2WYLA

Apo structure of a metallo-b-lactamase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
338
structure length
304
Chain Sequence
b'MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGNKLQPNLRTTPFVLDPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFDRGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG
molecule tags Hydrolase
source organism Escherichia coli
publication title Molecular Architecture of the Mn(2+)Dependent Lactonase Ulag Reveals an Rnase-Like Metallo-Beta-Lactamase Fold and a Novel Quaternary Structure.
pubmed doi rcsb
total genus 88
structure length 304
sequence length 338
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2wylA00
4C1DA 5ACXA 1VGNA 4EYBA 3I15A 2CBNA 4NQ2A 5A0TA 2Q0JA 5AEBA 2A7MA 3IE1A 4EY2A 1JJTA 2OHIA 2YCBA 2YNVB 4Z60A 1YCFA 4JO0A 3S0ZA 2BFZB 5HH6A 5EHTA 4BZ3A 1VJNA 3X2ZA 2WRSA 2AIOA 5KILA 3X2XA 2BG2A 2M5DA 3G1PA 3PY6A 4HL1A 3RKKA 4TZFA 4AD9A 3T3OA 3IELA 3ZNBA 3BV6A 1QH5A 4UBQA 5A87A 1WUPA 3I0VA 5LM6A 4EXSA 5EV6A 3MD7A 1JJEA 2Q42A 5A5ZA 4ZO3A 5EVKA 5LE1A 3X30A 3PY5A 4V0HA 2Q9UA 1Y44A 4BP0A 4WD6A 2XF4A 1DXKA 5EVBA 4RBSA 4P62A 1K07A 2Y8AA 4NQ4A 2I7XA 3SW3A 5FQBA 1KR3A 2AZ4A 2GFKA 3IEMA 4RL2A 3ESHA 2BFZA 2NXAA 1KO3A 3JXPA 1WUOA 5ACRA 2ZO4A 1ZKPA 3I14A 1VMEA 1E5DA 2FU7A 2BG7A 2WYMC 2NYPA 4ZO2A 5K4MA 4TYTA 3SFPA 2BMIA 1XTOA 4AX1B 2QDSA 3BC2A 1XM8A 4XWWA 1L9YA 2YNWA 1M2XA 2VW8A 2P1EA 4UA4A 5K0WA 4LE6A 1YCGA 3BK2A 4Z6XA 2GFJA 5B3RA 1JT1A 2NZEA 5LLDA 2BFKA 2FU8A 2Y8BA 2FK6A 3DH8A 4H0DA 2OHJA 4EXYA 4ZEJA 4UWOB 3RKJA 1YCHA 3P2UA 5AYAA 4RL0A 2BG6A 3PG4A 1WW1A 4ZNBA 4XWTA 2E7YA 2GKLA 2Y87A 4O98A 4KEQA 3ADRA 2QDTA 4Z67A 3DHBA 2ZWRA 4TYFA 2P4ZA 4NQ6A 4U4LA 5LSCA 2FHXA 5AHRA 5AXOA 2YNVA 3T3NA 4D1TA 1QH3A 5LCHA 3IDZA 2P18A 2P97A 3LVZA 5KIKA 4D1WA 2FU6A 2YNTB 5FQCA 4GYQA 4J5HA 4DIKA 3L6NA 3DHAA 4B87A 3H3EA 3SRXA 2M5CA 4UAMA 1BC2A 5B1UA 2YZ3A 4TZ9A 1P9EA 5HISA 4HKYA 4UWRB 5LCAA 2I7TA 2BTNA 4XUKA 2BG8B 4TZBA 4PVTA 4FEKA 4FSBA 5AXRA 2Q0IA 5IQKA 2I7VA 2BIBA 5K4NA 2GCUA 5LCFA 3AF6A 2QEDA 4YSKA 5HIQA 2QJSA 4C09A 5HH5A 4RAMA 3I11A 4EYFA 2OHHA 3AF5A 1WRAA 3ZR9A 4RAWA 3SPUA 2HB9A 5EWAA 3BK1A 4FR7A 2ZNBA 3FCZA 5EW0A 2FHXB 2FM6A 5AHOA 5HH4A 4C1CA 4KEPA 2NZFA 2R2DA 3IE2A 2YNUA 2GMNA 1KO2A 4AWZA 4C1HA 4J5FA 4EYLA 2YNTA 3SD9A 5ACUA 4C1EA 2FU9A 5LS3A 1SMLA 2DKFA 3AJ3A 4NQ5A 4C1GA 4RM5A 3IEKA 4AWYB 5A0VA 1BVTA 4GYUA 4Z7RA 4F6HA 2QINA 2WYMA 3IOFA 3TP9A 2H6AA 3DHCA 5ACTA 3SBLA 1ZTCA 3IOGA 5ACPA 4UWSB 3Q6VA 2WYLA 3T9MA 1HLKA 2BR6A 5B15A 1DD6A 3VQZA 4PVOA 5EH9A 4CHLA 5DPXA 4DILA 1X8HA 4Z5ZA 2BC2A 4YSBA 3WXCA 4EFZA 3RPCA 5K4KA 3VPEA 2ZZIA 2BGAA 4HL2A 3KNSA 1ZNBA 3KL7A 2BG8A 5EV8A 2WHGA 1DDKA 4F6ZA 4D1VA 5ACWA 3FAIA 4GCWA 5HIPA 3ZWFA 4C1FA 1BMCA 3F9OA 3IE0A 5EVDA 5ACSA 4D1UA 3KNRA 4D02A 3A4YA 4AX0B 5LMCA 1A7TA 5ACVA 4UWPB 1A8TA 2DOOA 4TZEA 1X8GA 5HIOA 2UYXA 1MQOA 3I13A 3QH8A 5FQAA 4Z5YA 4YSLA 3X2YA 3ZQ4A 2XR1A 3R2UA 5ACQA 1X8IA 2BFLA
chains in the Genus database with same CATH superfamily
4C1DA 5ACXA 1VGNA 4EYBA 3I15A 2CBNA 4NQ2A 5A0TA 2Q0JA 5AEBA 2A7MA 3IE1A 4EY2A 1JJTA 2OHIA 2YCBA 2YNVB 4Z60A 1YCFA 4JO0A 3S0ZA 2BFZB 5HH6A 5EHTA 4BZ3A 1VJNA 3X2ZA 2WRSA 2AIOA 5KILA 3X2XA 2BG2A 2M5DA 3G1PA 3PY6A 4HL1A 3RKKA 4TZFA 4AD9A 3T3OA 3IELA 3ZNBA 3BV6A 1QH5A 4UBQA 5A87A 1WUPA 3I0VA 5LM6A 4EXSA 5EV6A 3MD7A 1JJEA 2Q42A 5A5ZA 4ZO3A 5EVKA 5LE1A 3X30A 3PY5A 4V0HA 2Q9UA 1Y44A 4BP0A 4AXHA 4WD6A 2XF4A 1DXKA 4PDXA 2YHEA 5EVBA 4RBSA 4P62A 1K07A 2Y8AA 4NQ4A 2I7XA 3SW3A 5FQBA 1KR3A 2AZ4A 2GFKA 3IEMA 4RL2A 3ESHA 2BFZA 2NXAA 1KO3A 3JXPA 1WUOA 5ACRA 2ZO4A 1ZKPA 3I14A 1VMEA 1E5DA 2FU7A 2BG7A 2WYMC 2NYPA 4ZO2A 5K4MA 4TYTA 3SFPA 2BMIA 1XTOA 5AJLA 4AX1B 2QDSA 3BC2A 5A23A 1XM8A 4XWWA 1L9YA 2YNWA 1M2XA 2VW8A 2P1EA 4UA4A 2CG2A 5K0WA 4LE6A 1YCGA 3BK2A 4Z6XA 2GFJA 5B3RA 1JT1A 2NZEA 2BFKA 5LLDA 2FU8A 2Y8BA 2FK6A 3DH8A 4H0DA 2OHJA 4EXYA 4ZEJA 4UWOB 3RKJA 1YCHA 3P2UA 5AYAA 4RL0A 2BG6A 3PG4A 1WW1A 4ZNBA 4XWTA 2E7YA 5AIJA 2GKLA 2Y87A 4O98A 4KEQA 3ADRA 2QDTA 4Z67A 3DHBA 2ZWRA 4TYFA 2P4ZA 4NQ6A 4U4LA 5LSCA 2FHXA 5AHRA 5AXOA 2YNVA 3T3NA 4D1TA 1QH3A 2CFZA 5LCHA 3IDZA 2P18A 2P97A 3LVZA 5KIKA 4D1WA 2FU6A 2YNTB 5FQCA 4GYQA 4J5HA 4DIKA 3L6NA 3DHAA 4B87A 3H3EA 3SRXA 2M5CA 4UAMA 1BC2A 5B1UA 2YZ3A 4TZ9A 1P9EA 5HISA 4HKYA 2CFUA 4UWRB 5LCAA 2I7TA 2BTNA 4XUKA 2BG8B 4TZBA 4PVTA 4FEKA 4FSBA 5AXRA 2Q0IA 5IQKA 2I7VA 2BIBA 5K4NA 2GCUA 5LCFA 3AF6A 2QEDA 4YSKA 5HIQA 2QJSA 4C09A 5HH5A 4RAMA 3I11A 4EYFA 2OHHA 3AF5A 1WRAA 3ZR9A 4RAWA 3SPUA 2HB9A 5EWAA 3BK1A 4FR7A 2ZNBA 3FCZA 5EW0A 2FHXB 4AV7A 2FM6A 5AHOA 5HH4A 4C1CA 4KEPA 2NZFA 2R2DA 3IE2A 2YNUA 2GMNA 1KO2A 4AWZA 4C1HA 4J5FA 4EYLA 2YNTA 3SD9A 5ACUA 4C1EA 2FU9A 5LS3A 1SMLA 4NQ5A 2DKFA 3AJ3A 4C1GA 4RM5A 2CG3A 3IEKA 4AWYB 5A0VA 1BVTA 4GYUA 4Z7RA 4F6HA 2QINA 2WYMA 3IOFA 3TP9A 2H6AA 3DHCA 5ACTA 3SBLA 1ZTCA 3IOGA 5ACPA 4UWSB 3Q6VA 2WYLA 3T9MA 1HLKA 2BR6A 5B15A 1DD6A 3VQZA 4PVOA 5EH9A 4CHLA 5DPXA 4DILA 1X8HA 4Z5ZA 2BC2A 4YSBA 3WXCA 4EFZA 3RPCA 5K4KA 3VPEA 2ZZIA 2BGAA 4HL2A 3KNSA 1ZNBA 3KL7A 2BG8A 5EV8A 2WHGA 1DDKA 4F6ZA 4D1VA 5ACWA 3FAIA 4GCWA 5HIPA 3ZWFA 4C1FA 1BMCA 3F9OA 3IE0A 5EVDA 5ACSA 4D1UA 3KNRA 4D02A 3A4YA 4AX0B 5LMCA 1A7TA 5ACVA 4UWPB 1A8TA 2DOOA 4TZEA 1X8GA 5HIOA 2UYXA 4NURA 1MQOA 3I13A 3QH8A 5FQAA 4Z5YA 4YSLA 3X2YA 3ZQ4A 2XR1A 3R2UA 5ACQA 1X8IA 2BFLA
chains in the Genus database with same CATH topology
4C1DA 5ACXA 1VGNA 4EYBA 3I15A 2CBNA 4NQ2A 5A0TA 2Q0JA 5AEBA 2A7MA 3IE1A 4EY2A 1JJTA 2OHIA 2YCBA 2YNVB 4Z60A 1YCFA 4JO0A 3S0ZA 2BFZB 5HH6A 5EHTA 4BZ3A 1VJNA 3X2ZA 2WRSA 2AIOA 5KILA 3X2XA 2BG2A 2M5DA 3G1PA 3PY6A 4HL1A 3RKKA 4TZFA 4AD9A 3T3OA 3IELA 3ZNBA 3BV6A 1QH5A 4UBQA 5A87A 1WUPA 3I0VA 5LM6A 4EXSA 5EV6A 3MD7A 1JJEA 2Q42A 5A5ZA 4ZO3A 5EVKA 5LE1A 3X30A 3PY5A 4V0HA 2Q9UA 1Y44A 4BP0A 4WD6A 2XF4A 1DXKA 5EVBA 4RBSA 4P62A 1K07A 2Y8AA 4NQ4A 2I7XA 3SW3A 5FQBA 1KR3A 2AZ4A 2GFKA 3IEMA 4RL2A 3ESHA 2BFZA 2NXAA 1KO3A 3JXPA 1WUOA 5ACRA 2ZO4A 1ZKPA 3I14A 1VMEA 1E5DA 2FU7A 2BG7A 2WYMC 2NYPA 4ZO2A 5K4MA 4TYTA 3SFPA 2BMIA 1XTOA 4AX1B 2QDSA 3BC2A 1XM8A 4XWWA 1L9YA 2YNWA 1M2XA 2VW8A 2P1EA 4UA4A 5K0WA 4LE6A 1YCGA 3BK2A 4Z6XA 2GFJA 5B3RA 1JT1A 2NZEA 5LLDA 2BFKA 2FU8A 2Y8BA 2FK6A 3DH8A 4H0DA 2OHJA 4EXYA 4ZEJA 4UWOB 3RKJA 1YCHA 3P2UA 5AYAA 4RL0A 2BG6A 3PG4A 1WW1A 4ZNBA 4XWTA 2E7YA 2GKLA 2Y87A 4O98A 4KEQA 3ADRA 2QDTA 4Z67A 3DHBA 2ZWRA 4TYFA 2P4ZA 4NQ6A 4U4LA 5LSCA 2FHXA 5AHRA 5AXOA 2YNVA 3T3NA 4D1TA 1QH3A 5LCHA 3IDZA 2P18A 2P97A 3LVZA 5KIKA 4D1WA 2FU6A 2YNTB 5FQCA 4GYQA 4J5HA 4DIKA 3L6NA 3DHAA 4B87A 3H3EA 3SRXA 2M5CA 4UAMA 1BC2A 5B1UA 2YZ3A 4TZ9A 1P9EA 5HISA 4HKYA 4UWRB 5LCAA 2I7TA 2BTNA 4XUKA 2BG8B 4TZBA 4PVTA 4FEKA 4FSBA 5AXRA 2Q0IA 5IQKA 2I7VA 2BIBA 5K4NA 2GCUA 5LCFA 3AF6A 2QEDA 4YSKA 5HIQA 2QJSA 4C09A 5HH5A 4RAMA 3I11A 4EYFA 2OHHA 3AF5A 1WRAA 3ZR9A 4RAWA 3SPUA 2HB9A 5EWAA 3BK1A 4FR7A 2ZNBA 3FCZA 5EW0A 2FHXB 2FM6A 5AHOA 5HH4A 4C1CA 4KEPA 2NZFA 2R2DA 3IE2A 2YNUA 2GMNA 1KO2A 4AWZA 4C1HA 4J5FA 4EYLA 2YNTA 3SD9A 5ACUA 4C1EA 2FU9A 5LS3A 1SMLA 2DKFA 3AJ3A 4NQ5A 4C1GA 4RM5A 3IEKA 4AWYB 5A0VA 1BVTA 4GYUA 4Z7RA 4F6HA 2QINA 2WYMA 3IOFA 3TP9A 2H6AA 3DHCA 5ACTA 3SBLA 1ZTCA 3IOGA 5ACPA 4UWSB 3Q6VA 2WYLA 3T9MA 1HLKA 2BR6A 5B15A 1DD6A 3VQZA 4PVOA 5EH9A 4CHLA 5DPXA 4DILA 1X8HA 4Z5ZA 2BC2A 4YSBA 3WXCA 4EFZA 3RPCA 5K4KA 3VPEA 2ZZIA 2BGAA 4HL2A 3KNSA 1ZNBA 3KL7A 2BG8A 5EV8A 2WHGA 1DDKA 4F6ZA 4D1VA 5ACWA 3FAIA 4GCWA 5HIPA 3ZWFA 4C1FA 1BMCA 3F9OA 3IE0A 5EVDA 5ACSA 4D1UA 3KNRA 4D02A 3A4YA 4AX0B 5LMCA 1A7TA 5ACVA 4UWPB 1A8TA 2DOOA 4TZEA 1X8GA 5HIOA 2UYXA 1MQOA 3I13A 3QH8A 5FQAA 4Z5YA 4YSLA 3X2YA 3ZQ4A 2XR1A 3R2UA 5ACQA 1X8IA 2BFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1D A;  5ACX A;  1VGN A;  4EYB A;  3I15 A;  2CBN A;  4NQ2 A;  5A0T A;  2Q0J A;  5AEB A;  2A7M A;  3IE1 A;  4EY2 A;  1JJT A;  2OHI A;  2YCB A;  2YNV B;  4Z60 A;  1YCF A;  4JO0 A;  3S0Z A;  2BFZ B;  5HH6 A;  5EHT A;  4BZ3 A;  1VJN A;  3X2Z A;  2WRS A;  2AIO A;  5KIL A;  3X2X A;  2BG2 A;  2M5D A;  3G1P A;  3PY6 A;  4HL1 A;  3RKK A;  4TZF A;  4AD9 A;  3T3O A;  3IEL A;  3ZNB A;  3BV6 A;  1QH5 A;  4UBQ A;  5A87 A;  1WUP A;  3I0V A;  5LM6 A;  4EXS A;  5EV6 A;  3MD7 A;  1JJE A;  2Q42 A;  5A5Z A;  4ZO3 A;  5EVK A;  5LE1 A;  3X30 A;  3PY5 A;  4V0H A;  2Q9U A;  1Y44 A;  4BP0 A;  4WD6 A;  2XF4 A;  1DXK A;  5EVB A;  4RBS A;  4P62 A;  1K07 A;  2Y8A A;  4NQ4 A;  2I7X A;  3SW3 A;  5FQB A;  1KR3 A;  2AZ4 A;  2GFK A;  3IEM A;  4RL2 A;  3ESH A;  2BFZ A;  2NXA A;  1KO3 A;  3JXP A;  1WUO A;  5ACR A;  2ZO4 A;  1ZKP A;  3I14 A;  1VME A;  1E5D A;  2FU7 A;  2BG7 A;  2WYM C;  2NYP A;  4ZO2 A;  5K4M A;  4TYT A;  3SFP A;  2BMI A;  1XTO A;  4AX1 B;  2QDS A;  3BC2 A;  1XM8 A;  4XWW A;  1L9Y A;  2YNW A;  1M2X A;  2VW8 A;  2P1E A;  4UA4 A;  5K0W A;  4LE6 A;  1YCG A;  3BK2 A;  4Z6X A;  2GFJ A;  5B3R A;  1JT1 A;  2NZE A;  5LLD A;  2BFK A;  2FU8 A;  2Y8B A;  2FK6 A;  3DH8 A;  4H0D A;  2OHJ A;  4EXY A;  4ZEJ A;  4UWO B;  3RKJ A;  1YCH A;  3P2U A;  5AYA A;  4RL0 A;  2BG6 A;  3PG4 A;  1WW1 A;  4ZNB A;  4XWT A;  2E7Y A;  2GKL A;  2Y87 A;  4O98 A;  4KEQ A;  3ADR A;  2QDT A;  4Z67 A;  3DHB A;  2ZWR A;  4TYF A;  2P4Z A;  4NQ6 A;  4U4L A;  5LSC A;  2FHX A;  5AHR A;  5AXO A;  2YNV A;  3T3N A;  4D1T A;  1QH3 A;  5LCH A;  3IDZ A;  2P18 A;  2P97 A;  3LVZ A;  5KIK A;  4D1W A;  2FU6 A;  2YNT B;  5FQC A;  4GYQ A;  4J5H A;  4DIK A;  3L6N A;  3DHA A;  4B87 A;  3H3E A;  3SRX A;  2M5C A;  4UAM A;  1BC2 A;  5B1U A;  2YZ3 A;  4TZ9 A;  1P9E A;  5HIS A;  4HKY A;  4UWR B;  5LCA A;  2I7T A;  2BTN A;  4XUK A;  2BG8 B;  4TZB A;  4PVT A;  4FEK A;  4FSB A;  5AXR A;  2Q0I A;  5IQK A;  2I7V A;  2BIB A;  5K4N A;  2GCU A;  5LCF A;  3AF6 A;  2QED A;  4YSK A;  5HIQ A;  2QJS A;  4C09 A;  5HH5 A;  4RAM A;  3I11 A;  4EYF A;  2OHH A;  3AF5 A;  1WRA A;  3ZR9 A;  4RAW A;  3SPU A;  2HB9 A;  5EWA A;  3BK1 A;  4FR7 A;  2ZNB A;  3FCZ A;  5EW0 A;  2FHX B;  2FM6 A;  5AHO A;  5HH4 A;  4C1C A;  4KEP A;  2NZF A;  2R2D A;  3IE2 A;  2YNU A;  2GMN A;  1KO2 A;  4AWZ A;  4C1H A;  4J5F A;  4EYL A;  2YNT A;  3SD9 A;  5ACU A;  4C1E A;  2FU9 A;  5LS3 A;  1SML A;  2DKF A;  3AJ3 A;  4NQ5 A;  4C1G A;  4RM5 A;  3IEK A;  4AWY B;  5A0V A;  1BVT A;  4GYU A;  4Z7R A;  4F6H A;  2QIN A;  2WYM A;  3IOF A;  3TP9 A;  2H6A A;  3DHC A;  5ACT A;  3SBL A;  1ZTC A;  3IOG A;  5ACP A;  4UWS B;  3Q6V A;  2WYL A;  3T9M A;  1HLK A;  2BR6 A;  5B15 A;  1DD6 A;  3VQZ A;  4PVO A;  5EH9 A;  4CHL A;  5DPX A;  4DIL A;  1X8H A;  4Z5Z A;  2BC2 A;  4YSB A;  3WXC A;  4EFZ A;  3RPC A;  5K4K A;  3VPE A;  2ZZI A;  2BGA A;  4HL2 A;  3KNS A;  1ZNB A;  3KL7 A;  2BG8 A;  5EV8 A;  2WHG A;  1DDK A;  4F6Z A;  4D1V A;  5ACW A;  3FAI A;  4GCW A;  5HIP A;  3ZWF A;  4C1F A;  1BMC A;  3F9O A;  3IE0 A;  5EVD A;  5ACS A;  4D1U A;  3KNR A;  4D02 A;  3A4Y A;  4AX0 B;  5LMC A;  1A7T A;  5ACV A;  4UWP B;  1A8T A;  2DOO A;  4TZE A;  1X8G A;  5HIO A;  2UYX A;  1MQO A;  3I13 A;  3QH8 A;  5FQA A;  4Z5Y A;  4YSL A;  3X2Y A;  3ZQ4 A;  2XR1 A;  3R2U A;  5ACQ A;  1X8I A;  2BFL A; 
#chains in the Genus database with same CATH topology
 4C1D A;  5ACX A;  1VGN A;  4EYB A;  3I15 A;  2CBN A;  4NQ2 A;  5A0T A;  2Q0J A;  5AEB A;  2A7M A;  3IE1 A;  4EY2 A;  1JJT A;  2OHI A;  2YCB A;  2YNV B;  4Z60 A;  1YCF A;  4JO0 A;  3S0Z A;  2BFZ B;  5HH6 A;  5EHT A;  4BZ3 A;  1VJN A;  3X2Z A;  2WRS A;  2AIO A;  5KIL A;  3X2X A;  2BG2 A;  2M5D A;  3G1P A;  3PY6 A;  4HL1 A;  3RKK A;  4TZF A;  4AD9 A;  3T3O A;  3IEL A;  3ZNB A;  3BV6 A;  1QH5 A;  4UBQ A;  5A87 A;  1WUP A;  3I0V A;  5LM6 A;  4EXS A;  5EV6 A;  3MD7 A;  1JJE A;  2Q42 A;  5A5Z A;  4ZO3 A;  5EVK A;  5LE1 A;  3X30 A;  3PY5 A;  4V0H A;  2Q9U A;  1Y44 A;  4BP0 A;  4AXH A;  4WD6 A;  2XF4 A;  1DXK A;  4PDX A;  2YHE A;  5EVB A;  4RBS A;  4P62 A;  1K07 A;  2Y8A A;  4NQ4 A;  2I7X A;  3SW3 A;  5FQB A;  1KR3 A;  2AZ4 A;  2GFK A;  3IEM A;  4RL2 A;  3ESH A;  2BFZ A;  2NXA A;  1KO3 A;  3JXP A;  1WUO A;  5ACR A;  2ZO4 A;  1ZKP A;  3I14 A;  1VME A;  1E5D A;  2FU7 A;  2BG7 A;  2WYM C;  2NYP A;  4ZO2 A;  5K4M A;  4TYT A;  3SFP A;  2BMI A;  1XTO A;  5AJL A;  4AX1 B;  2QDS A;  3BC2 A;  5A23 A;  1XM8 A;  4XWW A;  1L9Y A;  2YNW A;  1M2X A;  2VW8 A;  2P1E A;  4UA4 A;  2CG2 A;  5K0W A;  4LE6 A;  1YCG A;  3BK2 A;  4Z6X A;  2GFJ A;  5B3R A;  1JT1 A;  2NZE A;  2BFK A;  5LLD A;  2FU8 A;  2Y8B A;  2FK6 A;  3DH8 A;  4H0D A;  2OHJ A;  4EXY A;  4ZEJ A;  4UWO B;  3RKJ A;  1YCH A;  3P2U A;  5AYA A;  4RL0 A;  2BG6 A;  3PG4 A;  1WW1 A;  4ZNB A;  4XWT A;  2E7Y A;  5AIJ A;  2GKL A;  2Y87 A;  4O98 A;  4KEQ A;  3ADR A;  2QDT A;  4Z67 A;  3DHB A;  2ZWR A;  4TYF A;  2P4Z A;  4NQ6 A;  4U4L A;  5LSC A;  2FHX A;  5AHR A;  5AXO A;  2YNV A;  3T3N A;  4D1T A;  1QH3 A;  2CFZ A;  5LCH A;  3IDZ A;  2P18 A;  2P97 A;  3LVZ A;  5KIK A;  4D1W A;  2FU6 A;  2YNT B;  5FQC A;  4GYQ A;  4J5H A;  4DIK A;  3L6N A;  3DHA A;  4B87 A;  3H3E A;  3SRX A;  2M5C A;  4UAM A;  1BC2 A;  5B1U A;  2YZ3 A;  4TZ9 A;  1P9E A;  5HIS A;  4HKY A;  2CFU A;  4UWR B;  5LCA A;  2I7T A;  2BTN A;  4XUK A;  2BG8 B;  4TZB A;  4PVT A;  4FEK A;  4FSB A;  5AXR A;  2Q0I A;  5IQK A;  2I7V A;  2BIB A;  5K4N A;  2GCU A;  5LCF A;  3AF6 A;  2QED A;  4YSK A;  5HIQ A;  2QJS A;  4C09 A;  5HH5 A;  4RAM A;  3I11 A;  4EYF A;  2OHH A;  3AF5 A;  1WRA A;  3ZR9 A;  4RAW A;  3SPU A;  2HB9 A;  5EWA A;  3BK1 A;  4FR7 A;  2ZNB A;  3FCZ A;  5EW0 A;  2FHX B;  4AV7 A;  2FM6 A;  5AHO A;  5HH4 A;  4C1C A;  4KEP A;  2NZF A;  2R2D A;  3IE2 A;  2YNU A;  2GMN A;  1KO2 A;  4AWZ A;  4C1H A;  4J5F A;  4EYL A;  2YNT A;  3SD9 A;  5ACU A;  4C1E A;  2FU9 A;  5LS3 A;  1SML A;  4NQ5 A;  2DKF A;  3AJ3 A;  4C1G A;  4RM5 A;  2CG3 A;  3IEK A;  4AWY B;  5A0V A;  1BVT A;  4GYU A;  4Z7R A;  4F6H A;  2QIN A;  2WYM A;  3IOF A;  3TP9 A;  2H6A A;  3DHC A;  5ACT A;  3SBL A;  1ZTC A;  3IOG A;  5ACP A;  4UWS B;  3Q6V A;  2WYL A;  3T9M A;  1HLK A;  2BR6 A;  5B15 A;  1DD6 A;  3VQZ A;  4PVO A;  5EH9 A;  4CHL A;  5DPX A;  4DIL A;  1X8H A;  4Z5Z A;  2BC2 A;  4YSB A;  3WXC A;  4EFZ A;  3RPC A;  5K4K A;  3VPE A;  2ZZI A;  2BGA A;  4HL2 A;  3KNS A;  1ZNB A;  3KL7 A;  2BG8 A;  5EV8 A;  2WHG A;  1DDK A;  4F6Z A;  4D1V A;  5ACW A;  3FAI A;  4GCW A;  5HIP A;  3ZWF A;  4C1F A;  1BMC A;  3F9O A;  3IE0 A;  5EVD A;  5ACS A;  4D1U A;  3KNR A;  4D02 A;  3A4Y A;  4AX0 B;  5LMC A;  1A7T A;  5ACV A;  4UWP B;  1A8T A;  2DOO A;  4TZE A;  1X8G A;  5HIO A;  2UYX A;  4NUR A;  1MQO A;  3I13 A;  3QH8 A;  5FQA A;  4Z5Y A;  4YSL A;  3X2Y A;  3ZQ4 A;  2XR1 A;  3R2U A;  5ACQ A;  1X8I A;  2BFL A; 
#chains in the Genus database with same CATH homology
 4C1D A;  5ACX A;  1VGN A;  4EYB A;  3I15 A;  2CBN A;  4NQ2 A;  5A0T A;  2Q0J A;  5AEB A;  2A7M A;  3IE1 A;  4EY2 A;  1JJT A;  2OHI A;  2YCB A;  2YNV B;  4Z60 A;  1YCF A;  4JO0 A;  3S0Z A;  2BFZ B;  5HH6 A;  5EHT A;  4BZ3 A;  1VJN A;  3X2Z A;  2WRS A;  2AIO A;  5KIL A;  3X2X A;  2BG2 A;  2M5D A;  3G1P A;  3PY6 A;  4HL1 A;  3RKK A;  4TZF A;  4AD9 A;  3T3O A;  3IEL A;  3ZNB A;  3BV6 A;  1QH5 A;  4UBQ A;  5A87 A;  1WUP A;  3I0V A;  5LM6 A;  4EXS A;  5EV6 A;  3MD7 A;  1JJE A;  2Q42 A;  5A5Z A;  4ZO3 A;  5EVK A;  5LE1 A;  3X30 A;  3PY5 A;  4V0H A;  2Q9U A;  1Y44 A;  4BP0 A;  4WD6 A;  2XF4 A;  1DXK A;  5EVB A;  4RBS A;  4P62 A;  1K07 A;  2Y8A A;  4NQ4 A;  2I7X A;  3SW3 A;  5FQB A;  1KR3 A;  2AZ4 A;  2GFK A;  3IEM A;  4RL2 A;  3ESH A;  2BFZ A;  2NXA A;  1KO3 A;  3JXP A;  1WUO A;  5ACR A;  2ZO4 A;  1ZKP A;  3I14 A;  1VME A;  1E5D A;  2FU7 A;  2BG7 A;  2WYM C;  2NYP A;  4ZO2 A;  5K4M A;  4TYT A;  3SFP A;  2BMI A;  1XTO A;  4AX1 B;  2QDS A;  3BC2 A;  1XM8 A;  4XWW A;  1L9Y A;  2YNW A;  1M2X A;  2VW8 A;  2P1E A;  4UA4 A;  5K0W A;  4LE6 A;  1YCG A;  3BK2 A;  4Z6X A;  2GFJ A;  5B3R A;  1JT1 A;  2NZE A;  5LLD A;  2BFK A;  2FU8 A;  2Y8B A;  2FK6 A;  3DH8 A;  4H0D A;  2OHJ A;  4EXY A;  4ZEJ A;  4UWO B;  3RKJ A;  1YCH A;  3P2U A;  5AYA A;  4RL0 A;  2BG6 A;  3PG4 A;  1WW1 A;  4ZNB A;  4XWT A;  2E7Y A;  2GKL A;  2Y87 A;  4O98 A;  4KEQ A;  3ADR A;  2QDT A;  4Z67 A;  3DHB A;  2ZWR A;  4TYF A;  2P4Z A;  4NQ6 A;  4U4L A;  5LSC A;  2FHX A;  5AHR A;  5AXO A;  2YNV A;  3T3N A;  4D1T A;  1QH3 A;  5LCH A;  3IDZ A;  2P18 A;  2P97 A;  3LVZ A;  5KIK A;  4D1W A;  2FU6 A;  2YNT B;  5FQC A;  4GYQ A;  4J5H A;  4DIK A;  3L6N A;  3DHA A;  4B87 A;  3H3E A;  3SRX A;  2M5C A;  4UAM A;  1BC2 A;  5B1U A;  2YZ3 A;  4TZ9 A;  1P9E A;  5HIS A;  4HKY A;  4UWR B;  5LCA A;  2I7T A;  2BTN A;  4XUK A;  2BG8 B;  4TZB A;  4PVT A;  4FEK A;  4FSB A;  5AXR A;  2Q0I A;  5IQK A;  2I7V A;  2BIB A;  5K4N A;  2GCU A;  5LCF A;  3AF6 A;  2QED A;  4YSK A;  5HIQ A;  2QJS A;  4C09 A;  5HH5 A;  4RAM A;  3I11 A;  4EYF A;  2OHH A;  3AF5 A;  1WRA A;  3ZR9 A;  4RAW A;  3SPU A;  2HB9 A;  5EWA A;  3BK1 A;  4FR7 A;  2ZNB A;  3FCZ A;  5EW0 A;  2FHX B;  2FM6 A;  5AHO A;  5HH4 A;  4C1C A;  4KEP A;  2NZF A;  2R2D A;  3IE2 A;  2YNU A;  2GMN A;  1KO2 A;  4AWZ A;  4C1H A;  4J5F A;  4EYL A;  2YNT A;  3SD9 A;  5ACU A;  4C1E A;  2FU9 A;  5LS3 A;  1SML A;  2DKF A;  3AJ3 A;  4NQ5 A;  4C1G A;  4RM5 A;  3IEK A;  4AWY B;  5A0V A;  1BVT A;  4GYU A;  4Z7R A;  4F6H A;  2QIN A;  2WYM A;  3IOF A;  3TP9 A;  2H6A A;  3DHC A;  5ACT A;  3SBL A;  1ZTC A;  3IOG A;  5ACP A;  4UWS B;  3Q6V A;  2WYL A;  3T9M A;  1HLK A;  2BR6 A;  5B15 A;  1DD6 A;  3VQZ A;  4PVO A;  5EH9 A;  4CHL A;  5DPX A;  4DIL A;  1X8H A;  4Z5Z A;  2BC2 A;  4YSB A;  3WXC A;  4EFZ A;  3RPC A;  5K4K A;  3VPE A;  2ZZI A;  2BGA A;  4HL2 A;  3KNS A;  1ZNB A;  3KL7 A;  2BG8 A;  5EV8 A;  2WHG A;  1DDK A;  4F6Z A;  4D1V A;  5ACW A;  3FAI A;  4GCW A;  5HIP A;  3ZWF A;  4C1F A;  1BMC A;  3F9O A;  3IE0 A;  5EVD A;  5ACS A;  4D1U A;  3KNR A;  4D02 A;  3A4Y A;  4AX0 B;  5LMC A;  1A7T A;  5ACV A;  4UWP B;  1A8T A;  2DOO A;  4TZE A;  1X8G A;  5HIO A;  2UYX A;  1MQO A;  3I13 A;  3QH8 A;  5FQA A;  4Z5Y A;  4YSL A;  3X2Y A;  3ZQ4 A;  2XR1 A;  3R2U A;  5ACQ A;  1X8I A;  2BFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...