2WYFA

Crystal structure of pa-il lectin complexed with agal12bgal-o-met at 2.4 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
b'AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA-I GALACTOPHILIC LECTIN
publication title Role of Water Molecules in Structure and Energetics of Pseudomonas Aeruginosa Lectin I Interacting with Disaccharides.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2wyfA00
4LKDA 4BQ5A 2WYFA 5D21A 1W8WA 3ZYFA 4A6SA 1W9FA 1WMXA 4BQ3A 1UOJA 1W90A 2Q1FA 3ZYBA 4CP9B 2O14A 1V0AA 1W8TA 3ZYHA 4CP9A 1WCUA 4LJHA 4YWAA 1OKOA 1GWLA 1GWMA 2C24A 2VXJA 4LKFA 4LKEA 2KR2A 2JWPA 2LROA 1L7LA 3F95A 4YW6A 4BQ2A 4CPBA 2K46A 4CPBD 4LK7A 3ORJA 4LK6A 1GWKA 2LRPA 4AL9A 3UT0A 1OH3A 4BQ4A 1W8ZA 1WZXA 4YW7A 1HN0A 1W8UA
chains in the Genus database with same CATH superfamily
1KEXA 2DCZA 1AL0G 3KV6A 4BQ5A 2WN2A 2X5IA 1P8JA 3VGIA 4CXXA 2YV8A 4XILA 5DDJ1 2RVAA 4HETA 5JXIA 3DKQA 4L9BA 5JSPA 2J1TA 4XJ9A 1YYNA 5DDJ2 5IVYA 1IG3A 2B4KA 2R063 4UWDA 4WM8C 5KHHA 3OGJA 1G9DA 5K8SA 4LBQA 2LROA 2Q5TA 4XE9A 5BNOA 2LS6A 2E31A 4QHZA 2Y8KA 3AP5A 2PQQA 1LKNA 2AEYA 3IZOA 1UYXA 4DXTA 2VGDA 1UOGA 3BVCA 1DFQA 4M0NA 4CXYA 1WLDA 1AYM3 2BNOA 3OUJA 2XLAA 1APNA 5FYUA 4XJZA 1UF2C 1S0FA 2RDRA 5ISLA 3O1RA 2Q1MA 2J1UA 1XE0A 3AX4A 3WF4A 2DYCA 1NA1A 4C8DA 2OQ6A 2IFWA 3KZ4C 4JGZC 3OY8A 1EYBA 3TYJA 1RC6A 2GAUA 3I59B 4AQ2A 5C5TA 3O7OA 4S2DA 4HVRA 4QM9A 2DCTA 5JPMB 4XF1A 5J96B 3LZZA 4Z2WA 1UYZA 3HQUA 3D6EA 2FDIA 1VRH1 3GJBA 2JG8C 1OLRA 3K77A 5A32A 3RYRA 5GLUA 5AVAA 4A45A 1K5MB 3OPWA 5LRRA 5C3PA 1VRH2 2AYHA 5FY5A 5F8PA 1FMD1 4BQ4A 4LO5B 1ZBE1 4QWNA 4AVSA 3H9AA 4BQYA 5DDJ3 4YZ1A 1CD3G 1LJ7A 4XDPA 1ZBE2 5EYXA 3ZFFC 3UGGA 2RDSA 3LIHA 3N35A 4QPIB 5F32A 2ZX0A 3N9LA 3LOBA 1GOGA 4IE7A 3Q8FA 3MDPA 5FWJA 3MI8A 2A7AA 4CCOA 1MZEA 4I0WB 4TZDA 3FBMA 2XL9A 4AFBA 4BLJA 2QVSB 1Z7S1 5FYVA 4A3ZA 1F8VA 1FV2A 1SLTA 1D4M2 2VTXJ 1WD3A 3AJYA 1FOD3 3CL1A 1SLCA 4OLLA 1K12A 5EIYB 5GZCA 5F5AA 1Z7S2 1SHWB 4NRQA 2FZ1A 1S0EA 3LEKA 1YFXA 5FZAA 1BLZA 1ZA7A 3TAYA 4YFZA 4AGVA 4YG6A 2QE3A 2Y6KA 3FLTA 1CX4A 2GALA 1EP0A 4JKLA 4IERA 4CUAA 2YBSA 3K3NA 3RJ2X 3WW2A 4XAAA 3WQBA 2LTNA 1UWWA 1HX6A 3E5UA 1YIFA 4IV3A 4IEXA 4LIUA 1VRH3 4XQDA 1LOBA 4X6RB 4LKFA 4MGQA 2NPIA 2W52A 3RWNA 1PMIA 4YG3A 3K48A 3DPRC 3BODA 1NE6A 4HKOA 2X53S 1ZBE3 3RJRA 1REEA 3AP4A 5C9AA 5FZ0A 3ZSLA 1H1IA 1F31A 4FPLA 4EN7B 1NXMA 3IIIA 5KR7A 1IQAA 4IEWA 1ODNA 2J7MA 5A7OA 5FZFA 3SKJE 3SCFA 1NCQA 1B35C 1D4M3 4XOGA 2CDPA 1ULEA 4BISA 5IFTA 3VBSC 4M3CB 2WT1A 4O7XA 1Z7S3 2R0FA 4BJ0A 4CP9B 4EE2A 1DF0A 3I2HA 3S57A 1URXA 1BVP1 4HK9A 3OEAA 4LNVA 3OTFA 4QKBA 2ATFA 4XFBA 3ZM8A 2VOXA 5L7OA 2GNDA 1X7NA 1DGWX 5JDBA 5BNQA 4OHZA 2DCJA 5KXCA 2PHFA 4ZU4A 1UQXA 1XNKA 2A71A 4RL7A 4D7YA 4YRDA 4MGZE 3WP4A 5I0RA 4DINB 2VOVA 3CJXA 1O3QA 1QJEA 4Y22A 3MUZ1 4MADA 3EB7A 5FK7A 1XNCA 5IT6A 1ND2B 3SXWA 3VZLA 1CAVA 1GFF2 2PHDA 1W9FA 1CPMA 3VKLA 2A3WA 2BGOA 1VBB3 4OVEA 2WO7A 3GF6A 5LEKA 2D3RA 4DOUA 4FXGB 1W8TA 1K5MC 4EWAA 3C3VA 5A7SA 2FD8A 3I2DA 1BJQA 3R4UA 3LKJA 4R4ZA 4SLIA 1NOVA 2GMMA 3ZLIA 1OMIA 4YW3A 4BQWA 1UU5A 4CCCA 4D69A 3GNEA 5C71A 3GBFA 2CY6A 3DGTA 4HPKA 3UYJA 4WZCA 5GLVA 5HCHA 2C1FA 4LLOA 5LBBA 3IWZA 5T54A 3H7JA 3L2YA 1OF3A 3NNLA 2J1RA 4QPIC 4Y1UA 3SITA 1G9FA 4XJUA 5DAPA 4C1XA 1UN1A 3LPFA 1X36A 4YW4A 4KG0A 4CEYA 4MXWB 4CE8A 1J3PA 4EWEA 2WFPA 1H30A 5FZOA 2E7AA 3HIFA 1NUKA 1TZOA 4COVA 3WDWA 1SCRA 3OGRA 3RVHA 4O9EA 5DUUA 2VAUA 2VZRA 4BXFA 1D4VB 4NR1A 1GZWB 2VTFA 1ZA4A 1FXZA 2XHNA 1UYPA 4PF5A 4CTEA 5HPOA 1AL23 4QX0A 1DP0A 3H7YA 5LB6A 1LR5A 2WA4A 3IT8A 4RD7A 3WW1A 3PJYA 2Q30A 1KJLA 5FPZA 1GV9A 1UKGA 3ORJA 1UX6A 2F4LA 3O1MA 4IGOA 3A0NA 5G04L 3RZKA 2AH2A 2XVGA 4GIQA 4UT5A 1WLTA 3MIHA 1OH4A 2V5YA 4TWTA 4B4RA 2DCYA 1C1FA 2PHRA 5C4WB 4Y1VA 3VD7A 2AREA 4YGBA 3IDAA 2Y6HA 2WNUA 1H2LA 3VBUA 4YVWA 3ZXEA 4CP1A 4IE5A 3T4HB 4W6WA 2VXRA 5IK8A 1K5JA 2DBIA 4ISQA 1DBNA 4P5YA 3T2PA 3IDBB 1UMZA 2DV9A 4KBBA 2X5IC 3ZSEA 3ZYGA 2RR12 4AFCA 4DS0A 3AL5A 1E5SA 1DQ0A 1X33A 3PURA 5FZ3A 2WBKA 5SV8A 3ZR6A 4OI0A 1WD4A 1K42A 1JHJA 3CDZB 4UFMA 4YW7A 1HXS3 5FFOC 5J37A 4FXKB 2JICA 1DU3D 2JDHA 2BV4A 5J48A 1XE7A 3AKTA 2EIBA 4H7MA 4LHLA 1HB2A 4IE6A 1GP4A 4XTMA 5A6ZA 5BNOC 2VY0A 3VBFA 4F8AA 1J3QA 3POBA 5CKMA 2G9ZA 4NRPA 2IZWA 4LPLA 1CAXA 2A6ZA 1NXD1 2DU1A 2VOTA 3V64A 2B7YA 4JQRA 3WT3A 3LIGA 2VMCA 1PO23 2E51A 4UW4A 4ARXA 2UU8A 3KT7A 4CSWA 1NA1C 3POFA 1TNFA 3NNJA 1VBC3 5FYYA 1YRZA 3QCWA 3U14A 3JQXA 1K3IA 3NNMA 3O1TA 1WWYA 1IGOA 4JCKA 4JTOA 3CQOA 3ILFA 4NPRA 3M2MA 5KC5A 1V00A 1UY0A 4CU8A 2WFF1 2B42B 3C7HA 3N7MA 2P3YA 5B2GB 4MG2A 4UW6A 5FP4A 4LLFA 2H6BA 2NN8A 2RR13 2WFF2 1QOTA 3IPVB 4KL1A 4BH9A 1YHFA 4MH0E 5A3TA 2ARCA 2R1DA 2EAAA 1Q8QA 2VPVA 3R05A 1AR71 1U5YA 1HRV1 4Q8LA 1PK6B 4OQ9A 1RUF1 3E1F1 1AR72 5EHDA 1HRV2 3UETA 3P5BA 3VDDB 1TME1 4PQQA 3P3NA 5FY1A 1UCXA 2GH8A 1RUF2 1SLLA 3VBOC 1TME2 1QJZA 3KV4A 4GKYA 4RFRB 3MGUA 5A3UA 2HLEA 3TEWA 5CEHA 2VQ0A 5A3PA 1ZRIA 3M3CA 5DZFA 3AYEA 3QH6A 1WMEA 2EVXA 3PVBB 4HN1A 3DXTA 4I3PA 1PGSA 2Y34A 2HWC1 3IN9A 3ZYBA 3VBRB 5T55A 2CWSA 5BNPB 1JZ8A 1LAJA 5A7WB 2ZGRA 2ZXQA 3ZO0B 3NV1A 2D93A 2JENA 1SLAA 4B7KA 2HWC2 2ZGKA 3MLLA 4TXWA 4CDUA 2AC1A 3POJA 1JYWA 2GN7A 1UD1A 4CPBA 1CONA 4AI9A 3FFQA 2PAKA 2NP0A 4DUVA 4ZXKA 4XPVA 4OI1A 3U75A 1I6XA 4HN0A 5D2AA 1TNRA 4GWNA 4Y20B 2WFF3 5SV5A 3OBAA 4YW2A 2SLIA 2JDZA 4B8EA 4JGYB 5JZGB 3CIHA 2XQRA 4NOTA 2JE8A 3AMMA 1AR73 2HH9A 2VMDA 1CWPA 2VVDA 4Y33A 5EQUA 3ZFEA 5C9AC 1JYTA 2NMNA 4NUBA 1RUF3 1DYOA 4V1PA 1F4HA 1TME3 4BZ4A 1OLMA 1CJDA 1YXWA 3POIA 4OHWA 5FBZA 4AAPA 3FFZA 4Q0UA 4AAXA 1NCQC 4BB3A 5DAXA 4XFIA 2J42A 2NYYA 1X50A 5T5LA 2UY9A 3UGFA 4AI3A 2RS51 5L36A 3WLUA 4UW3A 5FZBA 1UPSA 5F5QA 4DRRA 4MHRA 4BOWA 2RS52 1DHKB 4Y3OA 4AVTA 3BTAA 2WUHA 2ZEYA 4JTNA 5A3OA 4B4PA 2QDRA 2HWC3 1XPWA 5L7OC 3TEYA 1NZCA 1BEV3 3IKWA 3UKNA 4IE4A 4DB5A 3WR0A 2FDFA 1MPXA 1YJLA 2HKXA 3AZYA 3WDVA 2W91A 1O6UA 2BRTA 5GLWA 3RQ0A 5FY0A 4MV2A 3HT2A 2VZVA 2RDQA 1OFSA 5FOBB 1EAH1 2ZZQA 1WBLA 5A3MA 1DZQA 1T6GC 4I3GA 5DUXA 1GNZA 5FXZA 4F7ZA 5JOXA 1VALA 2ET1A 3TN91 5CVRA 1EAH2 4MOAA 4N53B 4QX5A 3CZUA 3KV9A 1C5HA 4Y5SA 4AW7A 1IKPA 3I3MA 4XCAA 3TN92 1E5HA 3LF7A 3I7DA 2XMLA 2EXIA 1MQTA 3AL6A 4CCKA 5T3NA 5J7MA 2X8KA 3MV01 1OPOA 1NCRB 1QXPA 2Z79A 5JMCA 1OLQA 4NVPA 4PT6A 4QQHA 1UZYA 4AEMA 3JUUA 3RDIA 5B4XA 2GNMA 2K2SA 4P9XA 3DYPA 3VDDC 1FAYA 3AJZA 3LAGA 3FHQA 4QT6A 1COV1 4XUQA 5FMCA 3SLIA 1V6JA 4H55A 2X09A 5DN2A 1UL9A 3CZJA 4GMP1 2JJ6A 3KMHA 4XF0A 3AMNA 4IW3A 2QCSB 3AP7A 3B9CA 1COV2 3NJZA 3I2JA 1CZTA 4QGLA 4QMAA 4QXHA 4FFGA 4UW5A 3H3LA 3ENRA 2R042 1WCQA 1PNFA 4XUTA 5KXDA 3ZMNA 3ES1A 4XIKA 4GXLA 1BZWA 2VQUA 2ZKNA 3D5OA 2Z4FA 1OH3A 5BNNB 4N8MA 4OI2A 2WC2A 4JQTA 2JE9A 2GMPA 1HN0A 1SCSA 1OOPB 3DEMA 2VMGA 1W6MB 5CU1A 3B69A 4FCAA 1WMXA 1CAUB 3MF6A 5I0UA 3FL7A 5CFCB 3T2QA 3PHMA 1EAH3 3T09A 4WVVA 5DAQA 4DZGA 4YW5A 5BUVA 3RYPA 2FCTA 4Q27A 2Z5WA 3TN93 4FPCA 2C24A 3JBG1 5J98B 4YYOA 3ZIXA 4XFGA 2IXLA 2ZBJA 4LHKA 3THDA 1SG3A 2Y60A 3AYCA 4PLNA 1HQWA 4R8HA 5FO7B 5A33B 4KWKA 2WABA 1W9YA 3JBG2 2P6CA 4RFT0 4JGYC 3VBUC 1AR83 5JZGC 1TEIA 4RS5B 1XNBA 3HWJA 2EALA 3NKTA 3WCSA 4K9SA 5DABA 5DQ0A 5LY2A 4AWDA 1NZIA 5ABJB 3KT1A 4FO9A 4BQ1A 1RJ7A 4E2GA 2DU0A 4W6XA 5F3EA 2R043 3EO6A 5T52A 3FZ3A 1KDMA 3AXEA 1W6OA 2AUYA 1XSQA 4CVUA 1AXZA 4W65A 1N3PA 1A78A 4YGCA 1AR61 4JZRA 4AI1A 1FT9A 4NHYA 4IXLA 4GB31 5C8CA 3ZXDA 3ECQA 3VBFC 5C8WA 1AR62 1ODMA 3AXDA 1W06A 1ZBA1 4GB32 3WG4A 1H8VA 3J9SA 1W0OA 2BWCA 3OG2A 2OA2A 5KXEA 2LM3A 4C91A 3FLPA 3ZSKA 4Q0QA 1RGSA 1ZBA2 4UF0A 5K0UB 3W9AA 4Z92B 4JKKA 5DG2A 4LR4A 3I2GA 3PL0A 5BV6A 3M3QA 2XPJA 4N53C 5FQ0B 1G9BA 1KJRA 3WG3A 1H6XA 2WQZC 2G19A 2ZCWA 3SEEA 5LRSA 1C8M3 2EXHA 1NCRC 1W9TA 2D6PA 2DTWA 3VD5A 4KBZA 2DFCA 2RS31 2ZMNA 5I0TA 2Q4SA 3LA7A 2YHJA 3LDRA 3L2HA 1F35A 1GQHA 4EYUA 1K45A 2RS32 4CUCA 4CRQA 2KXLA 2WIIB 1LOEA 3O1VA 2PHWA 4AGGA 2HBTA 1W9SA 1FATA 1G86A 1AR63 1UIJA 2ZAHA 3VKOA 3ZFGB 2ZEXA 3POWA 5IYYA 3WF1A 4PDWA 3ACLA 3EXUA 3T4VA 4XJAA 2I45A 5FMDA 2P6HA 2XUEA 2CYFA 3PUHA 4RGAA 2BZDA 2IUWA 1ZBA3 4PI2A 4LK7A 5IVEA 1OOPC 1Q8SA 5C5UA 3FHAA 2VUDA 1LOAA 4IEPA 2WO3A 4WM8B 4YM1A 3UJOA 5CFCC 1LHNA 2PMWB 4RA0A 5ACA1 1DGWA 3DCQA 4FOQA 4Y1ZA 4YVSA 4CDUC 4CP2A 1S0BA 1UOFA 4CU9A 5ACA2 1EPZA 4GH4A 4HZFA 4Y4RA 3SH5A 4XETA 5E88A 5I0SA 3WXPA 3U37A 1S55A 1QF3A 1GU3A 1W6NA 3W58A 1WW6A 4O61A 3N9OA 2BNNA 2RS33 5FRAA 4JGZB 3T3YA 2IVJA 4DUWA 4P9LA 1H2NA 1KDKA 2D6NA 3EYPA 4K8FA 2UWCA 2GC1A 4GAZA 4FPEA 4PLMA 5C6CA 5ABJC 2B39A 4DMIA 3ZFEC 1LGCA 2WYSA 5L73A 1E5RA 3H1YA 5IHRA 5FZ6A 2JG8B 5C3OA 1US2A 1JZ4A 4BXSV 5FP3A 3CJIB 4A6SA 1RL3A 3GZUC 4MHUA 3WDXA 1OLME 4AI0A 1Q56A 2ID4A 4XDOA 5H9RA 3RWKX 4PIYA 4ZONA 4EN6B 5F6LB 4ARYA 1OQEA 4BK5A 1M06G 3ZN4A 2VNVA 1R1A1 4RQPA 2DVAA 1RUG1 2BNMA 5F6KA 5A3WA 1FNZA 3WY6A 2FMYA 2W08A 2ZGSA 4Q0SA 3ZFFB 1GOFA 1W05A 1GR3A 1R1A2 4DEQA 3AKRA 2H0VA 4FPFA 1U12A 2W68A 4J6GA 5EJZB 2IXHA 3NMBA 1CZSA 4CPBD 1PM7A 2OUHA 1Y7BA 3DYOA 1QJX3 4HFSA 3ON7A 1T2XA 4FT8A 3HNBM 5ACA3 3NAPA 5FLJA 1EPWA 2ILMA 5G05L 1F4AA 2CSGA 4R52A 2E32A 4AI8A 4D6SA 3AVRA 3WNKA 5E8AA 2YPJA 4DUXA 3NO8A 4P00B 3P3PA 3PVEA 3H8XA 4H2AA 1CAWA 4S2HA 1V0AA 2Y6FA 5A6YA 4XFHA 1W6QA 4XF9A 1G8WA 2QQWA 3KGLA 2W2IA 2Q8EA 4TLGA 3NNFA 3Q8CA 4XQWA 4AEDB 1AR91 4URTA 5FZLA 1VRBA 2OZJA 5D8AC 1UX7A 1VLNA 4NN0A 1O3RA 1SQ4A 3GALA 1AR92 4DIQA 1G9AA 2BYVE 2WNVA 1W8OA 3PNAA 4S2GA 1MVQA 3DPRB 3ZFGC 3Q9OA 3I8TA 4N7UA 5EP9A 2WZ8A 4AVAA 4QQLA 4FP3A 2CL2A 5FYSA 5IAVA 1VR3A 2C9AA 3WW3A 4E4ZA 3AKSA 1BCXA 1C8NA 2YY1A 2OT7A 1OF4A 2BQPA 2HYKA 4QPWA 3V56A 4A6OA 1LHOA 2VVFA 1GP5A 1N1VA 1B35B 1WMDA 2YC2A 3VZKA 3MIGA 4Y4YA 2JDUA 3VBSB 1D2QA 3KV5A 2YBPA 3UV9A 3L9JT 3KVAA 1ZZ6A 2H6CA 2OW4A 1C57A 1IZ3A 4RYDA 2ZMKA 1AF9A 4UFJA 1QDOA 3BIEA 3LE0A 1M4WA 2XONA 1W8NA 3RZGA 1BK0A 1VBA3 5LA9A 1ONAA 3LEIA 3ACGA 3U07A 1TQ5A 1QXJA 2E7TA 3M3OA 2Q1FA 1ZYBA 1WUVA 1AZDA 1F5JA 5FYIA 3O1UA 3ZMOA 5F2WA 4LE3A 3ZN6A 1CN1A 4LO4B 1OKOA 4FOVA 4HANA 1VAKA 2BEOA 2NM1A 4M01A 4E4DX 5A1AA 1AX0A 3PUSA 4LOTA 4BU2A 3WDYA 2YB7A 3K46A 2LRPA 2V4VA 3CJIC 1RVF1 3RZMA 1BVVA 2MEV1 3UK9A 1RVF2 4QPGA 2PA7A 1OUXA 2MEV2 1FMD2 4PLOA 4YSFA 3WF3A 1RUI1 5L9RA 3ZXAC 2P3IA 5C8CC 3VD4A 2IFRA 4I0BA 4QB6A 4IESA 1T6BX 1RUI2 3PVOA 3NV3A 4AZZA 3LOIA 1SLIA 2DF7A 3IM0A 4QKDA 1MS0A 2VU9A 4HVOA 4KU8A 4NWWA 4YPJA 2A3YA 2J22A 3VZJA 3N9PA 1W2OA 2FHRA 2BVVA 2RJLA 5EJ3A 2G9FA 2PHUA 4OUSA 1ST8A 3QOPA 4YG0A 1UU6A 1PO11 2QQIA 5KHIA 3IB3A 4FOYA 2DVBA 1OURA 1Q8OA 1WCDJ 4E2QA 5FZ9A 1PO12 2QQVA 2GMEA 4AEDC 2ENRA 3AZXA 3POSA 3WSOA 4IQPA 1J58A 1JI6A 4I2OA 3O0XA 2YMZA 4FTSA 1YLLA 1QJFA 2UY8A 4LT5A 2DDUA 4YWAA 4CEWB 2VZPA 3E5XA 5IW0A 3CNAA 2WS91 2JE7A 5CKNA 3M7AA 1XNAA 1GANA 4HK8A 3NV4A 1AHSA 4NAMA 2KM2A 2MEV3 3PU3A 1FMD3 2B46X 4GKXA 2WS92 4B1MA 4AI2A 1S2EA 1HV0A 2VMFA 3OF1A 4EV0A 5LK5A 2ZACA 4ES8A 2TEPA 5DUWA 3ZSMA 4DXZA 2WZPP 1DGRA 1RUI3 3LEMA 3HQXA 1XYOA 2C9KA 3NRUA 4FTEA 2X5IB 4Q8KA 4QGNA 5JOYA 1WKYA 3A7QA 4AQSA 1A34A 1G6NA 1OKQA 4MGSA 4QX7A 1GYKA 2W1WA 2VW1A 3NV2A 3KWVA 3OBZA 2BOJA 3J8F1 4IGPA 3J4UH 2G9GA 4LBQB 1H0BA 2QZ3A 2F17A 3N3HA 5IUQA 5IFPA 5EXOA 3ACIA 3FLRA 5BNOB 1OD5A 3J8F2 1SPPA 1ND3A 2VECA 5FJHA 2HYXA 4Q1RA 4PF1A 2HJIA 4CDWA 2XJTA 4GH4C 3CHXA 2XGXA 4YARA 1F9KA 4IEUA 2QQPA 3C7OA 2YZ4A 4ONUA 1OQDA 4UXAA 4LE4A 4QHOA 2BJSA 1S2BA 2IXJA 3VKFC 1ZZBA 2FDGA 1TG7A 1JOBA 5D21A 1NA1B 1EY2A 3MW2A 4TYSA 5FZKA 3S30A 3OY8B 3U11A 3HN1A 3T0AA 2RV9A 4JX0A 3NSTA 2P34A 4FAGA 2WS93 2YROA 1XOYA 5FYHA 5E89A 2P3KA 2ZTNA 4D6QA 1GWLA 3D0SA 5FYCA 2XQXA 3O0WA 4INDA 2D98A 4LOSA 2OYZA 1REDA 4MYEA 5A32B 1H9WA 5A7PA 3ZIWA 2WNOA 1HKDA 1STMA 5E16A 1EV11 1MS4A 3PUQA 2UWAA 2XR4A 2RMU1 4NPMA 4JRAA 4LMFA 5FZHA 2QBXA 1QIQA 5F7UA 3I3BA 2XG3A 1EV12 1QXRA 1WW7A 2KD7A 2RMU2 3ZPOA 1DYPA 1LHWA 1R081 2ZX1A 3WINE 2QQNA 3GJAA 3MIEA 2ZHMA 4CDXA 4LULA 1R082 3J8F3 4B29A 2WZR1 5FYBA 3ALQA 3VBOB 4K6BA 1ZM1A 5IVCA 4Y5Z0 3ACHA 3C7GA 1SDDB 3D8CA 3HNYM 5CA6A 4F3JA 3NAPC 4XUNA 2XVKA 1OT5A 4HKWA 4Q4Y1 2VXJA 1ZNPA 1W2NA 2BFUS 1XBFA 4NAOA 2JDMA 2ETEA 4Q4Y2 3VZOA 4A44A 2WQ8A 5FPXA 1HB1A 1AYN1 1O4YA 5JPNB 1UMIA 4N43A 2YPDA 3OGGA 2R071 2QQMA 2V5DA 2VBDA 2PLV1 4TSVA 3VBHA 1AYN2 4ORFA 4DQAA 1ASJ1 1D2SA 2R072 1C5IA 2PLV2 3PJQA 4XXAA 5JLVA 1ASJ2 4OI4A 5JIUA 4RR3A 1W8HA 1A8MA 4IV3B 3FN9A 3KQRA 4QGMA 3H42B 2XKOA 3WUDA 2WO1A 2VQAA 3VDBA 4OHXA 3GZAA 1LOFA 4DNYA 4Q26A 2ZGUA 2HWF1 2HWB1 3H1MA 5T5JA 1W04A 4KMQA 3SISA 2XXZA 3AMQA 2X29A 5GKAC 3O5SA 1JUIA 2HWF2 2HWB2 4P5HA 1HRI1 3B94A 5C9AB 2G4IA 3TRSB 2HWE1 3THCA 1AX2A 1R083 2YU1A 3JU9A 3USUA 2BFUL 1G7YA 1HRI2 4GALA 3V0AA 1ZRCA 2HWE2 1LTEA 2O8OA 1A3KA 4LKDA 3HMYA 2XLGA 1NCQB 5LA0A 1AUYA 2WWJA 5D1IA 1DIWA 4ASLA 3IMMA 1I5PA 3OBRA 5I8SA 1LOCA 2HBUA 4Q4Y3 1TE1B 1JZ6A 1N1YA 2ZGLA 1WW4A 3VZNA 4YZ5A 4GWIA 4DPNA 1YFWA 3TWIA 5L7OB 1AYN3 2ZHKA 1QU0A 2FDHA 4XABA 3ST7A 2R073 2PLV3 5FZGA 4BIOA 1ASJ3 4LHNA 3BUCA 1MZ6A 2D5FA 3I2KA 4Y22B 4AFMA 1S0DA 1XRUA 3B9IA 2JDAA 3MEPA 4UAPA 1UNBA 1CAVB 3BOWA 4FQZA 1OA3A 1ZZCA 4TLFA 1JW6A 3WG1A 1DLLA 1XU2A 1I5ZA 2TNFA 1GQPA 3J7MA 3ROUA 4H3WA 3T1LA 2W95A 4QX8A 3VHOA 2BU9A 4QKFA 1W8FA 1Y9MA 2JECA 3GZTB 1CESA 1JUHA 1D0GA 4UFHA 4ZZ8A 1QJY1 4D3WA 4QB2A 4LBMA 4XHXA 4UFIA 2JB4A 1CIWA 1QJY2 4HPKB 1UZ0A 4JHZA 2CTVA 4HL0A 2VUCA 1DYKA 1H6YA 4QM8A 4IEZA 5CFDA 4KWLA 4ZHNA 2A75A 4AEKA 4CEYB 3RMXA 4MGKE 5CNAA 3C2UA 4A42A 5FZOB 4CU6A 2MHFA 4RHV1 1PIV1 2YGLA 2Q8DA 1W9WA 4ES9A 4IEVA 1H2MA 1YO8A 2EIEA 2IXIA 4H7LA 4RHV2 1PIV2 4CZSA 4BDVB 1LESA 2HEYF 5KWRA 4HT1T 4A7KA 2BBAA 2LALA 1MS1A 1IPSA 4MUVA 2XLFA 3W20A 4FP2A 3NNGA 2J1SA 1UO9A 4JHTA 5GM0A 3TOJA 4CDQA 1O8SA 1RHI1 3N36A 2GZWA 5L19A 3T0BA 3ES4A 2ARAA 5J1XA 1JHNA 4PJYA 4XZUG 4E4HA 1RHI2 1KQRA 4IV3C 3LEGA 5H9SA 1O59A 5HXVA 2B45X 1SFYA 5DXDA 3VHNA 2QDNA 4A7ZA 3GHNA 3FBYA 1HQLA 1RUD1 4NHKA 3ZYFA 3WNXA 3QBQA 3VBUB 1UOJA 1V9U1 2WNUB 4YVWB 4AVCA 1BKZA 3ZYRA 1KFUL 1UZZA 3KF3A 4UOJA 5F5CA 1RUD2 1HRV3 4GJYA 1V9U2 3OD0A 2ZGOA 3KSCA 1W2UA 1W39A 3DN7A 2RHPA 4QPYA 1XNTA 4ITCA 1PGL1 2YG0A 3LGRA 4LBNA 3B02A 2DVGA 1H8TA 1QHDA 2W87A 1LHVA 1AJOA 3LFIA 1ZREA 1PGL2 3CMGA 1IS5A 5LATA 1CJPA 3UKTA 4EJRA 4RHV3 1XXNA 2JX9A 1PIV3 4Q5OA 5A80A 3LSDA 4C1WA 2BERA 2GSYA 4G9SB 2A6WA 1PVC1 3MZHA 2VOKA 1W99A 4P02B 2VUAA 2XJUA 3O1SA 3VBFB 1YFUA 1PVC2 3AVSA 4LIVA 1YCIA 2C0ZA 2VBPA 4FAHA 4N7IA 2XDVA 1Y9GA 1DZTA 5KHJA 1GNYA 3I3EA 3QD6A 4K1ZA 3V0BA 1VMJA 3ATGA 2RG4A 1MS8A 4P9JA 3PUAA 3G6JB 2HEVF 3LA3A 4K3UA 3WQ1A 2Y33A 3Q8AA 4YZ3A 1SBDA 1WMFA 1ULGA 4XBNA 3ZX7A 3A23A 5AFEA 3BCWA 4K21A 5LWBA 5C70A 2ORZA 2FQPA 3UKVA 2C6SA 2J1VA 5FXXA 3WP6A 1J83A 2D43A 3LB9A 2WA3A 1D7PM 1RUD3 4Q0VA 1H1AA 1V9U3 2ZMLA 3RMYA 2R30A 2AZ5A 2VZUA 1VAVA 1BHGA 4Y26A 1XQNA 2FDJA 1YFYA 3FUOA 4XYXA 2W3JA 1RIRA 2XBO1 4PI0A 1DQ4A 5IATA 1GWMA 1VAMA 5FO8B 4WVWA 4XQ4A 4G3YC 5FV3A 4B4QA 4AHWA 4CEYC 3WNOA 4WVZA 2XBO2 5GZEA 4CXWA 1DG6A 2CHHA 2YFUA 2VC9A 2RS53 2XL7A 2WLPA 4LK6A 3W5NA 3DL3A 2XJVA 4AL9A 1PVC3 3J7HA 4AVVA 4KQ7A 4R4XA 1CPNA 5FZIA 1ZRFA 3KS7A 1O7FA 3TEZA 3I97A 1O4TA 2JD9A 2WAOA 2LW8A 1KXGA 1UY4A 3IDCB 4FPOB 1OHFA 3O0VA 4QU2A 1BMV1 3VZMA 1UY2A 2XH6A 1Q8VA 2O1QA 4K8RB 2MPFA 3KF5A 1J1LA 3FWEA 4N9IA 3FHIB 3S7EA 1JYVA 4GQ7A 1BMV2 3VBHC 4JRLA 4CDUB 2WNEA 4PIXA 4CCLA 3N9NA 3AP9A 5HXMA 4E2SA 4XJ8A 3AFKA 1LNSA 1O8PA 5FY9A 2PTMA 4RR3C 1FI2A 5F3GA 3N7LA 1GP6A 2WNUC 4YVWC 2VH9A 3PTYA 3BTYA 1O3TA 3N4MA 1V70A 2DVFA 3W59A 5JR2A 4CEWA 1GUIA 4H14A 2L9LA 2WO2A 4LO7A 4PBPA 4OYUA 2E53A 2WQ4A 4IEOA 4N9HA 5JWPA 1COV3 2FDKA 2W39A 3ZFEB 5JOZA 5FP8A 4GMP3 1YI9A 1J59A 2WWUA 2MNGA 5LEJA 1JYNA 2YGMA 2VR4A 1CVNA 5BXXA 1R64A 3K4AA 1UMHA 3OUHA 3M1HA 2GC2A 3C7FA 4XMAA 3VHPA 3AMHA 4Z2AA 2QQLA 1PGW1 4ZU7A 2VO5A 3OYWA 4QX1A 4V2VA 1QH6A 2EAKA 2PAMA 1PGW2 2A70A 4WVMA 1X8EA 1ZVFA 2JG8A 3MW3A 3NJXA 5CIRA 4YW1A 5IVJA 3BU0A 3LWCA 5HCFA 4A41A 4YM3A 4GZ9A 3ZYPA 5M0TA 3WF2A 3BALA 4AFAA 5F39A 1YQ6A 2UWBA 3AK0A 3EHKA 1OA2A 3BPZA 4FI9A 3JBG3 5IJRA 3SCGA 3DUIA 3ZYHA 5LCWL 2VJXA 1G9CA 4GMP0 1DCSA 3MIBA 2WRAA 2PYTA 3T2TA 1H9PA 1L7LA 1N3OA 1W6PB 4META 5ANQA 2ZKLA 4WM7A 3D82A 5BY5A 1ZZ7A 2DBNA 1ZZ8A 5CADA 3W5MA 1AXKA 2GC3A 4KH9A 2E7QA 2GC0A 2W1UA 1MQTB 1O5UA 4UI9L 1YQCA 2FBEA 2QKDA 3ZYIB 5E6HA 3DYMA 5D8AB 2ZABA 4DXSA 2ZGQA 2D3SA 2PHLA 3LDBA 4EN8B 3S5QA 4QQPA 2UURA 3FE5A 4IV1A 2P2KA 3ACFA 2JDNA 3ZDVA 1LU2A 4FPGA 3SKVA 4MZUA 1OXCA 4P9WA 3F2ZA 4LBKA 4KWUA 4XURA 1CR7A 3KT4A 4GB33 4QB1A 2PHXA 4FPYA 4NHLA 4U36A 1V6NA 1HLCA 4QX2A 5GALA 3M3EA 4QKNA 1SACA 2O8QA 5A1LA 2OVUA 1F15A 4I01A 2DUPA 2WR9A 2ADDA 4A4AA 5GZGA 2JG9A 3LPGA 4R9DA 2XVLA 5H9QA 3VDCA 3DPRA 3N7KA 3ILRA 4FSJA 1XYPA 2ZAAA 1KS4A 3JQWA 3MYXA 3WEZA 3M70A 3ZPYA 1NQDA 4MLOA 5KC6A 3I4IA 4EZHA 4AF9A 1S2KA 1C28A 1RUOA 2R7EB 2ZX2A 3VL9A 1VE0A 2X05A 3ZYJB 5FY7A 3CEWA 2YFZA 1BK1A 3OCPA 1JYIA 1JZ3A 5JVVA 3A4UA 3PU8A 4NHMA 3OBTA 3E97A 3F95A 1Y4WA 4YZ4A 5C3RA 1CZVA 4P9YA 2V73A 5APAA 4A3XA 1SFPA 3IAQA 2WT2A 1OSGA 4QDSA 1MZ5A 3R0RA 5FK8A 3SCHA 1I9RA 2A6YA 3I2IA 5FPLA 4NIAA 2OZ6A 2VNGA 4FPHA 1MS3A 2BWAA 2VZTA 3U78A 3KD4A 2QQKA 4LUKA 5LBEA 2ORXA 4BPZA 4BMEA 3VHRA 3GBWA 1HW5A 2VOWA 3U4XA 1IG0A 1YEWA 2ET7A 3RI9A 3FJSA 1UU4A 4X8NA 3I59A 2WL1A 5JSRA 3VKMA 3BOPA 3WHUA 2Z2SB 4DXRA 5FBJA 3H8RA 4BQ2A 5C8CB 1OVSA 1RUG2 4PCRA 4OZXA 1U5XA 2QQUA 4P9GA 3MW4A 1OQ1A 1K5MA 1QH7A 1OD3A 2Z69A 3GZEA 5GZDA 4LUMA 5F1RA 2ZHLA 5FZ1A 3EJKA 4UF0B 4AR2A 4M00A 2HEWF 1JU4A 4QX3A 2W5FA 2AACA 4LBLA 3HBZA 2XHKA 4KGQA 3B93A 4ASKA 1VMHA 4QPIA 1LHUA 3O1OA 2FZ2A 3J26N 2Y6JA 2R32A 5J36A 1UIKA 5JMOA 1WCUA 3AP6A 1GZCA 3V65A 4QXCA 1E57A 1H4GA 2D6KA 2JEMA 1MQTC 1QY4A 2A73B 1NLQA 2AGSA 1Y3TA 4ZY9A 5JAXA 4NPLA 3M4FA 5JXJA 2XJSA 1IPKA 3ILNA 4KU7A 5JUVA 4B7EA 2OUJA 4HBNA 1NT0A 2CAVA 4LEJA 5A1FA 4NWVA 4LORA 4MO3M 5IK7A 1IS6A 3PDQA 5A6XA 4Y1YA 5LA2A 3E6CC 4D0QA 2B9UA 1QMJA 2GN3A 2A3XA 3HD8B 2CGOA 4OMDA 5I91A 1QOOA 2VZSA 3ZXKA 1RYYA 1O3SA 2P1BA 5JXHA 1R1A3 1H2KA 1IHMA 1RTVA 1RUG3 2TUNA 2E9QA 3J7LA 3BTZA 4YM0A 4URAA 1N47A 2YYOA 4JV4A 4LJHA 4PDWB 5FP7A 2UYAA 4XEZA 1CIYA 3U1XA 1Q8PA 1W2TA 4M4RA 1REFA 5FOJB 1YJKA 1GZ9A 5FZEA 1H4HA 3NKGA 5DZEA 1KRIA 2ZOEB 4XVHA 1BBT1 4AOCA 1MEC1 2W94A 5HV4A 1GLHA 2VMEA 3FMGA 1U0AA 5FUNA 2V09A 4M4PA 1HDKA 5GZFA 4COUA 1BBT2 1MEC2 1W3VA 4XHBA 3E6DA 4YVSB 4OCTA 2BUKA 3H8OA 5AVPA 2WYFA 5AC91 4AQ6A 4K1YA 3ZXLA 1J1TA 4GH4B 4IETA 4CU7A 4CYDA 2Q1ZB 5CG8A 5AC92 2DUOA 3PIJA 4GWMA 3WP3A 4M3CA 4XIOA 2YC0A 3MFAA 1W6NB 1A6CA 1U5IA 3NJVA 4CP9A 5A70A 3S5AA 1AR93 1YQ2A 2P3JA 2WKKA 1QOSA 2B8MA 3RSJA 4ZZ5A 2WSVA 4CEWC 1KITA 3LA2A 3OOXA 2E63A 1FOD1 2YC4A 1RUC1 2YU2A 1GMMA 1O91A 2DVDA 3USSA 2IC1A 1W8ZA 3ZKYA 1I1EA 2W47A 4IUGA 1DZRA 3JD71 1FOD2 1RUC2 3BN6A 2H0BA 2J1EA 2W46A 2KA3A 3C7EA 1ND2A 3LDKA 3JD72 4Q1PA 4BQXA 1O5LA 3T2OA 3VD3A 4AXOA 2EA7A 4RQPB 4BK4A 4D94A 3DECA 1QKQA 3S7IA 2GP5A 4PBOA 1R1ZA 3SQOA 4BE3A 1Q3EA 4KNCA 4C90A 1BBT3 1MEC3 2A1XA 1TVGA 1GSLA 2BGCA 2C5DA 4QHBA 2Y0IA 3LQCA 3RPQA 2Y64A 5F2SA 4EQVA 2IXKA 3NAPB 3TNQA 1DQ5A 1RUH1 5AC93 2I07B 4CCEA 5J09A 3N9QA 4RSUA 3QH7A 1GICA 2WJSA 2ZX4A 2VZOA 4MXWA 1RUH2 1PM4A 5FREA 4AEJA 3VLBB 2RM21 4OMCA 1SZBA 3H3UA 3RRDA 3B01A 3R6SA 1CAWB 2VCBA 4WM7C 4X6QB 1HB4A 1WCKA 3VBOA 3NJYA 2RM22 4R9CA 4NIGA 3A22A 1D4M1 2O14A 1W6QB 3KGZA 1GZWA 5C3QA 2GNTA 3MIDA 5IVFA 1UYYA 4JDMA 1QJU1 2HWD1 4GJZA 4GWJA 1Y9QA 2WLQA 5AFBA 1X8MA 2JWPA 3MBWA 3APBA 1EUTA 4Q4V1 4HOOA 4W6YA 1RUC3 4XMIA 1C4RA 1RVF3 1QJU2 2HWD2 4JDOA 4XUPA 3JD73 4IV1C 3AYAA 4Q4V2 1W0PA 2WNVB 3UL2A 1VJ2A 5L9VA 1JOJA 4ZXEA 5IVBA 1UY1A 5FKCA 2W0XA 4MVTA 4UFLA 4HSLA 4NIHA 4XUOA 5FLHA 4OHYA 4PDWC 1LB2A 5FTTC 1IS4A 1JXNA 3VKNA 1V6MA 2WZEA 5C4WA 3KQ4B 1A8DA 3OPZA 1O4ZA 3UNPA 4LITA 3AB0A 1VBB1 5A6QA 3KCYA 2W92A 2WSUA 1WCSA 2JG9C 1PZ9A 1QEXA 2VNRA 1VBB2 3T0DA 4YGEA 1UZVA 4G4FA 2VCAA 3VB9A 1RUH3 4YVSC 1L7RA 1GWKA 2Y0OA 3GDBA 1UZWA 5IWFA 5CG9A 1PVXA 1JOPA 1D0HA 1W3XA 3T1MA 4DRVA 1PO13 4FOWA 2RM23 3CO2A 5CB7A 4P9IA 1GQGA 1VPHA 4Z1VA 5I93A 4NJ4A 4XDQA 3HR9A 3SMHA 4Z8BA 4M0HA 2BOIA 4FQ4A 5DG1A 4Q4X1 3ETPA 4FPJA 4BMBA 1H1MA 4HONA 5EPAA 2VBBA 4K7JA 1NLRA 1POV1 2ZGTA 3P6BA 2P4EA 4Q4X2 1QGLA 1QJU3 2HWD3 4IGQA 2D6LX 4QAWA 5FKBA 5FYMA 3ZN6B 4A2UA 5FAXA 2D3PA 4Q4V3 4BHPA 1HIXA 1MS9A 1IPJA 2OPWA 2OKXA 4AG4A 5KBFA 4LBOA 3HBKA 1DGRN 3MIFA 4OUEA 1AL21 2XJPA 1ULCA 1VB4A 3WDUA 1JODA 3RZLA 3K4ZA 1MVEA 1AL22 3ZDSA 1QNYA 4MGIE 1LOGA 5JI7A 3IIAA 4KWJA 1XB9A 2PN5A 4QPGB 3ZVXA 4RQPC 2CU5A 5LZ6A 4R9AA 4AK3A 3K3OA 1W8WA 1Y43B 3NW4A 2BPA2 3M3IA 4I30A 1WBFA 5JXGA 4DFSA 3RNSA 1UPIA 3AZVA 4Q0PA 4GA9A 5EJ1B 1HN1A 1SEFA 2JD4A 2CGPA 4AHXA 5GJ6A 3IPVA 4LO8A 4CUGA 2BDRA 4I0AA 1KFXL 2WZR2 1DQ6A 3AMPA 3ABZA 3D0JA 3N7JA 5JI9A 3U0ZA 4XF3A 3WQ0A 5EZWA 5FYZA 3I49A 2BGPA 4DY3A 1L3JA 1PK6A 1UW8A 1YNAA 1IKQA 1LCLA 4XBQA 2IVIB 1E5IA 5FZ8A 1U5ZA 4D8MA 3VDDA 4E9KA 1R091 4Y1XA 2A5ZA 1XYNA 5HV0A 1ENQA 4Q4X3 1JS9A 2CWMA 1WLCA 4XXPA 1R092 3HEIA 2A6VA 1POV3 2WDBA 3K2OA 3KLSA 3H1WA 5ANNA 2FCVA 4L11A 1HXS1 3GXUA 4DY5A 1VBE1 1WA4A 2UYBA 3ME2A 3EMRA 3RGBA 3ZXGA 3U10A 1NY71 4FFFA 1RUJ1 4L0PA 4EN9B 4RGGA 1HXS2 3I3QA 3WX5A 1VBE2 1UKRA 4COWA 1JYCA 4GD4A 4JAAA 1NY72 2ZX3A 1RUJ2 3JB8A 1PNGA 3G7DA 3VBRA 5BNPA 4AHYA 2WNVC 5A7WA 1DQ1A 2ZPXA 3KHBA 1J3RA 3U4SA 3WHTA 1EV13 4WBBA 3K51A 3CF6E 3VD9A 2RMU3 3BI3A 3BU7A 3M8LA 4P14A 2GNBA 3RFRA 1PO21 5JIAA 1OVPA 1OC1A 3A0KA 3LD8A 4XF4A 2QUOA 4PHZA 2B5HA 2RDNA 1BYHA 1QDCA 3QACA 3RZJA 1PO22 1WZXA 1VBC1 2I74A 4Y20A 3WP5A 2FMDA 3LSEA 4S2FA 1POV0 2WZR3 3WD5A 5FP9A 4FTBA 1VBC2 3MICA 4WV8A 1JMUB 2X10A 4JGYA 4Z82A 3SNMA 2OQ7A 5L9BA 5JZGA 2WN3A 1S0JA 2ZGNA 2EXJA 5I8TA 3BTXA 4J1XA 4BYYA 2RJ2A 5FR3A 1IS3A 3HQRA 2RR11 2P5BA 3OD4A 2VE1A 2Y26A 3GCWA 4C0BA 1SPPB 1ND3B 3KVBA 1R093 4QQ2A 3INAA 4D7TA 5FPVA 4CDWB 4E8DA 2OXBA 3VUOA 1RB8G 4ZU5A 3IAPA 3OGSA 1N1SA 4LQRA 1EUUA 1AVBA 1W03A 3IBMA 1ZRDA 1VBE3 1V6KA 3JB4C 4CUBA 1RUJ3 4IEQA 4M3CE 1KS5A 3MLKA 2N7GA 2DWRA 4UBGA 5GLZA 5CISA 3OJBA 2ZJCA 3PVNA 4E27A 3GYDA 2ES3A 4LTAA 3NVCA 3HAGA 4XBLA 3KHCA 1JTZX 1S0GA 5CYYA 3WNPA 5FZ7A 2JKXA 3OSDA 2HWF3 2HWB3 4QDRA 3DXUA 5FPAA 2VG9A 4MX3A 3ITQA 4D7SA 1HQNA 4SBVA 4OZOA 1JBCA 4BA6A 3OB8A 2O0OA 1XC6A 4EROA 2CGNA 1HRI3 4QPGC 1NLSA 1ND2C 1RMU1 2GH2A 2YXSA 2HWE3 5DMYA 1YQ5A 1NX9A 3DKWA 1RITA 1F5FA 4N53A 3SH4A 1RMU2 3TBDA 3T08A 4HMZA 5FXWA 3R4DB 2K9ZA 4YM2A 4UFKA 2B9VA 1JZ7A 3HPNA 2R49A 1NE4A 2V4AA 3AYDA 3O14A 4B3NA 2XWBB 4MXVA 3ZXJA 2JKBA 1NCRA 5IVVA 2AEZA 4CDXB 1RINA 2C4XA 5IAXA 3POYA 1JYXA 3MV11 1GBGA 1VIWB 3I2FA 2DTYA 1GZTA 4IEYA 4OUMA 2AENA 4J25A 4COZA 3WNLA 4N90A 4NIIA 2YUEA 3VV1A 4LBQD 1AX1A 1YC61 1W0NA 4HSJA 4LA2A 1C1LA 5IK4A 4D6RA 5JR7B 2JDYA 4GULA 4LBJA 4N43B 4YZ2A 1YI7A 2OS2A 2PELA 1FPN1 3VBHB 5FO9B 1V6OA 3AKQA 5BNNA 2EICA 1YQ8A 1VBD1 2R16A 3VDAA 2PHTA 3RZZA 2P37A 1FPN2 3MO4A 2VQTA 2VW2A 2VMHA 4L99A 1OOPA 1VBD2 1CX1A 3SC7X 1PZ7A 2V72A 4RR3B 1PHMA 2QQOA 1W6MA 1ACCA 2DCKA 3ETQA 4XCBA 1W90A 5LBCA 3ZXFA 1CAUA 2F4PA 1QJY3 3ZOIA 5CFCA 1S0IA 1HJFA 1BEV1 1SBEA 2XUMA 5FCCA 3POGA 5FDBA 3OGVA 1YWKA 1ZRRA 1RMU3 1RXFA 3RI8A 1FNYA 2PXJA 1CQ9A 1WA6X 4FFHA 1BEV2 2KR2A 3BGAA 1UXZA 3PTRB 1MZFA 2E26A 2PAEA 1W28A 2CDOA 4K40A 3ZSJA 4ATEA 3FX3A 2EXKA 1ZX5A 5A33A 3TEXA 5C4WC 3USUB 3H8UA 2G1MA 5LY1A 4Y5TA 2I2SA 4RGKA 3NWKA 4QD2A 3RS6A 4TN7A 1FYUA 2FCUA 3V0AB 1I3HA 4RS5A 5LW9A 1J84A 2VZ1A 2NMOA 3AM2A 3MPBA 2XWJB 3D4KA 4KG8A 1WW5A 3WQ7A 1SLBA 1LRHA 1ND3C 2ZZJA 1LECA 5ABJA 4I02A 4JC1A 4Q4W1 4LXLA 4CDWC 5EYYA 1CAXB 2NLRA 1JU3A 1QQP1 2D97A 2BW8A 2XJQA 4Q4W2 3UJQA 3N9MA 3GCXA 4W50A 5FY4A 4L8QA 1RHI3 5GLTA 4C0HA 1QQP2 3WNMA 2K46A 1FPN3 3CBNA 4L97A 3J7NA 4AE2A 1VBD3 2ZGMA 3ZN5A 3SHRA 2CV6A 5JOWA 5DZGA 5FLIA 4FFIA 3SEPA 1OFNA 2Z42A 5I0DA 4AQTA 2Q8OA 1AJKA 4AHZA 5K0UA 4MGTA 5FZMA 3TB0A 4MSVA 1Z0HA 1QNWA 4R9BA 2EIDA 3AC0A 4YFWA 2Y6GA 2NQYA 3MFCA 3T30A 3ASIA 3URFA 2CAUA 2VTXA 2XKPA 5FQ0A 5FUIA 1L7QA 2XB6C 1W6PA 2R6QA 4HKLA 5CFDB 5A7NA 3OPTA 2IXCA 3HN3A 2PFWA 2VZQA 4QXKA 5K9YA 2D44A 4O65A 4CDXC 5FXVA 3K4DA 4ZPIA 1MACA 5BPXA 4QXBA 3WZ1A 3EQEA 4XTPA 5C7GA 5JCTA 1AR81 3H50A 5EWSA 3PMSA 4KI5M 1HV1A 3GM8A 5D8AA 4J1WA 2E33A 2W1SA 1ULPA 3CU7A 4MGYE 4Q4W3 5EFUA 5A7QA 1AR82 2E6VA 1PK6C 4BQ3A 4M3CF 5ERLA 1LENA 1QQP3 3WNNA 2F6BA 5T50A 2K0GA 2CNAA 4LA3A 2R1BA 2VCMA 2Q0AA 5DAVA 3FC0A 4JVAA 4OFGA 4N43C 4AYUA 3P1IA 2R041 2JDPA 3BYWA 5E1RA 4BCUA 4HVQA 3KM5A 2VW0A 3ZFGA 1FV3A 5FMOS 1Q43A 5HCBA 4CDQB 3IDEA 3RZHA 1V6IA 4XFFA 5H9PA 4QU1A 3WUCA 3ZKUA 4EZ4A 1HJGA 1W2AX 1WLWA 5LK7B 2OX0A 4NHXA 1NAEA 1US3A 2WINB 4CCNA 4DEVA 3NL1A 5LBFA 2W9XA 1ULFA 1S0CA 4FVVA 4Z07A 4WM8A 1OA4A 3VBRC 5BNPC 2ZEZA 1LOFC 1WGPA 4WZFA 4XFAA 4ZS2A 3WOGA 4ZS3A 3POEA 1OPMA 2JDKA 3AZWA 2Y38A 2D40A 2XBO3 3MLJA 2VMIA 1LU1A 3D3AA 1DGLA 4XJWA 5F5IA 3O12A 4AFDA 3AFGA 3JZVA 5A3LA 3PMEA 1AXYA 4A7YA 4CCMA 1GNHA 1H8TB 4Q29A 4ISRA 3B3QE 3RYKA 4CCDA 2BVBA 4NE9A 4ASMB 5FPUA 1X9TA 3I54A 4JGZA 2ZHNA 5F3IA 2Q8CA 5KHKA 2OPKA 1C8M1 5FMOL 2J1AA 1ULDA 5FJKA 4LHSA 3UT0A 3CLPA 1POQA 2RS11 3PUIA 1NG0A 1BXHA 4O9GA 5DAWA 3WF0A 1C8M2 4BWOA 4XACA 2RS12 3KB5A 3CJIA 4ATFA 2VD7A 1PZ8A 1N1TA 5LASA 4F83A 1Q5OA 2D5HA 3K75B 4XW3A 3V0BB 1LODA 3MUY1 4YLZA 1S1AA 3WVJA 4LO6B 4HLTA 3ELNA 3O1PA 5CBLA 2Y6LA 4X8PA 5FYTA 2VUJA 3PLQA 3ZFFA 2VZ3A 2RE9A 1NYWA 3VL8A 4U2AA 3S0MA 1V6LA 1ENXA 3HOBA 4XFCA 3E6BA 5K7PA 4BM8A 2ADEA 2GP3A 3MF9A 4ZKTB 1VP6A 4NROA 2A6XA 4EN0A 4NIDA 2BP6A 4K20A 2QTWB 5A3NA 3IMNA 2VVEA 2QQJA 5T5PA 2DFBA 3PIGA 1XU1A 5CFDC 1LULA 4BLIA 2P17A 4XAEA 3AKPA 4IL7A 2ERFA 4W4ZA 1XE8A 3B00A 2GU9A 4AEDA 1UOBA 2C26A 1XNDA 4W8JA 1N3QA 2DUQA 2RS13 3KCCA 5FZ4A 4XZPA 1JN2P 5K4LA 4EWDA 1ZZ9A 2QNKA 3BB6A 2RJKA 1SMVA 3H3ZA 3W21A 5F37A 5DUVA 2YBKA 1S4CA 3MHZA 3UGHA 2D6MA 1MR5A 4UBHA 5HCAA 1DDLA 5I8YA 5IK5A 1TMF1 2D7FA 3HT1A 4CDQC 3GGLA 2WAAA 4QDQA 3FUQA 4E8CA 5BNNC 1TMF2 3QLQA 1DQ2A 2ARXA 2NZ9A 4LKEA 4JDNA 3THPA 4HG6B 3S6PA 3NQHA 5KXBA 1B35A 3BKZA 2VM9A 1X9PA 3HNMA 1Z78A 5F3CA 1VMFA 1PMJX 2TBVA 3VBSA 4HXCA 4PIZA 3MPPG 5J3UA 5FY8A 5C33A 1PX3A 2XJRA 1QJX1 1LEMA 1QWRA 2XOMA 3B5LB 3HJRA 3Q8BA 3RG0A 4LKSA 3WCRA 5HBAA 1X82A 3AZZA 3OUIA 1XSRA 4JKMA 1QJX2 1UAIA 1H8TC 2D6OX 4ET7A 5F9TA 1ENRA 2IWGB 5FZCA 4XC9A 2VULA 1NQJA 3THTA 3JXSA 3BIWE 4FBFA 2JB8A 5C3SA 4AGRA 3R4SA 4RN5A 1W6OB 3E5QA 4RS5C 5FUPA 1DLCA 3UESA 3I3DA 1ULOA 3CKHA 4L2NA 4DO0A 1RJ8A 3GBGA 4KGGA 4YW6A 1KD7A 3WDTA 4L92A 1OBNA 1UXXX 2ARBA 2QFEA 3Q8EA 4CCJA 3HVDA 1RUE1 4OULA 4B1LA 3OYWB 2JXAA 2ZA9A 5JSOA 4UYBA 2BTVC 4CP0A 2OIIA 1GOHA 1RUNA 1CGPA 1SFNA 1RUE2 3H0OA 4WVMB 3VN4A 2VNOA 1UY3A 1FX5A 2EIGA 2SBAA 1W8UA 2W1QA 5FIXA 1LGNA 3JCIA 1KGYA 2JIGA 1TMF3 1BQPA 3TNPB 3WV6A 4TTGA 1IOAA 2PQSA 3C8XA 1OI6A 1JZ5A 1PMHX 4Q2FA 1LEDA 3I2OA 5KHGA 3X29B 1RXGA 4P08A 4QQOA 2DURA 5FMBA 2R0HA 1VB2A 3DV8A 5TSWA 4OQ8A 1ALYA 1OUSA 3DF0A 3WW4A 3WG2A 4WM7B 2AR6A 2WWSA 1YIPA 2R061 3B7MA 5FZDA 5K0UC 4IE0A 3BPSA 4E4SA 2BBVA 1JZ2A 2EF6A 2WT0A 2R062 4NO4A 4CA9A 1SBFA 1C3HA 5CKQA 2ZS6B 3GHMA 1XJAA 4YGDA 1HB3A 1NKGA 2ZGPA 1PX4A 1JH5A 2VCCA 5DPNA 1LGBA 1AYM1 4AVBA 4IV1B 1GKBA 5EV7A 4IDZA 1VBA1 1YUDA 3KCXA 1B09A 2LUWA 2VL4A 4FPKA 5FWEA 1AYM2 4NRMA 1F2NA 3ZR5A 5B4NA 5HI0A 3SH3A 1IQDC 1ENSA 4NMIA 4COYA 5T5OA 1VBA2 5FPBA 2QZ2A 4YNIA 5BYNA 1RUE3 2ZEWA 4V2WA 3LCPA 2YDEA 1MS5A 3LFMA 2JIJA 5CZKA 2QJVA 1SDWA 2GDFA 3EBRA 2JG9B 4OHVA 3A21A 4I09A 4PQ9A 5CAZA 5LA1A 4Y24A 4BIFA 3OEBA
chains in the Genus database with same CATH topology
4LKDA 4BQ5A 2WYFA 5D21A 1W8WA 3ZYFA 4A6SA 1W9FA 1WMXA 4BQ3A 1UOJA 1W90A 2Q1FA 3ZYBA 4CP9B 2O14A 1V0AA 1W8TA 3ZYHA 4CP9A 1WCUA 4LJHA 4YWAA 1OKOA 1GWLA 1GWMA 2C24A 2VXJA 4LKFA 4LKEA 2KR2A 2JWPA 2LROA 1L7LA 3F95A 4YW6A 4BQ2A 4CPBA 2K46A 4CPBD 4LK7A 3ORJA 4LK6A 1GWKA 2LRPA 4AL9A 3UT0A 1OH3A 4BQ4A 1W8ZA 1WZXA 4YW7A 1HN0A 1W8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKD A;  4BQ5 A;  2WYF A;  5D21 A;  1W8W A;  3ZYF A;  4A6S A;  1W9F A;  1WMX A;  4BQ3 A;  1UOJ A;  1W90 A;  2Q1F A;  3ZYB A;  4CP9 B;  2O14 A;  1V0A A;  1W8T A;  3ZYH A;  4CP9 A;  1WCU A;  4LJH A;  4YWA A;  1OKO A;  1GWL A;  1GWM A;  2C24 A;  2VXJ A;  4LKF A;  4LKE A;  2KR2 A;  2JWP A;  2LRO A;  1L7L A;  3F95 A;  4YW6 A;  4BQ2 A;  4CPB A;  2K46 A;  4CPB D;  4LK7 A;  3ORJ A;  4LK6 A;  1GWK A;  2LRP A;  4AL9 A;  3UT0 A;  1OH3 A;  4BQ4 A;  1W8Z A;  1WZX A;  4YW7 A;  1HN0 A;  1W8U A; 
#chains in the Genus database with same CATH topology
 1KEX A;  2DCZ A;  1AL0 G;  3KV6 A;  4BQ5 A;  2WN2 A;  2X5I A;  1P8J A;  3VGI A;  4CXX A;  2YV8 A;  4XIL A;  5DDJ 1;  2RVA A;  4HET A;  5JXI A;  3DKQ A;  4L9B A;  5JSP A;  2J1T A;  4XJ9 A;  1YYN A;  5DDJ 2;  5IVY A;  1IG3 A;  2B4K A;  2R06 3;  4UWD A;  4WM8 C;  5KHH A;  3OGJ A;  1G9D A;  5K8S A;  4LBQ A;  2LRO A;  2Q5T A;  4XE9 A;  5BNO A;  2LS6 A;  2E31 A;  4QHZ A;  2Y8K A;  3AP5 A;  2PQQ A;  1LKN A;  2AEY A;  3IZO A;  1UYX A;  4DXT A;  2VGD A;  1UOG A;  3BVC A;  1DFQ A;  4M0N A;  4CXY A;  1WLD A;  1AYM 3;  2BNO A;  3OUJ A;  2XLA A;  1APN A;  5FYU A;  4XJZ A;  1UF2 C;  1S0F A;  2RDR A;  5ISL A;  3O1R A;  2Q1M A;  2J1U A;  1XE0 A;  3AX4 A;  3WF4 A;  2DYC A;  1NA1 A;  4C8D A;  2OQ6 A;  2IFW A;  3KZ4 C;  4JGZ C;  3OY8 A;  1EYB A;  3TYJ A;  1RC6 A;  2GAU A;  3I59 B;  4AQ2 A;  5C5T A;  3O7O A;  4S2D A;  4HVR A;  4QM9 A;  2DCT A;  5JPM B;  4XF1 A;  5J96 B;  3LZZ A;  4Z2W A;  1UYZ A;  3HQU A;  3D6E A;  2FDI A;  1VRH 1;  3GJB A;  2JG8 C;  1OLR A;  3K77 A;  5A32 A;  3RYR A;  5GLU A;  5AVA A;  4A45 A;  1K5M B;  3OPW A;  5LRR A;  5C3P A;  1VRH 2;  2AYH A;  5FY5 A;  5F8P A;  1FMD 1;  4BQ4 A;  4LO5 B;  1ZBE 1;  4QWN A;  4AVS A;  3H9A A;  4BQY A;  5DDJ 3;  4YZ1 A;  1CD3 G;  1LJ7 A;  4XDP A;  1ZBE 2;  5EYX A;  3ZFF C;  3UGG A;  2RDS A;  3LIH A;  3N35 A;  4QPI B;  5F32 A;  2ZX0 A;  3N9L A;  3LOB A;  1GOG A;  4IE7 A;  3Q8F A;  3MDP A;  5FWJ A;  3MI8 A;  2A7A A;  4CCO A;  1MZE A;  4I0W B;  4TZD A;  3FBM A;  2XL9 A;  4AFB A;  4BLJ A;  2QVS B;  1Z7S 1;  5FYV A;  4A3Z A;  1F8V A;  1FV2 A;  1SLT A;  1D4M 2;  2VTX J;  1WD3 A;  3AJY A;  1FOD 3;  3CL1 A;  1SLC A;  4OLL A;  1K12 A;  5EIY B;  5GZC A;  5F5A A;  1Z7S 2;  1SHW B;  4NRQ A;  2FZ1 A;  1S0E A;  3LEK A;  1YFX A;  5FZA A;  1BLZ A;  1ZA7 A;  3TAY A;  4YFZ A;  4AGV A;  4YG6 A;  2QE3 A;  2Y6K A;  3FLT A;  1CX4 A;  2GAL A;  1EP0 A;  4JKL A;  4IER A;  4CUA A;  2YBS A;  3K3N A;  3RJ2 X;  3WW2 A;  4XAA A;  3WQB A;  2LTN A;  1UWW A;  1HX6 A;  3E5U A;  1YIF A;  4IV3 A;  4IEX A;  4LIU A;  1VRH 3;  4XQD A;  1LOB A;  4X6R B;  4LKF A;  4MGQ A;  2NPI A;  2W52 A;  3RWN A;  1PMI A;  4YG3 A;  3K48 A;  3DPR C;  3BOD A;  1NE6 A;  4HKO A;  2X53 S;  1ZBE 3;  3RJR A;  1REE A;  3AP4 A;  5C9A A;  5FZ0 A;  3ZSL A;  1H1I A;  1F31 A;  4FPL A;  4EN7 B;  1NXM A;  3III A;  5KR7 A;  1IQA A;  4IEW A;  1ODN A;  2J7M A;  5A7O A;  5FZF A;  3SKJ E;  3SCF A;  1NCQ A;  1B35 C;  1D4M 3;  4XOG A;  2CDP A;  1ULE A;  4BIS A;  5IFT A;  3VBS C;  4M3C B;  2WT1 A;  4O7X A;  1Z7S 3;  2R0F A;  4BJ0 A;  4CP9 B;  4EE2 A;  1DF0 A;  3I2H A;  3S57 A;  1URX A;  1BVP 1;  4HK9 A;  3OEA A;  4LNV A;  3OTF A;  4QKB A;  2ATF A;  4XFB A;  3ZM8 A;  2VOX A;  5L7O A;  2GND A;  1X7N A;  1DGW X;  5JDB A;  5BNQ A;  4OHZ A;  2DCJ A;  5KXC A;  2PHF A;  4ZU4 A;  1UQX A;  1XNK A;  2A71 A;  4RL7 A;  4D7Y A;  4YRD A;  4MGZ E;  3WP4 A;  5I0R A;  4DIN B;  2VOV A;  3CJX A;  1O3Q A;  1QJE A;  4Y22 A;  3MUZ 1;  4MAD A;  3EB7 A;  5FK7 A;  1XNC A;  5IT6 A;  1ND2 B;  3SXW A;  3VZL A;  1CAV A;  1GFF 2;  2PHD A;  1W9F A;  1CPM A;  3VKL A;  2A3W A;  2BGO A;  1VBB 3;  4OVE A;  2WO7 A;  3GF6 A;  5LEK A;  2D3R A;  4DOU A;  4FXG B;  1W8T A;  1K5M C;  4EWA A;  3C3V A;  5A7S A;  2FD8 A;  3I2D A;  1BJQ A;  3R4U A;  3LKJ A;  4R4Z A;  4SLI A;  1NOV A;  2GMM A;  3ZLI A;  1OMI A;  4YW3 A;  4BQW A;  1UU5 A;  4CCC A;  4D69 A;  3GNE A;  5C71 A;  3GBF A;  2CY6 A;  3DGT A;  4HPK A;  3UYJ A;  4WZC A;  5GLV A;  5HCH A;  2C1F A;  4LLO A;  5LBB A;  3IWZ A;  5T54 A;  3H7J A;  3L2Y A;  1OF3 A;  3NNL A;  2J1R A;  4QPI C;  4Y1U A;  3SIT A;  1G9F A;  4XJU A;  5DAP A;  4C1X A;  1UN1 A;  3LPF A;  1X36 A;  4YW4 A;  4KG0 A;  4CEY A;  4MXW B;  4CE8 A;  1J3P A;  4EWE A;  2WFP A;  1H30 A;  5FZO A;  2E7A A;  3HIF A;  1NUK A;  1TZO A;  4COV A;  3WDW A;  1SCR A;  3OGR A;  3RVH A;  4O9E A;  5DUU A;  2VAU A;  2VZR A;  4BXF A;  1D4V B;  4NR1 A;  1GZW B;  2VTF A;  1ZA4 A;  1FXZ A;  2XHN A;  1UYP A;  4PF5 A;  4CTE A;  5HPO A;  1AL2 3;  4QX0 A;  1DP0 A;  3H7Y A;  5LB6 A;  1LR5 A;  2WA4 A;  3IT8 A;  4RD7 A;  3WW1 A;  3PJY A;  2Q30 A;  1KJL A;  5FPZ A;  1GV9 A;  1UKG A;  3ORJ A;  1UX6 A;  2F4L A;  3O1M A;  4IGO A;  3A0N A;  5G04 L;  3RZK A;  2AH2 A;  2XVG A;  4GIQ A;  4UT5 A;  1WLT A;  3MIH A;  1OH4 A;  2V5Y A;  4TWT A;  4B4R A;  2DCY A;  1C1F A;  2PHR A;  5C4W B;  4Y1V A;  3VD7 A;  2ARE A;  4YGB A;  3IDA A;  2Y6H A;  2WNU A;  1H2L A;  3VBU A;  4YVW A;  3ZXE A;  4CP1 A;  4IE5 A;  3T4H B;  4W6W A;  2VXR A;  5IK8 A;  1K5J A;  2DBI A;  4ISQ A;  1DBN A;  4P5Y A;  3T2P A;  3IDB B;  1UMZ A;  2DV9 A;  4KBB A;  2X5I C;  3ZSE A;  3ZYG A;  2RR1 2;  4AFC A;  4DS0 A;  3AL5 A;  1E5S A;  1DQ0 A;  1X33 A;  3PUR A;  5FZ3 A;  2WBK A;  5SV8 A;  3ZR6 A;  4OI0 A;  1WD4 A;  1K42 A;  1JHJ A;  3CDZ B;  4UFM A;  4YW7 A;  1HXS 3;  5FFO C;  5J37 A;  4FXK B;  2JIC A;  1DU3 D;  2JDH A;  2BV4 A;  5J48 A;  1XE7 A;  3AKT A;  2EIB A;  4H7M A;  4LHL A;  1HB2 A;  4IE6 A;  1GP4 A;  4XTM A;  5A6Z A;  5BNO C;  2VY0 A;  3VBF A;  4F8A A;  1J3Q A;  3POB A;  5CKM A;  2G9Z A;  4NRP A;  2IZW A;  4LPL A;  1CAX A;  2A6Z A;  1NXD 1;  2DU1 A;  2VOT A;  3V64 A;  2B7Y A;  4JQR A;  3WT3 A;  3LIG A;  2VMC A;  1PO2 3;  2E51 A;  4UW4 A;  4ARX A;  2UU8 A;  3KT7 A;  4CSW A;  1NA1 C;  3POF A;  1TNF A;  3NNJ A;  1VBC 3;  5FYY A;  1YRZ A;  3QCW A;  3U14 A;  3JQX A;  1K3I A;  3NNM A;  3O1T A;  1WWY A;  1IGO A;  4JCK A;  4JTO A;  3CQO A;  3ILF A;  4NPR A;  3M2M A;  5KC5 A;  1V00 A;  1UY0 A;  4CU8 A;  2WFF 1;  2B42 B;  3C7H A;  3N7M A;  2P3Y A;  5B2G B;  4MG2 A;  4UW6 A;  5FP4 A;  4LLF A;  2H6B A;  2NN8 A;  2RR1 3;  2WFF 2;  1QOT A;  3IPV B;  4KL1 A;  4BH9 A;  1YHF A;  4MH0 E;  5A3T A;  2ARC A;  2R1D A;  2EAA A;  1Q8Q A;  2VPV A;  3R05 A;  1AR7 1;  1U5Y A;  1HRV 1;  4Q8L A;  1PK6 B;  4OQ9 A;  1RUF 1;  3E1F 1;  1AR7 2;  5EHD A;  1HRV 2;  3UET A;  3P5B A;  3VDD B;  1TME 1;  4PQQ A;  3P3N A;  5FY1 A;  1UCX A;  2GH8 A;  1RUF 2;  1SLL A;  3VBO C;  1TME 2;  1QJZ A;  3KV4 A;  4GKY A;  4RFR B;  3MGU A;  5A3U A;  2HLE A;  3TEW A;  5CEH A;  2VQ0 A;  5A3P A;  1ZRI A;  3M3C A;  5DZF A;  3AYE A;  3QH6 A;  1WME A;  2EVX A;  3PVB B;  4HN1 A;  3DXT A;  4I3P A;  1PGS A;  2Y34 A;  2HWC 1;  3IN9 A;  3ZYB A;  3VBR B;  5T55 A;  2CWS A;  5BNP B;  1JZ8 A;  1LAJ A;  5A7W B;  2ZGR A;  2ZXQ A;  3ZO0 B;  3NV1 A;  2D93 A;  2JEN A;  1SLA A;  4B7K A;  2HWC 2;  2ZGK A;  3MLL A;  4TXW A;  4CDU A;  2AC1 A;  3POJ A;  1JYW A;  2GN7 A;  1UD1 A;  4CPB A;  1CON A;  4AI9 A;  3FFQ A;  2PAK A;  2NP0 A;  4DUV A;  4ZXK A;  4XPV A;  4OI1 A;  3U75 A;  1I6X A;  4HN0 A;  5D2A A;  1TNR A;  4GWN A;  4Y20 B;  2WFF 3;  5SV5 A;  3OBA A;  4YW2 A;  2SLI A;  2JDZ A;  4B8E A;  4JGY B;  5JZG B;  3CIH A;  2XQR A;  4NOT A;  2JE8 A;  3AMM A;  1AR7 3;  2HH9 A;  2VMD A;  1CWP A;  2VVD A;  4Y33 A;  5EQU A;  3ZFE A;  5C9A C;  1JYT A;  2NMN A;  4NUB A;  1RUF 3;  1DYO A;  4V1P A;  1F4H A;  1TME 3;  4BZ4 A;  1OLM A;  1CJD A;  1YXW A;  3POI A;  4OHW A;  5FBZ A;  4AAP A;  3FFZ A;  4Q0U A;  4AAX A;  1NCQ C;  4BB3 A;  5DAX A;  4XFI A;  2J42 A;  2NYY A;  1X50 A;  5T5L A;  2UY9 A;  3UGF A;  4AI3 A;  2RS5 1;  5L36 A;  3WLU A;  4UW3 A;  5FZB A;  1UPS A;  5F5Q A;  4DRR A;  4MHR A;  4BOW A;  2RS5 2;  1DHK B;  4Y3O A;  4AVT A;  3BTA A;  2WUH A;  2ZEY A;  4JTN A;  5A3O A;  4B4P A;  2QDR A;  2HWC 3;  1XPW A;  5L7O C;  3TEY A;  1NZC A;  1BEV 3;  3IKW A;  3UKN A;  4IE4 A;  4DB5 A;  3WR0 A;  2FDF A;  1MPX A;  1YJL A;  2HKX A;  3AZY A;  3WDV A;  2W91 A;  1O6U A;  2BRT A;  5GLW A;  3RQ0 A;  5FY0 A;  4MV2 A;  3HT2 A;  2VZV A;  2RDQ A;  1OFS A;  5FOB B;  1EAH 1;  2ZZQ A;  1WBL A;  5A3M A;  1DZQ A;  1T6G C;  4I3G A;  5DUX A;  1GNZ A;  5FXZ A;  4F7Z A;  5JOX A;  1VAL A;  2ET1 A;  3TN9 1;  5CVR A;  1EAH 2;  4MOA A;  4N53 B;  4QX5 A;  3CZU A;  3KV9 A;  1C5H A;  4Y5S A;  4AW7 A;  1IKP A;  3I3M A;  4XCA A;  3TN9 2;  1E5H A;  3LF7 A;  3I7D A;  2XML A;  2EXI A;  1MQT A;  3AL6 A;  4CCK A;  5T3N A;  5J7M A;  2X8K A;  3MV0 1;  1OPO A;  1NCR B;  1QXP A;  2Z79 A;  5JMC A;  1OLQ A;  4NVP A;  4PT6 A;  4QQH A;  1UZY A;  4AEM A;  3JUU A;  3RDI A;  5B4X A;  2GNM A;  2K2S A;  4P9X A;  3DYP A;  3VDD C;  1FAY A;  3AJZ A;  3LAG A;  3FHQ A;  4QT6 A;  1COV 1;  4XUQ A;  5FMC A;  3SLI A;  1V6J A;  4H55 A;  2X09 A;  5DN2 A;  1UL9 A;  3CZJ A;  4GMP 1;  2JJ6 A;  3KMH A;  4XF0 A;  3AMN A;  4IW3 A;  2QCS B;  3AP7 A;  3B9C A;  1COV 2;  3NJZ A;  3I2J A;  1CZT A;  4QGL A;  4QMA A;  4QXH A;  4FFG A;  4UW5 A;  3H3L A;  3ENR A;  2R04 2;  1WCQ A;  1PNF A;  4XUT A;  5KXD A;  3ZMN A;  3ES1 A;  4XIK A;  4GXL A;  1BZW A;  2VQU A;  2ZKN A;  3D5O A;  2Z4F A;  1OH3 A;  5BNN B;  4N8M A;  4OI2 A;  2WC2 A;  4JQT A;  2JE9 A;  2GMP A;  1HN0 A;  1SCS A;  1OOP B;  3DEM A;  2VMG A;  1W6M B;  5CU1 A;  3B69 A;  4FCA A;  1WMX A;  1CAU B;  3MF6 A;  5I0U A;  3FL7 A;  5CFC B;  3T2Q A;  3PHM A;  1EAH 3;  3T09 A;  4WVV A;  5DAQ A;  4DZG A;  4YW5 A;  5BUV A;  3RYP A;  2FCT A;  4Q27 A;  2Z5W A;  3TN9 3;  4FPC A;  2C24 A;  3JBG 1;  5J98 B;  4YYO A;  3ZIX A;  4XFG A;  2IXL A;  2ZBJ A;  4LHK A;  3THD A;  1SG3 A;  2Y60 A;  3AYC A;  4PLN A;  1HQW A;  4R8H A;  5FO7 B;  5A33 B;  4KWK A;  2WAB A;  1W9Y A;  3JBG 2;  2P6C A;  4RFT 0;  4JGY C;  3VBU C;  1AR8 3;  5JZG C;  1TEI A;  4RS5 B;  1XNB A;  3HWJ A;  2EAL A;  3NKT A;  3WCS A;  4K9S A;  5DAB A;  5DQ0 A;  5LY2 A;  4AWD A;  1NZI A;  5ABJ B;  3KT1 A;  4FO9 A;  4BQ1 A;  1RJ7 A;  4E2G A;  2DU0 A;  4W6X A;  5F3E A;  2R04 3;  3EO6 A;  5T52 A;  3FZ3 A;  1KDM A;  3AXE A;  1W6O A;  2AUY A;  1XSQ A;  4CVU A;  1AXZ A;  4W65 A;  1N3P A;  1A78 A;  4YGC A;  1AR6 1;  4JZR A;  4AI1 A;  1FT9 A;  4NHY A;  4IXL A;  4GB3 1;  5C8C A;  3ZXD A;  3ECQ A;  3VBF C;  5C8W A;  1AR6 2;  1ODM A;  3AXD A;  1W06 A;  1ZBA 1;  4GB3 2;  3WG4 A;  1H8V A;  3J9S A;  1W0O A;  2BWC A;  3OG2 A;  2OA2 A;  5KXE A;  2LM3 A;  4C91 A;  3FLP A;  3ZSK A;  4Q0Q A;  1RGS A;  1ZBA 2;  4UF0 A;  5K0U B;  3W9A A;  4Z92 B;  4JKK A;  5DG2 A;  4LR4 A;  3I2G A;  3PL0 A;  5BV6 A;  3M3Q A;  2XPJ A;  4N53 C;  5FQ0 B;  1G9B A;  1KJR A;  3WG3 A;  1H6X A;  2WQZ C;  2G19 A;  2ZCW A;  3SEE A;  5LRS A;  1C8M 3;  2EXH A;  1NCR C;  1W9T A;  2D6P A;  2DTW A;  3VD5 A;  4KBZ A;  2DFC A;  2RS3 1;  2ZMN A;  5I0T A;  2Q4S A;  3LA7 A;  2YHJ A;  3LDR A;  3L2H A;  1F35 A;  1GQH A;  4EYU A;  1K45 A;  2RS3 2;  4CUC A;  4CRQ A;  2KXL A;  2WII B;  1LOE A;  3O1V A;  2PHW A;  4AGG A;  2HBT A;  1W9S A;  1FAT A;  1G86 A;  1AR6 3;  1UIJ A;  2ZAH A;  3VKO A;  3ZFG B;  2ZEX A;  3POW A;  5IYY A;  3WF1 A;  4PDW A;  3ACL A;  3EXU A;  3T4V A;  4XJA A;  2I45 A;  5FMD A;  2P6H A;  2XUE A;  2CYF A;  3PUH A;  4RGA A;  2BZD A;  2IUW A;  1ZBA 3;  4PI2 A;  4LK7 A;  5IVE A;  1OOP C;  1Q8S A;  5C5U A;  3FHA A;  2VUD A;  1LOA A;  4IEP A;  2WO3 A;  4WM8 B;  4YM1 A;  3UJO A;  5CFC C;  1LHN A;  2PMW B;  4RA0 A;  5ACA 1;  1DGW A;  3DCQ A;  4FOQ A;  4Y1Z A;  4YVS A;  4CDU C;  4CP2 A;  1S0B A;  1UOF A;  4CU9 A;  5ACA 2;  1EPZ A;  4GH4 A;  4HZF A;  4Y4R A;  3SH5 A;  4XET A;  5E88 A;  5I0S A;  3WXP A;  3U37 A;  1S55 A;  1QF3 A;  1GU3 A;  1W6N A;  3W58 A;  1WW6 A;  4O61 A;  3N9O A;  2BNN A;  2RS3 3;  5FRA A;  4JGZ B;  3T3Y A;  2IVJ A;  4DUW A;  4P9L A;  1H2N A;  1KDK A;  2D6N A;  3EYP A;  4K8F A;  2UWC A;  2GC1 A;  4GAZ A;  4FPE A;  4PLM A;  5C6C A;  5ABJ C;  2B39 A;  4DMI A;  3ZFE C;  1LGC A;  2WYS A;  5L73 A;  1E5R A;  3H1Y A;  5IHR A;  5FZ6 A;  2JG8 B;  5C3O A;  1US2 A;  1JZ4 A;  4BXS V;  5FP3 A;  3CJI B;  4A6S A;  1RL3 A;  3GZU C;  4MHU A;  3WDX A;  1OLM E;  4AI0 A;  1Q56 A;  2ID4 A;  4XDO A;  5H9R A;  3RWK X;  4PIY A;  4ZON A;  4EN6 B;  5F6L B;  4ARY A;  1OQE A;  4BK5 A;  1M06 G;  3ZN4 A;  2VNV A;  1R1A 1;  4RQP A;  2DVA A;  1RUG 1;  2BNM A;  5F6K A;  5A3W A;  1FNZ A;  3WY6 A;  2FMY A;  2W08 A;  2ZGS A;  4Q0S A;  3ZFF B;  1GOF A;  1W05 A;  1GR3 A;  1R1A 2;  4DEQ A;  3AKR A;  2H0V A;  4FPF A;  1U12 A;  2W68 A;  4J6G A;  5EJZ B;  2IXH A;  3NMB A;  1CZS A;  4CPB D;  1PM7 A;  2OUH A;  1Y7B A;  3DYO A;  1QJX 3;  4HFS A;  3ON7 A;  1T2X A;  4FT8 A;  3HNB M;  5ACA 3;  3NAP A;  5FLJ A;  1EPW A;  2ILM A;  5G05 L;  1F4A A;  2CSG A;  4R52 A;  2E32 A;  4AI8 A;  4D6S A;  3AVR A;  3WNK A;  5E8A A;  2YPJ A;  4DUX A;  3NO8 A;  4P00 B;  3P3P A;  3PVE A;  3H8X A;  4H2A A;  1CAW A;  4S2H A;  1V0A A;  2Y6F A;  5A6Y A;  4XFH A;  1W6Q A;  4XF9 A;  1G8W A;  2QQW A;  3KGL A;  2W2I A;  2Q8E A;  4TLG A;  3NNF A;  3Q8C A;  4XQW A;  4AED B;  1AR9 1;  4URT A;  5FZL A;  1VRB A;  2OZJ A;  5D8A C;  1UX7 A;  1VLN A;  4NN0 A;  1O3R A;  1SQ4 A;  3GAL A;  1AR9 2;  4DIQ A;  1G9A A;  2BYV E;  2WNV A;  1W8O A;  3PNA A;  4S2G A;  1MVQ A;  3DPR B;  3ZFG C;  3Q9O A;  3I8T A;  4N7U A;  5EP9 A;  2WZ8 A;  4AVA A;  4QQL A;  4FP3 A;  2CL2 A;  5FYS A;  5IAV A;  1VR3 A;  2C9A A;  3WW3 A;  4E4Z A;  3AKS A;  1BCX A;  1C8N A;  2YY1 A;  2OT7 A;  1OF4 A;  2BQP A;  2HYK A;  4QPW A;  3V56 A;  4A6O A;  1LHO A;  2VVF A;  1GP5 A;  1N1V A;  1B35 B;  1WMD A;  2YC2 A;  3VZK A;  3MIG A;  4Y4Y A;  2JDU A;  3VBS B;  1D2Q A;  3KV5 A;  2YBP A;  3UV9 A;  3L9J T;  3KVA A;  1ZZ6 A;  2H6C A;  2OW4 A;  1C57 A;  1IZ3 A;  4RYD A;  2ZMK A;  1AF9 A;  4UFJ A;  1QDO A;  3BIE A;  3LE0 A;  1M4W A;  2XON A;  1W8N A;  3RZG A;  1BK0 A;  1VBA 3;  5LA9 A;  1ONA A;  3LEI A;  3ACG A;  3U07 A;  1TQ5 A;  1QXJ A;  2E7T A;  3M3O A;  2Q1F A;  1ZYB A;  1WUV A;  1AZD A;  1F5J A;  5FYI A;  3O1U A;  3ZMO A;  5F2W A;  4LE3 A;  3ZN6 A;  1CN1 A;  4LO4 B;  1OKO A;  4FOV A;  4HAN A;  1VAK A;  2BEO A;  2NM1 A;  4M01 A;  4E4D X;  5A1A A;  1AX0 A;  3PUS A;  4LOT A;  4BU2 A;  3WDY A;  2YB7 A;  3K46 A;  2LRP A;  2V4V A;  3CJI C;  1RVF 1;  3RZM A;  1BVV A;  2MEV 1;  3UK9 A;  1RVF 2;  4QPG A;  2PA7 A;  1OUX A;  2MEV 2;  1FMD 2;  4PLO A;  4YSF A;  3WF3 A;  1RUI 1;  5L9R A;  3ZXA C;  2P3I A;  5C8C C;  3VD4 A;  2IFR A;  4I0B A;  4QB6 A;  4IES A;  1T6B X;  1RUI 2;  3PVO A;  3NV3 A;  4AZZ A;  3LOI A;  1SLI A;  2DF7 A;  3IM0 A;  4QKD A;  1MS0 A;  2VU9 A;  4HVO A;  4KU8 A;  4NWW A;  4YPJ A;  2A3Y A;  2J22 A;  3VZJ A;  3N9P A;  1W2O A;  2FHR A;  2BVV A;  2RJL A;  5EJ3 A;  2G9F A;  2PHU A;  4OUS A;  1ST8 A;  3QOP A;  4YG0 A;  1UU6 A;  1PO1 1;  2QQI A;  5KHI A;  3IB3 A;  4FOY A;  2DVB A;  1OUR A;  1Q8O A;  1WCD J;  4E2Q A;  5FZ9 A;  1PO1 2;  2QQV A;  2GME A;  4AED C;  2ENR A;  3AZX A;  3POS A;  3WSO A;  4IQP A;  1J58 A;  1JI6 A;  4I2O A;  3O0X A;  2YMZ A;  4FTS A;  1YLL A;  1QJF A;  2UY8 A;  4LT5 A;  2DDU A;  4YWA A;  4CEW B;  2VZP A;  3E5X A;  5IW0 A;  3CNA A;  2WS9 1;  2JE7 A;  5CKN A;  3M7A A;  1XNA A;  1GAN A;  4HK8 A;  3NV4 A;  1AHS A;  4NAM A;  2KM2 A;  2MEV 3;  3PU3 A;  1FMD 3;  2B46 X;  4GKX A;  2WS9 2;  4B1M A;  4AI2 A;  1S2E A;  1HV0 A;  2VMF A;  3OF1 A;  4EV0 A;  5LK5 A;  2ZAC A;  4ES8 A;  2TEP A;  5DUW A;  3ZSM A;  4DXZ A;  2WZP P;  1DGR A;  1RUI 3;  3LEM A;  3HQX A;  1XYO A;  2C9K A;  3NRU A;  4FTE A;  2X5I B;  4Q8K A;  4QGN A;  5JOY A;  1WKY A;  3A7Q A;  4AQS A;  1A34 A;  1G6N A;  1OKQ A;  4MGS A;  4QX7 A;  1GYK A;  2W1W A;  2VW1 A;  3NV2 A;  3KWV A;  3OBZ A;  2BOJ A;  3J8F 1;  4IGP A;  3J4U H;  2G9G A;  4LBQ B;  1H0B A;  2QZ3 A;  2F17 A;  3N3H A;  5IUQ A;  5IFP A;  5EXO A;  3ACI A;  3FLR A;  5BNO B;  1OD5 A;  3J8F 2;  1SPP A;  1ND3 A;  2VEC A;  5FJH A;  2HYX A;  4Q1R A;  4PF1 A;  2HJI A;  4CDW A;  2XJT A;  4GH4 C;  3CHX A;  2XGX A;  4YAR A;  1F9K A;  4IEU A;  2QQP A;  3C7O A;  2YZ4 A;  4ONU A;  1OQD A;  4UXA A;  4LE4 A;  4QHO A;  2BJS A;  1S2B A;  2IXJ A;  3VKF C;  1ZZB A;  2FDG A;  1TG7 A;  1JOB A;  5D21 A;  1NA1 B;  1EY2 A;  3MW2 A;  4TYS A;  5FZK A;  3S30 A;  3OY8 B;  3U11 A;  3HN1 A;  3T0A A;  2RV9 A;  4JX0 A;  3NST A;  2P34 A;  4FAG A;  2WS9 3;  2YRO A;  1XOY A;  5FYH A;  5E89 A;  2P3K A;  2ZTN A;  4D6Q A;  1GWL A;  3D0S A;  5FYC A;  2XQX A;  3O0W A;  4IND A;  2D98 A;  4LOS A;  2OYZ A;  1RED A;  4MYE A;  5A32 B;  1H9W A;  5A7P A;  3ZIW A;  2WNO A;  1HKD A;  1STM A;  5E16 A;  1EV1 1;  1MS4 A;  3PUQ A;  2UWA A;  2XR4 A;  2RMU 1;  4NPM A;  4JRA A;  4LMF A;  5FZH A;  2QBX A;  1QIQ A;  5F7U A;  3I3B A;  2XG3 A;  1EV1 2;  1QXR A;  1WW7 A;  2KD7 A;  2RMU 2;  3ZPO A;  1DYP A;  1LHW A;  1R08 1;  2ZX1 A;  3WIN E;  2QQN A;  3GJA A;  3MIE A;  2ZHM A;  4CDX A;  4LUL A;  1R08 2;  3J8F 3;  4B29 A;  2WZR 1;  5FYB A;  3ALQ A;  3VBO B;  4K6B A;  1ZM1 A;  5IVC A;  4Y5Z 0;  3ACH A;  3C7G A;  1SDD B;  3D8C A;  3HNY M;  5CA6 A;  4F3J A;  3NAP C;  4XUN A;  2XVK A;  1OT5 A;  4HKW A;  4Q4Y 1;  2VXJ A;  1ZNP A;  1W2N A;  2BFU S;  1XBF A;  4NAO A;  2JDM A;  2ETE A;  4Q4Y 2;  3VZO A;  4A44 A;  2WQ8 A;  5FPX A;  1HB1 A;  1AYN 1;  1O4Y A;  5JPN B;  1UMI A;  4N43 A;  2YPD A;  3OGG A;  2R07 1;  2QQM A;  2V5D A;  2VBD A;  2PLV 1;  4TSV A;  3VBH A;  1AYN 2;  4ORF A;  4DQA A;  1ASJ 1;  1D2S A;  2R07 2;  1C5I A;  2PLV 2;  3PJQ A;  4XXA A;  5JLV A;  1ASJ 2;  4OI4 A;  5JIU A;  4RR3 A;  1W8H A;  1A8M A;  4IV3 B;  3FN9 A;  3KQR A;  4QGM A;  3H42 B;  2XKO A;  3WUD A;  2WO1 A;  2VQA A;  3VDB A;  4OHX A;  3GZA A;  1LOF A;  4DNY A;  4Q26 A;  2ZGU A;  2HWF 1;  2HWB 1;  3H1M A;  5T5J A;  1W04 A;  4KMQ A;  3SIS A;  2XXZ A;  3AMQ A;  2X29 A;  5GKA C;  3O5S A;  1JUI A;  2HWF 2;  2HWB 2;  4P5H A;  1HRI 1;  3B94 A;  5C9A B;  2G4I A;  3TRS B;  2HWE 1;  3THC A;  1AX2 A;  1R08 3;  2YU1 A;  3JU9 A;  3USU A;  2BFU L;  1G7Y A;  1HRI 2;  4GAL A;  3V0A A;  1ZRC A;  2HWE 2;  1LTE A;  2O8O A;  1A3K A;  4LKD A;  3HMY A;  2XLG A;  1NCQ B;  5LA0 A;  1AUY A;  2WWJ A;  5D1I A;  1DIW A;  4ASL A;  3IMM A;  1I5P A;  3OBR A;  5I8S A;  1LOC A;  2HBU A;  4Q4Y 3;  1TE1 B;  1JZ6 A;  1N1Y A;  2ZGL A;  1WW4 A;  3VZN A;  4YZ5 A;  4GWI A;  4DPN A;  1YFW A;  3TWI A;  5L7O B;  1AYN 3;  2ZHK A;  1QU0 A;  2FDH A;  4XAB A;  3ST7 A;  2R07 3;  2PLV 3;  5FZG A;  4BIO A;  1ASJ 3;  4LHN A;  3BUC A;  1MZ6 A;  2D5F A;  3I2K A;  4Y22 B;  4AFM A;  1S0D A;  1XRU A;  3B9I A;  2JDA A;  3MEP A;  4UAP A;  1UNB A;  1CAV B;  3BOW A;  4FQZ A;  1OA3 A;  1ZZC A;  4TLF A;  1JW6 A;  3WG1 A;  1DLL A;  1XU2 A;  1I5Z A;  2TNF A;  1GQP A;  3J7M A;  3ROU A;  4H3W A;  3T1L A;  2W95 A;  4QX8 A;  3VHO A;  2BU9 A;  4QKF A;  1W8F A;  1Y9M A;  2JEC A;  3GZT B;  1CES A;  1JUH A;  1D0G A;  4UFH A;  4ZZ8 A;  1QJY 1;  4D3W A;  4QB2 A;  4LBM A;  4XHX A;  4UFI A;  2JB4 A;  1CIW A;  1QJY 2;  4HPK B;  1UZ0 A;  4JHZ A;  2CTV A;  4HL0 A;  2VUC A;  1DYK A;  1H6Y A;  4QM8 A;  4IEZ A;  5CFD A;  4KWL A;  4ZHN A;  2A75 A;  4AEK A;  4CEY B;  3RMX A;  4MGK E;  5CNA A;  3C2U A;  4A42 A;  5FZO B;  4CU6 A;  2MHF A;  4RHV 1;  1PIV 1;  2YGL A;  2Q8D A;  1W9W A;  4ES9 A;  4IEV A;  1H2M A;  1YO8 A;  2EIE A;  2IXI A;  4H7L A;  4RHV 2;  1PIV 2;  4CZS A;  4BDV B;  1LES A;  2HEY F;  5KWR A;  4HT1 T;  4A7K A;  2BBA A;  2LAL A;  1MS1 A;  1IPS A;  4MUV A;  2XLF A;  3W20 A;  4FP2 A;  3NNG A;  2J1S A;  1UO9 A;  4JHT A;  5GM0 A;  3TOJ A;  4CDQ A;  1O8S A;  1RHI 1;  3N36 A;  2GZW A;  5L19 A;  3T0B A;  3ES4 A;  2ARA A;  5J1X A;  1JHN A;  4PJY A;  4XZU G;  4E4H A;  1RHI 2;  1KQR A;  4IV3 C;  3LEG A;  5H9S A;  1O59 A;  5HXV A;  2B45 X;  1SFY A;  5DXD A;  3VHN A;  2QDN A;  4A7Z A;  3GHN A;  3FBY A;  1HQL A;  1RUD 1;  4NHK A;  3ZYF A;  3WNX A;  3QBQ A;  3VBU B;  1UOJ A;  1V9U 1;  2WNU B;  4YVW B;  4AVC A;  1BKZ A;  3ZYR A;  1KFU L;  1UZZ A;  3KF3 A;  4UOJ A;  5F5C A;  1RUD 2;  1HRV 3;  4GJY A;  1V9U 2;  3OD0 A;  2ZGO A;  3KSC A;  1W2U A;  1W39 A;  3DN7 A;  2RHP A;  4QPY A;  1XNT A;  4ITC A;  1PGL 1;  2YG0 A;  3LGR A;  4LBN A;  3B02 A;  2DVG A;  1H8T A;  1QHD A;  2W87 A;  1LHV A;  1AJO A;  3LFI A;  1ZRE A;  1PGL 2;  3CMG A;  1IS5 A;  5LAT A;  1CJP A;  3UKT A;  4EJR A;  4RHV 3;  1XXN A;  2JX9 A;  1PIV 3;  4Q5O A;  5A80 A;  3LSD A;  4C1W A;  2BER A;  2GSY A;  4G9S B;  2A6W A;  1PVC 1;  3MZH A;  2VOK A;  1W99 A;  4P02 B;  2VUA A;  2XJU A;  3O1S A;  3VBF B;  1YFU A;  1PVC 2;  3AVS A;  4LIV A;  1YCI A;  2C0Z A;  2VBP A;  4FAH A;  4N7I A;  2XDV A;  1Y9G A;  1DZT A;  5KHJ A;  1GNY A;  3I3E A;  3QD6 A;  4K1Z A;  3V0B A;  1VMJ A;  3ATG A;  2RG4 A;  1MS8 A;  4P9J A;  3PUA A;  3G6J B;  2HEV F;  3LA3 A;  4K3U A;  3WQ1 A;  2Y33 A;  3Q8A A;  4YZ3 A;  1SBD A;  1WMF A;  1ULG A;  4XBN A;  3ZX7 A;  3A23 A;  5AFE A;  3BCW A;  4K21 A;  5LWB A;  5C70 A;  2ORZ A;  2FQP A;  3UKV A;  2C6S A;  2J1V A;  5FXX A;  3WP6 A;  1J83 A;  2D43 A;  3LB9 A;  2WA3 A;  1D7P M;  1RUD 3;  4Q0V A;  1H1A A;  1V9U 3;  2ZML A;  3RMY A;  2R30 A;  2AZ5 A;  2VZU A;  1VAV A;  1BHG A;  4Y26 A;  1XQN A;  2FDJ A;  1YFY A;  3FUO A;  4XYX A;  2W3J A;  1RIR A;  2XBO 1;  4PI0 A;  1DQ4 A;  5IAT A;  1GWM A;  1VAM A;  5FO8 B;  4WVW A;  4XQ4 A;  4G3Y C;  5FV3 A;  4B4Q A;  4AHW A;  4CEY C;  3WNO A;  4WVZ A;  2XBO 2;  5GZE A;  4CXW A;  1DG6 A;  2CHH A;  2YFU A;  2VC9 A;  2RS5 3;  2XL7 A;  2WLP A;  4LK6 A;  3W5N A;  3DL3 A;  2XJV A;  4AL9 A;  1PVC 3;  3J7H A;  4AVV A;  4KQ7 A;  4R4X A;  1CPN A;  5FZI A;  1ZRF A;  3KS7 A;  1O7F A;  3TEZ A;  3I97 A;  1O4T A;  2JD9 A;  2WAO A;  2LW8 A;  1KXG A;  1UY4 A;  3IDC B;  4FPO B;  1OHF A;  3O0V A;  4QU2 A;  1BMV 1;  3VZM A;  1UY2 A;  2XH6 A;  1Q8V A;  2O1Q A;  4K8R B;  2MPF A;  3KF5 A;  1J1L A;  3FWE A;  4N9I A;  3FHI B;  3S7E A;  1JYV A;  4GQ7 A;  1BMV 2;  3VBH C;  4JRL A;  4CDU B;  2WNE A;  4PIX A;  4CCL A;  3N9N A;  3AP9 A;  5HXM A;  4E2S A;  4XJ8 A;  3AFK A;  1LNS A;  1O8P A;  5FY9 A;  2PTM A;  4RR3 C;  1FI2 A;  5F3G A;  3N7L A;  1GP6 A;  2WNU C;  4YVW C;  2VH9 A;  3PTY A;  3BTY A;  1O3T A;  3N4M A;  1V70 A;  2DVF A;  3W59 A;  5JR2 A;  4CEW A;  1GUI A;  4H14 A;  2L9L A;  2WO2 A;  4LO7 A;  4PBP A;  4OYU A;  2E53 A;  2WQ4 A;  4IEO A;  4N9H A;  5JWP A;  1COV 3;  2FDK A;  2W39 A;  3ZFE B;  5JOZ A;  5FP8 A;  4GMP 3;  1YI9 A;  1J59 A;  2WWU A;  2MNG A;  5LEJ A;  1JYN A;  2YGM A;  2VR4 A;  1CVN A;  5BXX A;  1R64 A;  3K4A A;  1UMH A;  3OUH A;  3M1H A;  2GC2 A;  3C7F A;  4XMA A;  3VHP A;  3AMH A;  4Z2A A;  2QQL A;  1PGW 1;  4ZU7 A;  2VO5 A;  3OYW A;  4QX1 A;  4V2V A;  1QH6 A;  2EAK A;  2PAM A;  1PGW 2;  2A70 A;  4WVM A;  1X8E A;  1ZVF A;  2JG8 A;  3MW3 A;  3NJX A;  5CIR A;  4YW1 A;  5IVJ A;  3BU0 A;  3LWC A;  5HCF A;  4A41 A;  4YM3 A;  4GZ9 A;  3ZYP A;  5M0T A;  3WF2 A;  3BAL A;  4AFA A;  5F39 A;  1YQ6 A;  2UWB A;  3AK0 A;  3EHK A;  1OA2 A;  3BPZ A;  4FI9 A;  3JBG 3;  5IJR A;  3SCG A;  3DUI A;  3ZYH A;  5LCW L;  2VJX A;  1G9C A;  4GMP 0;  1DCS A;  3MIB A;  2WRA A;  2PYT A;  3T2T A;  1H9P A;  1L7L A;  1N3O A;  1W6P B;  4MET A;  5ANQ A;  2ZKL A;  4WM7 A;  3D82 A;  5BY5 A;  1ZZ7 A;  2DBN A;  1ZZ8 A;  5CAD A;  3W5M A;  1AXK A;  2GC3 A;  4KH9 A;  2E7Q A;  2GC0 A;  2W1U A;  1MQT B;  1O5U A;  4UI9 L;  1YQC A;  2FBE A;  2QKD A;  3ZYI B;  5E6H A;  3DYM A;  5D8A B;  2ZAB A;  4DXS A;  2ZGQ A;  2D3S A;  2PHL A;  3LDB A;  4EN8 B;  3S5Q A;  4QQP A;  2UUR A;  3FE5 A;  4IV1 A;  2P2K A;  3ACF A;  2JDN A;  3ZDV A;  1LU2 A;  4FPG A;  3SKV A;  4MZU A;  1OXC A;  4P9W A;  3F2Z A;  4LBK A;  4KWU A;  4XUR A;  1CR7 A;  3KT4 A;  4GB3 3;  4QB1 A;  2PHX A;  4FPY A;  4NHL A;  4U36 A;  1V6N A;  1HLC A;  4QX2 A;  5GAL A;  3M3E A;  4QKN A;  1SAC A;  2O8Q A;  5A1L A;  2OVU A;  1F15 A;  4I01 A;  2DUP A;  2WR9 A;  2ADD A;  4A4A A;  5GZG A;  2JG9 A;  3LPG A;  4R9D A;  2XVL A;  5H9Q A;  3VDC A;  3DPR A;  3N7K A;  3ILR A;  4FSJ A;  1XYP A;  2ZAA A;  1KS4 A;  3JQW A;  3MYX A;  3WEZ A;  3M70 A;  3ZPY A;  1NQD A;  4MLO A;  5KC6 A;  3I4I A;  4EZH A;  4AF9 A;  1S2K A;  1C28 A;  1RUO A;  2R7E B;  2ZX2 A;  3VL9 A;  1VE0 A;  2X05 A;  3ZYJ B;  5FY7 A;  3CEW A;  2YFZ A;  1BK1 A;  3OCP A;  1JYI A;  1JZ3 A;  5JVV A;  3A4U A;  3PU8 A;  4NHM A;  3OBT A;  3E97 A;  3F95 A;  1Y4W A;  4YZ4 A;  5C3R A;  1CZV A;  4P9Y A;  2V73 A;  5APA A;  4A3X A;  1SFP A;  3IAQ A;  2WT2 A;  1OSG A;  4QDS A;  1MZ5 A;  3R0R A;  5FK8 A;  3SCH A;  1I9R A;  2A6Y A;  3I2I A;  5FPL A;  4NIA A;  2OZ6 A;  2VNG A;  4FPH A;  1MS3 A;  2BWA A;  2VZT A;  3U78 A;  3KD4 A;  2QQK A;  4LUK A;  5LBE A;  2ORX A;  4BPZ A;  4BME A;  3VHR A;  3GBW A;  1HW5 A;  2VOW A;  3U4X A;  1IG0 A;  1YEW A;  2ET7 A;  3RI9 A;  3FJS A;  1UU4 A;  4X8N A;  3I59 A;  2WL1 A;  5JSR A;  3VKM A;  3BOP A;  3WHU A;  2Z2S B;  4DXR A;  5FBJ A;  3H8R A;  4BQ2 A;  5C8C B;  1OVS A;  1RUG 2;  4PCR A;  4OZX A;  1U5X A;  2QQU A;  4P9G A;  3MW4 A;  1OQ1 A;  1K5M A;  1QH7 A;  1OD3 A;  2Z69 A;  3GZE A;  5GZD A;  4LUM A;  5F1R A;  2ZHL A;  5FZ1 A;  3EJK A;  4UF0 B;  4AR2 A;  4M00 A;  2HEW F;  1JU4 A;  4QX3 A;  2W5F A;  2AAC A;  4LBL A;  3HBZ A;  2XHK A;  4KGQ A;  3B93 A;  4ASK A;  1VMH A;  4QPI A;  1LHU A;  3O1O A;  2FZ2 A;  3J26 N;  2Y6J A;  2R32 A;  5J36 A;  1UIK A;  5JMO A;  1WCU A;  3AP6 A;  1GZC A;  3V65 A;  4QXC A;  1E57 A;  1H4G A;  2D6K A;  2JEM A;  1MQT C;  1QY4 A;  2A73 B;  1NLQ A;  2AGS A;  1Y3T A;  4ZY9 A;  5JAX A;  4NPL A;  3M4F A;  5JXJ A;  2XJS A;  1IPK A;  3ILN A;  4KU7 A;  5JUV A;  4B7E A;  2OUJ A;  4HBN A;  1NT0 A;  2CAV A;  4LEJ A;  5A1F A;  4NWV A;  4LOR A;  4MO3 M;  5IK7 A;  1IS6 A;  3PDQ A;  5A6X A;  4Y1Y A;  5LA2 A;  3E6C C;  4D0Q A;  2B9U A;  1QMJ A;  2GN3 A;  2A3X A;  3HD8 B;  2CGO A;  4OMD A;  5I91 A;  1QOO A;  2VZS A;  3ZXK A;  1RYY A;  1O3S A;  2P1B A;  5JXH A;  1R1A 3;  1H2K A;  1IHM A;  1RTV A;  1RUG 3;  2TUN A;  2E9Q A;  3J7L A;  3BTZ A;  4YM0 A;  4URA A;  1N47 A;  2YYO A;  4JV4 A;  4LJH A;  4PDW B;  5FP7 A;  2UYA A;  4XEZ A;  1CIY A;  3U1X A;  1Q8P A;  1W2T A;  4M4R A;  1REF A;  5FOJ B;  1YJK A;  1GZ9 A;  5FZE A;  1H4H A;  3NKG A;  5DZE A;  1KRI A;  2ZOE B;  4XVH A;  1BBT 1;  4AOC A;  1MEC 1;  2W94 A;  5HV4 A;  1GLH A;  2VME A;  3FMG A;  1U0A A;  5FUN A;  2V09 A;  4M4P A;  1HDK A;  5GZF A;  4COU A;  1BBT 2;  1MEC 2;  1W3V A;  4XHB A;  3E6D A;  4YVS B;  4OCT A;  2BUK A;  3H8O A;  5AVP A;  2WYF A;  5AC9 1;  4AQ6 A;  4K1Y A;  3ZXL A;  1J1T A;  4GH4 B;  4IET A;  4CU7 A;  4CYD A;  2Q1Z B;  5CG8 A;  5AC9 2;  2DUO A;  3PIJ A;  4GWM A;  3WP3 A;  4M3C A;  4XIO A;  2YC0 A;  3MFA A;  1W6N B;  1A6C A;  1U5I A;  3NJV A;  4CP9 A;  5A70 A;  3S5A A;  1AR9 3;  1YQ2 A;  2P3J A;  2WKK A;  1QOS A;  2B8M A;  3RSJ A;  4ZZ5 A;  2WSV A;  4CEW C;  1KIT A;  3LA2 A;  3OOX A;  2E63 A;  1FOD 1;  2YC4 A;  1RUC 1;  2YU2 A;  1GMM A;  1O91 A;  2DVD A;  3USS A;  2IC1 A;  1W8Z A;  3ZKY A;  1I1E A;  2W47 A;  4IUG A;  1DZR A;  3JD7 1;  1FOD 2;  1RUC 2;  3BN6 A;  2H0B A;  2J1E A;  2W46 A;  2KA3 A;  3C7E A;  1ND2 A;  3LDK A;  3JD7 2;  4Q1P A;  4BQX A;  1O5L A;  3T2O A;  3VD3 A;  4AXO A;  2EA7 A;  4RQP B;  4BK4 A;  4D94 A;  3DEC A;  1QKQ A;  3S7I A;  2GP5 A;  4PBO A;  1R1Z A;  3SQO A;  4BE3 A;  1Q3E A;  4KNC A;  4C90 A;  1BBT 3;  1MEC 3;  2A1X A;  1TVG A;  1GSL A;  2BGC A;  2C5D A;  4QHB A;  2Y0I A;  3LQC A;  3RPQ A;  2Y64 A;  5F2S A;  4EQV A;  2IXK A;  3NAP B;  3TNQ A;  1DQ5 A;  1RUH 1;  5AC9 3;  2I07 B;  4CCE A;  5J09 A;  3N9Q A;  4RSU A;  3QH7 A;  1GIC A;  2WJS A;  2ZX4 A;  2VZO A;  4MXW A;  1RUH 2;  1PM4 A;  5FRE A;  4AEJ A;  3VLB B;  2RM2 1;  4OMC A;  1SZB A;  3H3U A;  3RRD A;  3B01 A;  3R6S A;  1CAW B;  2VCB A;  4WM7 C;  4X6Q B;  1HB4 A;  1WCK A;  3VBO A;  3NJY A;  2RM2 2;  4R9C A;  4NIG A;  3A22 A;  1D4M 1;  2O14 A;  1W6Q B;  3KGZ A;  1GZW A;  5C3Q A;  2GNT A;  3MID A;  5IVF A;  1UYY A;  4JDM A;  1QJU 1;  2HWD 1;  4GJZ A;  4GWJ A;  1Y9Q A;  2WLQ A;  5AFB A;  1X8M A;  2JWP A;  3MBW A;  3APB A;  1EUT A;  4Q4V 1;  4HOO A;  4W6Y A;  1RUC 3;  4XMI A;  1C4R A;  1RVF 3;  1QJU 2;  2HWD 2;  4JDO A;  4XUP A;  3JD7 3;  4IV1 C;  3AYA A;  4Q4V 2;  1W0P A;  2WNV B;  3UL2 A;  1VJ2 A;  5L9V A;  1JOJ A;  4ZXE A;  5IVB A;  1UY1 A;  5FKC A;  2W0X A;  4MVT A;  4UFL A;  4HSL A;  4NIH A;  4XUO A;  5FLH A;  4OHY A;  4PDW C;  1LB2 A;  5FTT C;  1IS4 A;  1JXN A;  3VKN A;  1V6M A;  2WZE A;  5C4W A;  3KQ4 B;  1A8D A;  3OPZ A;  1O4Z A;  3UNP A;  4LIT A;  3AB0 A;  1VBB 1;  5A6Q A;  3KCY A;  2W92 A;  2WSU A;  1WCS A;  2JG9 C;  1PZ9 A;  1QEX A;  2VNR A;  1VBB 2;  3T0D A;  4YGE A;  1UZV A;  4G4F A;  2VCA A;  3VB9 A;  1RUH 3;  4YVS C;  1L7R A;  1GWK A;  2Y0O A;  3GDB A;  1UZW A;  5IWF A;  5CG9 A;  1PVX A;  1JOP A;  1D0H A;  1W3X A;  3T1M A;  4DRV A;  1PO1 3;  4FOW A;  2RM2 3;  3CO2 A;  5CB7 A;  4P9I A;  1GQG A;  1VPH A;  4Z1V A;  5I93 A;  4NJ4 A;  4XDQ A;  3HR9 A;  3SMH A;  4Z8B A;  4M0H A;  2BOI A;  4FQ4 A;  5DG1 A;  4Q4X 1;  3ETP A;  4FPJ A;  4BMB A;  1H1M A;  4HON A;  5EPA A;  2VBB A;  4K7J A;  1NLR A;  1POV 1;  2ZGT A;  3P6B A;  2P4E A;  4Q4X 2;  1QGL A;  1QJU 3;  2HWD 3;  4IGQ A;  2D6L X;  4QAW A;  5FKB A;  5FYM A;  3ZN6 B;  4A2U A;  5FAX A;  2D3P A;  4Q4V 3;  4BHP A;  1HIX A;  1MS9 A;  1IPJ A;  2OPW A;  2OKX A;  4AG4 A;  5KBF A;  4LBO A;  3HBK A;  1DGR N;  3MIF A;  4OUE A;  1AL2 1;  2XJP A;  1ULC A;  1VB4 A;  3WDU A;  1JOD A;  3RZL A;  3K4Z A;  1MVE A;  1AL2 2;  3ZDS A;  1QNY A;  4MGI E;  1LOG A;  5JI7 A;  3IIA A;  4KWJ A;  1XB9 A;  2PN5 A;  4QPG B;  3ZVX A;  4RQP C;  2CU5 A;  5LZ6 A;  4R9A A;  4AK3 A;  3K3O A;  1W8W A;  1Y43 B;  3NW4 A;  2BPA 2;  3M3I A;  4I30 A;  1WBF A;  5JXG A;  4DFS A;  3RNS A;  1UPI A;  3AZV A;  4Q0P A;  4GA9 A;  5EJ1 B;  1HN1 A;  1SEF A;  2JD4 A;  2CGP A;  4AHX A;  5GJ6 A;  3IPV A;  4LO8 A;  4CUG A;  2BDR A;  4I0A A;  1KFX L;  2WZR 2;  1DQ6 A;  3AMP A;  3ABZ A;  3D0J A;  3N7J A;  5JI9 A;  3U0Z A;  4XF3 A;  3WQ0 A;  5EZW A;  5FYZ A;  3I49 A;  2BGP A;  4DY3 A;  1L3J A;  1PK6 A;  1UW8 A;  1YNA A;  1IKQ A;  1LCL A;  4XBQ A;  2IVI B;  1E5I A;  5FZ8 A;  1U5Z A;  4D8M A;  3VDD A;  4E9K A;  1R09 1;  4Y1X A;  2A5Z A;  1XYN A;  5HV0 A;  1ENQ A;  4Q4X 3;  1JS9 A;  2CWM A;  1WLC A;  4XXP A;  1R09 2;  3HEI A;  2A6V A;  1POV 3;  2WDB A;  3K2O A;  3KLS A;  3H1W A;  5ANN A;  2FCV A;  4L11 A;  1HXS 1;  3GXU A;  4DY5 A;  1VBE 1;  1WA4 A;  2UYB A;  3ME2 A;  3EMR A;  3RGB A;  3ZXG A;  3U10 A;  1NY7 1;  4FFF A;  1RUJ 1;  4L0P A;  4EN9 B;  4RGG A;  1HXS 2;  3I3Q A;  3WX5 A;  1VBE 2;  1UKR A;  4COW A;  1JYC A;  4GD4 A;  4JAA A;  1NY7 2;  2ZX3 A;  1RUJ 2;  3JB8 A;  1PNG A;  3G7D A;  3VBR A;  5BNP A;  4AHY A;  2WNV C;  5A7W A;  1DQ1 A;  2ZPX A;  3KHB A;  1J3R A;  3U4S A;  3WHT A;  1EV1 3;  4WBB A;  3K51 A;  3CF6 E;  3VD9 A;  2RMU 3;  3BI3 A;  3BU7 A;  3M8L A;  4P14 A;  2GNB A;  3RFR A;  1PO2 1;  5JIA A;  1OVP A;  1OC1 A;  3A0K A;  3LD8 A;  4XF4 A;  2QUO A;  4PHZ A;  2B5H A;  2RDN A;  1BYH A;  1QDC A;  3QAC A;  3RZJ A;  1PO2 2;  1WZX A;  1VBC 1;  2I74 A;  4Y20 A;  3WP5 A;  2FMD A;  3LSE A;  4S2F A;  1POV 0;  2WZR 3;  3WD5 A;  5FP9 A;  4FTB A;  1VBC 2;  3MIC A;  4WV8 A;  1JMU B;  2X10 A;  4JGY A;  4Z82 A;  3SNM A;  2OQ7 A;  5L9B A;  5JZG A;  2WN3 A;  1S0J A;  2ZGN A;  2EXJ A;  5I8T A;  3BTX A;  4J1X A;  4BYY A;  2RJ2 A;  5FR3 A;  1IS3 A;  3HQR A;  2RR1 1;  2P5B A;  3OD4 A;  2VE1 A;  2Y26 A;  3GCW A;  4C0B A;  1SPP B;  1ND3 B;  3KVB A;  1R09 3;  4QQ2 A;  3INA A;  4D7T A;  5FPV A;  4CDW B;  4E8D A;  2OXB A;  3VUO A;  1RB8 G;  4ZU5 A;  3IAP A;  3OGS A;  1N1S A;  4LQR A;  1EUU A;  1AVB A;  1W03 A;  3IBM A;  1ZRD A;  1VBE 3;  1V6K A;  3JB4 C;  4CUB A;  1RUJ 3;  4IEQ A;  4M3C E;  1KS5 A;  3MLK A;  2N7G A;  2DWR A;  4UBG A;  5GLZ A;  5CIS A;  3OJB A;  2ZJC A;  3PVN A;  4E27 A;  3GYD A;  2ES3 A;  4LTA A;  3NVC A;  3HAG A;  4XBL A;  3KHC A;  1JTZ X;  1S0G A;  5CYY A;  3WNP A;  5FZ7 A;  2JKX A;  3OSD A;  2HWF 3;  2HWB 3;  4QDR A;  3DXU A;  5FPA A;  2VG9 A;  4MX3 A;  3ITQ A;  4D7S A;  1HQN A;  4SBV A;  4OZO A;  1JBC A;  4BA6 A;  3OB8 A;  2O0O A;  1XC6 A;  4ERO A;  2CGN A;  1HRI 3;  4QPG C;  1NLS A;  1ND2 C;  1RMU 1;  2GH2 A;  2YXS A;  2HWE 3;  5DMY A;  1YQ5 A;  1NX9 A;  3DKW A;  1RIT A;  1F5F A;  4N53 A;  3SH4 A;  1RMU 2;  3TBD A;  3T08 A;  4HMZ A;  5FXW A;  3R4D B;  2K9Z A;  4YM2 A;  4UFK A;  2B9V A;  1JZ7 A;  3HPN A;  2R49 A;  1NE4 A;  2V4A A;  3AYD A;  3O14 A;  4B3N A;  2XWB B;  4MXV A;  3ZXJ A;  2JKB A;  1NCR A;  5IVV A;  2AEZ A;  4CDX B;  1RIN A;  2C4X A;  5IAX A;  3POY A;  1JYX A;  3MV1 1;  1GBG A;  1VIW B;  3I2F A;  2DTY A;  1GZT A;  4IEY A;  4OUM A;  2AEN A;  4J25 A;  4COZ A;  3WNL A;  4N90 A;  4NII A;  2YUE A;  3VV1 A;  4LBQ D;  1AX1 A;  1YC6 1;  1W0N A;  4HSJ A;  4LA2 A;  1C1L A;  5IK4 A;  4D6R A;  5JR7 B;  2JDY A;  4GUL A;  4LBJ A;  4N43 B;  4YZ2 A;  1YI7 A;  2OS2 A;  2PEL A;  1FPN 1;  3VBH B;  5FO9 B;  1V6O A;  3AKQ A;  5BNN A;  2EIC A;  1YQ8 A;  1VBD 1;  2R16 A;  3VDA A;  2PHT A;  3RZZ A;  2P37 A;  1FPN 2;  3MO4 A;  2VQT A;  2VW2 A;  2VMH A;  4L99 A;  1OOP A;  1VBD 2;  1CX1 A;  3SC7 X;  1PZ7 A;  2V72 A;  4RR3 B;  1PHM A;  2QQO A;  1W6M A;  1ACC A;  2DCK A;  3ETQ A;  4XCB A;  1W90 A;  5LBC A;  3ZXF A;  1CAU A;  2F4P A;  1QJY 3;  3ZOI A;  5CFC A;  1S0I A;  1HJF A;  1BEV 1;  1SBE A;  2XUM A;  5FCC A;  3POG A;  5FDB A;  3OGV A;  1YWK A;  1ZRR A;  1RMU 3;  1RXF A;  3RI8 A;  1FNY A;  2PXJ A;  1CQ9 A;  1WA6 X;  4FFH A;  1BEV 2;  2KR2 A;  3BGA A;  1UXZ A;  3PTR B;  1MZF A;  2E26 A;  2PAE A;  1W28 A;  2CDO A;  4K40 A;  3ZSJ A;  4ATE A;  3FX3 A;  2EXK A;  1ZX5 A;  5A33 A;  3TEX A;  5C4W C;  3USU B;  3H8U A;  2G1M A;  5LY1 A;  4Y5T A;  2I2S A;  4RGK A;  3NWK A;  4QD2 A;  3RS6 A;  4TN7 A;  1FYU A;  2FCU A;  3V0A B;  1I3H A;  4RS5 A;  5LW9 A;  1J84 A;  2VZ1 A;  2NMO A;  3AM2 A;  3MPB A;  2XWJ B;  3D4K A;  4KG8 A;  1WW5 A;  3WQ7 A;  1SLB A;  1LRH A;  1ND3 C;  2ZZJ A;  1LEC A;  5ABJ A;  4I02 A;  4JC1 A;  4Q4W 1;  4LXL A;  4CDW C;  5EYY A;  1CAX B;  2NLR A;  1JU3 A;  1QQP 1;  2D97 A;  2BW8 A;  2XJQ A;  4Q4W 2;  3UJQ A;  3N9M A;  3GCX A;  4W50 A;  5FY4 A;  4L8Q A;  1RHI 3;  5GLT A;  4C0H A;  1QQP 2;  3WNM A;  2K46 A;  1FPN 3;  3CBN A;  4L97 A;  3J7N A;  4AE2 A;  1VBD 3;  2ZGM A;  3ZN5 A;  3SHR A;  2CV6 A;  5JOW A;  5DZG A;  5FLI A;  4FFI A;  3SEP A;  1OFN A;  2Z42 A;  5I0D A;  4AQT A;  2Q8O A;  1AJK A;  4AHZ A;  5K0U A;  4MGT A;  5FZM A;  3TB0 A;  4MSV A;  1Z0H A;  1QNW A;  4R9B A;  2EID A;  3AC0 A;  4YFW A;  2Y6G A;  2NQY A;  3MFC A;  3T30 A;  3ASI A;  3URF A;  2CAU A;  2VTX A;  2XKP A;  5FQ0 A;  5FUI A;  1L7Q A;  2XB6 C;  1W6P A;  2R6Q A;  4HKL A;  5CFD B;  5A7N A;  3OPT A;  2IXC A;  3HN3 A;  2PFW A;  2VZQ A;  4QXK A;  5K9Y A;  2D44 A;  4O65 A;  4CDX C;  5FXV A;  3K4D A;  4ZPI A;  1MAC A;  5BPX A;  4QXB A;  3WZ1 A;  3EQE A;  4XTP A;  5C7G A;  5JCT A;  1AR8 1;  3H50 A;  5EWS A;  3PMS A;  4KI5 M;  1HV1 A;  3GM8 A;  5D8A A;  4J1W A;  2E33 A;  2W1S A;  1ULP A;  3CU7 A;  4MGY E;  4Q4W 3;  5EFU A;  5A7Q A;  1AR8 2;  2E6V A;  1PK6 C;  4BQ3 A;  4M3C F;  5ERL A;  1LEN A;  1QQP 3;  3WNN A;  2F6B A;  5T50 A;  2K0G A;  2CNA A;  4LA3 A;  2R1B A;  2VCM A;  2Q0A A;  5DAV A;  3FC0 A;  4JVA A;  4OFG A;  4N43 C;  4AYU A;  3P1I A;  2R04 1;  2JDP A;  3BYW A;  5E1R A;  4BCU A;  4HVQ A;  3KM5 A;  2VW0 A;  3ZFG A;  1FV3 A;  5FMO S;  1Q43 A;  5HCB A;  4CDQ B;  3IDE A;  3RZH A;  1V6I A;  4XFF A;  5H9P A;  4QU1 A;  3WUC A;  3ZKU A;  4EZ4 A;  1HJG A;  1W2A X;  1WLW A;  5LK7 B;  2OX0 A;  4NHX A;  1NAE A;  1US3 A;  2WIN B;  4CCN A;  4DEV A;  3NL1 A;  5LBF A;  2W9X A;  1ULF A;  1S0C A;  4FVV A;  4Z07 A;  4WM8 A;  1OA4 A;  3VBR C;  5BNP C;  2ZEZ A;  1LOF C;  1WGP A;  4WZF A;  4XFA A;  4ZS2 A;  3WOG A;  4ZS3 A;  3POE A;  1OPM A;  2JDK A;  3AZW A;  2Y38 A;  2D40 A;  2XBO 3;  3MLJ A;  2VMI A;  1LU1 A;  3D3A A;  1DGL A;  4XJW A;  5F5I A;  3O12 A;  4AFD A;  3AFG A;  3JZV A;  5A3L A;  3PME A;  1AXY A;  4A7Y A;  4CCM A;  1GNH A;  1H8T B;  4Q29 A;  4ISR A;  3B3Q E;  3RYK A;  4CCD A;  2BVB A;  4NE9 A;  4ASM B;  5FPU A;  1X9T A;  3I54 A;  4JGZ A;  2ZHN A;  5F3I A;  2Q8C A;  5KHK A;  2OPK A;  1C8M 1;  5FMO L;  2J1A A;  1ULD A;  5FJK A;  4LHS A;  3UT0 A;  3CLP A;  1POQ A;  2RS1 1;  3PUI A;  1NG0 A;  1BXH A;  4O9G A;  5DAW A;  3WF0 A;  1C8M 2;  4BWO A;  4XAC A;  2RS1 2;  3KB5 A;  3CJI A;  4ATF A;  2VD7 A;  1PZ8 A;  1N1T A;  5LAS A;  4F83 A;  1Q5O A;  2D5H A;  3K75 B;  4XW3 A;  3V0B B;  1LOD A;  3MUY 1;  4YLZ A;  1S1A A;  3WVJ A;  4LO6 B;  4HLT A;  3ELN A;  3O1P A;  5CBL A;  2Y6L A;  4X8P A;  5FYT A;  2VUJ A;  3PLQ A;  3ZFF A;  2VZ3 A;  2RE9 A;  1NYW A;  3VL8 A;  4U2A A;  3S0M A;  1V6L A;  1ENX A;  3HOB A;  4XFC A;  3E6B A;  5K7P A;  4BM8 A;  2ADE A;  2GP3 A;  3MF9 A;  4ZKT B;  1VP6 A;  4NRO A;  2A6X A;  4EN0 A;  4NID A;  2BP6 A;  4K20 A;  2QTW B;  5A3N A;  3IMN A;  2VVE A;  2QQJ A;  5T5P A;  2DFB A;  3PIG A;  1XU1 A;  5CFD C;  1LUL A;  4BLI A;  2P17 A;  4XAE A;  3AKP A;  4IL7 A;  2ERF A;  4W4Z A;  1XE8 A;  3B00 A;  2GU9 A;  4AED A;  1UOB A;  2C26 A;  1XND A;  4W8J A;  1N3Q A;  2DUQ A;  2RS1 3;  3KCC A;  5FZ4 A;  4XZP A;  1JN2 P;  5K4L A;  4EWD A;  1ZZ9 A;  2QNK A;  3BB6 A;  2RJK A;  1SMV A;  3H3Z A;  3W21 A;  5F37 A;  5DUV A;  2YBK A;  1S4C A;  3MHZ A;  3UGH A;  2D6M A;  1MR5 A;  4UBH A;  5HCA A;  1DDL A;  5I8Y A;  5IK5 A;  1TMF 1;  2D7F A;  3HT1 A;  4CDQ C;  3GGL A;  2WAA A;  4QDQ A;  3FUQ A;  4E8C A;  5BNN C;  1TMF 2;  3QLQ A;  1DQ2 A;  2ARX A;  2NZ9 A;  4LKE A;  4JDN A;  3THP A;  4HG6 B;  3S6P A;  3NQH A;  5KXB A;  1B35 A;  3BKZ A;  2VM9 A;  1X9P A;  3HNM A;  1Z78 A;  5F3C A;  1VMF A;  1PMJ X;  2TBV A;  3VBS A;  4HXC A;  4PIZ A;  3MPP G;  5J3U A;  5FY8 A;  5C33 A;  1PX3 A;  2XJR A;  1QJX 1;  1LEM A;  1QWR A;  2XOM A;  3B5L B;  3HJR A;  3Q8B A;  3RG0 A;  4LKS A;  3WCR A;  5HBA A;  1X82 A;  3AZZ A;  3OUI A;  1XSR A;  4JKM A;  1QJX 2;  1UAI A;  1H8T C;  2D6O X;  4ET7 A;  5F9T A;  1ENR A;  2IWG B;  5FZC A;  4XC9 A;  2VUL A;  1NQJ A;  3THT A;  3JXS A;  3BIW E;  4FBF A;  2JB8 A;  5C3S A;  4AGR A;  3R4S A;  4RN5 A;  1W6O B;  3E5Q A;  4RS5 C;  5FUP A;  1DLC A;  3UES A;  3I3D A;  1ULO A;  3CKH A;  4L2N A;  4DO0 A;  1RJ8 A;  3GBG A;  4KGG A;  4YW6 A;  1KD7 A;  3WDT A;  4L92 A;  1OBN A;  1UXX X;  2ARB A;  2QFE A;  3Q8E A;  4CCJ A;  3HVD A;  1RUE 1;  4OUL A;  4B1L A;  3OYW B;  2JXA A;  2ZA9 A;  5JSO A;  4UYB A;  2BTV C;  4CP0 A;  2OII A;  1GOH A;  1RUN A;  1CGP A;  1SFN A;  1RUE 2;  3H0O A;  4WVM B;  3VN4 A;  2VNO A;  1UY3 A;  1FX5 A;  2EIG A;  2SBA A;  1W8U A;  2W1Q A;  5FIX A;  1LGN A;  3JCI A;  1KGY A;  2JIG A;  1TMF 3;  1BQP A;  3TNP B;  3WV6 A;  4TTG A;  1IOA A;  2PQS A;  3C8X A;  1OI6 A;  1JZ5 A;  1PMH X;  4Q2F A;  1LED A;  3I2O A;  5KHG A;  3X29 B;  1RXG A;  4P08 A;  4QQO A;  2DUR A;  5FMB A;  2R0H A;  1VB2 A;  3DV8 A;  5TSW A;  4OQ8 A;  1ALY A;  1OUS A;  3DF0 A;  3WW4 A;  3WG2 A;  4WM7 B;  2AR6 A;  2WWS A;  1YIP A;  2R06 1;  3B7M A;  5FZD A;  5K0U C;  4IE0 A;  3BPS A;  4E4S A;  2BBV A;  1JZ2 A;  2EF6 A;  2WT0 A;  2R06 2;  4NO4 A;  4CA9 A;  1SBF A;  1C3H A;  5CKQ A;  2ZS6 B;  3GHM A;  1XJA A;  4YGD A;  1HB3 A;  1NKG A;  2ZGP A;  1PX4 A;  1JH5 A;  2VCC A;  5DPN A;  1LGB A;  1AYM 1;  4AVB A;  4IV1 B;  1GKB A;  5EV7 A;  4IDZ A;  1VBA 1;  1YUD A;  3KCX A;  1B09 A;  2LUW A;  2VL4 A;  4FPK A;  5FWE A;  1AYM 2;  4NRM A;  1F2N A;  3ZR5 A;  5B4N A;  5HI0 A;  3SH3 A;  1IQD C;  1ENS A;  4NMI A;  4COY A;  5T5O A;  1VBA 2;  5FPB A;  2QZ2 A;  4YNI A;  5BYN A;  1RUE 3;  2ZEW A;  4V2W A;  3LCP A;  2YDE A;  1MS5 A;  3LFM A;  2JIJ A;  5CZK A;  2QJV A;  1SDW A;  2GDF A;  3EBR A;  2JG9 B;  4OHV A;  3A21 A;  4I09 A;  4PQ9 A;  5CAZ A;  5LA1 A;  4Y24 A;  4BIF A;  3OEB A; 
#chains in the Genus database with same CATH homology
 4LKD A;  4BQ5 A;  2WYF A;  5D21 A;  1W8W A;  3ZYF A;  4A6S A;  1W9F A;  1WMX A;  4BQ3 A;  1UOJ A;  1W90 A;  2Q1F A;  3ZYB A;  4CP9 B;  2O14 A;  1V0A A;  1W8T A;  3ZYH A;  4CP9 A;  1WCU A;  4LJH A;  4YWA A;  1OKO A;  1GWL A;  1GWM A;  2C24 A;  2VXJ A;  4LKF A;  4LKE A;  2KR2 A;  2JWP A;  2LRO A;  1L7L A;  3F95 A;  4YW6 A;  4BQ2 A;  4CPB A;  2K46 A;  4CPB D;  4LK7 A;  3ORJ A;  4LK6 A;  1GWK A;  2LRP A;  4AL9 A;  3UT0 A;  1OH3 A;  4BQ4 A;  1W8Z A;  1WZX A;  4YW7 A;  1HN0 A;  1W8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...