2WYPA

Crystal structure of sialic acid binding protein
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
308
structure length
306
Chain Sequence
ADYDLKFGMNNGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKTHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Sialic Acid Binding Protein
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 122
structure length 306
sequence length 308
ec nomenclature
pdb deposition date 2009-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2wypA00
4P1LA 3B50A 4PFBA 4P3LA 4YZZA 4MNPA 5IGAA 4MAGA 4O7MA 3GYYA 2V4CA 2CEYA 2XWOA 4P1EA 4PF8A 4NAPA 2ZZVA 4MX6A 4N6DA 4NG7A 4O8MA 4PFRA 4MHFA 2VPOA 4O94A 4PAIA 4PDDA 4PGNA 4MNCA 2CEXA 3FXBA 4N8GA 4PCDA 4OA4A 5LTCA 4NQ8A 4OANA 4DI3D 2PFYA 4PBHA 4PAFA 2XA5A 4MNIA 4N8YA 4N6KA 4N17A 2VPNA 4PC9A 4NN3A 4NHBA 4N91A 4NX1A 4OVTA 4P8BA 4MMPA 3U65A 4P47A 5CM6A 4X8RA 4YICA 4XFEA 2WYKA 4N4UA 4OVPA 4UABA 4PETA 4PBQA 2XWVA 5IM2A 4PAKA 4NGUA 4MCOA 4P56A 2PFZA 4P9KA 4XF5A 2XWIA 2XXKA 4PE3A 4DI4B 2XWKA 5I5PA 4MIJA 4N15A 4NF0A 4XEQA 2WX9A 2HZLA 4PDHA 4PFIA 2HPGA 2ZZWA 4MEVA 4PF6A 4PGPA 5IZZA 2HZKA 4X04A 4OVSA 4OVQA 4OVRA 4LN5A 5I7IA 2ZZXA 2WYPA
chains in the Genus database with same CATH superfamily
3PD8A 3SEWA 3K6WA 1M5CA 4MNPA 4LP2B 5I57A 2F3DA 2DWIA 1Y20A 3PUVE 4X9TA 5EYGA 4F3GA 4NMYA 3TTLA 4EUOA 1FPGA 3A29A 1USYE 4MX6A 4O8MA 2IEEA 4PFRA 3SDFA 4AB5A 1B32A 3CSBA 1SI1A 2V84A 4RK2A 5EQ9A 2REJA 3L6GA 3MSTA 3Q28A 1DTGA 2QSXA 1B4HA 4OMBA 2DWAA 2NXOA 4YKPA 2ZXTA 5AA2A 4P0GA 4YKKA 2UYFA 5JTYB 1H3DA 2R8TA 3RT8A 4G68B 2LAOA 2VD3A 2B4LA 4JBZA 4NN3A 5I2KB 3TTKA 1MPCA 1BLFA 1SD3A 1NUXA 1N7XA 3KJTA 1GGGA 5CM6A 2WEFA 2HHMA 4OVPA 4GWXA 4PE5B 3QMFA 4XF5A 3B7DA 1LBXA 4NF5A 3CFZA 4DXBA 2R71A 1JEUA 1DPEA 4JB7A 1D9VA 2XXUA 1EYJA 1Y1MA 3SEXA 3SETA 1LFGA 2DP8A 2HZKA 4O3AA 4NF4B 5J1DA 3DM0A 1XOCA 2GH9A 1UTBB 4FECA 1NV7A 2DOJA 3ZS6A 3GZGA 4P3LA 2REGA 3USDA 1UIUA 1EYIA 3QUFA 4F3BA 1I6BA 3H6TA 3IOVA 5DVFA 3H7MA 2XXPA 3ZSFA 3MVXA 2QS4A 3D4GA 4PAIA 1PB8A 3OO7A 1INPA 5I2NB 5ICQA 4BLAA 4MNCA 4R6YA 2O68A 4GL0A 3KOTA 4FATA 1QW0A 2Z8FA 3A09A 3G3JA 3ISPA 2I48A 1NV2A 1S9TA 1HSLA 1B3LA 4OFOA 5F24A 4ZEFA 4ZE8A 3ONMA 1MH3A 4NWDA 3PGFA 1OVTA 4R9GA 4OXVA 1UTBA 2XX9A 3MQ9A 3B8BA 1IQ7A 1QUKA 1ZTYA 3I5OA 4F1YA 5HBCA 5IZ3B 4QF9A 3TZAA 5DEXB 2Y7WA 3HPIA 4C1TA 4R72A 3ZKLA 4MIJA 1P1OA 3RN8A 4XTCQ 3B6QA 4PFIA 5L8DA 2HPGA 1FPDA 3LV0A 2ZYNA 3O6IA 1SW1A 1BIYA 4Q5TA 3EPEA 3MUQA 3DLNA 4TLMB 3FV1A 5I7IA 4U22A 1NV1A 4EQ7A 2FYIA 4WEDA 3VVEA 3V8XB 3GYYA 3FVKA 4PFWA 4EF2A 3VXBA 3U72A 1A7LA 3FVNA 1QVSA 3A3CA 5TPAA 4JDFA 3PPOA 4RY1A 1MM7A 1MPBA 3OENA 4FEBA 3TEPA 4M4GA 3U92A 4I3EA 4PDDA 2X7QA 2NOOA 4OETA 3RPWA 3H6UA 5JK4A 4OA4A 3FBPA 3A3UA 2ZNSA 4N07A 5DVIA 1B5IA 4H1XA 3THIA 5I56B 3Q26A 3LUZA 3KBRA 2AYSA 4GWZA 5IKBA 2P2AA 5L9MA 1URDA 4HCYA 1Q1KA 3D1RA 4H6DA 2GHBA 4ZS9A 2O7IA 3O66A 3U65A 5H8SA 1FBDA 3PUYE 3HHGA 4H5FA 3PD9A 3KGCA 3O6HA 4GX4A 5H8FB 3RTWB 3UA8A 2I0BA 1YAEA 4LVQA 4OFLA 4NTLA 3MJNA 3TTMA 4KCDA 1O63A 1SVXB 2HCAA 2Y7IA 5AE4A 3LC8A 3IO4A 2Q8JA 1GVCA 1B51A 2NUVA 1B40A 1US5A 5EQ7A 1B5HA 3E13X 3P7IA 1MM6A 3FJGA 3WAEA 2F6GA 1MQHA 3B50A 5DVJA 4PFBA 4EQ9A 2KR0A 1GTKA 2D21A 1I6AA 4H67A 1SW5A 2F3BA 4NF8A 2RC9A 5KCJB 1PEBA 3KSJA 4C0RA 5L9SA 2QMWA 1FJ9A 3CFLA 4GD5A 1AMFA 1Q9DA 5H8HA 2ONKE 3C4MA 1SW4A 3KEIA 1BP5A 4IY6A 4JXIA 5CI5A 1B9JA 1I69A 2AL4A 3BKIB 3FXBA 2UVGA 3RLFE 4DCYA 1D3KA 4GIZA 3CIJA 4OANA 2Z8DA 2UYEA 3IJXB 2O7UA 2VP1A 3OEKA 3WAFA 4JWXA 4PC9A 4O7IA 1LAGE 4OVJA 3TCHA 3FXQA 5EYHA 1LB9A 4LUBA 2G29A 2PCRA 2WYKA 3PUWE 4I8CA 4I1DA 1O7TA 4YMAA 1OLAA 4QFNA 4TQUQ 1NH7A 3IB1A 1FW0A 1B1XA 1WDNA 1A8FA 1B7ZA 2Z22A 4IB2A 4LA9A 2FBPA 2ZZWA 2F36A 4DXCA 2PMSA 4LN5A 3CRBA 3BFUA 3FIRA 2DVZA 4R74A 2A5SA 4YMBA 1B7HA 1B58A 2XXWA 3BBRA 5H8HB 1FJ6A 1DCUA 3KSXA 2Q88A 3EHUA 4LONB 3LUYA 4YB7A 4QFOA 1LEVA 2DDKA 1IXGA 5H8NB 3QIMA 1NKXA 1UIVA 4MF3A 4LZ7A 4G2ZA 4F18A 5KDTB 1R1NA 1IUDA 2RKMA 3MPKA 1JVYA 3TTRA 3TMGA 2CMOA 1RDZA 2GFEA 4PAFA 2D3IA 1K9YA 4BDMA 5CMBA 5F1QA 2V93A 2I3WA 2QS2A 1PB7A 1N0TA 3K02A 4XIGQ 3ZKKA 3KC1A 3L6HA 1MQIA 2Q2AA 2XD2A 3IFAA 4GOTA 2OWTA 4IY5A 3O9PA 2BJJX 4UABA 1NV5A 2F7BA 1R9LA 2XWVA 1NH8A 2F7CA 1YYZA 2OWZA 1MRPA 2XXKA 4AS5A 2GQ1A 4ELPA 3QK6A 2F7AA 1UTHA 2O51A 2XWKA 4JSDA 1FBPA 4ESXA 3SKPA 4R9FA 4WXJA 3HFUA 3DELB 4X04A 4NF6A 2F6PA 3IOWA 3MAMA 3GBBA 3KBZA 1NV3A 3N6TA 4HTGA 1XS5A 3CI8A 5AA3A 3IAZA 4YZZA 1ZBMA 1R6ZA 4MAGA 4O7MA 3KN7A 4F39A 2Y5LA 1MXVA 1N7WA 3M3LA 4IGTA 4HE1A 4PP0A 4QSCA 3N5LA 4I62A 3G3KA 1QKBA 2Q89A 3TODA 4RNSA 3C31A 4YKJA 4GXSB 1AL3A 5EYFA 5LTCA 4R6KA 3G3HA 3MP1A 3T66A 3I6VA 1FTOA 3KOSA 4H0WA 1B3FA 3U94A 1IMBA 2FA7A 1FTLA 2QMXA 4R75A 1FPJA 4PQJA 4NHBA 1RYXA 1MY1A 2FHYA 1D4NA 1FPEA 1OIBA 3E3KA 3N26A 1IITA 1S50A 1FCKA 5I2NA 5HM4B 1URSA 2HAVA 3TELA 3IB0A 3T22A 4Z7EA 2VD2A 2PFZA 5TP9A 1POY1 1NNPA 5F7VA 2XHDA 1NMUA 1Q35A 1B3GA 1FSAA 2YPNA 4MBPA 1TXFA 4XEQA 2FIXA 1Y4CA 1XVXA 5HPQA 3EQ1A 2NVUB 3TCFA 3PPNA 4OVQA 1B2HA 3M3FA 1TFAA 3B6WA 1JP4A 1B3HA 4FORA 1B1HA 5ET6A 2QRYA 2UVIA 3S9MC 2OWSA 4DLDA 2YLNA 2XWOA 1MXWA 1KA0A 4R73A 3FJ7A 1SYIA 2QL3A 3T93B 3W15C 3MP6A 2QFLA 2W7YA 3E4RA 4EXKA 1ZLQA 4F22A 1Y3QA 2XXXA 3LBSA 4UACA 3S4UA 1AWBA 4I9DA 1SYHA 2PBWA 4HE2A 1FPBA 2DWJA 1G0HA 4KHZE 2O1MA 3OOAA 3OEMA 4IO4A 2RINA 2P1SA 1FQFA 2D5WA 1IIWA 1JNFA 1IMCA 2PT1A 3CVGA 4ZECA 1OQHA 4X48A 4XFEA 5H8NA 4HXVA 1FBCA 3VVDA 1LAXA 1LBCA 4POWA 2XXYA 1A8EA 3VLVA 2I4BA 5I2KA 4U21A 3K6VA 1ZIUA 1NV6A 3CR9A 1R9QA 3IX1A 3TUSA 2QS3A 2XXQA 5LOMA 3LSXA 3H4ZA 3SESA 3DP8A 2BJIA 3RT6B 2Y7PA 1S7YA 1US4A 5DYHA 1USYH 4XKQA 4R2BA 2ABHA 1SI0A 3B6TA 4UA8A 3BIHA 3R26A 1K9ZA 3CHGA 4F3PA 4F3SA 1MY4A 3G3GA 4N6DA 5CRYA 4H8JA 1OLCA 4WEPA 3R6UA 2DXRA 1MDP1 4FE8A 3EKIA 4F2QA 3EN3A 1FPLA 1Z7NE 2CEXA 4R6HA 4PCDA 3ILTB 3H03A 3IR1A 2F97A 3K1PA 1B6HA 4NF8B 1URGA 4RPNA 3RTFB 1B0LA 4N6KA 3H06B 3KG2A 1BK4A 3IO6A 4N91A 1QKAA 3PUZE 5I3SA 2RCBA 1NNTA 1EYKA 1ZU0A 2V25A 1SBPA 4PFTA 1JW1A 3VE1B 1LBBA 2UVJA 1WODA 4PFYA 2B65A 2R9JA 4L17A 4PBQA 3GLBA 3IFCA 1JQFA 1UQWA 4GWUA 3ECRA 1MG1A 4U1OA 4LZ5A 4PE3A 4DI4B 5IAIA 2KQZA 1RYOA 2HZLA 1KA1A 4RJZA 4PF6A 4QRZA 1H43A 1PBQA 3HO7A 2DSFA 1EZOA 3UK4A 2OK2A 3TQLA 3OELA 5EQ8A 2I3VA 1ZMGA 4NE4A 4G8NA 4QXDA 2ESNA 1D9QA 4PF8A 1LCFA 4NAPA 1N04A 1TWYA 1DTZA 4U23A 2VPOA 1LBVA 1KWHA 2F35A 1XVYA 2P0SA 4QFLA 2HXRA 1G0IA 4YB6A 2G93A 1VFDA 4I40A 4DI3D 1YXIA 2PFYA 1N3XA 2VGQA 1FQEA 3FD3A 1LLSA 4QSEA 1XC1A 2Y84A 5IZ3A 1DMBA 5BUUA 1OVBA 1IMFA 3IL1B 2V3UA 4N17A 3EF7A 4TOZA 4ZEIA 3K01A 2PT2A 1P1NA 1EZ9A 4P11A 5H8FA 1Z7ME 3H6VA 4GBVA 3KN3A 3Q27A 4OVTA 4U4SA 4OENA 4E0XA 3O29A 3MPLA 1RKMA 2Q9TA 1N84A 3RPLB 4DCXA 4M1VA 2GHAA 2Y7KA 4JWYA 1LSTA 1SPIA 3NOHA 4P9KA 4Q0CA 2WBDA 2B4MA 3S9NC 4F2OA 4RPOA 5FTHA 2R6GE 4NF0A 2FNCA 4EXLA 1MPDA 4O3BA 4ZDMA 5I59A 4FBPA 3IORA 1FTJA 2QVRA 3C33A 1B4ZA 5ESYA 4DDDA 1LGBC 4X1DA 5DTBA 4IO2A 1VE4A 2Y7RA 3RUMA 3HV1A 4Z0IA 1ZKBA 2RCAA 4H45A 1Y9UA 1IXIA 4NWCA 1MXXA 4HE0A 4KD5A 4H65A 2XXRA 3MYUA 3JZJA 3HHFA 3O2AA 4BDLA 5ICTA 3V5AA 5ET8A 5AA4B 4MFIA 1FTKA 3M3KA 4PGNA 4IO5A 3FVOA 4GX3A 2Z8EA 4ZZEA 2F78A 1ANFA 3C34A 3KJ7A 1Y3NA 5L9OA 3BFTA 2DE2A 1ELJA 4JVIA 1MY3A 4POXA 2XA5A 2DWHA 5LDZA 4ELQA 3K4UA 1JW4A 3QYTA 3QSLA 4EF1A 5DEXA 1ZJLA 3W9WA 5H8QA 1KZ8A 5FHNA 5EQAA 3SZPA 1H44A 5DT6A 2RF1A 4F29A 4R2FA 1UTHB 4OYVA 4BDNA 4GBWA 3M8UA 1M5EA 4BDOA 1SDXA 2THIA 3MW0A 3N6UA 2ZYKA 2ONSA 3JYRA 4DIGA 3MVWA 5I84A 4GF8A 2WKYA 4ECFA 1FBHA 4G8HA 4HS7A 1RDXA 1Y3PA 2Q74A 4YU0A 5DW8A 2O1LA 3Q25A 2WYPA 4F19A 4F31B 1NNFA 4KPTA 2DYXA 1VR5A 1D9YA 4E0WA 2I49A 3IK6B 3RQTA 4H46A 2UXAA 2VOZA 4FEDA 2CEYA 1I6QA 2CZHA 3SEYA 2CZIA 2AL5A 2I0CA 5EHMA 4THIA 3FASA 1QGXA 3LSFB 1MY2A 2XXHA 2H98A 1DOTA 3TAJA 1VDWA 3FJMA 2XXTA 4LATA 4DE8A 1II5A 4BDRA 3GBAA 3T9UA 1MS7A 2HAUA 4HCWA 4GFRA 3QAXA 3OO6A 1IEJA 2ZMBA 5I57B 4N8YA 1JETA 2Q8MA 1H45A 2VPNA 1O64A 1B3EA 1LFIA 4Q30B 1NI9A 1JEVA 5KDTA 4WKMA 4OEUA 1MH4A 4ELOA 3PMWA 2XXVA 4H5GA 1A99A 3FZVA 5FHOA 3K2DA 5B7DA 2I6EA 4NGUA 3PPPA 5K2XA 3BIGA 4KR5A 4G77A 4C1UA 2HEUA 3PPRA 3MZ9A 4IO3A 3HN0A 1AH5A 4G68A 3O97A 4IR8A 3HSTA 4MEVA 4F1VA 4IO7A 2Q2CA 2OLBA 3K1MA 4QHQA 3ILUB 1NV4A 3IOUA 4DZ1A 1Y4TA 1XI6A 4I3YA 4G8MA 2OCUA 2AIXA 2V4CA 2ZNTA 3FGSA 3G7WA 3DP4A 3K0VA 3KN8A 2PVUA 1MXZA 1M5DA 4YKIA 3UIFA 3QXMA 4JWOA 1VFEA 4GQOA 2DE3A 2DQVA 2P3VA 2ZYMA 4N8GA 4RYAA 1IMEA 4MJOA 3VV5A 1FBFA 4MH5A 3RY3A 3H3GA 3TPAA 1P1UA 3R7XA 3CG1A 3QUJA 2V3QA 2XX7A 2IA4A 1MXUA 3C9HA 1B7UA 2Z23A 3K1NA 4Q8RA 1IMDA 1WVJA 4LQ2A 4GLIA 5I58B 1M5BA 4ZE9A 2OZZA 2GRVA 4ND9A 3TYHA 1QJMA 3VXCA 3H6WA 3MVZA 4ISUA 5IM2A 4PAKA 1HSEA 3D4CA 1EH3A 2XWIA 3OO9A 4G4PA 4K3FA 5KCJA 2QS1A 3PV0E 1MQGA 3PU5A 5ELVA 3MBPA 4ZEKA 3K6XA 3T9XB 5AA1A 4PDHA 2XXIA 4EQBA 3FXRA 3HCQA 2XD3A 4PGPA 5EHSA 4OVSA 5K2YA 5BWJA 1FRPA 3T9VA 5B70A 2F34A 3I3VA 1MY0A 2B3FA 1LBWA 1CE2A 3FATA 2VHAA 1NV0A 5TU0A 3S2VA 1IXHA 3OO8A 3VLWA 4XKPA 3JV9A 3IOTA 4FIMA 4AS4A 4GRKA 2X26A 1H76A 5CC2A 1FTAA 3DP6A 1M5FA 2WBBA 4NQ8A 4KXPA 4XKRA 3CFXA 5A5XA 3EHTA 4OQOA 1LAHE 1FQDA 4ESWA 2V3TA 4QFPA 1LBZA 4AB6A 4GVOA 3PMVA 3U8QA 3IB2A 2QPQA 2Y5KA 1F9BA 4N4UA 2O84X 5ISUA 1TFDA 4OZ9A 4U2RA 1N3WA 5TPAB 3G3IA 4MCOA 1FTMA 3T96B 1NFTA 5TP9B 5CMMA 1P1WA 1XT8A 2CZKA 2FIEA 2QVVA 4N81A 3O6GA 2WX9A 4IO6A 3PTYA 2ZNUA 2JJKA 1MDQA 5H8QB 3UORA 4FAJA 2B3BA 4BDQA 1GR2A 1DBZA 3FXUA 3MVYA 1AIVA 4P1LA 2I4CA 3RNNA 1YCJA 2A5TB 4RXLA 4G61A 4GWWA 5IGAA 3C36A 4KYEA 1NNKA 2ZYOA 3MZBA 2A5TA 3SEVA 2QVUA 3TKDA 2H25A 3F11A 1YTVA 5IZ1A 3UN6A 5JEIA 3GXAA 2HFBA 1Y1ZA 3OMBA 3OSRA 4GX6A 2H4IA 3PUXE 2VT5A 5CMKA 4NF4A 3TFLA 4O94A 4LZ8A 3TTNA 2HXWA 2DVCA 5ET5A 3SEUA 5CBSA 3MWBA 5FBPA 1PB9A 1PDAA 4KYSA 3TQWA 2DS9A 2ALUA 1QUJA 4P0IA 4GL8A 5CMCA 4DXUA 2PYYA 3RPLA 3MZ1A 5KZTA 3K6UA 1PBPA 4NX1A 1DPPA 4MMPA 4OFJA 1VSOA 4OTEA 1A40A 4X8RA 3SERA 4OHNA 3MC2A 3V83A 5FHMA 2CZLA 1IMAA 1CNQA 4ZEDA 4JSOA 1B05A 1FQCA 4NEDA 2E0SA 2DXYA 4NF5B 2MKZA 4PFUA 5A5XB 1LCTA 4KI0E 3PPQA 1BKAA 1PC3A 3LR1A 2RC7A 3T9HB 4KCCA 1POTA 2ANJA 1QULA 4KYDA 4ONYA 4N13A 3G3FA 1NL5A 1NUZA 4IGRA 5CBRA 4OEVA 4JVDA 1T0KA 2HQ0A 5I59B 1LAFE 3C35A 3IJOB 4FJPA 3S9LC 5ET7A 5AA4A 3T1BA 4GWYA 2DE4A 1QUIA 2H5YA 4P1EA 4HW8A 5AA2B 3LSWA 1AOVA 1OQGA 3CSGA 3PMXA 1YZ0A 1B46A 4MLVA 2KLFA 3C32A 3CG3A 3V89B 4LQ5A 4QSDA 4NF6B 4TLLB 4OERA 4ELRA 4PTKA 2O69A 4MNIA 3VLUA 3TDJA 1NUYA 2H99A 4RK9A 5JTYA 4KFQA 4OESA 3OD7A 4RA1A 4P8BA 4U4XA 4AQ4A 1OMPA 5I58A 3LSLA 4YICA 1FPIA 3U1OA 4EDPA 2E1SA 3VFJA 1SQYA 1EZPA 4YB5A 1MQDA 4GXAA 3VDFA 2F5XA 4P56A 3RYDA 1IXCA 3FVGA 3UP9A 3ODBA 3TCGA 5ITPA 1MXYA 4N15A 5M2VA 2P3NA 1A55A 2ONRA 1LBYA 2UVHA 1N76A 3ROJA 3VVFA 4JVCA 4F1UA 3FV2A 5AA2D 4GWSA 2FVZA 1DSNA 3S9EA 2YJPA 4X1BA 1JW5A 1B52A 4N6PA 2OBGA 1DK4A 3FUZA 5FTIA 5ITOA 1B0HA 2RC8A 2ZZVA 4NG7A 2OJTA 4QBAA 1LFHA 4MHFA 5J16A 3W9VA 3U93A 2F8DA 1L5TA 4ZZAA 2XX8A 4OWDA 1SW2A 2NWJA 1XHYA 4QFKA 1LB8A 4XXUA 2L5VA 1ATGA 2M8CA 1HSJA 3E78A 1GV8A 4XKNA 3KFMA 4PBHA 1MQJA 2H9BA 4YAHX 2OX3A 4GWOA 3RGYA 2X7PA 4KQPA 3O28A 3N94A 1YPNA 1JVXA 1FPKA 1FQAA 4P47A 4ZEBA 2QJEA 1TT1A 1NUWA 1P1QA 4PETA 4O3CA 1B5JA 3KZGA 5I56A 2I58A 2O6AA 4U1ZA 3UGWA 4H8IA 3E9XA 1P99A 5A5LA 4G68C 5I5PA 1FQBA 4MLQA 3K00A 1BTJA 5T3JA 1A54A 3T0JA 3OXNA 5IZZA 1CB6A 3OSQA 2PX1A 4OVRA 1J1NA 3MP8A 3Q29A 1IZ1A 1FBGA 3AXFA 1FPFA 1EU8A 3EHSA 3E79A 1RDYA 2ZZXA 1FBEA 3KC0A
chains in the Genus database with same CATH topology
2DVZA 1LBWA 1XI6A 3B50A 4P1LA 4PFBA 4F19A 4P3LA 5EQ8A 4I3YA 5ET7A 2KR0A 4G61A 3T1BA 4GWWA 4YZZA 4QXDA 4MNPA 5IGAA 1EYIA 1FJ6A 3GYYA 2F3DA 2DE4A 4GWYA 2V4CA 1DCUA 1DK4A 4H46A 4O7MA 1NV0A 2Y5LA 2CEYA 3BIHA 1D9QA 2CZHA 2F3BA 2QVUA 1KA0A 2XWOA 4H45A 1K9ZA 3CHGA 4P1EA 4PF8A 5IZ1A 2CZIA 4NAPA 2ZZVA 1FPGA 3A29A 4HE1A 4MX6A 4N6DA 1FJ9A 4HE0A 4NG7A 4O8MA 4PFRA 4QBAA 1Q9DA 4GX6A 4MHFA 2VT5A 3MYUA 5J16A 1QGXA 2VPOA 5EYGA 3W9VA 2QFLA 5EQ9A 5ET8A 1LEVA 4AS4A 4O94A 3MSTA 2DDKA 1LBVA 4PAIA 3EKIA 1YZ0A 4X9TA 1INPA 2DE3A 1VDWA 2P3VA 4I3EA 4PDDA 4PGNA 5ET5A 1FPLA 4MNCA 5FBPA 2CEXA 2L5VA 3FXBA 4N8GA 1AWBA 5JK4A 1IMEA 4GX3A 4MJOA 1FTAA 1G0IA 2HXRA 4OA4A 4PCDA 4F18A 5LTCA 3FBPA 2WBBA 3ISPA 4HCWA 4NQ8A 4HE2A 4KXPA 4OANA 1FPBA 3E78A 4I40A 4DI3D 1NV2A 1YXIA 2PFYA 2DE2A 1G0HA 4JVIA 1FBFA 4PBHA 4PTKA 5F24A 1RDZA 5IZ3A 2R8TA 2OX3A 4PAFA 1IMFA 2XA5A 4MNIA 4N8YA 1K9YA 1IMBA 2V3QA 2Q8MA 5LDZA 1NUYA 3LUZA 2B4LA 4N17A 4N6KA 4GWZA 1FPJA 2VPNA 4PC9A 1BK4A 3RPLA 4NN3A 1LBZA 4N91A 4NHBA 4O7IA 3RYDA 4HCYA 1IMDA 1IMCA 2FHYA 4GBVA 4NX1A 3KC1A 5I3SA 3D1RA 1FPKA 1FPEA 1EYKA 4OVTA 1NI9A 1NUXA 3B8BA 4MMPA 4P8BA 5EYHA 3U65A 4P47A 3W9WA 5CM6A 3IFAA 1FBDA 4X8RA 1FPIA 4YICA 2QPQA 1KZ8A 2PCRA 2WEFA 2WYKA 2Y5KA 4XFEA 2HHMA 4N4UA 4OVPA 2Q9TA 4HXVA 4UABA 1IMAA 1CNQA 1NV5A 5EQAA 1NUWA 3RPLB 1FBCA 4M1VA 4PETA 4PBQA 4GWXA 2XWVA 5IM2A 3SZPA 4PAKA 4NGUA 4MCOA 2F5XA 4P56A 3IFCA 5IZ3B 1YYZA 2OWZA 1SPIA 2PFZA 3NOHA 3QMFA 4GX4A 3BIGA 4P9KA 4GWUA 2MKZA 2WBDA 2XWIA 2XXKA 4XF5A 4AS5A 1LBXA 2GQ1A 2B4MA 4PE3A 4GBWA 4DI4B 2FIEA 2QVVA 2CZKA 2XWKA 5A5LA 4MIJA 2KQZA 1FBPA 1FSAA 4N81A 1NV6A 5I5PA 4N15A 4NF0A 4XEQA 2FIXA 2WX9A 2HZLA 4PDHA 5T3JA 1EYJA 2P3NA 4IR8A 4PFIA 1LBYA 2HPGA 2FBPA 2ZZWA 1KA1A 3PTYA 1FPDA 3LV0A 4MEVA 3HFUA 1FBHA 2JJKA 3ROJA 3T0JA 4PF6A 4PGPA 5IZZA 2HZKA 4JVCA 4X04A 4OVSA 4F1VA 4OVQA 4OVRA 1RDXA 2Q74A 4FBPA 4F1UA 5EQ7A 5J1DA 4LN5A 1NUZA 2QVRA 4JVDA 1FBGA 1JP4A 3KBZA 5I7IA 1FRPA 1FPFA 5DW8A 1NV3A 1DBZA 2BJIA 5ESYA 4MAGA 5ET6A 1NV1A 1NV4A 2FVZA 1RDYA 3E79A 4GWSA 1NV7A 2ZZXA 1FBEA 2WYPA 3KC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1L A;  3B50 A;  4PFB A;  4P3L A;  4YZZ A;  4MNP A;  5IGA A;  4MAG A;  4O7M A;  3GYY A;  2V4C A;  2CEY A;  2XWO A;  4P1E A;  4PF8 A;  4NAP A;  2ZZV A;  4MX6 A;  4N6D A;  4NG7 A;  4O8M A;  4PFR A;  4MHF A;  2VPO A;  4O94 A;  4PAI A;  4PDD A;  4PGN A;  4MNC A;  2CEX A;  3FXB A;  4N8G A;  4PCD A;  4OA4 A;  5LTC A;  4NQ8 A;  4OAN A;  4DI3 D;  2PFY A;  4PBH A;  4PAF A;  2XA5 A;  4MNI A;  4N8Y A;  4N6K A;  4N17 A;  2VPN A;  4PC9 A;  4NN3 A;  4NHB A;  4N91 A;  4NX1 A;  4OVT A;  4P8B A;  4MMP A;  3U65 A;  4P47 A;  5CM6 A;  4X8R A;  4YIC A;  4XFE A;  2WYK A;  4N4U A;  4OVP A;  4UAB A;  4PET A;  4PBQ A;  2XWV A;  5IM2 A;  4PAK A;  4NGU A;  4MCO A;  4P56 A;  2PFZ A;  4P9K A;  4XF5 A;  2XWI A;  2XXK A;  4PE3 A;  4DI4 B;  2XWK A;  5I5P A;  4MIJ A;  4N15 A;  4NF0 A;  4XEQ A;  2WX9 A;  2HZL A;  4PDH A;  4PFI A;  2HPG A;  2ZZW A;  4MEV A;  4PF6 A;  4PGP A;  5IZZ A;  2HZK A;  4X04 A;  4OVS A;  4OVQ A;  4OVR A;  4LN5 A;  5I7I A;  2ZZX A;  2WYP A; 
#chains in the Genus database with same CATH topology
 3PD8 A;  3SEW A;  3K6W A;  1M5C A;  4MNP A;  4LP2 B;  5I57 A;  2F3D A;  2DWI A;  1Y20 A;  3PUV E;  4X9T A;  5EYG A;  4F3G A;  4NMY A;  3TTL A;  4EUO A;  1FPG A;  3A29 A;  1USY E;  4MX6 A;  4O8M A;  2IEE A;  4PFR A;  3SDF A;  4AB5 A;  1B32 A;  3CSB A;  1SI1 A;  2V84 A;  4RK2 A;  5EQ9 A;  2REJ A;  3L6G A;  3MST A;  3Q28 A;  1DTG A;  2QSX A;  1B4H A;  4OMB A;  2DWA A;  2NXO A;  4YKP A;  2ZXT A;  5AA2 A;  4P0G A;  4YKK A;  2UYF A;  5JTY B;  1H3D A;  2R8T A;  3RT8 A;  4G68 B;  2LAO A;  2VD3 A;  2B4L A;  4JBZ A;  4NN3 A;  5I2K B;  3TTK A;  1MPC A;  1BLF A;  1SD3 A;  1NUX A;  1N7X A;  3KJT A;  1GGG A;  5CM6 A;  2WEF A;  2HHM A;  4OVP A;  4GWX A;  4PE5 B;  3QMF A;  4XF5 A;  3B7D A;  1LBX A;  4NF5 A;  3CFZ A;  4DXB A;  2R71 A;  1JEU A;  1DPE A;  4JB7 A;  1D9V A;  2XXU A;  1EYJ A;  1Y1M A;  3SEX A;  3SET A;  1LFG A;  2DP8 A;  2HZK A;  4O3A A;  4NF4 B;  5J1D A;  3DM0 A;  1XOC A;  2GH9 A;  1UTB B;  4FEC A;  1NV7 A;  2DOJ A;  3ZS6 A;  3GZG A;  4P3L A;  2REG A;  3USD A;  1UIU A;  1EYI A;  3QUF A;  4F3B A;  1I6B A;  3H6T A;  3IOV A;  5DVF A;  3H7M A;  2XXP A;  3ZSF A;  3MVX A;  2QS4 A;  3D4G A;  4PAI A;  1PB8 A;  3OO7 A;  1INP A;  5I2N B;  5ICQ A;  4BLA A;  4MNC A;  4R6Y A;  2O68 A;  4GL0 A;  3KOT A;  4FAT A;  1QW0 A;  2Z8F A;  3A09 A;  3G3J A;  3ISP A;  2I48 A;  1NV2 A;  1S9T A;  1HSL A;  1B3L A;  4OFO A;  5F24 A;  4ZEF A;  4ZE8 A;  3ONM A;  1MH3 A;  4NWD A;  3PGF A;  1OVT A;  4R9G A;  4OXV A;  1UTB A;  2XX9 A;  3MQ9 A;  3B8B A;  1IQ7 A;  1QUK A;  1ZTY A;  3I5O A;  4F1Y A;  5HBC A;  5IZ3 B;  4QF9 A;  3TZA A;  5DEX B;  2Y7W A;  3HPI A;  4C1T A;  4R72 A;  3ZKL A;  4MIJ A;  1P1O A;  3RN8 A;  4XTC Q;  3B6Q A;  4PFI A;  5L8D A;  2HPG A;  1FPD A;  3LV0 A;  2ZYN A;  3O6I A;  1SW1 A;  1BIY A;  4Q5T A;  3EPE A;  3MUQ A;  3DLN A;  4TLM B;  3FV1 A;  5I7I A;  4U22 A;  1NV1 A;  4EQ7 A;  2FYI A;  4WED A;  3VVE A;  3V8X B;  3GYY A;  3FVK A;  4PFW A;  4EF2 A;  3VXB A;  3U72 A;  1A7L A;  3FVN A;  1QVS A;  3A3C A;  5TPA A;  4JDF A;  3PPO A;  4RY1 A;  1MM7 A;  1MPB A;  3OEN A;  4FEB A;  3TEP A;  4M4G A;  3U92 A;  4I3E A;  4PDD A;  2X7Q A;  2NOO A;  4OET A;  3RPW A;  3H6U A;  5JK4 A;  4OA4 A;  3FBP A;  3A3U A;  2ZNS A;  4N07 A;  5DVI A;  1B5I A;  4H1X A;  3THI A;  5I56 B;  3Q26 A;  3LUZ A;  3KBR A;  2AYS A;  4GWZ A;  5IKB A;  2P2A A;  5L9M A;  1URD A;  4HCY A;  1Q1K A;  3D1R A;  4H6D A;  2GHB A;  4ZS9 A;  2O7I A;  3O66 A;  3U65 A;  5H8S A;  1FBD A;  3PUY E;  3HHG A;  4H5F A;  3PD9 A;  3KGC A;  3O6H A;  4GX4 A;  5H8F B;  3RTW B;  3UA8 A;  2I0B A;  1YAE A;  4LVQ A;  4OFL A;  4NTL A;  3MJN A;  3TTM A;  4KCD A;  1O63 A;  1SVX B;  2HCA A;  2Y7I A;  5AE4 A;  3LC8 A;  3IO4 A;  2Q8J A;  1GVC A;  1B51 A;  2NUV A;  1B40 A;  1US5 A;  5EQ7 A;  1B5H A;  3E13 X;  3P7I A;  1MM6 A;  3FJG A;  3WAE A;  2F6G A;  1MQH A;  3B50 A;  5DVJ A;  4PFB A;  4EQ9 A;  2KR0 A;  1GTK A;  2D21 A;  1I6A A;  4H67 A;  1SW5 A;  2F3B A;  4NF8 A;  2RC9 A;  5KCJ B;  1PEB A;  3KSJ A;  4C0R A;  5L9S A;  2QMW A;  1FJ9 A;  3CFL A;  4GD5 A;  1AMF A;  1Q9D A;  5H8H A;  2ONK E;  3C4M A;  1SW4 A;  3KEI A;  1BP5 A;  4IY6 A;  4JXI A;  5CI5 A;  1B9J A;  1I69 A;  2AL4 A;  3BKI B;  3FXB A;  2UVG A;  3RLF E;  4DCY A;  1D3K A;  4GIZ A;  3CIJ A;  4OAN A;  2Z8D A;  2UYE A;  3IJX B;  2O7U A;  2VP1 A;  3OEK A;  3WAF A;  4JWX A;  4PC9 A;  4O7I A;  1LAG E;  4OVJ A;  3TCH A;  3FXQ A;  5EYH A;  1LB9 A;  4LUB A;  2G29 A;  2PCR A;  2WYK A;  3PUW E;  4I8C A;  4I1D A;  1O7T A;  4YMA A;  1OLA A;  4QFN A;  4TQU Q;  1NH7 A;  3IB1 A;  1FW0 A;  1B1X A;  1WDN A;  1A8F A;  1B7Z A;  2Z22 A;  4IB2 A;  4LA9 A;  2FBP A;  2ZZW A;  2F36 A;  4DXC A;  2PMS A;  4LN5 A;  3CRB A;  3BFU A;  3FIR A;  2DVZ A;  4R74 A;  2A5S A;  4YMB A;  1B7H A;  1B58 A;  2XXW A;  3BBR A;  5H8H B;  1FJ6 A;  1DCU A;  3KSX A;  2Q88 A;  3EHU A;  4LON B;  3LUY A;  4YB7 A;  4QFO A;  1LEV A;  2DDK A;  1IXG A;  5H8N B;  3QIM A;  1NKX A;  1UIV A;  4MF3 A;  4LZ7 A;  4G2Z A;  4F18 A;  5KDT B;  1R1N A;  1IUD A;  2RKM A;  3MPK A;  1JVY A;  3TTR A;  3TMG A;  2CMO A;  1RDZ A;  2GFE A;  4PAF A;  2D3I A;  1K9Y A;  4BDM A;  5CMB A;  5F1Q A;  2V93 A;  2I3W A;  2QS2 A;  1PB7 A;  1N0T A;  3K02 A;  4XIG Q;  3ZKK A;  3KC1 A;  3L6H A;  1MQI A;  2Q2A A;  2XD2 A;  3IFA A;  4GOT A;  2OWT A;  4IY5 A;  3O9P A;  2BJJ X;  4UAB A;  1NV5 A;  2F7B A;  1R9L A;  2XWV A;  1NH8 A;  2F7C A;  1YYZ A;  2OWZ A;  1MRP A;  2XXK A;  4AS5 A;  2GQ1 A;  4ELP A;  3QK6 A;  2F7A A;  1UTH A;  2O51 A;  2XWK A;  4JSD A;  1FBP A;  4ESX A;  3SKP A;  4R9F A;  4WXJ A;  3HFU A;  3DEL B;  4X04 A;  4NF6 A;  2F6P A;  3IOW A;  3MAM A;  3GBB A;  3KBZ A;  1NV3 A;  3N6T A;  4HTG A;  1XS5 A;  3CI8 A;  5AA3 A;  3IAZ A;  4YZZ A;  1ZBM A;  1R6Z A;  4MAG A;  4O7M A;  3KN7 A;  4F39 A;  2Y5L A;  1MXV A;  1N7W A;  3M3L A;  4IGT A;  4HE1 A;  4PP0 A;  4QSC A;  3N5L A;  4I62 A;  3G3K A;  1QKB A;  2Q89 A;  3TOD A;  4RNS A;  3C31 A;  4YKJ A;  4GXS B;  1AL3 A;  5EYF A;  5LTC A;  4R6K A;  3G3H A;  3MP1 A;  3T66 A;  3I6V A;  1FTO A;  3KOS A;  4H0W A;  1B3F A;  3U94 A;  1IMB A;  2FA7 A;  1FTL A;  2QMX A;  4R75 A;  1FPJ A;  4PQJ A;  4NHB A;  1RYX A;  1MY1 A;  2FHY A;  1D4N A;  1FPE A;  1OIB A;  3E3K A;  3N26 A;  1IIT A;  1S50 A;  1FCK A;  5I2N A;  5HM4 B;  1URS A;  2HAV A;  3TEL A;  3IB0 A;  3T22 A;  4Z7E A;  2VD2 A;  2PFZ A;  5TP9 A;  1POY 1;  1NNP A;  5F7V A;  2XHD A;  1NMU A;  1Q35 A;  1B3G A;  1FSA A;  2YPN A;  4MBP A;  1TXF A;  4XEQ A;  2FIX A;  1Y4C A;  1XVX A;  5HPQ A;  3EQ1 A;  2NVU B;  3TCF A;  3PPN A;  4OVQ A;  1B2H A;  3M3F A;  1TFA A;  3B6W A;  1JP4 A;  1B3H A;  4FOR A;  1B1H A;  5ET6 A;  2QRY A;  2UVI A;  3S9M C;  2OWS A;  4DLD A;  2YLN A;  2XWO A;  1MXW A;  1KA0 A;  4R73 A;  3FJ7 A;  1SYI A;  2QL3 A;  3T93 B;  3W15 C;  3MP6 A;  2QFL A;  2W7Y A;  3E4R A;  4EXK A;  1ZLQ A;  4F22 A;  1Y3Q A;  2XXX A;  3LBS A;  4UAC A;  3S4U A;  1AWB A;  4I9D A;  1SYH A;  2PBW A;  4HE2 A;  1FPB A;  2DWJ A;  1G0H A;  4KHZ E;  2O1M A;  3OOA A;  3OEM A;  4IO4 A;  2RIN A;  2P1S A;  1FQF A;  2D5W A;  1IIW A;  1JNF A;  1IMC A;  2PT1 A;  3CVG A;  4ZEC A;  1OQH A;  4X48 A;  4XFE A;  5H8N A;  4HXV A;  1FBC A;  3VVD A;  1LAX A;  1LBC A;  4POW A;  2XXY A;  1A8E A;  3VLV A;  2I4B A;  5I2K A;  4U21 A;  3K6V A;  1ZIU A;  1NV6 A;  3CR9 A;  1R9Q A;  3IX1 A;  3TUS A;  2QS3 A;  2XXQ A;  5LOM A;  3LSX A;  3H4Z A;  3SES A;  3DP8 A;  2BJI A;  3RT6 B;  2Y7P A;  1S7Y A;  1US4 A;  5DYH A;  1USY H;  4XKQ A;  4R2B A;  2ABH A;  1SI0 A;  3B6T A;  4UA8 A;  3BIH A;  3R26 A;  1K9Z A;  3CHG A;  4F3P A;  4F3S A;  1MY4 A;  3G3G A;  4N6D A;  5CRY A;  4H8J A;  1OLC A;  4WEP A;  3R6U A;  2DXR A;  1MDP 1;  4FE8 A;  3EKI A;  4F2Q A;  3EN3 A;  1FPL A;  1Z7N E;  2CEX A;  4R6H A;  4PCD A;  3ILT B;  3H03 A;  3IR1 A;  2F97 A;  3K1P A;  1B6H A;  4NF8 B;  1URG A;  4RPN A;  3RTF B;  1B0L A;  4N6K A;  3H06 B;  3KG2 A;  1BK4 A;  3IO6 A;  4N91 A;  1QKA A;  3PUZ E;  5I3S A;  2RCB A;  1NNT A;  1EYK A;  1ZU0 A;  2V25 A;  1SBP A;  4PFT A;  1JW1 A;  3VE1 B;  1LBB A;  2UVJ A;  1WOD A;  4PFY A;  2B65 A;  2R9J A;  4L17 A;  4PBQ A;  3GLB A;  3IFC A;  1JQF A;  1UQW A;  4GWU A;  3ECR A;  1MG1 A;  4U1O A;  4LZ5 A;  4PE3 A;  4DI4 B;  5IAI A;  2KQZ A;  1RYO A;  2HZL A;  1KA1 A;  4RJZ A;  4PF6 A;  4QRZ A;  1H43 A;  1PBQ A;  3HO7 A;  2DSF A;  1EZO A;  3UK4 A;  2OK2 A;  3TQL A;  3OEL A;  5EQ8 A;  2I3V A;  1ZMG A;  4NE4 A;  4G8N A;  4QXD A;  2ESN A;  1D9Q A;  4PF8 A;  1LCF A;  4NAP A;  1N04 A;  1TWY A;  1DTZ A;  4U23 A;  2VPO A;  1LBV A;  1KWH A;  2F35 A;  1XVY A;  2P0S A;  4QFL A;  2HXR A;  1G0I A;  4YB6 A;  2G93 A;  1VFD A;  4I40 A;  4DI3 D;  1YXI A;  2PFY A;  1N3X A;  2VGQ A;  1FQE A;  3FD3 A;  1LLS A;  4QSE A;  1XC1 A;  2Y84 A;  5IZ3 A;  1DMB A;  5BUU A;  1OVB A;  1IMF A;  3IL1 B;  2V3U A;  4N17 A;  3EF7 A;  4TOZ A;  4ZEI A;  3K01 A;  2PT2 A;  1P1N A;  1EZ9 A;  4P11 A;  5H8F A;  1Z7M E;  3H6V A;  4GBV A;  3KN3 A;  3Q27 A;  4OVT A;  4U4S A;  4OEN A;  4E0X A;  3O29 A;  3MPL A;  1RKM A;  2Q9T A;  1N84 A;  3RPL B;  4DCX A;  4M1V A;  2GHA A;  2Y7K A;  4JWY A;  1LST A;  1SPI A;  3NOH A;  4P9K A;  4Q0C A;  2WBD A;  2B4M A;  3S9N C;  4F2O A;  4RPO A;  5FTH A;  2R6G E;  4NF0 A;  2FNC A;  4EXL A;  1MPD A;  4O3B A;  4ZDM A;  5I59 A;  4FBP A;  3IOR A;  1FTJ A;  2QVR A;  3C33 A;  1B4Z A;  5ESY A;  4DDD A;  1LGB C;  4X1D A;  5DTB A;  4IO2 A;  1VE4 A;  2Y7R A;  3RUM A;  3HV1 A;  4Z0I A;  1ZKB A;  2RCA A;  4H45 A;  1Y9U A;  1IXI A;  4NWC A;  1MXX A;  4HE0 A;  4KD5 A;  4H65 A;  2XXR A;  3MYU A;  3JZJ A;  3HHF A;  3O2A A;  4BDL A;  5ICT A;  3V5A A;  5ET8 A;  5AA4 B;  4MFI A;  1FTK A;  3M3K A;  4PGN A;  4IO5 A;  3FVO A;  4GX3 A;  2Z8E A;  4ZZE A;  2F78 A;  1ANF A;  3C34 A;  3KJ7 A;  1Y3N A;  5L9O A;  3BFT A;  2DE2 A;  1ELJ A;  4JVI A;  1MY3 A;  4POX A;  2XA5 A;  2DWH A;  5LDZ A;  4ELQ A;  3K4U A;  1JW4 A;  3QYT A;  3QSL A;  4EF1 A;  5DEX A;  1ZJL A;  3W9W A;  5H8Q A;  1KZ8 A;  5FHN A;  5EQA A;  3SZP A;  1H44 A;  5DT6 A;  2RF1 A;  4F29 A;  4R2F A;  1UTH B;  4OYV A;  4BDN A;  4GBW A;  3M8U A;  1M5E A;  4BDO A;  1SDX A;  2THI A;  3MW0 A;  3N6U A;  2ZYK A;  2ONS A;  3JYR A;  4DIG A;  3MVW A;  5I84 A;  4GF8 A;  2WKY A;  4ECF A;  1FBH A;  4G8H A;  4HS7 A;  1RDX A;  1Y3P A;  2Q74 A;  4YU0 A;  5DW8 A;  2O1L A;  3Q25 A;  2WYP A;  4F19 A;  4F31 B;  1NNF A;  4KPT A;  2DYX A;  1VR5 A;  1D9Y A;  4E0W A;  2I49 A;  3IK6 B;  3RQT A;  4H46 A;  2UXA A;  2VOZ A;  4FED A;  2CEY A;  1I6Q A;  2CZH A;  3SEY A;  2CZI A;  2AL5 A;  2I0C A;  5EHM A;  4THI A;  3FAS A;  1QGX A;  3LSF B;  1MY2 A;  2XXH A;  2H98 A;  1DOT A;  3TAJ A;  1VDW A;  3FJM A;  2XXT A;  4LAT A;  4DE8 A;  1II5 A;  4BDR A;  3GBA A;  3T9U A;  1MS7 A;  2HAU A;  4HCW A;  4GFR A;  3QAX A;  3OO6 A;  1IEJ A;  2ZMB A;  5I57 B;  4N8Y A;  1JET A;  2Q8M A;  1H45 A;  2VPN A;  1O64 A;  1B3E A;  1LFI A;  4Q30 B;  1NI9 A;  1JEV A;  5KDT A;  4WKM A;  4OEU A;  1MH4 A;  4ELO A;  3PMW A;  2XXV A;  4H5G A;  1A99 A;  3FZV A;  5FHO A;  3K2D A;  5B7D A;  2I6E A;  4NGU A;  3PPP A;  5K2X A;  3BIG A;  4KR5 A;  4G77 A;  4C1U A;  2HEU A;  3PPR A;  3MZ9 A;  4IO3 A;  3HN0 A;  1AH5 A;  4G68 A;  3O97 A;  4IR8 A;  3HST A;  4MEV A;  4F1V A;  4IO7 A;  2Q2C A;  2OLB A;  3K1M A;  4QHQ A;  3ILU B;  1NV4 A;  3IOU A;  4DZ1 A;  1Y4T A;  1XI6 A;  4I3Y A;  4G8M A;  2OCU A;  2AIX A;  2V4C A;  2ZNT A;  3FGS A;  3G7W A;  3DP4 A;  3K0V A;  3KN8 A;  2PVU A;  1MXZ A;  1M5D A;  4YKI A;  3UIF A;  3QXM A;  4JWO A;  1VFE A;  4GQO A;  2DE3 A;  2DQV A;  2P3V A;  2ZYM A;  4N8G A;  4RYA A;  1IME A;  4MJO A;  3VV5 A;  1FBF A;  4MH5 A;  3RY3 A;  3H3G A;  3TPA A;  1P1U A;  3R7X A;  3CG1 A;  3QUJ A;  2V3Q A;  2XX7 A;  2IA4 A;  1MXU A;  3C9H A;  1B7U A;  2Z23 A;  3K1N A;  4Q8R A;  1IMD A;  1WVJ A;  4LQ2 A;  4GLI A;  5I58 B;  1M5B A;  4ZE9 A;  2OZZ A;  2GRV A;  4ND9 A;  3TYH A;  1QJM A;  3VXC A;  3H6W A;  3MVZ A;  4ISU A;  5IM2 A;  4PAK A;  1HSE A;  3D4C A;  1EH3 A;  2XWI A;  3OO9 A;  4G4P A;  4K3F A;  5KCJ A;  2QS1 A;  3PV0 E;  1MQG A;  3PU5 A;  5ELV A;  3MBP A;  4ZEK A;  3K6X A;  3T9X B;  5AA1 A;  4PDH A;  2XXI A;  4EQB A;  3FXR A;  3HCQ A;  2XD3 A;  4PGP A;  5EHS A;  4OVS A;  5K2Y A;  5BWJ A;  1FRP A;  3T9V A;  5B70 A;  2F34 A;  3I3V A;  1MY0 A;  2B3F A;  1LBW A;  1CE2 A;  3FAT A;  2VHA A;  1NV0 A;  5TU0 A;  3S2V A;  1IXH A;  3OO8 A;  3VLW A;  4XKP A;  3JV9 A;  3IOT A;  4FIM A;  4AS4 A;  4GRK A;  2X26 A;  1H76 A;  5CC2 A;  1FTA A;  3DP6 A;  1M5F A;  2WBB A;  4NQ8 A;  4KXP A;  4XKR A;  3CFX A;  5A5X A;  3EHT A;  4OQO A;  1LAH E;  1FQD A;  4ESW A;  2V3T A;  4QFP A;  1LBZ A;  4AB6 A;  4GVO A;  3PMV A;  3U8Q A;  3IB2 A;  2QPQ A;  2Y5K A;  1F9B A;  4N4U A;  2O84 X;  5ISU A;  1TFD A;  4OZ9 A;  4U2R A;  1N3W A;  5TPA B;  3G3I A;  4MCO A;  1FTM A;  3T96 B;  1NFT A;  5TP9 B;  5CMM A;  1P1W A;  1XT8 A;  2CZK A;  2FIE A;  2QVV A;  4N81 A;  3O6G A;  2WX9 A;  4IO6 A;  3PTY A;  2ZNU A;  2JJK A;  1MDQ A;  5H8Q B;  3UOR A;  4FAJ A;  2B3B A;  4BDQ A;  1GR2 A;  1DBZ A;  3FXU A;  3MVY A;  1AIV A;  4P1L A;  2I4C A;  3RNN A;  1YCJ A;  2A5T B;  4RXL A;  4G61 A;  4GWW A;  5IGA A;  3C36 A;  4KYE A;  1NNK A;  2ZYO A;  3MZB A;  2A5T A;  3SEV A;  2QVU A;  3TKD A;  2H25 A;  3F11 A;  1YTV A;  5IZ1 A;  3UN6 A;  5JEI A;  3GXA A;  2HFB A;  1Y1Z A;  3OMB A;  3OSR A;  4GX6 A;  2H4I A;  3PUX E;  2VT5 A;  5CMK A;  4NF4 A;  3TFL A;  4O94 A;  4LZ8 A;  3TTN A;  2HXW A;  2DVC A;  5ET5 A;  3SEU A;  5CBS A;  3MWB A;  5FBP A;  1PB9 A;  1PDA A;  4KYS A;  3TQW A;  2DS9 A;  2ALU A;  1QUJ A;  4P0I A;  4GL8 A;  5CMC A;  4DXU A;  2PYY A;  3RPL A;  3MZ1 A;  5KZT A;  3K6U A;  1PBP A;  4NX1 A;  1DPP A;  4MMP A;  4OFJ A;  1VSO A;  4OTE A;  1A40 A;  4X8R A;  3SER A;  4OHN A;  3MC2 A;  3V83 A;  5FHM A;  2CZL A;  1IMA A;  1CNQ A;  4ZED A;  4JSO A;  1B05 A;  1FQC A;  4NED A;  2E0S A;  2DXY A;  4NF5 B;  2MKZ A;  4PFU A;  5A5X B;  1LCT A;  4KI0 E;  3PPQ A;  1BKA A;  1PC3 A;  3LR1 A;  2RC7 A;  3T9H B;  4KCC A;  1POT A;  2ANJ A;  1QUL A;  4KYD A;  4ONY A;  4N13 A;  3G3F A;  1NL5 A;  1NUZ A;  4IGR A;  5CBR A;  4OEV A;  4JVD A;  1T0K A;  2HQ0 A;  5I59 B;  1LAF E;  3C35 A;  3IJO B;  4FJP A;  3S9L C;  5ET7 A;  5AA4 A;  3T1B A;  4GWY A;  2DE4 A;  1QUI A;  2H5Y A;  4P1E A;  4HW8 A;  5AA2 B;  3LSW A;  1AOV A;  1OQG A;  3CSG A;  3PMX A;  1YZ0 A;  1B46 A;  4MLV A;  2KLF A;  3C32 A;  3CG3 A;  3V89 B;  4LQ5 A;  4QSD A;  4NF6 B;  4TLL B;  4OER A;  4ELR A;  4PTK A;  2O69 A;  4MNI A;  3VLU A;  3TDJ A;  1NUY A;  2H99 A;  4RK9 A;  5JTY A;  4KFQ A;  4OES A;  3OD7 A;  4RA1 A;  4P8B A;  4U4X A;  4AQ4 A;  1OMP A;  5I58 A;  3LSL A;  4YIC A;  1FPI A;  3U1O A;  4EDP A;  2E1S A;  3VFJ A;  1SQY A;  1EZP A;  4YB5 A;  1MQD A;  4GXA A;  3VDF A;  2F5X A;  4P56 A;  3RYD A;  1IXC A;  3FVG A;  3UP9 A;  3ODB A;  3TCG A;  5ITP A;  1MXY A;  4N15 A;  5M2V A;  2P3N A;  1A55 A;  2ONR A;  1LBY A;  2UVH A;  1N76 A;  3ROJ A;  3VVF A;  4JVC A;  4F1U A;  3FV2 A;  5AA2 D;  4GWS A;  2FVZ A;  1DSN A;  3S9E A;  2YJP A;  4X1B A;  1JW5 A;  1B52 A;  4N6P A;  2OBG A;  1DK4 A;  3FUZ A;  5FTI A;  5ITO A;  1B0H A;  2RC8 A;  2ZZV A;  4NG7 A;  2OJT A;  4QBA A;  1LFH A;  4MHF A;  5J16 A;  3W9V A;  3U93 A;  2F8D A;  1L5T A;  4ZZA A;  2XX8 A;  4OWD A;  1SW2 A;  2NWJ A;  1XHY A;  4QFK A;  1LB8 A;  4XXU A;  2L5V A;  1ATG A;  2M8C A;  1HSJ A;  3E78 A;  1GV8 A;  4XKN A;  3KFM A;  4PBH A;  1MQJ A;  2H9B A;  4YAH X;  2OX3 A;  4GWO A;  3RGY A;  2X7P A;  4KQP A;  3O28 A;  3N94 A;  1YPN A;  1JVX A;  1FPK A;  1FQA A;  4P47 A;  4ZEB A;  2QJE A;  1TT1 A;  1NUW A;  1P1Q A;  4PET A;  4O3C A;  1B5J A;  3KZG A;  5I56 A;  2I58 A;  2O6A A;  4U1Z A;  3UGW A;  4H8I A;  3E9X A;  1P99 A;  5A5L A;  4G68 C;  5I5P A;  1FQB A;  4MLQ A;  3K00 A;  1BTJ A;  5T3J A;  1A54 A;  3T0J A;  3OXN A;  5IZZ A;  1CB6 A;  3OSQ A;  2PX1 A;  4OVR A;  1J1N A;  3MP8 A;  3Q29 A;  1IZ1 A;  1FBG A;  3AXF A;  1FPF A;  1EU8 A;  3EHS A;  3E79 A;  1RDY A;  2ZZX A;  1FBE A;  3KC0 A; 
#chains in the Genus database with same CATH homology
 2DVZ A;  1LBW A;  1XI6 A;  3B50 A;  4P1L A;  4PFB A;  4F19 A;  4P3L A;  5EQ8 A;  4I3Y A;  5ET7 A;  2KR0 A;  4G61 A;  3T1B A;  4GWW A;  4YZZ A;  4QXD A;  4MNP A;  5IGA A;  1EYI A;  1FJ6 A;  3GYY A;  2F3D A;  2DE4 A;  4GWY A;  2V4C A;  1DCU A;  1DK4 A;  4H46 A;  4O7M A;  1NV0 A;  2Y5L A;  2CEY A;  3BIH A;  1D9Q A;  2CZH A;  2F3B A;  2QVU A;  1KA0 A;  2XWO A;  4H45 A;  1K9Z A;  3CHG A;  4P1E A;  4PF8 A;  5IZ1 A;  2CZI A;  4NAP A;  2ZZV A;  1FPG A;  3A29 A;  4HE1 A;  4MX6 A;  4N6D A;  1FJ9 A;  4HE0 A;  4NG7 A;  4O8M A;  4PFR A;  4QBA A;  1Q9D A;  4GX6 A;  4MHF A;  2VT5 A;  3MYU A;  5J16 A;  1QGX A;  2VPO A;  5EYG A;  3W9V A;  2QFL A;  5EQ9 A;  5ET8 A;  1LEV A;  4AS4 A;  4O94 A;  3MST A;  2DDK A;  1LBV A;  4PAI A;  3EKI A;  1YZ0 A;  4X9T A;  1INP A;  2DE3 A;  1VDW A;  2P3V A;  4I3E A;  4PDD A;  4PGN A;  5ET5 A;  1FPL A;  4MNC A;  5FBP A;  2CEX A;  2L5V A;  3FXB A;  4N8G A;  1AWB A;  5JK4 A;  1IME A;  4GX3 A;  4MJO A;  1FTA A;  1G0I A;  2HXR A;  4OA4 A;  4PCD A;  4F18 A;  5LTC A;  3FBP A;  2WBB A;  3ISP A;  4HCW A;  4NQ8 A;  4HE2 A;  4KXP A;  4OAN A;  1FPB A;  3E78 A;  4I40 A;  4DI3 D;  1NV2 A;  1YXI A;  2PFY A;  2DE2 A;  1G0H A;  4JVI A;  1FBF A;  4PBH A;  4PTK A;  5F24 A;  1RDZ A;  5IZ3 A;  2R8T A;  2OX3 A;  4PAF A;  1IMF A;  2XA5 A;  4MNI A;  4N8Y A;  1K9Y A;  1IMB A;  2V3Q A;  2Q8M A;  5LDZ A;  1NUY A;  3LUZ A;  2B4L A;  4N17 A;  4N6K A;  4GWZ A;  1FPJ A;  2VPN A;  4PC9 A;  1BK4 A;  3RPL A;  4NN3 A;  1LBZ A;  4N91 A;  4NHB A;  4O7I A;  3RYD A;  4HCY A;  1IMD A;  1IMC A;  2FHY A;  4GBV A;  4NX1 A;  3KC1 A;  5I3S A;  3D1R A;  1FPK A;  1FPE A;  1EYK A;  4OVT A;  1NI9 A;  1NUX A;  3B8B A;  4MMP A;  4P8B A;  5EYH A;  3U65 A;  4P47 A;  3W9W A;  5CM6 A;  3IFA A;  1FBD A;  4X8R A;  1FPI A;  4YIC A;  2QPQ A;  1KZ8 A;  2PCR A;  2WEF A;  2WYK A;  2Y5K A;  4XFE A;  2HHM A;  4N4U A;  4OVP A;  2Q9T A;  4HXV A;  4UAB A;  1IMA A;  1CNQ A;  1NV5 A;  5EQA A;  1NUW A;  3RPL B;  1FBC A;  4M1V A;  4PET A;  4PBQ A;  4GWX A;  2XWV A;  5IM2 A;  3SZP A;  4PAK A;  4NGU A;  4MCO A;  2F5X A;  4P56 A;  3IFC A;  5IZ3 B;  1YYZ A;  2OWZ A;  1SPI A;  2PFZ A;  3NOH A;  3QMF A;  4GX4 A;  3BIG A;  4P9K A;  4GWU A;  2MKZ A;  2WBD A;  2XWI A;  2XXK A;  4XF5 A;  4AS5 A;  1LBX A;  2GQ1 A;  2B4M A;  4PE3 A;  4GBW A;  4DI4 B;  2FIE A;  2QVV A;  2CZK A;  2XWK A;  5A5L A;  4MIJ A;  2KQZ A;  1FBP A;  1FSA A;  4N81 A;  1NV6 A;  5I5P A;  4N15 A;  4NF0 A;  4XEQ A;  2FIX A;  2WX9 A;  2HZL A;  4PDH A;  5T3J A;  1EYJ A;  2P3N A;  4IR8 A;  4PFI A;  1LBY A;  2HPG A;  2FBP A;  2ZZW A;  1KA1 A;  3PTY A;  1FPD A;  3LV0 A;  4MEV A;  3HFU A;  1FBH A;  2JJK A;  3ROJ A;  3T0J A;  4PF6 A;  4PGP A;  5IZZ A;  2HZK A;  4JVC A;  4X04 A;  4OVS A;  4F1V A;  4OVQ A;  4OVR A;  1RDX A;  2Q74 A;  4FBP A;  4F1U A;  5EQ7 A;  5J1D A;  4LN5 A;  1NUZ A;  2QVR A;  4JVD A;  1FBG A;  1JP4 A;  3KBZ A;  5I7I A;  1FRP A;  1FPF A;  5DW8 A;  1NV3 A;  1DBZ A;  2BJI A;  5ESY A;  4MAG A;  5ET6 A;  1NV1 A;  1NV4 A;  2FVZ A;  1RDY A;  3E79 A;  4GWS A;  1NV7 A;  2ZZX A;  1FBE A;  2WYP A;  3KC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...