A;  3HD8 B;  1N3Q A;  2VVD A;  4IEY A;  1EV1 2;  3RZJ A;  3VL8 A;  2ILM A;  2PHR A;  2OII A;  3CZU A;  5ISL A;  3UKT A;  1PGS A;  5HPO A;  3RYK A;  2HWC 2;  1RUD 1;  1ASJ 1;  1VMJ A;  3FX3 A;  4QGM A;  2QUO A;  5FP3 A;  1QKQ A;  5J3U A;  1BKZ A;  1R1A 1;  4RL7 A;  5A3N A;  5EXO A;  2FCV A;  1RVF 3;  2EID A;  4RR3 B;  3WNK A;  5FDB A;  5B4N A;  3W5N A;  3SH5 A;  2W47 A;  5EPA A;  1CZS A;  1US2 A;  3MW4 A;  4GWI A;  1FNZ A;  3WT3 A;  2WZR 2;  3LF7 A;  3ALQ A;  1ZYB A;  4FO9 A;  2VTX J;  4RR3 A;  3WXP A;  1SLL A;  3MIB A;  4QT6 A;  2GMP A;  2H6C A;  4COY A;  1AX1 A;  2HWD 1;  2Y34 A;  3NNG A;  4GH4 A;  2GME A;  1V6N A;  1IKP A;  1OBN A;  2VZ1 A;  3PUQ A;  3I3B A;  2Y26 A;  1SEF A;  1JYI A;  3HN1 A;  5H9P A;  2XBO 2;  2VD7 A;  4YZ2 A;  1SDD B;  2VVF A;  3ZM8 A;  1BCX A;  3WW2 A;  5E88 A;  2VAU A;  3ME2 A;  1I1E A;  1X50 A;  2ZML A;  3J8F 3;  2UUR A;  3TEX A;  1W6N B;  3E97 A;  5BV6 A;  3TAY A;  2ZKL A;  3FC0 A;  4ATE A;  2VZR A;  2SBA A;  4QXB A;  4XAE A;  4LBL A;  3I2H A;  5CKM A;  3AZX A;  1J3Q A;  3ZPO A;  4CU9 A;  4OZO A;  4FAH A;  1HKD A;  2NP0 A;  2WFP A;  3KT4 A;  1Q43 A;  5FJH A;  2HWC 1;  1W6N A;  5CIS A;  3H1Y A;  3KV4 A;  3ACL A;  1JZ2 A;  1RUC 3;  4XMA A;  1VAM A;  2A6Z A;  3NKT A;  5FZK A;  2Y33 A;  3L2H A;  1TQ5 A;  1AL2 1;  5A3L A;  3CEW A;  2VZU A;  3OY8 B;  5GAL A;  4HKW A;  1MEC 1;  4KWJ A;  2UYA A;  3POY A;  4XFG A;  1H1A A;  4IND A;  5IVE A;  4TTG A;  2HEV F;  5FZA A;  4GD4 A;  3WG2 A;  4AL9 A;  2JEM A;  3C8X A;  3ZYR A;  2XB6 C;  1OQD A;  3N4M A;  4D7S A;  3OY8 A;  4P02 B;  2RE9 A;  4JGY B;  1IG0 A;  1QQP 3;  1VBB 1;  2IWG B;  3DL3 A;  4Q2F A;  4KQ7 A;  1APN A;  2RS5 2;  4MG2 A;  1UWW A;  5DZG A;  3DF0 A;  2J1R A;  1GZW B;  2OZJ A;  2X8K A;  4O61 A;  2JIC A;  2CSG A;  2EF6 A;  2X29 A;  4P14 A;  1W3V A;  3ILR A;  5EV7 A;  5F32 A;  2B9V A;  2WT1 A;  1K5M C;  4JGY A;  4CEY C;  4FSJ A;  1C1F A;  4K6B A;  1W0N A;  2QE3 A;  2VW2 A;  3WNL A;  3O1R A;  3AYA A;  1DQ1 A;  1SLB A;  3VBO C;  2RR1 2;  1GZW A;  2ZEX A;  4FXK B;  2D93 A;  3CMG A;  2DTW A;  5JLV A;  2EXK A;  5IVC A;  4E2Q A;  3NW4 A;  4P9I A;  2VUD A;  2CDO A;  3VKF C;  5H9Q A;  4QX7 A;  3RPQ A;  1ZZ8 A;  3PJQ A;  4XJW A;  3O12 A;  1F15 A;  2ZJC A;  1GOF A;  1PK6 B;  3AYD A;  2H0V A;  5IYY A;  4D3W A;  5FQ0 B;  3IMN A;  1GAN A;  1R64 A;  1SLC A;  2AEZ A;  3VD3 A;  2R16 A;  4B7E A;  2KM2 A;  4TLF A;  2EXI A;  1QU0 A;  5JPM B;  2VZQ A;  3BUC A;  4LHS A;  3SKV A;  4PDW C;  1PK6 A;  1UOF A;  1VBA 2;  5F9T A;  3KT1 A;  2XML A;  3CQO A;  3PUH A;  4P9Y A;  4YSF A;  5FQ0 A;  1XE8 A;  2BUK A; 
#chains in the Genus database with same CATH homology
 4LK7 A;  1UOJ A;  2O14 A;  1WMX A;  3F95 A;  4LKE A;  4YWA A;  4YW6 A;  3ZYF A;  4BQ5 A;  4CPB D;  1GWM A;  1WZX A;  4CP9 B;  3ZYH A;  1W8T A;  4AL9 A;  2LRP A;  1WCU A;  4LKD A;  1GWK A;  2JWP A;  1W8U A;  2VXJ A;  4LK6 A;  2C24 A;  4CPB A;  1OH3 A;  3ORJ A;  4BQ3 A;  3ZYB A;  4YW7 A;  4BQ2 A;  1W8Z A;  4CP9 A;  1V0A A;  3UT0 A;  1HN0 A;  1OKO A;  4LKF A;  2WYF A;  2K46 A;  2Q1F A;  1GWL A;  4LJH A;  2KR2 A;  4A6S A;  2LRO A;  1W8W A;  1W90 A;  4BQ4 A;  5D21 A;  1L7L A;  1W9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...