2WYLA

Apo structure of a metallo-b-lactamase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
338
structure length
304
Chain Sequence
MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGNKLQPNLRTTPFVLDPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFDRGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Architecture of the Mn(2+)Dependent Lactonase Ulag Reveals an Rnase-Like Metallo-Beta-Lactamase Fold and a Novel Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG
total genus 88
structure length 304
sequence length 338
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2wylA00
5AHRA 5AYAA 3RKKA 2BFLA 3QH8A 4RAMA 4Z5YA 4PVTA 2BFZB 3BV6A 2BC2A 4EYLA 3DHAA 2R2DA 2ZWRA 3IEKA 4TZFA 5HH4A 3AJ3A 5ACTA 5A0TA 2YNTB 5KIKA 4C1HA 4EXYA 4XWTA 2GKLA 4FEKA 4J5FA 2VW8A 4TYFA 1VJNA 4D02A 4FR7A 2BTNA 2BG2A 5LSCA 4EXSA 3T3NA 2I7XA 5EWAA 5B3RA 2GMNA 1SMLA 4RM5A 5EV8A 5A0VA 2DOOA 3BK2A 2BG8B 3AF5A 2BG8A 4BP0A 5LMCA 2P1EA 3LVZA 4U4LA 3FAIA 4TZ9A 5LCHA 4UWOB 1QH3A 3KNSA 4C1EA 2E7YA 3I0VA 4B87A 3DHCA 3X2YA 1P9EA 1DD6A 2QDSA 1M2XA 4CHLA 4NQ5A 4GYUA 4AWYB 3I14A 4WD6A 4TZEA 4F6ZA 3SW3A 2OHHA 2WYLA 4Z5ZA 4ZO2A 2QINA 4BZ3A 4D1UA 2Q9UA 2P97A 4YSKA 5ACVA 1QH5A 4C1FA 2QDTA 2YNVA 5DPXA 5EVDA 1ZNBA 1Y44A 5HH5A 4J5HA 3P2UA 2ZO4A 2Y8BA 5LE1A 2GFKA 3I15A 5K4NA 4V0HA 4DIKA 2AIOA 4TZBA 5ACRA 5HIQA 2NYPA 1KR3A 1BC2A 1VMEA 3ZR9A 4ZO3A 4YSLA 5ACXA 5ACPA 4UBQA 3IOGA 5B1UA 4HL2A 4EYBA 2Q0IA 3ZWFA 4FSBA 2FU9A 1VGNA 5FQAA 2FU6A 2FK6A 4UWSB 4LE6A 4TYTA 3WXCA 2FHXA 2FM6A 3MD7A 4Z60A 3IOFA 5AXRA 2BMIA 3A4YA 5B15A 2M5CA 4GCWA 4D1WA 1XTOA 5LLDA 4KEQA 4Z7RA 3ZNBA 1X8GA 5AEBA 1X8HA 2YZ3A 2QEDA 1KO3A 2HB9A 5ACSA 1ZTCA 3IEMA 4ZNBA 1KO2A 3I11A 1L9YA 1WW1A 5ACQA 2OHIA 3KL7A 3X2ZA 5IQKA 3ESHA 3Q6VA 2BR6A 1BMCA 2P4ZA 3L6NA 4AX0B 3S0ZA 3AF6A 4NQ6A 3DH8A 2YCBA 3ZQ4A 4UAMA 4C09A 2NXAA 5K0WA 1E5DA 5EVKA 2FHXB 3JXPA 4NQ4A 2YNTA 3I13A 2AZ4A 5EH9A 2BG6A 3TP9A 5HIOA 2WYMA 1JT1A 2NZFA 4DILA 5EV6A 3VQZA 2Y87A 4EFZA 5A5ZA 4D1VA 3T3OA 2BFZA 3H3EA 4XWWA 2YNWA 4JO0A 3R2UA 5AXOA 1XM8A 2FU8A 5ACWA 3PY5A 1WUOA 4F6HA 4HL1A 4O98A 5LCAA 5HISA 4P62A 2Y8AA 2I7TA 2P18A 4RL2A 3DHBA 1HLKA 1MQOA 3SRXA 1YCGA 3KNRA 2M5DA 2CBNA 4ZEJA 5EHTA 3BK1A 4HKYA 2A7MA 4C1DA 5FQCA 5ACUA 4EY2A 1YCFA 4D1TA 4XUKA 1DXKA 3IE2A 2YNVB 4YSBA 2BG7A 5K4KA 5A87A 3X30A 5HIPA 4H0DA 4C1GA 5KILA 1A8TA 2Q42A 2I7VA 3PY6A 3SD9A 3IE1A 4C1CA 2ZNBA 1WRAA 4KEPA 3PG4A 1JJTA 3X2XA 2DKFA 2UYXA 2GFJA 4AX1B 2NZEA 5AHOA 5FQBA 1BVTA 3BC2A 5HH6A 4GYQA 5LS3A 5EVBA 2H6AA 2OHJA 1X8IA 2FU7A 2XR1A 3ADRA 3RPCA 3IELA 5K4MA 1YCHA 2YNUA 3SBLA 4AD9A 1JJEA 2XF4A 3FCZA 4UA4A 3RKJA 3T9MA 5EW0A 4UWPB 3SFPA 2WRSA 2GCUA 2BFKA 1DDKA 1K07A 4RBSA 2BGAA 3IDZA 3SPUA 2ZZIA 2QJSA 4Z67A 2WYMC 4RAWA 4Z6XA 3IE0A 4NQ2A 1WUPA 2BIBA 4UWRB 5LCFA 3F9OA 1A7TA 4PVOA 2WHGA 4AWZA 5LM6A 1ZKPA 3VPEA 2Q0JA 4EYFA 3G1PA 4RL0A
chains in the Genus database with same CATH superfamily
5AHRA 5AYAA 3RKKA 2BFLA 3QH8A 4RAMA 4Z5YA 4PVTA 2BFZB 3BV6A 2BC2A 4EYLA 3DHAA 2R2DA 5AJLA 2ZWRA 3IEKA 4TZFA 5HH4A 3AJ3A 5ACTA 5A0TA 2YNTB 5KIKA 4C1HA 4EXYA 4XWTA 2GKLA 4FEKA 4J5FA 2VW8A 4TYFA 1VJNA 4D02A 4FR7A 2BTNA 2BG2A 5LSCA 4EXSA 3T3NA 2I7XA 5EWAA 5B3RA 2GMNA 1SMLA 4RM5A 5EV8A 4NURA 5A0VA 2DOOA 3BK2A 2BG8B 3AF5A 2BG8A 4BP0A 5LMCA 2P1EA 3LVZA 4U4LA 5A23A 3FAIA 4TZ9A 5LCHA 4UWOB 1QH3A 3KNSA 4C1EA 2E7YA 3I0VA 4B87A 3DHCA 3X2YA 1P9EA 2YHEA 1DD6A 2QDSA 1M2XA 4CHLA 4NQ5A 4GYUA 4AWYB 3I14A 4WD6A 4TZEA 4F6ZA 3SW3A 2OHHA 2WYLA 4Z5ZA 4ZO2A 2QINA 4BZ3A 4D1UA 2Q9UA 2P97A 4YSKA 5ACVA 1QH5A 4C1FA 2QDTA 2YNVA 5DPXA 5EVDA 1ZNBA 1Y44A 5HH5A 4J5HA 3P2UA 2ZO4A 2Y8BA 5LE1A 2GFKA 3I15A 5K4NA 4V0HA 4DIKA 2AIOA 4TZBA 4PDXA 5ACRA 4AV7A 5HIQA 2NYPA 1KR3A 1BC2A 1VMEA 3ZR9A 4ZO3A 4YSLA 5ACXA 5ACPA 4UBQA 3IOGA 5B1UA 4HL2A 4EYBA 2Q0IA 3ZWFA 4FSBA 2FU9A 4AXHA 1VGNA 5FQAA 2FU6A 2FK6A 4UWSB 4LE6A 4TYTA 3WXCA 2FHXA 2FM6A 3MD7A 4Z60A 3IOFA 5AXRA 2BMIA 3A4YA 5B15A 2M5CA 4GCWA 4D1WA 1XTOA 5LLDA 5AIJA 4KEQA 4Z7RA 2CG3A 3ZNBA 1X8GA 5AEBA 1X8HA 2YZ3A 2QEDA 1KO3A 2HB9A 5ACSA 1ZTCA 3IEMA 4ZNBA 1KO2A 3I11A 1L9YA 1WW1A 5ACQA 2OHIA 3KL7A 3X2ZA 5IQKA 3ESHA 3Q6VA 2BR6A 1BMCA 2P4ZA 3L6NA 4AX0B 3S0ZA 3AF6A 4NQ6A 3DH8A 2YCBA 3ZQ4A 2CG2A 4UAMA 4C09A 2NXAA 5K0WA 1E5DA 5EVKA 2FHXB 3JXPA 4NQ4A 2YNTA 3I13A 2AZ4A 5EH9A 2BG6A 3TP9A 2CFUA 5HIOA 2WYMA 1JT1A 2NZFA 4DILA 5EV6A 3VQZA 2Y87A 4EFZA 5A5ZA 4D1VA 3T3OA 2BFZA 3H3EA 4XWWA 2YNWA 4JO0A 3R2UA 5AXOA 1XM8A 2FU8A 5ACWA 3PY5A 1WUOA 4F6HA 4HL1A 4O98A 5LCAA 5HISA 4P62A 2Y8AA 2I7TA 2P18A 4RL2A 3DHBA 1HLKA 1MQOA 3SRXA 1YCGA 3KNRA 2M5DA 2CBNA 4ZEJA 5EHTA 3BK1A 4HKYA 2A7MA 4C1DA 5FQCA 5ACUA 4EY2A 1YCFA 4D1TA 4XUKA 1DXKA 3IE2A 2YNVB 4YSBA 2BG7A 5K4KA 5A87A 3X30A 5HIPA 4H0DA 4C1GA 5KILA 1A8TA 2Q42A 2I7VA 3PY6A 3SD9A 3IE1A 4C1CA 2CFZA 2ZNBA 1WRAA 4KEPA 3PG4A 1JJTA 3X2XA 2DKFA 2UYXA 2GFJA 4AX1B 2NZEA 5AHOA 5FQBA 1BVTA 3BC2A 5HH6A 4GYQA 5LS3A 5EVBA 2H6AA 2OHJA 1X8IA 2FU7A 2XR1A 3ADRA 3RPCA 3IELA 5K4MA 1YCHA 2YNUA 3SBLA 4AD9A 1JJEA 2XF4A 3FCZA 4UA4A 3RKJA 3T9MA 5EW0A 4UWPB 3SFPA 2WRSA 2GCUA 2BFKA 1DDKA 1K07A 4RBSA 2BGAA 3IDZA 3SPUA 2ZZIA 2QJSA 4Z67A 2WYMC 4RAWA 4Z6XA 3IE0A 4NQ2A 1WUPA 2BIBA 4UWRB 5LCFA 3F9OA 1A7TA 4PVOA 2WHGA 4AWZA 5LM6A 1ZKPA 3VPEA 2Q0JA 4EYFA 3G1PA 4RL0A
chains in the Genus database with same CATH topology
5AHRA 5AYAA 3RKKA 2BFLA 3QH8A 4RAMA 4Z5YA 4PVTA 2BFZB 3BV6A 2BC2A 4EYLA 3DHAA 2R2DA 2ZWRA 3IEKA 4TZFA 5HH4A 3AJ3A 5ACTA 5A0TA 2YNTB 5KIKA 4C1HA 4EXYA 4XWTA 2GKLA 4FEKA 4J5FA 2VW8A 4TYFA 1VJNA 4D02A 4FR7A 2BTNA 2BG2A 5LSCA 4EXSA 3T3NA 2I7XA 5EWAA 5B3RA 2GMNA 1SMLA 4RM5A 5EV8A 5A0VA 2DOOA 3BK2A 2BG8B 3AF5A 2BG8A 4BP0A 5LMCA 2P1EA 3LVZA 4U4LA 3FAIA 4TZ9A 5LCHA 4UWOB 1QH3A 3KNSA 4C1EA 2E7YA 3I0VA 4B87A 3DHCA 3X2YA 1P9EA 1DD6A 2QDSA 1M2XA 4CHLA 4NQ5A 4GYUA 4AWYB 3I14A 4WD6A 4TZEA 4F6ZA 3SW3A 2OHHA 2WYLA 4Z5ZA 4ZO2A 2QINA 4BZ3A 4D1UA 2Q9UA 2P97A 4YSKA 5ACVA 1QH5A 4C1FA 2QDTA 2YNVA 5DPXA 5EVDA 1ZNBA 1Y44A 5HH5A 4J5HA 3P2UA 2ZO4A 2Y8BA 5LE1A 2GFKA 3I15A 5K4NA 4V0HA 4DIKA 2AIOA 4TZBA 5ACRA 5HIQA 2NYPA 1KR3A 1BC2A 1VMEA 3ZR9A 4ZO3A 4YSLA 5ACXA 5ACPA 4UBQA 3IOGA 5B1UA 4HL2A 4EYBA 2Q0IA 3ZWFA 4FSBA 2FU9A 1VGNA 5FQAA 2FU6A 2FK6A 4UWSB 4LE6A 4TYTA 3WXCA 2FHXA 2FM6A 3MD7A 4Z60A 3IOFA 5AXRA 2BMIA 3A4YA 5B15A 2M5CA 4GCWA 4D1WA 1XTOA 5LLDA 4KEQA 4Z7RA 3ZNBA 1X8GA 5AEBA 1X8HA 2YZ3A 2QEDA 1KO3A 2HB9A 5ACSA 1ZTCA 3IEMA 4ZNBA 1KO2A 3I11A 1L9YA 1WW1A 5ACQA 2OHIA 3KL7A 3X2ZA 5IQKA 3ESHA 3Q6VA 2BR6A 1BMCA 2P4ZA 3L6NA 4AX0B 3S0ZA 3AF6A 4NQ6A 3DH8A 2YCBA 3ZQ4A 4UAMA 4C09A 2NXAA 5K0WA 1E5DA 5EVKA 2FHXB 3JXPA 4NQ4A 2YNTA 3I13A 2AZ4A 5EH9A 2BG6A 3TP9A 5HIOA 2WYMA 1JT1A 2NZFA 4DILA 5EV6A 3VQZA 2Y87A 4EFZA 5A5ZA 4D1VA 3T3OA 2BFZA 3H3EA 4XWWA 2YNWA 4JO0A 3R2UA 5AXOA 1XM8A 2FU8A 5ACWA 3PY5A 1WUOA 4F6HA 4HL1A 4O98A 5LCAA 5HISA 4P62A 2Y8AA 2I7TA 2P18A 4RL2A 3DHBA 1HLKA 1MQOA 3SRXA 1YCGA 3KNRA 2M5DA 2CBNA 4ZEJA 5EHTA 3BK1A 4HKYA 2A7MA 4C1DA 5FQCA 5ACUA 4EY2A 1YCFA 4D1TA 4XUKA 1DXKA 3IE2A 2YNVB 4YSBA 2BG7A 5K4KA 5A87A 3X30A 5HIPA 4H0DA 4C1GA 5KILA 1A8TA 2Q42A 2I7VA 3PY6A 3SD9A 3IE1A 4C1CA 2ZNBA 1WRAA 4KEPA 3PG4A 1JJTA 3X2XA 2DKFA 2UYXA 2GFJA 4AX1B 2NZEA 5AHOA 5FQBA 1BVTA 3BC2A 5HH6A 4GYQA 5LS3A 5EVBA 2H6AA 2OHJA 1X8IA 2FU7A 2XR1A 3ADRA 3RPCA 3IELA 5K4MA 1YCHA 2YNUA 3SBLA 4AD9A 1JJEA 2XF4A 3FCZA 4UA4A 3RKJA 3T9MA 5EW0A 4UWPB 3SFPA 2WRSA 2GCUA 2BFKA 1DDKA 1K07A 4RBSA 2BGAA 3IDZA 3SPUA 2ZZIA 2QJSA 4Z67A 2WYMC 4RAWA 4Z6XA 3IE0A 4NQ2A 1WUPA 2BIBA 4UWRB 5LCFA 3F9OA 1A7TA 4PVOA 2WHGA 4AWZA 5LM6A 1ZKPA 3VPEA 2Q0JA 4EYFA 3G1PA 4RL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AHR A;  5AYA A;  3RKK A;  2BFL A;  3QH8 A;  4RAM A;  4Z5Y A;  4PVT A;  2BFZ B;  3BV6 A;  2BC2 A;  4EYL A;  3DHA A;  2R2D A;  2ZWR A;  3IEK A;  4TZF A;  5HH4 A;  3AJ3 A;  5ACT A;  5A0T A;  2YNT B;  5KIK A;  4C1H A;  4EXY A;  4XWT A;  2GKL A;  4FEK A;  4J5F A;  2VW8 A;  4TYF A;  1VJN A;  4D02 A;  4FR7 A;  2BTN A;  2BG2 A;  5LSC A;  4EXS A;  3T3N A;  2I7X A;  5EWA A;  5B3R A;  2GMN A;  1SML A;  4RM5 A;  5EV8 A;  5A0V A;  2DOO A;  3BK2 A;  2BG8 B;  3AF5 A;  2BG8 A;  4BP0 A;  5LMC A;  2P1E A;  3LVZ A;  4U4L A;  3FAI A;  4TZ9 A;  5LCH A;  4UWO B;  1QH3 A;  3KNS A;  4C1E A;  2E7Y A;  3I0V A;  4B87 A;  3DHC A;  3X2Y A;  1P9E A;  1DD6 A;  2QDS A;  1M2X A;  4CHL A;  4NQ5 A;  4GYU A;  4AWY B;  3I14 A;  4WD6 A;  4TZE A;  4F6Z A;  3SW3 A;  2OHH A;  2WYL A;  4Z5Z A;  4ZO2 A;  2QIN A;  4BZ3 A;  4D1U A;  2Q9U A;  2P97 A;  4YSK A;  5ACV A;  1QH5 A;  4C1F A;  2QDT A;  2YNV A;  5DPX A;  5EVD A;  1ZNB A;  1Y44 A;  5HH5 A;  4J5H A;  3P2U A;  2ZO4 A;  2Y8B A;  5LE1 A;  2GFK A;  3I15 A;  5K4N A;  4V0H A;  4DIK A;  2AIO A;  4TZB A;  5ACR A;  5HIQ A;  2NYP A;  1KR3 A;  1BC2 A;  1VME A;  3ZR9 A;  4ZO3 A;  4YSL A;  5ACX A;  5ACP A;  4UBQ A;  3IOG A;  5B1U A;  4HL2 A;  4EYB A;  2Q0I A;  3ZWF A;  4FSB A;  2FU9 A;  1VGN A;  5FQA A;  2FU6 A;  2FK6 A;  4UWS B;  4LE6 A;  4TYT A;  3WXC A;  2FHX A;  2FM6 A;  3MD7 A;  4Z60 A;  3IOF A;  5AXR A;  2BMI A;  3A4Y A;  5B15 A;  2M5C A;  4GCW A;  4D1W A;  1XTO A;  5LLD A;  4KEQ A;  4Z7R A;  3ZNB A;  1X8G A;  5AEB A;  1X8H A;  2YZ3 A;  2QED A;  1KO3 A;  2HB9 A;  5ACS A;  1ZTC A;  3IEM A;  4ZNB A;  1KO2 A;  3I11 A;  1L9Y A;  1WW1 A;  5ACQ A;  2OHI A;  3KL7 A;  3X2Z A;  5IQK A;  3ESH A;  3Q6V A;  2BR6 A;  1BMC A;  2P4Z A;  3L6N A;  4AX0 B;  3S0Z A;  3AF6 A;  4NQ6 A;  3DH8 A;  2YCB A;  3ZQ4 A;  4UAM A;  4C09 A;  2NXA A;  5K0W A;  1E5D A;  5EVK A;  2FHX B;  3JXP A;  4NQ4 A;  2YNT A;  3I13 A;  2AZ4 A;  5EH9 A;  2BG6 A;  3TP9 A;  5HIO A;  2WYM A;  1JT1 A;  2NZF A;  4DIL A;  5EV6 A;  3VQZ A;  2Y87 A;  4EFZ A;  5A5Z A;  4D1V A;  3T3O A;  2BFZ A;  3H3E A;  4XWW A;  2YNW A;  4JO0 A;  3R2U A;  5AXO A;  1XM8 A;  2FU8 A;  5ACW A;  3PY5 A;  1WUO A;  4F6H A;  4HL1 A;  4O98 A;  5LCA A;  5HIS A;  4P62 A;  2Y8A A;  2I7T A;  2P18 A;  4RL2 A;  3DHB A;  1HLK A;  1MQO A;  3SRX A;  1YCG A;  3KNR A;  2M5D A;  2CBN A;  4ZEJ A;  5EHT A;  3BK1 A;  4HKY A;  2A7M A;  4C1D A;  5FQC A;  5ACU A;  4EY2 A;  1YCF A;  4D1T A;  4XUK A;  1DXK A;  3IE2 A;  2YNV B;  4YSB A;  2BG7 A;  5K4K A;  5A87 A;  3X30 A;  5HIP A;  4H0D A;  4C1G A;  5KIL A;  1A8T A;  2Q42 A;  2I7V A;  3PY6 A;  3SD9 A;  3IE1 A;  4C1C A;  2ZNB A;  1WRA A;  4KEP A;  3PG4 A;  1JJT A;  3X2X A;  2DKF A;  2UYX A;  2GFJ A;  4AX1 B;  2NZE A;  5AHO A;  5FQB A;  1BVT A;  3BC2 A;  5HH6 A;  4GYQ A;  5LS3 A;  5EVB A;  2H6A A;  2OHJ A;  1X8I A;  2FU7 A;  2XR1 A;  3ADR A;  3RPC A;  3IEL A;  5K4M A;  1YCH A;  2YNU A;  3SBL A;  4AD9 A;  1JJE A;  2XF4 A;  3FCZ A;  4UA4 A;  3RKJ A;  3T9M A;  5EW0 A;  4UWP B;  3SFP A;  2WRS A;  2GCU A;  2BFK A;  1DDK A;  1K07 A;  4RBS A;  2BGA A;  3IDZ A;  3SPU A;  2ZZI A;  2QJS A;  4Z67 A;  2WYM C;  4RAW A;  4Z6X A;  3IE0 A;  4NQ2 A;  1WUP A;  2BIB A;  4UWR B;  5LCF A;  3F9O A;  1A7T A;  4PVO A;  2WHG A;  4AWZ A;  5LM6 A;  1ZKP A;  3VPE A;  2Q0J A;  4EYF A;  3G1P A;  4RL0 A; 
#chains in the Genus database with same CATH topology
 5AHR A;  5AYA A;  3RKK A;  2BFL A;  3QH8 A;  4RAM A;  4Z5Y A;  4PVT A;  2BFZ B;  3BV6 A;  2BC2 A;  4EYL A;  3DHA A;  2R2D A;  5AJL A;  2ZWR A;  3IEK A;  4TZF A;  5HH4 A;  3AJ3 A;  5ACT A;  5A0T A;  2YNT B;  5KIK A;  4C1H A;  4EXY A;  4XWT A;  2GKL A;  4FEK A;  4J5F A;  2VW8 A;  4TYF A;  1VJN A;  4D02 A;  4FR7 A;  2BTN A;  2BG2 A;  5LSC A;  4EXS A;  3T3N A;  2I7X A;  5EWA A;  5B3R A;  2GMN A;  1SML A;  4RM5 A;  5EV8 A;  4NUR A;  5A0V A;  2DOO A;  3BK2 A;  2BG8 B;  3AF5 A;  2BG8 A;  4BP0 A;  5LMC A;  2P1E A;  3LVZ A;  4U4L A;  5A23 A;  3FAI A;  4TZ9 A;  5LCH A;  4UWO B;  1QH3 A;  3KNS A;  4C1E A;  2E7Y A;  3I0V A;  4B87 A;  3DHC A;  3X2Y A;  1P9E A;  2YHE A;  1DD6 A;  2QDS A;  1M2X A;  4CHL A;  4NQ5 A;  4GYU A;  4AWY B;  3I14 A;  4WD6 A;  4TZE A;  4F6Z A;  3SW3 A;  2OHH A;  2WYL A;  4Z5Z A;  4ZO2 A;  2QIN A;  4BZ3 A;  4D1U A;  2Q9U A;  2P97 A;  4YSK A;  5ACV A;  1QH5 A;  4C1F A;  2QDT A;  2YNV A;  5DPX A;  5EVD A;  1ZNB A;  1Y44 A;  5HH5 A;  4J5H A;  3P2U A;  2ZO4 A;  2Y8B A;  5LE1 A;  2GFK A;  3I15 A;  5K4N A;  4V0H A;  4DIK A;  2AIO A;  4TZB A;  4PDX A;  5ACR A;  4AV7 A;  5HIQ A;  2NYP A;  1KR3 A;  1BC2 A;  1VME A;  3ZR9 A;  4ZO3 A;  4YSL A;  5ACX A;  5ACP A;  4UBQ A;  3IOG A;  5B1U A;  4HL2 A;  4EYB A;  2Q0I A;  3ZWF A;  4FSB A;  2FU9 A;  4AXH A;  1VGN A;  5FQA A;  2FU6 A;  2FK6 A;  4UWS B;  4LE6 A;  4TYT A;  3WXC A;  2FHX A;  2FM6 A;  3MD7 A;  4Z60 A;  3IOF A;  5AXR A;  2BMI A;  3A4Y A;  5B15 A;  2M5C A;  4GCW A;  4D1W A;  1XTO A;  5LLD A;  5AIJ A;  4KEQ A;  4Z7R A;  2CG3 A;  3ZNB A;  1X8G A;  5AEB A;  1X8H A;  2YZ3 A;  2QED A;  1KO3 A;  2HB9 A;  5ACS A;  1ZTC A;  3IEM A;  4ZNB A;  1KO2 A;  3I11 A;  1L9Y A;  1WW1 A;  5ACQ A;  2OHI A;  3KL7 A;  3X2Z A;  5IQK A;  3ESH A;  3Q6V A;  2BR6 A;  1BMC A;  2P4Z A;  3L6N A;  4AX0 B;  3S0Z A;  3AF6 A;  4NQ6 A;  3DH8 A;  2YCB A;  3ZQ4 A;  2CG2 A;  4UAM A;  4C09 A;  2NXA A;  5K0W A;  1E5D A;  5EVK A;  2FHX B;  3JXP A;  4NQ4 A;  2YNT A;  3I13 A;  2AZ4 A;  5EH9 A;  2BG6 A;  3TP9 A;  2CFU A;  5HIO A;  2WYM A;  1JT1 A;  2NZF A;  4DIL A;  5EV6 A;  3VQZ A;  2Y87 A;  4EFZ A;  5A5Z A;  4D1V A;  3T3O A;  2BFZ A;  3H3E A;  4XWW A;  2YNW A;  4JO0 A;  3R2U A;  5AXO A;  1XM8 A;  2FU8 A;  5ACW A;  3PY5 A;  1WUO A;  4F6H A;  4HL1 A;  4O98 A;  5LCA A;  5HIS A;  4P62 A;  2Y8A A;  2I7T A;  2P18 A;  4RL2 A;  3DHB A;  1HLK A;  1MQO A;  3SRX A;  1YCG A;  3KNR A;  2M5D A;  2CBN A;  4ZEJ A;  5EHT A;  3BK1 A;  4HKY A;  2A7M A;  4C1D A;  5FQC A;  5ACU A;  4EY2 A;  1YCF A;  4D1T A;  4XUK A;  1DXK A;  3IE2 A;  2YNV B;  4YSB A;  2BG7 A;  5K4K A;  5A87 A;  3X30 A;  5HIP A;  4H0D A;  4C1G A;  5KIL A;  1A8T A;  2Q42 A;  2I7V A;  3PY6 A;  3SD9 A;  3IE1 A;  4C1C A;  2CFZ A;  2ZNB A;  1WRA A;  4KEP A;  3PG4 A;  1JJT A;  3X2X A;  2DKF A;  2UYX A;  2GFJ A;  4AX1 B;  2NZE A;  5AHO A;  5FQB A;  1BVT A;  3BC2 A;  5HH6 A;  4GYQ A;  5LS3 A;  5EVB A;  2H6A A;  2OHJ A;  1X8I A;  2FU7 A;  2XR1 A;  3ADR A;  3RPC A;  3IEL A;  5K4M A;  1YCH A;  2YNU A;  3SBL A;  4AD9 A;  1JJE A;  2XF4 A;  3FCZ A;  4UA4 A;  3RKJ A;  3T9M A;  5EW0 A;  4UWP B;  3SFP A;  2WRS A;  2GCU A;  2BFK A;  1DDK A;  1K07 A;  4RBS A;  2BGA A;  3IDZ A;  3SPU A;  2ZZI A;  2QJS A;  4Z67 A;  2WYM C;  4RAW A;  4Z6X A;  3IE0 A;  4NQ2 A;  1WUP A;  2BIB A;  4UWR B;  5LCF A;  3F9O A;  1A7T A;  4PVO A;  2WHG A;  4AWZ A;  5LM6 A;  1ZKP A;  3VPE A;  2Q0J A;  4EYF A;  3G1P A;  4RL0 A; 
#chains in the Genus database with same CATH homology
 5AHR A;  5AYA A;  3RKK A;  2BFL A;  3QH8 A;  4RAM A;  4Z5Y A;  4PVT A;  2BFZ B;  3BV6 A;  2BC2 A;  4EYL A;  3DHA A;  2R2D A;  2ZWR A;  3IEK A;  4TZF A;  5HH4 A;  3AJ3 A;  5ACT A;  5A0T A;  2YNT B;  5KIK A;  4C1H A;  4EXY A;  4XWT A;  2GKL A;  4FEK A;  4J5F A;  2VW8 A;  4TYF A;  1VJN A;  4D02 A;  4FR7 A;  2BTN A;  2BG2 A;  5LSC A;  4EXS A;  3T3N A;  2I7X A;  5EWA A;  5B3R A;  2GMN A;  1SML A;  4RM5 A;  5EV8 A;  5A0V A;  2DOO A;  3BK2 A;  2BG8 B;  3AF5 A;  2BG8 A;  4BP0 A;  5LMC A;  2P1E A;  3LVZ A;  4U4L A;  3FAI A;  4TZ9 A;  5LCH A;  4UWO B;  1QH3 A;  3KNS A;  4C1E A;  2E7Y A;  3I0V A;  4B87 A;  3DHC A;  3X2Y A;  1P9E A;  1DD6 A;  2QDS A;  1M2X A;  4CHL A;  4NQ5 A;  4GYU A;  4AWY B;  3I14 A;  4WD6 A;  4TZE A;  4F6Z A;  3SW3 A;  2OHH A;  2WYL A;  4Z5Z A;  4ZO2 A;  2QIN A;  4BZ3 A;  4D1U A;  2Q9U A;  2P97 A;  4YSK A;  5ACV A;  1QH5 A;  4C1F A;  2QDT A;  2YNV A;  5DPX A;  5EVD A;  1ZNB A;  1Y44 A;  5HH5 A;  4J5H A;  3P2U A;  2ZO4 A;  2Y8B A;  5LE1 A;  2GFK A;  3I15 A;  5K4N A;  4V0H A;  4DIK A;  2AIO A;  4TZB A;  5ACR A;  5HIQ A;  2NYP A;  1KR3 A;  1BC2 A;  1VME A;  3ZR9 A;  4ZO3 A;  4YSL A;  5ACX A;  5ACP A;  4UBQ A;  3IOG A;  5B1U A;  4HL2 A;  4EYB A;  2Q0I A;  3ZWF A;  4FSB A;  2FU9 A;  1VGN A;  5FQA A;  2FU6 A;  2FK6 A;  4UWS B;  4LE6 A;  4TYT A;  3WXC A;  2FHX A;  2FM6 A;  3MD7 A;  4Z60 A;  3IOF A;  5AXR A;  2BMI A;  3A4Y A;  5B15 A;  2M5C A;  4GCW A;  4D1W A;  1XTO A;  5LLD A;  4KEQ A;  4Z7R A;  3ZNB A;  1X8G A;  5AEB A;  1X8H A;  2YZ3 A;  2QED A;  1KO3 A;  2HB9 A;  5ACS A;  1ZTC A;  3IEM A;  4ZNB A;  1KO2 A;  3I11 A;  1L9Y A;  1WW1 A;  5ACQ A;  2OHI A;  3KL7 A;  3X2Z A;  5IQK A;  3ESH A;  3Q6V A;  2BR6 A;  1BMC A;  2P4Z A;  3L6N A;  4AX0 B;  3S0Z A;  3AF6 A;  4NQ6 A;  3DH8 A;  2YCB A;  3ZQ4 A;  4UAM A;  4C09 A;  2NXA A;  5K0W A;  1E5D A;  5EVK A;  2FHX B;  3JXP A;  4NQ4 A;  2YNT A;  3I13 A;  2AZ4 A;  5EH9 A;  2BG6 A;  3TP9 A;  5HIO A;  2WYM A;  1JT1 A;  2NZF A;  4DIL A;  5EV6 A;  3VQZ A;  2Y87 A;  4EFZ A;  5A5Z A;  4D1V A;  3T3O A;  2BFZ A;  3H3E A;  4XWW A;  2YNW A;  4JO0 A;  3R2U A;  5AXO A;  1XM8 A;  2FU8 A;  5ACW A;  3PY5 A;  1WUO A;  4F6H A;  4HL1 A;  4O98 A;  5LCA A;  5HIS A;  4P62 A;  2Y8A A;  2I7T A;  2P18 A;  4RL2 A;  3DHB A;  1HLK A;  1MQO A;  3SRX A;  1YCG A;  3KNR A;  2M5D A;  2CBN A;  4ZEJ A;  5EHT A;  3BK1 A;  4HKY A;  2A7M A;  4C1D A;  5FQC A;  5ACU A;  4EY2 A;  1YCF A;  4D1T A;  4XUK A;  1DXK A;  3IE2 A;  2YNV B;  4YSB A;  2BG7 A;  5K4K A;  5A87 A;  3X30 A;  5HIP A;  4H0D A;  4C1G A;  5KIL A;  1A8T A;  2Q42 A;  2I7V A;  3PY6 A;  3SD9 A;  3IE1 A;  4C1C A;  2ZNB A;  1WRA A;  4KEP A;  3PG4 A;  1JJT A;  3X2X A;  2DKF A;  2UYX A;  2GFJ A;  4AX1 B;  2NZE A;  5AHO A;  5FQB A;  1BVT A;  3BC2 A;  5HH6 A;  4GYQ A;  5LS3 A;  5EVB A;  2H6A A;  2OHJ A;  1X8I A;  2FU7 A;  2XR1 A;  3ADR A;  3RPC A;  3IEL A;  5K4M A;  1YCH A;  2YNU A;  3SBL A;  4AD9 A;  1JJE A;  2XF4 A;  3FCZ A;  4UA4 A;  3RKJ A;  3T9M A;  5EW0 A;  4UWP B;  3SFP A;  2WRS A;  2GCU A;  2BFK A;  1DDK A;  1K07 A;  4RBS A;  2BGA A;  3IDZ A;  3SPU A;  2ZZI A;  2QJS A;  4Z67 A;  2WYM C;  4RAW A;  4Z6X A;  3IE0 A;  4NQ2 A;  1WUP A;  2BIB A;  4UWR B;  5LCF A;  3F9O A;  1A7T A;  4PVO A;  2WHG A;  4AWZ A;  5LM6 A;  1ZKP A;  3VPE A;  2Q0J A;  4EYF A;  3G1P A;  4RL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...