2WZ5A

L38v sod1 mutant complexed with l-methionine.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGVTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Discovery of Small Molecule Binding Sites in Cu-Zn Human Superoxide Dismutase Familial Amyotrophic Lateral Sclerosis Mutants Provides Insights for Lead Optimization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 40
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2wz5A00
4A7GF 1EQWA 1E9QB 2WYTA 4B3EA 2C9SA 3GTTA 4N3TA 4OH2A 1CB4A 1OALA 1PTZA 1SXZA 5KBKA 4OJAA 4L05A 1RK7A 2GBUA 3S0PA 2AQTA 4BCZA 3QQDA 3KBEA 4A7TA 2VR7A 1BZOA 3K91A 4FF9A 2E47A 1P1VA 1S4IA 2ZKWA 2JCWA 2E46A 2Z7YA 1MFMA 2SODB 1UXLA 5KBLA 1DO5A 1IBDA 1YAIA 3T5WA 2K4WA 3ECVA 3L9YA 3PU7A 1IBFA 4BCYA 1XTLA 1F1GA 1Z9PA 1Q0EA 1SXAA 1IBBA 1U3NA 1N18A 1IB5A 3KM2A 1CBJA 1FUNA 4A7QA 4BD4A 3KBFA 1QUPA 3ECUA 1B4LA 1SXBA 3GTVA 2VR8A 2Z7WA 3H2QA 1HL4A 4A7GA 1SDAB 1TO4A 1Z9NA 2XJLA 2LU5A 2APSA 1F1AA 1PZSA 3CQPA 1E9QA 3CE1A 1HL5A 1SXNA 4U4IA 3SODB 2WKOF 2GBVA 2AQSA 2WZ5A 2NNXA 4MCMA 1OEZW 1YSOA 1COBA 2WWNA 1TO5A 1E9PB 1JCVA 1OAJA 1JK9B 1ESOA 4N3UA 2AQNA 2WZ6A 3HOGA 4MCNA 1SPDA 1XSOA 2WYZA 3L9EA 5CU9A 1EJ8A 3CQQA 1E9OB 1BA9A 3GZOA 3GQFA 5KBMA 1N19A 3MKGA 1PU0A 2C9VA 1F1DA 3H2PA 2WWOA 2VR6A 2AQQA 1OZTG 3QQDB 1F18A 1DSWA 1OZUA 1SXCA 2Q2LA 1B4TA 1SDYA 3GZPA 1UXMA 2AQRA 1YAZA 1SXSA 2ZOWA 4A7VA 2ZKYA 2ZKXA 3KM1A 1XTMA 1IBHA 1L3NA 2GBTA 2V0AA 2R27A 1E9OA 2WZ0A 3RE0A 1SRDA 3KH3A 3LTVA 1KMGA 4A7SA 3HFFA 1AZVA 1SOSA 3GZQA 2Z7UA 1JK9A 2JLPA 1E9PA 3HW7A 3KH4A 2Z7ZA 2XJKA 2WKOA 2AF2A 3F7KA 2AQPA 3ECWA 2AEOA 2C9UA 4A7UA 3MNDA 3F7LA
chains in the Genus database with same CATH superfamily
3NK3A 4BELD 4DH2A 2GIMA 1MLBB 4LVHB 3RUGB 4NO2B 3UEQA 4QRTA 5DJ2A 3T0ED 1CFNB 2HB0A 4PREA 4K8RL 2DBJA 5LG1A 3HR6A 4CN4A 2FWOA 2XTJD 4ZRGA 4Q58C 3I02A 2Q76A 4G2AA 5FKPB 3AS3A 2YGQA 2X3CA 4OJAA 3ZL1A 5K5YA 5ANME 3V6OA 1IILE 3ULUE 4JR9H 2CO6A 3K74B 3WY2A 1MFAH 1MCQA 1U3ZA 2K45A 2GJJA 1T7ZA 2CLRA 2IANB 3BXNB 3GBML 4MD0B 5IB5A 1HSBA 1CU4H 3JV5A 4N9OB 1FNLA 3FS9A 3TPKA 5KVGE 1OV8A 3GLZA 5DXWA 3CSGA 4R5XA 1I7RB 5EBWB 3BAJA 1BQSA 3AABA 1E7VA 1MFBL 1KCRH 3DSFL 3KW7A 2DN7A 3FQNB 3NAAH 1S46A 4GAAA 4ZFOL 2YLHA 5JR1H 4R5TA 3VGEA 2JJTA 4M4PA 4JQVC 4HOXA 2KL6A 4P2YA 4RMSA 3ECBA 3WHXB 2PR9A 2NNAA 5IJBC 2ZYSA 3QEQE 4U1KB 5TDOA 43C9A 2XKNB 2ZAIA 4TNEA 3VU1A 3WXWH 4MXWL 3ZTNL 3HRZC 8CGTA 3D39E 1OOWA 5E99H 3KBFA 2P24A 2QADB 3LHAA 2CMRH 2VIRB 2YD8A 3FT2B 4DSYA 3GS7A 2YK1H 3TBYA 1MWAL 3INUL 1CYGA 2NUTB 1T1YA 3JVGC 1EXUA 3NFNB 3JTSA 5ETUB 4NQCE 5I1LA 2BP3A 2NNCA 4NC1E 2WN3A 1Q8MA 1KCUH 2ENPA 3D2UB 4IRJB 4XVOA 4I18B 5EIVA 5FYJL 1TTCA 2F7PA 4HC1H 2B4CC 1FN4B 3UBXI 4MCMA 1K6QL 1TZ8A 3LKOB 4JKKA 4QI3A 3BH8B 3N41B 1TJMA 5LJYH 3K8LA 1VAHA 1KJ3L 3EDDA 3HC0A 5BQDA 4BFOA 3GHEH 5CAYB 5JNYB 4Y19E 1D7CA 4DPAX 1V3KA 2CU9A 1JZ6A 4ADJA 3SQOH 3HC3L 3BFQG 3P2BA 5LGYA 1KOAA 2H6PB 3HG2A 4Z0BL 3RWJA 3N85L 3U0WL 1NICA 3QDGB 1LYQA 2EIJB 5D7KD 4R7DB 2FIKA 4PRPB 5KN5B 2AJYL 1QMUA 2AAAA 1MCSA 4K3EL 4E9QA 5E6ID 2CK0H 4WDIA 2APTA 4H1LB 5AL8A 4FL4B 1S7QA 1D6EA 4LCUB 2ZKYA 4G6AC 2QJDA 4NHUB 2DWXA 3UAJD 3TVMD 4FLHA 4R2GD 3DROA 1ADWA 2QLYA 1KGCE 5G5DB 4MJ5B 3T4AC 2GABA 1BVNT 4ISVB 4WUKH 1QEWB 1EO8H 1B6DA 2HWZL 2PXYB 2XVKA 2OMVB 3B7YA 4X5QA 1P7QD 4L8CB 2XG4A 3OG6B 2PXYA 4M02A 4Y16C 2MCMA 4Z6AT 4WJ5B 3IN0A 1YN6B 4Z7AA 4OZIF 2FO4B 1BQHG 1C5BL 4MCYA 3V4UH 4F3FA 1HQ4A 3IRCA 1CB4A 2OKMA 4LVHC 1M9SA 4WFED 2WVUA 2PP7A 3R06B 1FYTB 1YEDB 5HHOB 2F53E 4P57A 2E6PA 3KW8A 3QUZD 1KBKA 3QIUD 3QJTB 1MI5D 1ZK9A 4JFQB 2AK1L 4M43L 3MAWA 5ESQA 5IROA 2N01B 1JYNA 1J8HA 4I85A 3REVB 3O0RL 1FH5L 1ETB1 3QNYA 4JM4H 5FA4B 5MEOB 2CLVB 4XNUH 3BZ5A 5EIIG 4D9RE 3ABGA 4M5TA 4YHZL 5C6WH 1HOEA 1MHHB 2P8LA 4UTBH 4PS3A 2R2HB 3FDWA 4S1DD 2A99A 1GIGL 2FT7A 2OAAA 2IVFC 1G9ML 4QD2E 2XXFA 1MQ8A 5I1CH 1FZKA 1QVOA 4NO0D 4J6RL 4LSPH 2Y36L 2AV1A 2Y72A 3SQBB 2OYMA 2X88A 5KYNA 1CI3M 4MA8H 4JE4B 4OLEA 2M8XA 3EH1A 4POZC 4ZPVB 1GIGH 4PLJD 5F1SA 2EDBA 4HUUA 2CR0A 2QDVA 4WWNA 5IW1B 1N3NA 1LJMA 1WIPA 3LKPA 4XWOC 4YL4A 3TT3H 2WJ5A 1ZGLB 4XNUL 1MCEA 2ATPA 2Y5TB 4RNRB 4U6HA 2HT4C 1PCXA 2X7LA 4YDVA 1ZD6A 2R39A 1TEGA 3FJTA 4YDLB 3MX0B 2HKHH 5I75C 3ZVVA 3WV0A 5AKVA 4YR6A 1EFXD 3B6SA 1JRHI 2V3EA 4JHAH 4QYOA 2X44D 4HJUA 3VG9B 1I8MB 3BVNB 4K94L 1I1FA 2FEEI 3EH3B 4AE0A 4I5BA 4UQAA 1T0MB 3RDTD 4EIUA 3B7UX 3UTZA 1IFHL 2EEDA 4GMSH 4XPAH 4GINA 1QBML 3T2NH 4KI1A 3GIVB 4J39A 4GT0A 4MNHB 1RJYA 1R46A 4IBUA 1OE3A 2KKQA 3EYUH 1VZHA 5HHVL 2APWA 4I48B 4C58B 3ZE0E 5IUCA 4GRWE 3TNMA 4L29B 2ZF9A 4GEIA 5EHFA 4Z7NB 2B2XH 2HFFB 3RE0A 3BC9A 5AYUH 3ETBJ 1LO4H 3RKPA 1CG9B 1L5GA 4UT6H 4ANXA 1TPXC 3WEXB 4KNUA 5HHXL 1OANA 4EI6A 3V0FA 1W91A 2RJMA 1NUGA 2X10A 4Y9CA 5LGHH 3UYRH 2YPKB 4DVBB 4JY6A 4YUEH 2I24N 5C0EA 5I8KH 2IG2H 1ECZA 4DK6A 2EDOA 1ZDQA 3TPUB 4KZDH 4Q6IB 5ENWA 4CC1A 2CIIA 2OCFD 2P43B 1JZ3A 1RPQA 3PHQA 3GMNA 2EACA 3T0WA 1AR1B 2J6EH 2WP3O 4HV8B 4YLCA 4RETB 1RZFL 3QDMD 4QTHB 2YMXL 4E42B 5EUKB 5JHBA 1SMAA 2NW3B 2IWFA 3QIUC 1U36A 5HDQH 4BQBA 3HBZA 1WFOA 3BYTA 3VXRB 1YLBB 1CGWA 2BIHA 3MBEB 3US9A 1ZLVH 2RQEA 1F97A 2GBAA 5ID1A 2YS4A 4GRMA 2ZCKL 5A2IH 5E08H 4ZMXA 4OM0L 3GSUA 1XF2A 2EDEA 5DQ9B 1DQDL 3L5WB 1IGYB 5HI5D 1S7XB 3GYRA 2EYSB 1ZPLA 4DGUA 5ITBL 4ICWA 3HAEG 4NRZA 4G1MB 5EZOH 4FQXD 4JVPA 2EEAA 2CLZA 5ITBH 4WI8A 4X7CC 1T1ZB 4EJ1C 3L3JA 1FV1B 2CHDA 2QGCA 2BY0A 4GSRA 4YHLL 3L3IB 4K7PL 1B0WA 3FULA 2QSQA 1F11A 5DMKA 3VFPB 4JKLA 1RHHA 4OCNC 43CAA 5IMKA 4ZX4A 4G9DA 4MJIA 1KXQE 3G6JA 2UXFA 4HW6A 4XN7A 4LPTA 3SPVA 2E8ZA 1PPIA 4B9YA 4PS4H 1JN6A 3I6GB 5KYYB 3G04A 5ALBL 5BRZA 4JUTA 3LB6C 4LRIA 5E5MA 1ZV9A 2W5PA 2HYMA 3FOMB 1RI8A 3EYFA 1A4BA 1RD6A 5K93A 4M29A 5AALA 1F00I 1FF5A 3ZRSA 5BRQA 4I2XE 3LZNA 4FQ2L 3UDWA 2ITFA 4TNWK 1F18A 3D50A 4ZO6A 3BH9A 4IGBA 1BWWA 5KN5A 2WWMC 2X5PA 2R1WB 4PRDA 4YDZA 1T21B 3GI9L 2ERJB 3L3KB 4H25B 2FECI 3O6ML 4YIQB 5EC2B 3HZMB 2W1NA 4LCVA 5AZEH 1IV8A 1NBQA 3GNMH 3MRDB 5B1KA 1WBZA 2DQJH 4RCAA 3QJRB 5C0CD 3IF1B 2LOEA 2ESVD 3DVFA 3FQ4A 3MLRL 4JAMA 4XO4A 1FDLH 4FQ1L 4DO5A 4AT6A 2YMXH 4K9JA 2A1WH 3IETB 3BE1L 1AOHA 2J6EA 1CWVA 3SPCA 4A2HA 2HRPH 1DFBH 1K8IA 2HT3D 4NAQA 1LK3H 3VGGA 4KAQH 3U9PL 1MJJA 3IGAA 4CU8A 3NESA 5C0AE 1KGJA 1J05A 2C9UA 4LGSB 4OF6A 3CZSA 1E8XA 1KTCA 2FNBA 5BXFA 4J2XA 2D7TH 3RFZC 3APMA 5BV7B 4PJ8C 1C12B 1HESA 4HS6A 1MI5E 1QI3A 4KHTH 2TSBA 3QDME 1THAA 2Q7AA 3C6LC 1AQKL 2YQGA 1F4XH 2X3BA 1P7QB 1GW6A 3G9VA 1XSKA 3MV8D 4P4RB 3HN8A 3NPSB 4NQDB 3VJ6A 1B2WH 1I9EA 5TDNA 4LIQH 1W0WA 1HCYA 1QHQA 3HS9A 4LLMB 2TRYA 3ZBMA 3VMNA 1XL6A 1ZHBA 2KZKA 2I26N 4XPFH 5E5MB 3T0EC 4B96A 3KYOA 2EDTA 3BLBA 2O5NA 3GSOB 3I6GA 3FH8A 4YVUA 3EYUL 5JXAH 4TQIA 2NY0B 5T3ZH 4ZUUB 2OMXB 1MRFL 2B3RA 3LH2H 3ZSSA 2YUXA 2C4FT 3ROLA 1CD9B 4U1GB 1BP3B 2CO6B 3HI1B 5BO0D 3S88L 2KPNA 5FKPA 4KRPC 5FXCH 1ZLUK 3MLSH 3NRQA 3ZGIA 4ECNA 1HL4A 3C5SA 1HNGA 3DX9A 2VLRE 5D2NE 4N86A 3WG7B 4G8EA 3T8XB 3DX8A 2ADIA 3QULA 5EIIA 4FFZL 3CHXA 3ZMRA 5ADOL 4ETQA 2ICWI 2VERA 2P5WB 4OGAD 3TNNA 4LBEB 1KENL 3CMGA 4H5SA 4IRJD 2VDQB 3D87B 4HC1A 3L5WA 4X4YA 3D4YA 2XYBA 3KWUA 1MFDL 2AXFA 1YN7A 4JFEB 3K4AA 4L9LC 1N19A 4WKZA 3MKGA 5F7DB 5IEKA 4D3CL 3C2SA 2XRAH 5IFHL 1IMHC 5KSUA 1CF8H 3E9UA 1DDTA 5FPIA 1ZVNA 3ELQA 2Q1EA 4JFPB 2DBLL 4MNHA 2VABB 3MUGB 1W72L 2F5AH 3M6DA 1E0OB 5HYIA 4YMPA 2H32H 3VXPA 1PKOA 4QHKJ 2GBTA 4DPCX 3CU1A 3GBLA 5HBBA 5FW8A 3QO1B 2XIDA 1KYOJ 4HEPA 4FKEA 3IGLA 4LXFA 3PDDA 3T6XA 3NRFA 1GYAA 3ARBA 3X13B 4HZLA 1XGZA 3VXUE 3SO5A 5I1EL 3V9EA 3I9GH 3VFNB 4JKPH 3SBRA 2O26U 5ES4B 3PV6B 4JKPL 2WUCH 3IAQA 4JG0L 3NCWA 2GTQA 4AI7A 5A2KH 4LIQL 5CGTA 4JGMA 4F91B 3VQMA 3RL1A 1OWWA 5DJAA 4F9PA 1GKEA 4MZIA 4A7TA 4F37K 5D6CA 5E94A 1LILA 2W9DH 4H2CA 1FZOA 2HA1A 2TSAA 3UTZB 3GMQB 4PWGA 3CFEB 5CU5A 4LEXL 2P8LB 2RB8A 1KTKE 1Q94A 3D0LB 4YSTA 3MLSL 3W39A 1TSHA 3C9NB 4RA0C 2K8QA 1EMTL 4W9DC 4EDWH 4WFFD 4HLEA 1CT8A 3KBHE 2DQEL 2AVGA 1KGUA 4LP8A 4RAVB 3VD0A 5DRXA 2IPTH 5J9PB 2GI7A 3OZKA 1JGUL 3IDUA 1OF2A 3MDJA 5AAWC 3KLAA 3CZLA 2EEXA 4MNQE 5ICYB 4UNIA 3QK0A 1KCSH 3BWSA 4OIBA 5C0FB 1IM3B 5D1QC 4E68A 5GS0C 2DF3A 1PL3A 1HL9A 2EDXA 3F00A 3QSKB 5LN8A 4G7VL 5BUPA 3RIFF 3ZTEA 2UUDK 5ABDE 5HVGB 5F93C 4TUJB 4ODXB 1CFVH 4YXLH 3OTTA 3ARZA 1T1WA 2I5YL 5HDBE 3QO0B 2BXYA 2XWCA 1RUQH 4YO0A 1MH5A 4IOIB 3X11A 3LMJH 1TZGH 2PP9A 5GSRA 3V0IA 4L8CA 3EG9A 4ZMTA 3TTYA 2DI7A 1VSCA 4B9ZA 5A2BA 3ULVH 5C2UB 4BFFA 4ENEC 4A39A 4P5KB 1NKOA 4IK6A 4H1LG 5D9SA 3DXAB 2X4TA 3HC4L 4QEGA 5I0YA 5EEYA 4NUGH 2BP8A 4GFTB 1S7RA 4KXZI 1FJ1A 2DLFL 4M7ZB 3EXJA 1I75A 3EYOA 4H1LA 4RX4D 4AQ1A 1HZHL 2Z31A 4NKIH 5E7BA 5F9DC 4ZUSB 2ZE0A 3BX7C 5DZNA 4AGOA 5ICZB 2DWDA 2W9EH 3NJGA 4TN9A 2J25A 3KPLA 3MLWL 4P04A 4PH8A 1IC5H 5EBLB 4UOW1 4I9WE 4HUXA 4AYFA 4MAUH 3RB5A 2DQDL 3C60C 2BPBA 3Q1SH 2V0AA 1B90A 2BRRH 4P5KA 3UMNA 1O6SA 5JHLL 3R7QA 3HC0B 3A24A 4TMPA 4CVZA 2FDBP 1FIGH 1SDDB 2DAVA 1S9WB 3EYQC 1A21A 1VF5C 1EEUA 3A47A 2B9AA 5G4NA 5EPMB 3IFPB 2ZXDA 4NUJB 3PWJB 1UVQB 4LEXH 4P2QA 1YNKH 4FD0A 2H1XA 4GRLC 1U8QA 4PY8I 5GRZA 4F8PA 1IGTB 4DESA 1OGAB 5C08A 3QT2A 4MQXD 1F86A 1CD8A 5C0FA 5TK2A 1G6RL 4DUWA 4FXTA 4KBPA 3ETTA 5AOZA 3O11B 3MACL 5DFVD 4ZAKA 3QDJD 1U41A 4JFHE 1JZHA 2KQNA 3DA0A 3CBRA 5B7EA 3VFVB 4IHOB 4Z7NE 2XV0A 1K5WA 3HVDA 1JVKA 1JWUA 3BP4A 4NQVA 3QJSB 2COVD 2G5RA 1NSNL 3O9WD 4ANVA 1T4KB 2RCSH 3OKMB 3QDJB 1CGXA 3B1UA 4GG8A 4RAUA 1UWYA 1ZIAA 2LGNA 1SM3H 3T77B 4X9GA 1NCHA 3DTUB 5IIEA 4G9FA 4NT6A 5BJTA 1W9XA 3TV3L 1B4LA 5I1LB 3D33A 2ADYA 3RY6C 2VZSA 4ZS6D 4WWKA 2VZ1A 2OYPA 5A43C 5L8LB 2GQHA 3GSNB 3WNLA 4NO0B 2NZIA 3P2TA 5TPWL 1UC6A 4WWOA 3WHE1 4UT9A 5EU3A 5CEXA 3EOTH 3N55A 2WYIA 4BSWB 2WXJA 3QXVA 4F24A 3SQOL 1G4MA 5F6IB 1MKFA 3D48R 4IBWA 2BVUA 3S3JA 3C87A 4OTXL 5SWSE 4GP4B 1RSFA 2HFTA 2ZX5A 1AZBA 2OXHB 4PTTB 2JKLA 2IFFH 3DBXB 1F3DJ 2Z91B 3BUDA 3TBTA 4PJXE 4WEBH 1UKTA 1KPVB 3NDZE 4KRLB 3CAFA 5L2KE 3OF6A 5AOIA 4Q9QL 4H88H 5CWSB 5DURB 4DO4A 4PRPD 5DRZA 3QHFH 1ID5I 3BCFA 1E65A 3LIZA 4W9EC 3ZHFA 5IR1B 4BKSC 2VWEE 4H26B 4N6QA 1WA2X 4Q52A 2VQ1B 1JV2A 1UWGL 1NAKH 3GRWL 5D71H 3TVMA 3U82B 2C3VA 4XC3L 1MCCA 4NO5B 2IAMA 1CBVH 1DN0B 2V9TA 5EWIH 5KG9B 4PVBA 4X4ZA 1NCBL 2VUKA 1M57B 1H3WM 2BSSB 1M7UA 3TO4D 2AQTA 1ACYH 2WPGA 3BT2H 3P11H 4Y4HB 4GT7A 2L7JA 5C07B 1J1XL 4IMKC 3V95A 3ABKB 1R47A 4Y9FA 4P2RB 1TLMA 5TFSL 4N0RA 3PL6C 2GBUA 3CFKA 3WTTA 3RJQB 1IVTA 3KR3L 4CC4A 1NBVL 5CP3H 5K9KB 1OKEA 2VR7A 1T5XA 2X4NA 4ZJ9A 1KCKA 3JQOB 1BVLA 2ALWA 3SJVD 5ISZD 5IROC 1KN2H 1LTXA 2VH5H 5IBUB 4IMLB 3SE4C 3RVXD 4TQHA 5KTEH 1NGYB 3DURA 3PQYE 3S34L 3IMSA 1MHPL 5IF0A 2BVYA 2FEJA 2Z9TA 2Q87A 4TSAH 2FJUB 1S7UB 4XGZA 4HIQA 4XO3A 3MA9H 4XPHL 3APNA 2CKBH 1MVUB 4K4KA 2DQJL 2ISDA 3TA4D 2FX8H 2OA9A 2C3GA 4C56E 1TXKA 4P3CL 2J20A 3KD4A 5CEZD 4WWKB 2D7PA 5L88H 1VGKB 4NDMB 1UJ3A 4JZJA 4AK1A 4GW4A 4PJGE 1FQ9C 3PP4L 5GQBA 4UTAL 2M83A 1KB5H 2OXGB 4JZOB 5ECJE 3IGAB 5FCUH 5JPNB 2A74A 3N04A 4X6EB 4ZMYA 3LY6A 1NEZG 4HOMA 4FEMA 3SYCA 3ZIMA 3N50A 4JAMB 5DQDL 3ZN6A 1LO0H 4N2KA 3MREA 1WFTA 3QH3A 4CSPA 1E9OB 2M2DA 2X6MA 1RV6X 4J27A 4DKTA 3SDAC 4IHOA 3O3UN 4LO9A 1T04B 3MGAA 2UUDH 2D7MA 2XV6B 1RVFL 5CD5C 3EJSA 2C9PA 2UY6B 4J3BA 5B1CA 4HXBL 3FFCB 2YA1A 1G9MH 2V5TA 1Q72H 4AEHL 4ZTPL 3EYSL 1GCFA 1OZUA 1P5UA 3WXVL 4DK3A 5E1IA 4Z8FH 1HYSD 1IC7H 1SDYA 3I75B 4NN7C 4XPGL 1XT5A 3MFFB 4B9KC 2AK4E 2G2RB 3OZLA 3MYJB 1O0VA 1A6UH 4NQEE 3NCFB 1QLRB 1N0XH 1DCLA 1SRDA 1ES0A 3V6FA 4YBLB 4OFQA 4L0ZA 5DJCA 1KG0A 1J0KA 4PJHB 3IJ7A 3BUPA 4QOKB 2XJKA 2V2WA 3HHSA 4FQXB 5E6RB 1DQKA 4MB4A 1QR4A 4KXCA 4JFFE 4NENA 2ICCA 4GAGH 1J8KA 4Y5XC 3AJ7A 2DM7A 1HSAA 3ATEA 5GGTH 1OTSD 2W92A 1D5RA 3G08A 1DUZB 4I2XA 1ZCRA 1G5GA 3ZZQA 2NLJA 5FLUA 5B39A 4OJEH 5IFJA 3L3IA 1PTZA 3I6KB 5DUBA 3F7QA 4QHLA 3TH4T 1FVCA 1ZHLA 2FJSA 5B4MD 4D0DB 2XFXA 4PUBH 4DN4H 3S3PA 3FQTB 1BAFL 4OZGF 2EO7A 1F3JB 1S7SB 4KKCC 1PF3A 2XNAB 3MRFB 1R3JB 3IKKA 3ILPB 4GRWF 1INDL 1CTOA 4NQED 4MMXB 3ARFD 1QWHA 4MB5A 5I8KL 4JGUA 2H45A 5JLZA 4Y4KB 4I1NB 1KPUB 1AR1D 2XOTA 4TKWA 1DO5A 2XA3A 3QZOA 4NPKA 1RK1B 2DI9A 2OMZB 2E0PA 2ZCHH 4MA3B 1ZLWK 5DLML 4H40A 4HPYH 1K4DA 2XWTB 1NCBH 3O6FC 3VCLB 2AJSH 4MBRA 4Z7WF 4PJBA 4BFEA 2IH8A 3GRGA 3HC3H 4TSAL 3TZVB 3OJDA 5D1ZB 3RKDC 2CALA 3VX0A 3TF7C 5JTWA 4LT7A 3L1GA 1SXBA 3O0LA 2WUBH 4PJ5A 3GXUB 2J3SA 1BZ7A 2P28B 1HAWA 1FH2A 1UUNA 2EDHA 1C1EL 2PETA 2WO2B 3FU6A 4YDIH 3CBJB 4Y4FA 2XA8H 1XL4A 4HUVB 2V3DA 4K71C 4E2OA 2YPKA 1A7OL 1O5PA 5DK0B 1DBJL 4N2EA 2R51A 3C5JB 2OL3B 4NUMA 1DQJA 1K5NA 2IH9A 1SEBB 1SLWA 2X28A 4K7FB 4NZTL 3S5YA 2Q9OA 2FH6A 1L5GB 2WYZA 2HTLC 4L3AA 1MIML 4OZIE 2HKHL 5HHPA 3PUCA 1ETZA 5JO5A 3BGFB 3IDJB 1MCKA 5KJRH 1XO8A 3NSJA 1ZSHA 3SDCB 5E94B 3ZMEA 1WAAA 3O8XD 1MN4A 3IDXH 2IAMD 4B50A 2XQYK 4PG2A 1C16B 3DECA 1Z3GL 5TGBA 2UWEE 1XGUB 1M3JA 4ZO7A 2GK2A 3L4WA 3U7YH 1WA1X 3F6IA 2XQBH 1YNTA 5IJVA 1KYFA 4KH9A 4KVCL 5CZVL 4XMTA 1ED3B 4BV1A 5D2NC 2OBGA 4F37F 2PW2B 3ZRFC 2VLKA 2EVFA 4O51B 2IH1A 4JZJC 3PCYA 4BIKA 3I9AA 4DZ8B 4PJDE 4BQ9A 2DW5A 1OF0A 1V54B 1AGDA 4QMEA 2WQAA 5JOPE 1UA7A 1F4WL 3NJIA 3GSVB 5D7LD 2JLPA 3PLYA 3OB8A 4DW2L 3N5AA 4U2ZA 3Q2NA 2OL3A 2WXFA 4U1SB 4JRXD 2K9FB 4MMYB 4YHZH 1MIEL 4NO3A 2FB4L 1HIML 2J5LB 2ARWA 2DJMA 1O75A 2E27H 4Q56A 3HS0A 4B3EA 4NBXB 3P9LB 3UJIL 1JG9A 3DJZA 3VH8A 1CFQB 4Z1PA 3MUGA 3FHEA 3ZL4L 4WNJA 4OZHF 5HSFA 1GTNA 2WLZA 4PGBA 2IWEA 1XGUA 3MODH 4MRBA 4XN5A 1H3GA 5EA0L 2X9YA 1KCBA 2CXKA 4TUKL 3ZE1B 2APVA 4JRFA 3MV8A 5BCAA 3VD2A 4Q9BA 4HK3N 4X6CF 1KN4L 1HHJB 2EXSA 4O5LH 3GSNH 3OX8A 3AY2A 1J0HA 4Z3HA 5HGDB 3BW9B 4XXWC 1YMHB 2V9RA 4FQCH 1DBAH 2BIPA 2Y24A 3L1OL 5LLIC 2VRQA 3HAEH 5DHXB 4F1SA 1KJ2H 1ZJBA 2HP4A 2ZXWB 2CR6A 2QFPA 3WN5B 1O9ZA 3DO7A 1WICA 1YEDA 3ZYJA 4AX3A 2XV2A 4G9FD 3UFIA 3IJHA 4HIPA 2C7UB 4HISA 5I19L 1FNAA 4TSCH 1Z9NA 2E6QA 2JVUA 2X4UA 3V8OA 3OJDB 4C83B 3SE8H 5KSAC 4IRZL 4LHUA 3QJQB 4NRXB 4Y5YB 1SXNA 4A2FA 5JQ6H 3RL2A 5CJXA 3P73B 3KLDA 2OMXA 5JDSB 4G6FD 2J7LA 1HILB 1B4JH 5GHWH 1V7MH 5FFGA 5KS9A 3U79A 4D0CB 2G5BA 4YE4L 2YEQA 5FCUL 3UTSE 3TV8A 1Y0LB 2A3TA 4YSPA 3VQ1C 1Y1UA 1DUYB 1UM5L 4LCUA 5TDNB 2IPUG 4UT9L 5CEZL 2W81C 3MJWA 3A5VA 5FECB 3ULVL 1J0YA 4CA4A 5I28A 4OV6F 4PS7A 3VNZA 4LLAA 2V17H 2NQ3A 4XO5A 2JK5B 3N44B 3Q43A 4P3DB 4BZYA 1JZ8A 4JMXA 3HMXH 3T3MB 2ZOWA 3NIFE 4QTIL 3E38A 5C97A 1NCJA 6TAAA 4JFHD 3EOAA 4FKHA 2YAQA 4JLRA 1G0YR 2J2ZB 4OCRL 2DWYA 1NDTA 5E2WL 2IOMA 3G3LA 3RY6A 4RSYA 4W70A 4PG9B 1JPGA 1PDKB 2JIXB 3MLWH 3O41B 3SGEH 4KMTL 5TQ2L 1G9HA 4WGWB 4ERSH 4ETYA 2Y7OA 1CGTA 4F9PC 1ZLVK 5L2JA 2BFVL 2Q3AA 2Z35B 5JR1L 3A4FA 4AYID 5D1ZI 3ILQC 2OMTA 2WOYA 3LQZA 2DM2A 2H1PH 3LNHA 2G5UA 5CLZA 4WQOA 5CINL 1T89A 2BXZA 4ATTA 2XZQH 1GZHC 8PAZA 3V5HB 1P5UB 5AB2A 5AAMC 1QR1A 1KLFA 4ODHL 4TOYL 3RY5A 3K72A 2HFEA 3WTWA 1KY6A 4HH9A 2H1PL 2K6ZA 1FA4A 2EJ1A 3ESUF 3ML8A 3ZE2F 3FOMA 5I0XA 4PUBL 2Y2YA 1DJYA 2HUHA 3BISA 2XN2A 2N3JA 5A2AA 2BNRD 3T5WA 2NQCA 2I9LA 3J07A 5JHDE 3P9WB 1JOIA 4AVKA 2UZYB 1JFQH 2V8MA 4JQXA 3QJVB 5LB1A 3CXHJ 5TE7H 2Q8AL 3AWFA 1Z9SB 2Q7YB 3W0WB 2ZOOA 5F9OH 3II3A 3WNPA 5FYLD 1BQ5A 2YARA 4UQ3A 2J1WA 4L9LA 1F0LA 4EZMA 1F11B 1CJYA 4PJBF 4M6MH 3LRSB 3X2QB 2F54B 2V17L 4ZOBA 1D2PA 1HXMB 4I0PB 3O8XA 4MDJA 4YEEA 1CR9H 3EJYC 3BPLB 4AGMA 1EIBA 1DN0A 4Y19A 1NEZA 4XGZB 4AL8H 1WZLA 1NFIB 4WI0A 2C3VB 4KTDH 5E8OB 5CR1A 4X5XB 5JYLA 3U46B 3LKQA 3G5XA 5DMGC 4OM1L 1JZJA 3L16A 3HMXA 3JZ7A 3Q8FA 3PJSA 4V2CB 2ZUWA 3J8F7 2B1AH 3OGCA 2MTPA 3G5YA 4XMLL 2B08A 4TVUA 3BLKA 5K9KA 1ILSA 1U8MA 2XICA 3QG7H 1IKFL 5E8NB 1MXDA 4W9ZA 2Q2LA 3TF4A 3HZKB 4FMVA 4OLWL 2NX5A 4XCCL 3QIWB 4KJWD 1NFKA 1V55B 4XE0A 4KWUA 3WEMA 4GQPH 1JXDA 1SY6L 5D4QA 3EBHA 1AKJB 1UD2A 4OLZH 3TEUA 1I8KB 2HSIA 5MEND 4MVBD 3OXRB 3IGKA 3EJPA 4PJIE 5FKAA 3IJEA 2Y06H 1JI2A 4U1GC 4APQC 3MCKB 3FT3A 1CLYL 4YE4H 1H8NA 4V11A 2WGNB 2ZYRA 3BGMB 3C75A 3VRIA 1FFPA 4L8SB 2HFFA 1AZNA 2KDYA 3DUUA 1M6OB 1T2JA 4HWBH 4KXZH 3WFEH 3WS6C 2WIMA 4L29A 3I2CL 5DGQA 2DI8A 3AREB 5EEXA 3X1EA 3VI3F 1BJ8A 1MHPH 4BFRA 2X4QB 3P77A 2HLFC 4NQSB 4ODVH 5KBKA 2EXYC 3C8KA 1U95A 3UO1H 3CDGB 4CADB 2FVNA 4NQDD 2N1KA 1BQHB 3PNWB 1KJ2A 4XAWL 3VO0A 2GEQA 3RVVC 3BGFC 4QGTA 2C26A 4DGWC 3F6JA 2B4CL 3CFJB 2OXHA 3BUTA 1FFRA 5HHPB 4UQ2B 3VG0L 3V0GA 1I8LA 4H8QA 1LO5A 5IW3A 4F33B 5CBAA 1NCGA 4S2SA 2VN3A 4ODTH 3ZT7A 1INEH 1R5IB 1S9YB 4ZYKB 2W88A 3O2DL 4MNGA 1UM4H 1SJEB 3CFUA 1R3LB 1BX2A 2BWQA 3ME0A 4K5MA 4YHKH 4WENB 1T22B 2WLNA 3BZFB 4S1SH 1A6TB 1KLGB 5DD5H 5I1JL 2GITA 2KS0A 5MP6H 5IV2B 3UGXA 2BVTA 4YWGH 3UAEA 5I1AA 3GSNA 3OKEB 1ZDSA 3NK4A 3L5XL 1Y6MR 2VW6A 5LO7A 2ZCLL 1LO0L 1SVBA 1G87A 1Z5YD 2COQA 4GLRI 3MBXH 3S4SB 4PCYA 1OOAA 1TU2A 4QHMB 1DE4B 1IC4H 4OCXL 1AQMA 4MQXC 2YWZA 1N6UA 1PW3A 4QJ4B 4Y2OA 2HJKB 4QRPE 4D7BA 2H0PA 1E9PB 2GC7C 3O9WC 1JPTH 1NOLA 4FNUA 1JWUB 4GI6A 5CJQL 3DVGA 4P23D 3ATAA 2FBJL 2RALA 4KRPB 1DANT 3AMKA 4U6YA 4O58L 4FLRA 5AVSB 1PLBA 3QARA 4OAWB 4UOJA 1NDMA 4HKZA 4XPBH 4ZUWB 3TM6A 4LCYB 5JHMA 3CNKA 3CFBA 1GC1H 1O6VA 4G11A 4QHLB 4Y8AA 1GC1L 3DUHA 3QIBA 3KM1A 5HI3D 3W2DL 3WGVB 4IM8A 4NPYB 4ZX5A 4LSTH 3QG6A 2OV0A 5HVWA 5BVJB 1TJHH 4FP8H 3UOAB 3NZUA 1HEZA 1E8YA 5K1VA 1U4EA 3O2DH 5H94A 1GAFL 1HILA 4NN6B 4QXUL 5GS0L 2JQZA 4TUUA 4Y2OB 5IG7A 1QBLL 3FB5A 3SCMA 4HBCH 1WCBB 4MD5B 4M43H 3V5DA 2B4CH 4RMRA 4TYUA 1GS8A 4HIJA 5JIQA 4J4PA 1MCRA 4JO1H 5JHDB 1INDH 4NZRH 1QLRA 2IDQA 3GTTA 2VKXA 3CZUB 1HWWA 1VGEL 1DQDH 3ARSA 3KMDA 3T0EA 2G2RA 2UXTA 3OKLB 5IBLC 1TMQA 4Z3FA 1JSYA 5DK2A 3C5ZC 4RFOH 5SV3A 2AXHA 3CDCA 4J8RA 3RIKA 4JPKL 5DD6A 3N91A 5LDSA 1NIBA 4UUJA 4YBQC 3LEXA 4BWTA 4G8GE 1RZFH 4MHHI 4N2FA 4KFZC 5AVWB 1ZT7B 5J11C 3C08H 1YMMD 3QHFL 1MCIA 3RTQD 2G3ZA 4G3YH 3QH3B 2J6EL 2ESVE 2CDGB 2E9JA 2BY1A 4X80H 1U33A 4X9YA 3IK2A 4Z7WA 1SXAA 2QGBA 2WO4A 3BESR 5JPNC 4B27A 3ULUL 1DVFD 5HDWA 1G7MB 1GGIH 1ICTA 4JN1H 2GYSA 4A63A 2CK0L 3VDBA 3UAAA 2B5IC 2KUTA 3TWYA 2FO8A 4IBZA 1ZVHA 4H4NA 4HX1A 5TJWK 4D8PA 1CL7L 4FKKA 4GBXD 4NM8H 2UWEB 5DUJA 1GGTA 3BAEH 3HI5H 4UNTA 5GGQL 5I1AB 3WDJA 3EJTA 2ENYA 3OLIA 3WIAA 5E00B 2BW5A 4J28A 5KSBE 4O4YL 4N0FA 1X5KA 3RNQA 4JO2L 5I6MA 1YPZE 4L1DA 2NNAB 3WFEL 4FCAA 4A67A 1S9YA 4B9JA 1SJMA 3MCG1 1UB6A 1LO5B 1EHLH 5HD8C 4J12A 3T3PB 5I8OH 2ARJQ 1I3UA 2WW8A 1R1CA 4XPAL 3TURA 4B41A 3IWVA 1M05A 4PJDF 1E4JA 3TFKC 4NKOA 2QPSA 1JHKL 3UTSB 5JXED 3LKRB 1E28A 4XPTH 4Z7OE 5HPMB 3QQ9D 2B8OT 2YGNA 4NPJA 5BS0B 3UO8B 4NQUA 1QATA 2MNWA 1SXCA 5HYJE 2NXYC 3C8KB 4QLWA 3RZCB 1KB9K 2KI6A 3CC5B 4JHUA 5GXBB 3W5NA 4AV5A 1XBRA 3HNSL 4Z7OB 4KV5E 3IBEA 3ZTJH 4AQZA 3IS0X 3P4MA 3PL6A 4OD1L 1RERA 2Y1VA 1LP9F 2RIKA 3D18A 4GMTH 1OAKH 5SWQA 4P23B 4LSTL 1N26A 1B3JA 2UX7A 3VE0A 4XH2A 2GFBA 3G6AA 4GIPD 5D55A 5I1CL 1B2WL 3A6BL 5EC1B 5M95B 1I8KA 2HMID 1QBMH 1YEJL 5E03A 2DQEH 3GLDA 3T8XA 2OX5B 4EUPG 4HJGB 3NCMA 4JDEA 1G43A 3H56A 3MRMA 2RHEA 2VLJD 1LMKA 3NCYP 5DUMH 4UQ3B 4EUPA 2RACA 3Q5OA 5CJOH 1SJVA 3OKOB 1U8MB 4P0DA 5E8NA 2BSTA 3O4OC 1EUUA 3HC2A 4QO1B 1ZVYA 1UENA 3QIUA 4KAQL 3U9PH 4F9LC 1J1XH 3ARTA 2VB5A 3T2LA 4NZTH 4WKZB 4I1PA 3ATBA 1F3DH 5EBMA 2K9UA 4FZEH 5F88B 2D9CA 3NACL 1YQVL 4Y4KA 1F3RB 2XQBL 4NKDB 3DO3A 1GJWA 2OTWB 1N8OE 2VN4A 2VN5A 4ZFGH 4Q9RL 1U58B 1U3NA 4LKCA 2YKLL 3K72B 4FXGA 3CSBA 1KZQA 3CPUA 3D0VA 4LMQE 2BX5A 1KXVC 4X7SL 1MFEH 2GVYA 5FGBC 2PYEE 3U36B 4UTCA 4AJ0A 4KPHL 2BDNH 2D3LA 3C5XA 4KY2A 5E8EA 1NFDA 3OGOE 1UZ6F 4PAZA 1QFUL 5E4OA 2KLTA 3ASOB 1ZA3B 1UYWL 4HJEA 4M5SA 1UOWA 3WI9A 3U4BL 3AW5A 3W81A 3CE1A 3EYVB 1D9KB 2P45B 1KGYE 4C56B 2W0FA 2DMCA 2D03L 3QCTL 1MHCB 2DOCA 4R5VA 5ALBH 2DIEA 4IKNA 3RGHA 4GP8B 4HCIA 4U1NA 4GQRA 4PG9A 1HWGB 3QS3A 4ZSOA 5AOLA 3B9KD 4NC2B 3WU1A 3B56A 5I8EA 1CBVL 3UTOA 3UIZA 3VH8G 4AM0B 1BG9A 4ZFZA 5T1DH 3TH2T 3ZKQD 1OB1A 3IFOA 4YN3A 1EERB 1WF5A 3A6BH 4YIQA 1JD7A 4LASL 4W9LC 1S9VA 1JZ2A 2YFOA 3IMRA 4HVBA 2BOCA 2Y7SA 4OCSH 1SQ2N 3P69A 2A6IA 3AU1A 3NPZB 2GCYA 4EQ2A 2CHXA 3D2UD 3AXHA 1JNLH 1BPVA 5BVPL 3WYRA 4TULL 1H3PH 1T1XB 4LFHD 4CVWA 3ES6B 5LG6A 2XX0A 4IMKA 4Z9KB 1W72H 4KTEL 3MUZ1 3DYOA 3C8HA 1EZVY 4R0LC 3TGXA 3VRLF 3WJLC 1CDCA 1DBAL 2N7SA 4PV9A 5I5JA 5DS1A 4L3CB 5D1QE 1QABA 3TS8A 4HIXH 1WS7A 1S3KH 1I7TB 4GKSB 4PJ8B 2DQ6A 4JPIB 5EB9A 3U4EB 1BHGA 1E9QB 1J5OH 1R5VA 3B9DA 3IDIA 4JLRB 3ZKMC 1XCXA 3WLBB 4G8FB 4XPFL 1AI1L 3L3KA 1NFDB 2DLTA 3HPJA 4L05A 5LBSL 4IRSC 4IIQB 2CKBB 5I6LA 5MHSE 4UZGA 1CGSL 2EYTB 4KRNA 2D03H 1PG7L 3UPRA 1OE2A 2XSKA 3Q6FA 4U1HA 1GYWA 4WAFA 1VEMA 3D1MC 1CFMA 4MA7H 2WBWB 2ZKWA 2OTWA 2QQNL 3N40P 4GIAA 1YMHA 1D5MB 3ESOA 2P49B 5CP3A 5ICXB 1AR1C 3X1FA 4IOFD 2Z34A 1R33A 5I0VA 4D0CA 3JWDL 2BS71 5BRZB 5FM8A 3A3YB 4DW2H 3VXMD 2PCXA 4L37A 3QDAA 1XTLA 4PJ9A 4AQEB 2EEBA 1RIVL 3VW3H 5I6XB 1MH5B 3J7HA 4JPSA 2R2EA 1MRFH 2IDUA 3QP3A 3CXDH 4QTHA 5C0ND 2XWZA 3CFKB 2X4UB 1ZXQA 4I9XA 2BJML 3F8UB 4C83A 4BWUA 12E8L 1SOKA 2JTDA 4NGHH 1MVFA 4WHCA 5E4EB 3T1FA 1EEZA 2FJGA 4MDIB 2YPVA 3GHPA 4F20A 4HJGA 1A9BB 3ALXA 4LLDA 4Z7OF 1YECL 2Z92B 1XF1A 3EO9L 4QNPE 2WOBA 1MUJB 3LNFA 2EVHA 2R8SL 3V4PH 2J57A 2VISA 3S3BB 3SE3C 5ADOH 5J9PA 5IK3B 2P5EE 2W9LA 4ZFFA 3QCUH 5HHQB 3ZW3A 1P7KB 1XIWC 4UQIM 1WHPA 2WZ6A 3AGVA 5KW9H 1F13A 1HHKA 3BPNC 3EGSA 3EH5B 4X9IA 4ODHH 4PRAA 2I25N 4QAWA 4TF4A 2J44A 1CS6A 2FYYA 2J88L 4FNLH 4OFVA 4UANA 3GQFA 3ISRA 3S5ZA 2F7OA 4HULB 5H37H 4QRSB 2QVMA 1AVAA 1HWHB 4OGZA 5D6CB 3KLQA 3KNBA 2EC8A 5I5RA 4B60A 6PAZA 2DMGA 4ZS7H 2V7HB 1ZPUA 4IW4C 4ONFH 4RSVA 3RVXC 3ESPA 4ACPA 2AQRA 1IAIL 4PGBB 3WFZA 2G3XA 3V79C 1AGFB 2W59A 2JB5L 3K4DA 2VC2L 3DUSA 2GTZB 1R75A 1XCTB 5F7BA 1A7RL 1Q38A 4BFGA 1E2WA 2CIIB 4M8RA 4ORGB 4ALAC 4HZ1A 2R27A 3RILA 4LKXB 3GGWA 2IBZX 4KOCA 1ZA6A 4WFHE 1Y1DA 3GS4A 4XZUB 5LQBL 4JY5H 4XBGB 4ONFL 3CVHH 3WTUA 4HT1L 5IHWA 2Z7ZA 4RNRA 4YHPB 3WLWC 3DJ9A 2V2XA 5BO1L 3D4CA 4G6FB 4KX9A 5T3ZD 1J11A 1J0IA 2NSQA 3ILQD 2ATKB 1UD5A 4JHVA 1MEXH 3MR9A 4QRQA 5KUMA 1RZ7L 2G75B 2QVFB 3OVUB 4J4PD 5DS8A 2VXQA 2J5LC 1XCQA 3OMZA 1XCTA 1WSST 3RBGA 2CR3A 5IJVB 5BZDB 2FEDD 1P4BH 3B5GA 2IFFL 2BK8A 1YO4A 3MJ6A 3T0EE 4BRVA 1QVOB 4BCZA 2AK4A 3MRNB 4XNMB 3Q44A 1RFDL 2CQVA 2AXGB 3NJJA 4Y1SA 1SN2A 3ZXAC 3OG4B 4G82A 4X4XB 3TO4C 1UXLA 4BDVB 5ERWB 4TVPD 3JSSA 2CG9X 1L6PA 3SGDH 4BFBD 1PLGL 4EO5A 4X4YB 4YWGL 1QWUA 4PJXF 4K23H 1MWOA 2VMDA 4U6HB 4OCWH 5D7KE 3BVVA 3LRGA 3V4VA 1L6XA 4OCWL 3MXVL 1HNFA 3DRQA 4NM4L 3KAAA 2C9XA 4ODTL 2XFXB 3FUJA 4PW3A 4RGOH 5C7XL 5ESAB 2YRBA 3RI5K 5D5MA 1BZ7B 3QI9A 3HZYA 3M7OA 5IFJB 3F12B 2ICEC 5B7FA 3VYPA 2CO4A 3Q8CA 4M61A 4AKPA 1SF3A 4PGEB 2Q86B 2XN9B 4JCMA 2WQUA 4G6KH 3S8FB 1J9CT 5DUPH 3GSQA 3DMMC 3BT0A 3IFPA 1T5WB 1ML0A 1BYNA 1REIA 2R56L 4UINH 4YPJA 1NBZB 3DGDA 5C0BE 3B8YA 4UAOC 4PLNC 3QPKA 3TONA 4CDGC 4L37B 3R1GL 4AQEA 1DDHA 3CG8A 2BSED 5HY9A 2XC8A 2D3VA 4H7VA 5CKAA 3ZTJG 2R2CA 5TQ0H 3OKDA 5JW5B 5KEZA 4FTVA 2EDFA 5FA4A 1KCUL 3IT8D 3JTBA 4FQLH 4HHAA 4RWYL 1YHPA 3CMOH 5B3SB 1J8HB 2VDOB 3REVA 5D5ME 1YYMH 4PB9L 2XNAA 4UB0L 3I75A 1T66C 4B9PA 4AYEC 1GL4B 2DQHH 2PCFA 2B14A 4WUUD 1GAFH 1C5DA 5I1EH 2FB4H 4OLZL 3TA3C 1G7LB 2BP8B 2X2UA 5EO0B 1GZPA 2EUZA 2V2TA 3CWGA 4F3FB 3H9ZA 5BXFB 3FTYA 3WKPA 1E9OA 5EN2B 1RZKH 1AAJA 3LRMA 1H5BC 4IDLA 3IMTA 2PPFA 3NAAL 5BRZE 4I9WD 3WELA 5D1XD 1E8WA 1U91B 4MNQD 4OJFL 3IETA 4WFGE 4IIZA 4G1EB 4M7KH 5C0AA 1G6RH 1NFDF 2E5EA 5C2BH 1S5IH 2DQFB 3QJHB 3ZIYA 1WBZB 4NKIL 3TVMC 4JFYA 3SBWA 2AQ3A 3F05A 2IDSA 2QHRH 1NH6A 2EO1A 1ZLUH 1SJHA 4XP1H 1OTTD 3WKYA 4WK0B 4JGJA 4FEIA 2PWDA 3MGOB 4HIIA 3S2AA 4O2CA 4HA1A 2MOVA 3BRGC 4K15A 5JYMA 1UM6H 5TDOB 4OCXH 5F9JA 5F7UA 4POYA 1TQCB 2VKWA 1PNDA 3P11L 4AQ8A 3CVDA 3BI9X 2NY6D 3POCA 1FNFA 4KVNL 2QZQA 4X6FA 1K8DB 4KROC 3BAYA 3RA7L 3UX9B 1UCBL 4U1NB 4LSSH 4RX4A 4Y4KD 2F7QA 4K8RC 4Z7UF 4CMMA 2WNKA 1AO7B 3PWLB 4YAQB 5CS7A 3PPSA 4FOMA 5CBEB 5F1IB 2DLFH 3BZEB 2XQYA 2HH0L 3K6IA 4PCKA 3RL1B 2O6PA 2HWZH 1R3HB 5CMAA 3OM3B 4QF1A 3SKMA 3AACA 3PXJA 1VGKA 4HFUH 1SBSH 3GINA 3C60B 2CM6A 3M17B 1WP6A 3VG0H 5HYJA 2A9ML 3PIQB 2GUOA 4Y4HA 9PCYA 2WXLA 4JQIA 2NY2D 3QCVH 2K70A 3GIZH 3QIWD 4LOVA 3U36A 5FYJD 3SPIA 4FXGB 3VVWA 4M7JL 3TYGL 1H5BA 1XDTT 1BFOA 4LSQH 3IJEB 4KUZH 4F7EA 2HT4D 4YDJB 3UG3A 5LWYH 2NW2B 4KX8A 2RAMA 4L4TD 4P5TA 5DA4A 2W9DL 1N64H 2OMWB 1B0GB 2XFGB 2CUAA 2EDMA 3HG1D 2ZAHA 2ORBL 4PY7A 1X7TA 1P2CB 2NMSA 4M6AA 1RUKH 4GRMB 2OTUB 3M88A 5F7NC 5IR1A 4X8CA 2Y7QA 4IBVA 2IH3A 1NLDH 3Q48A 3MLVH 2NZ1A 1EDQA 3ZKXB 2VABA 2ZUTA 2Y07H 1JF6A 1EHNA 1M1XB 4JFPA 1M1XA 2EDJA 3D51A 5AW1B 4FQHB 4G6JL 4ONGH 1GJIA 3E3QE 5FO9A 1GOFA 3VXME 4XRCA 3SDXB 1UT1A 3HKFA 1MLBA 4QJ3B 1YEIL 2QL1A 4ENED 2JXMA 4Q4IA 4H13C 5DZOA 2YSTA 3WUWG 3Q0HA 5DI8A 1GGUA 1FFQA 3PWVB 1NSNH 1N0XL 4L3EA 4MNQB 1MFUA 4G70B 4HFWA 5GJSL 2B7DT 4ILDA 4P9HC 4QKTA 4XZ4A 5EULV 3N43B 2PTUA 2VQ1A 2O30A 3JZYA 1W16A 1CLOH 2AEWA 4X9HA 4Y4HC 2VDMH 2HTLD 3C60A 1Q9WA 1JTOA 3GJEA 2OK0H 4WUUB 3X12A 2FHBA 3R0NA 2VDML 4MJ4A 1U21A 4AMXA 1OCOB 2APXA 3T3ME 4DO6A 5JOEA 3ROLB 4QIRA 2VJ8A 1QRNA 2EKSA 4ZFOB 4BINA 1NGWA 1NC4B 1AP2B 4DGYL 5F3BB 2DD8H 4FYRA 3OHMB 4X50A 1FGVL 5G4OA 3WFCL 3VGFA 4P5TC 1NZRA 1TEYA 4IHBA 4YOKA 2XN0A 4F27A 1U3HB 2VMCA 1CYWA 1LEIA 3X14A 3PP4H 4LAQL 3KWTA 1BZQK 1RLBA 2J73A 4OZGB 5ALCL 1I7ZB 1PD1A 5IM7A 1WPCA 3O9WA 2VL5A 4XCNB 1P7QA 4KXAA 4OF8A 5DVNA 2FL5B 4Z95H 7FABH 1SOXA 1A3RL 3L7EA 3G5WA 1F42A 4D0BB 1TJGL 2WJ7A 1SJHB 2NRDA 4NQQA 4ZUVA 3HNVH 4MRCA 4G6MH 4IJ3C 3K2UH 3C08L 3A23A 3TBVB 5IW6A 1SDAB 3ARQA 1M53A 3OPUA 1R3HA 2P7TA 5CMAB 1OAXL 2AV1B 4OQTA 2KQMA 2NQDA 4HUCA 1J05B 2DKSA 2HVJB 2P80A 2JKIS 3GXPA 1T4KA 3MODL 4FA6A 3DMMB 4HDIB 1HOCB 5KOMC 4M7JH 3TYGH 2BNRA 5DYOB 3ZKSD 4BUGA 5LGHL 4OZHA 2V5RA 4IYKA 1I8LC 1LE5A 2JKRM 1U9KA 3NN8B 5TFSH 3U30B 2FNWA 2IQAA 3NFSH 4UUJB 4L5FE 3CN1A 4AWJC 4P3DA 4L4VB 4UYQA 4ZUSA 1V3LA 4EVNA 3PXHA 2WCGA 3VXOA 4HS8H 1ODUA 2Z4QA 4HS8L 4KU1A 5SX4I 5CJ8A 2ZSVA 4ZS7L 1G1YA 3PPEA 1T7YA 5F44A 5C71A 5BZZA 2FO4A 4DGVH 5GGVL 1E2ZA 2D7QA 3OQ3B 5D1QB 3DIDA 2R0LH 4NUJA 4KGLA 4ODWB 4ABVA 1P7BA 5IG7B 2DIBA 4APQA 1J9QA 1H9DA 5GSRB 4UM9A 3OMNB 4MAZA 5GRUL 2VDNL 5FUCE 1LEKA 3BPCA 1D5BB 4JFDD 5HGBB 3STBA 1I1RA 2NXYD 3ZHDA 4P05A 2JCCB 5KSAA 4KTGA 2PPEA 3FU3A 4PWHA 1RZGB 3T4AA 3AMLA 5GS1A 5DVMA 2V6HA 1KC5H 1KFAL 3M07A 4NUPA 3HIZA 5F8QC 3I50L 1BFVH 5I15H 4JCWA 5DRXB 5SWZA 5BPPA 2PCPB 1F90L 2H6PA 1S7XA 2WWMD 3EH4B 3LSOB 1JGLL 4N2HA 1IKNA 1MFMA 3ZR6A 2ZCLH 4N20A 4YNYB 5I19H 3KPRB 2E7MA 4KQ0A 1JPFB 3WTYA 3K6DA 3QJFB 2P1YA 1SN0A 4Y89A 1CLVA 3KPOB 1J12A 4XBEH 4WV1A 4JN1L 5EO9B 1TNMA 4K7PH 4HPYL 2XZAH 3LB6D 5DWUH 3FUNA 2AFNA 2Z65C 5DJAB 3UJTL 4N0YH 5E4IA 4JG5A 5IEHA 3UZVA 5DWUL 5MEPB 3TC9A 4LSVL 1GS7A 2AJUH 5AOMA 3TBYB 2AK1H 5B3NA 2DBLH 1PLAA 1AYRA 1J1PL 2OCJA 5GGTA 3V7AG 3QYCA 3IU3B 4AGNA 2AVFA 3WD5H 2GITB 2F6AA 4R4NC 4H8PA 5C8JA 4PGCA 5CZXD 3GXFA 4XN2A 5IWLA 3ELAT 4K8RD 2VOTA 3ZU8A 1OHQA 1D9KC 2MHAB 3SO3B 3ZYZA 1I1AD 2X12A 3O3AA 1MCBA 2I85A 3QB7C 1BBJB 2UY7A 4YHLH 3PYCA 4PR5B 2NNFA 5IJKA 3SJVE 5ISZE 4JG9A 4F7KA 4EUPH 2PW2A 3WSQH 5EIQA 2IPUK 2F8XC 3PDOB 4J1UA 2EKJA 4O02H 2AXGA 3LXBA 1OHZA 4BWWA 2JJSC 3IU4H 2D2OA 3UZQB 2A4CA 4MSWA 4ZMVA 1U8JA 3FFDB 5IVZB 1F4WH 1NIFA 5IQNA 3DIFB 1NMAL 3QWQB 1ZE3H 2HPTA 1YEFL 4PREB 4Y9EA 3ZHNA 3FB6A 5F7DA 1R17A 2PLTA 5CIPH 3ZTDC 3DTXB 4WI9A 1E50A 3BGMA 3AZUA 5L9DH 1W15A 1U93A 1MPAH 3PHOA 5BW7A 3L7FA 5D7SL 2ZUQC 4YEFA 1RZPA 2I07A 2CPUA 1FLRH 3BO8A 3OF6D 3ULAB 3SGKA 1F90H 2ZG1A 3BPLC 2MNJB 2XBTA 3VSQA 4CSSA 5FOJA 4HWZB 4HUVA 3P4OB 2AGJH 3ABLB 3B9EA 1ZVSB 2IEPA 5F7FA 1TQTA 5T1LA 1ADQH 2FHFA 3D25A 1KENH 1DBMH 4PJCA 2YRLA 4A2EA 2HG0A 1AXSA 1OTTC 3VQLA 1T4WA 1AGFA 2WTRB 4NUGL 5EOCH 3HZKA 3QYMA 1RJLB 3RTLA 2YQ3A 4AIZA 3DGGB 4XMPL 2DYSB 4P5MA 4PJXB 4KUCD 5IB2B 4FQXC 4FHJA 1BZOA 2WXMA 5AYUL 3H9HA 2HUEA 1JFHA 1GJUA 2VYRE 2WLLB 3DOSB 4N0UA 3TYFB 2C9RA 3QDJE 4MJJA 2OJZL 3UYPA 1HHHA 1KTLB 2ZYIA 1U3HD 5J57B 3LH2L 3CHRA 4XT1C 2J8UE 4JJHA 2HFGL 4EMZA 1MOEA 4KDTA 4KZEH 4AQOA 3SCMD 4XCYA 1R3JA 2CHNA 3OAUL 4P4RA 3QZWB 1X3DA 2N7AA 4PB0L 1KTRL 1H3UA 2DQCL 5DZVA 5GS2D 3BSZA 4V1DE 2JCCF 3HPJB 3SQRA 2YC1B 3BSGA 5GGUB 1JZ7A 1KEGH 3K8KA 5C08D 1JYWA 3BKYH 1I7TA 4PJ8A 4U1MB 3IGUA 3VYOA 4W9KC 2RTTA 3Q01A 1KJVB 3NIDF 1EWHA 4MA7L 2QGEA 1VERA 1ASOA 4DP2X 1PJWA 5ID0A 3V4VH 5IBLD 1VDGA 2JJTC 2HN7B 2XQYG 3MJ8A 4K2UH 3LN4A 2OJ1A 3VG9C 1LO3H 3IFNL 3CLFH 5L2KA 1Z1WA 2EILB 4H0LC 2HFEB 3VWKC 3VXOB 3WMSA 5CZXC 4DVRH 1QHOA 1Q0XH 2FZ3B 2NY5C 1P4IH 3WNNA 4ANKA 5D7EA 5AZEL 2HXAA 4AJVA 4OI7A 3RWJB 4CN1A 4DERA 3BEWA 1IM9B 4HPOH 5E9DA 4M8QA 1C8QA 1CIDA 3LS5L 4JUSA 4IS6A 2E4TA 2HX8A 2R69A 5F7WC 3ARGD 3AC0A 3DK2A 3G6DL 3CLEH 1TQVA 4RMVA 3CFCL 3AG4B 5FYKD 4XE5B 1ZHNB 2E9BA 3CFTA 4DP7X 2O93L 4H8UA 3FT1A 4JFFA 4KKBD 3K0YA 4L4TB 1FZJA 4XMZA 2DEXX 4JM0A 4DP4X 3P2DA 2F54E 3ZE2E 3AU0A 2GJRA 1UM5H 3O3DA 2YMTA 3JWOL 4NHCH 3F7LA 3V0VA 1A0QL 1JXGA 1SHMA 4MFHA 4CNIA 5IJDC 4R8WH 1C5BH 1ZA3A 3CHSA 4KUCF 1A8ZA 1EHAA 4NWTH 4EI5B 2FEDC 2ED7A 1B88A 4JRYA 5I1KL 2YC1A 4XN4A 4AOFA 4QAMB 4WU7B 3IE9A 4UTBA 4AL8L 2CO2A 2F1AA 1QA9B 2HX9A 5FFOA 1CL7H 4NM8L 1U8NA 2CHWA 4L1SA 1FC1A 4GQQA 2VLRA 3ETBF 4I7ZC 4X6DE 1P1VA 5TPWH 2WLJA 3QHZH 5E5RB 1EHXA 2N0KA 1S7VA 1PG7W 4GUQA 1IGYA 5I71C 5SWSD 4ZSOB 3BMVA 3GKWL 3OKDB 5JW5A 1FL6A 5FYJH 5IZ7A 4JFUA 3PGDB 2G3NA 1HH9B 4TNGA 3FQXB 4WFGD 3PWPD 4GG6A 3IPBA 1TVHA 1CFTA 2DS4A 4XB8A 1N18A 3EJQA 4DPRA 4IRSA 5IB3A 3VD5A 4AEIH 1JPEA 1P84K 1OAYL 4PTUB 1RHHB 1WZKA 43CAB 5LN4A 1KB9J 3MRMB 5GGUA 4N8PA 4F7PA 2ITCA 4XMXA 5IFAH 1WIUA 1GGCL 3U9WA 3D25B 1I3GH 1AZCA 1P4IL 4Q6IA 3SYPA 3QXAB 5C3TA 5HYSB 3P30H 2GBVA 1W2KT 1URZA 1JWMA 3K8MA 5KG9A 1OAJA 4U33A 4K94H 1KPRB 2DYPD 5DJZA 4X7EC 1BF5A 1T2QL 2E59A 2ZPKL 3LEVL 3NSCA 4YPGB 3GSUB 4XNZB 5DD3H 1XF2B 2ZQKA 1WAPA 2YUZA 1WAAF 4HD9A 4QXUH 5DDHA 1V3MA 5ID1B 4G80A 4GAFB 5D96B 1TYRA 2ADGA 4MX7B 1ACYL 1HNYA 5C0RL 5L4IA 5F3FA 4ZX6A 5KW9L 4X98A 2HRLA 4X5PA 3ML9A 4N8VG 1L9SA 2XTLA 2N0MA 4UU9B 3W37A 1MZZA 2PPCA 2NY1C 1MHEA 2AI0L 5JHDD 1KWKA 2IAAC 3HS0C 3T4YA 2WBJC 2UX6A 3DBXA 1TCMA 3BKCL 1TDQA 2DH2A 5EUOE 3TPUA 4B0MM 2AI0H 3NSFA 4GQZA 1I1AC 4QRQB 2B5IB 4HQQH 3Q2VA 1EANA 1RJCA 1J8RA 4PJIB 2IALA 2YPLD 4YHIA 3DSNB 4YHPA 3SGJA 4ZQTA 4TTDD 3LCYA 4AJWA 2J43A 2ROYA 2W95A 4HJTA 1MJ7H 4K7PX 5TE6H 3E8UH 2FTAA 1G7PA 1XZ0B 1G7QA 3NYKA 2IV9A 3DX4A 4KK6D 2VDKH 2SEBA 3MTRA 3IU3A 2WLYA 5D2NA 5C3IA 3M17A 4AE1A 3D9AL 5LGKA 4Z3IA 1MREL 4LSUL 2P5ED 3OR6A 3VGAC 1MJ7L 1Z9OA 1FGVH 4NJ9H 1IKOP 4BH8B 3II2A 4MSWB 3B2UD 5HXMA 3L4YA 1L0XA 3IXAB 1YEJH 3C5ZB 4AYMC 3EJUA 3HB3C 1J8SA 4X6CA 2XT1B 2J8UF 2QV2A 3X3GH 1ZXKA 4N8CL 1YUHA 1FO0H 3RVVD 4YLQT 3MV7B 3BP4B 3GSWB 5DSCA 5T5FH 2R1YA 3ARGA 5I1JH 4NKMA 2R56H 3EXLA 4KOBA 5FA3A 1A6VH 3MRCB 3HS8A 1XR8A 3MX0A 5INDB 3RZCC 1K5NB 2VM4A 2WC7A 1B2YA 1FLTX 4X6BB 2ATPB 5IQMA 4KK9D 3ZZSA 1OAZH 4MTMA 2P8MB 3KJ4B 3RUGF 4F8LA 1PZAA 4UB0H 4D8PB 4ZXBA 2OL3L 4QXTB 5LUMA 2ICWJ 1OP3H 1W0VB 1T3FB 1TVBB 3WN6A 3JTTA 1SFHA 2R59A 1F1AA 2WBJA 4MCYB 4LESA 3S96B 4P2QB 4OCYL 4R4ND 1IQWH 3FB5B 2IAMC 4Z3JA 3M86A 5C0AB 1YZZA 3GMOB 4KXBA 4APQB 1DBBL 5I1HL 1BSIA 4U7MA 1JDCA 1X6LA 3NIGB 1A7QL 1JK8B 5GJTL 5HJBA 2VDPB 5E9DD 3DROB 2Y2WA 1IGJB 5FO8B 1UEYA 1MY5A 3ILPA 1S7QB 4EIBA 1AJ7L 2VR6A 3UPRB 1VFBA 2MPVA 4QHUA 4BK5A 4EVNB 4PCTA 2OTPA 3KS0H 1X7QB 3N0PB 4YUEL 4HHWA 5D2LE 4NQCA 4ZQKB 3WAJA 3FPYA 3LPWA 1I9RH 5IHUH 4A6YL 2E8YA 2BRRL 2C34A 1ZAGA 2DZEA 3G08B 4LPCA 1GVIA 1NEUA 2QMKA 2O5YH 1KCWA 3QNFA 1IM3D 1N10A 2GTWB 1HOCA 2R0KL 2B39A 2X42A 4Z7VB 5HI4C 1DVUA 3HE7B 4BSJA 4Z8FL 2X4OA 5LXVA 3MQIA 1I85A 4AITA 4YFEA 5DQJA 5GZOA 4YHOH 5E2TL 3LS4L 4G8IA 4E9XA 3OJVC 4PM1A 1F4HA 2CJTA 4NOBA 5BVJA 3UG5A 5T5FL 4IRJC 3L81A 4LL4A 2XY1A 2ZSVB 4CRPA 2GJ6E 3AQDA 4QXTA 1YQVH 3HZYB 4ZUVB 3T2NL 5DQDH 1MAJA 3TIEB 1BQKA 5BZWA 4LEOB 5DT1L 3D69A 1RK7A 1MQKL 2WXQA 5C86A 4KI5E 3U4AA 4X8GA 1IGML 1U92B 2X4PB 3BOVA 4NFCA 3LMJL 3SDCC 5AAWA 2XKNA 4ZMNA 3U2SA 2B59A 1M42A 5MI0C 4RAVA 4HIEB 2XA8L 4NNXA 5INDA 5BUAA 1LEIB 4B53A 1DJSA 1U3HA 4UV7H 3VXUB 4GSDH 1IM9D 3CDFA 3NIDB 4DJMA 2JWYA 3ULSA 1BWMA 1BJMA 1I7RA 3P3UA 4PJGA 1RULL 5DSCB 4IOSA 3H42L 2QPDB 4ZZFA 4JO8A 5I1GL 2GJ6A 1Z66A 2DMBA 5DWPA 1DJGA 5GGVH 5AW7B 5D7LA 2O5ZL 3BKCH 4MZ3A 3ZRCC 4BH8A 4NSKB 3QUYC 1GYVA 1UCBH 3ZDZE 1UZ6E 1EXGA 1JF1A 2WKGA 1HEJC 5GRJL 5D2NB 3BPNB 3VI4A 2VITA 3ROOB 3EFOA 1G7HB 1QSEB 3O4LB 4HJ0C 1XF5A 1WZ1L 3GMRB 3OBAA 1CQKA 3IDYB 3UXFA 3VXSB 5T33L 1QO3B 4XCEB 4DT2A 1I7ZA 2FX9L 1GOHA 1R3LA 3ME0B 4HFWB 1SJEA 4BM7A 4EQ3A 3CZFB 1BAFH 2IALB 3X14B 4S2SB 3OR7B 3V0HA 5D4JA 4HUKB 1GPOL 1XXFC 1ZA6B 3TCXA 4J3UA 4PJFB 3MXWL 5H2BA 3EO9H 4HU8A 2FD6H 5C09E 4JFED 4HK0A 5B8CA 2H32A 3ZE1E 4ALAH 4IU2B 3SB3A 1BDYA 1NC4A 4NJAL 4WW2F 3QIWA 5EU6B 2CLRB 4ZTEA 1KUMA 1BQHA 3VFOA 4M7KL 3LYRA 4ZMLA 4OGXL 3OKOA 1DBKH 3DYPA 4WO4B 1XV8A 4P5TD 1MPAL 1S3KL 2AKRB 5JIKA 1TJGH 1A3RH 1SBBA 3NJVA 1E6OL 4MS8D 3AT0A 4OSUL 4S0TD 2P5EA 4GAJH 2NYZA 2X3AA 2WWKT 3HE7D 4APXA 2FX7L 1OP5K 3EYSH 2C3HA 2NY3B 1KJMB 4AEHH 1QKZH 3FQYA 4JFFD 4O02B 2LFEA 1U30A 3PL6B 3BUYB 3T0AA 4JO4H 2VE6B 1PYWB 2VR4A 4J5VA 2BSRA 3ZE0B 3WTVA 4P59L 5D7JB 4HKBB 4MJHA 1K4CB 3K80A 1JUFB 2DKUA 2MQCA 4X7TB 1EVUA 2VSDA 3WMQA 4WZ9A 4A1RA 4P59H 3P9MA 2AJVL 1JBJA 1U2HA 3K6SB 4NWTL 2BZ7A 5EOTB 4HMCA 4PLJC 3D5OF 2I9LB 3T6ZA 2XUWA 3G5XB 2GEEA 1IGFL 4TTGA 1P4BL 1K8DA 2CJUL 5H2BB 4PY7B 5KBLA 1PIGA 1X5JA 3HRPA 2R2BA 5IMLA 3S37L 4NKQB 3FTZA 3NT0A 4FJZA 4P5TB 6FABH 1FORH 5B8CC 1D5XA 4Z3TA 5I16A 2DY2A 2X09A 1AE6H 3FUIA 5FS5A 5D2LA 4U1IA 2EYTA 4MDJB 5JUEL 4RMQA 1QR1B 3GSNL 2CKBA 3L5HA 4UNUA 5I1DA 4WI4A 5EZJA 2OP4H 2WNXA 2F15A 2CAKA 4F58L 1NAMB 2QGDA 2P47B 3IDNA 2F74A 1I1AB 3N1QC 4PWEA 4EIGB 4NSKA 3ATFA 1PZSA 3JT2A 1E9QA 1F02I 4RAUB 2GT9B 5DR5L 1KC5L 1QZ1A 4WI3A 4WSKA 4GUPA 4QCIB 2ZZUT 2AEQL 2MTAA 2WXOA 4HJIA 4EXPX 4FFYA 4NQXB 1G9NC 3TIDA 3EFFB 3L4CA 3TLRA 1NMBH 1KCVL 4R0LB 5HHME 4P8QA 1MIEH 2D8KA 3RNKA 5FUOH 4P46C 4U4BA 4Y0GA 1T1XA 4XHJC 5EC2A 2DL9A 2XZAL 3FT9A 4HH9B 4AENA 3P1VA 4XBEL 2YSSA 1PD0A 2ZOKB 5EZIL 5JW3H 1MXGA 3R4RA 1IAKA 1HAUA 2Y3AA 4AT6B 1UJTA 1IGTA 3HTLX 3O3BA 4LDLB 2YXVA 1Y0LA 3H42H 4P46D 4YSOA 5JHDA 3PGCB 3JVFC 1M7DA 4OKVB 2OQJA 3R8BB 2JB5H 2QFRA 3HFFA 3HUJA 2VMEA 4JX0A 3NVQA 3QJXA 4IBTA 4PJEE 3TJEL 4HWBA 3RA7H 1KT2A 5MERB 4WV1C 1KLUB 3TCTA 1TT6A 2R4RH 4PJHF 4KK8C 4R4FH 2FUQA 1EAQA 4LHUB 4MJIB 2BVPB 5IKCA 4K3JL 2DEYX 3UERA 4N3TA 4MA1C 2XHNA 4D94A 4F7MA 2EDNA 3OL2A 1TYEB 3UMTA 4GRLB 2YJQA 5FX3A 2VJXA 3FF8A 4QHKI 2Z31C 4LEEA 2JELL 5ESVB 3RGVB 5IQ7L 3SPGA 4AQ1B 3SEPA 4G1MA 4DEUA 5FECA 1CI5A 1WWWX 1CGSH 3DARA 5GISL 3BZ4B 3RVTD 1B4JL 1KBVA 2UZXA 5JMRA 2NX5D 2N4IA 3WDHA 1GTFA 3HNVL 3MV11 3ZTCC 5T1JA 3DIVA 4XXWA 4TV3A 1X9RA 1CXEA 1JGEA 1L0QA 4IRZH 5B4MC 5FEBA 5PCYA 1FPTL 1UHVA 1J5OL 2ZCHL 4JHWH 4PJGF 2VDPL 3VGHA 4A55A 1BM3H 3AADB 4P5MB 5IB2A 1T1WB 1HXKA 5JW4M 3L3GB 4PJEB 5F96L 2Q86A 3ARDB 4A66A 1E3XA 2A9NL 3ECUA 5E2UL 2AJZB 4JREC 2DEWX 3V6ZB 2K3TA 4FA8A 3STZA 4HKJB 4EE2A 1F56A 3PHQB 4HEPG 3S9DB 1JHLH 3F64A 1NFAA 4TM9A 4WGKA 5GGRB 5AKTA 4XTRD 3S6CA 5BW7C 3KLAB 1YYML 1KLGA 4PB9H 3LZQA 1K3ZA 2LAAA 2NR6C 4QRPD 2NUPB 2ZP8A 1HJBC 1BX2B 5E5UB 5L8JB 2GK0B 3QQ4B 3QC5X 4PJDA 3UC0H 4MS8C 3T0DA 3QC6X 4UQDA 2GAZA 2F18A 4JANA 4XP9L 3UPAA 5AW4B 5B39G 4TSCL 2W07A 3KVPA 4JB9L 3GRWA 5B22A 1AKPA 3JV4A 3ERXA 3KVQA 4R90L 1SY6H 4WK4B 4X0KB 5BV7L 4W4OC 3QI9D 3B2XA 4EIZC 2P44B 3FQUB 1MJ8L 3GXMA 1SMOA 4OIIL 3BAIA 1N59A 1S5HA 2WZ0A 1JGVL 4MNGE 3VRIB 2ZIDA 2E7HA 3PHAA 3RWCB 3UTPE 1WLHA 1N0LB 1NAMH 3K4ZA 1TITA 8FABB 4GIOA 1XMWA 2XKSA 4YHNB 3CV5A 2OCCB 2Y69B 4UOW0 2FO1A 1XF4A 5TE7L 2Q8AH 4TVPL 1VFAA 2XN1A 3FO1B 2B1OA 4UIMA 2DQMA 5DEGA 1OAQH 2Q0ZX 3BDXA 1TIUA 3BQUB 1YNLL 1H6UA 4UU9A 4KQ3L 4FQJL 5CIPB 4XP4H 5IEHB 5L4JA 1F6AB 1PEWA 1E40A 3BFOA 4MXVE 1TTAA 3B7RL 3B8SA 1D6VL 2EABA 3SHSA 3VCLA 3G5YB 4KJPD 5I6PA 3FRUA 1D6VH 4QRSA 4PJ9B 1QBAA 1NJ9B 5AW3B 3FAWA 3KYMA 4KQ3H 5FM5O 4TULH 3UTQB 4NI6A 4ONGL 1HHKB 3B37A 3MJ9A 4PI2A 2DICA 3UP6A 2MQ0A 5CHNA 4PJFF 4Y19B 3BRFA 1XGPA 5HGGS 1QQDA 3IKCA 2V5SA 2B0SL 4ETQB 3CVHA 5D7IE 2H9GB 3GUFA 4LQ1A 4IRSD 4RBPK 5FDYA 4FNRA 3DX0A 3L17A 3R06A 4JY4B 5GZOC 1IEBA 2R0KH 3W9DB 1BOGA 2ZXBA 3OB0H 4AXWB 4KVNH 1IAIH 1V3JA 1OCWL 3CZNA 1TO4A 1BBDL 3MA7B 3QS2A 3VVVA 3S4SG 1CXLA 4AVIA 3HVNA 2R2EB 3QZPA 3VI4E 2ZPKH 1AGEA 3LAFA 5DD1L 4UM9B 2CBQA 4L3CA 2JQMA 1EO7A 1JGDB 4FI8A 3RX8A 4EBQL 4JR9L 5AFAA 5I5IA 2A9AA 4NN6C 5A2CA 5KBDA 3P4NA 4BHUA 2GIYA 4XP1L 3WNJA 4XBMA 2J1KA 4XNYL 4F2EA 1KPUA 4HFUL 6PCYA 5C0NC 2WIIB 3EGDB 2ICES 3RHWK 1N6QH 5H35B 3NBNA 3VFSA 3LNEA 1FO0B 1YYCA 1WUZA 2VLRB 4KKZA 2GCYB 2MJWA 4M1DL 2AABH 1NUNB 3F7RA 3DJSA 3EJJX 2BOCB 1MZYA 2EP6A 1LNUA 2ODHA 2Z1KA 1FFTB 2YSSB 4P2CG 3PG2A 1MVYA 3CU7A 4PIBA 2KHAA 3D08A 3T2QA 5JQ6L 3F83A 1YEGH 2XG5B 5DYFA 4U6YB 4Y4HD 4U1LB 1X5ZA 3IDIB 5KVEE 3FBKA 4RISL 2ZX6A 1U8OA 1NMCC 2BOLA 3LQAC 3SKUD 2HLFD 2QSCL 5I66B 2ICEA 3DVNA 1OQOA 1YEHL 4CL7A 5J1SC 2EC9T 3FB8B 4HCFA 3QUXA 2LU7A 3MOAH 1MHCA 3LKOA 2JJUA 4DEPC 1S2EA 2YN3A 2ZUUA 4N8VA 1H0DA 1S78C 1K85A 4JZOA 5CP7A 2G60L 1YY9D 3D2UA 4NFDA 4A7UA 4WSGA 3WFCH 1UWFA 2F1BA 1Q4NX 4E9WA 3DJRA 2NZ9C 4HUWA 3EOAB 1I1AA 3BVTA 4XHQA 3APFA 4Z76A 5I1KH 3NIDE 3H7BB 5JIMA 1E30A 5K9OA 5MI0B 4IGBC 2BSDA 3O6FA 2ZOKA 2IFGA 4KGJA 4UMSA 1S9VB 2UVFA 1VCAA 4ZO9A 3TH3T 4LKCB 1GCYA 2E47A 5LAPA 1KGXA 4BKLA 5C0CB 2JCWA 4EN3C 1CTMA 3L3HA 2NTSP 4HEMA 2NDGA 4URKA 3TP4A 1INQA 1KB5L 3ZR5A 3T6QC 1V27A 2WNWA 3P4NB 3X3FL 4L18A 5BV7H 1BQUA 2AITA 4XCFH 1RURH 1XXDC 4KJYA 5DU7A 3PNRB 1A5FL 2A74B 1CGUA 2CNYA 5IB5B 4QRRE 1KJ2B 1U8LB 1Z32X 5EOQH 2V7NB 1U95B 3RWHB 2XACC 3FSWA 4C4KO 4AXWA 2YBRA 1V8HA 3WS3A 5FCSH 4PIRF 3SN6N 1T0NB 1TTBA 2MOGA 1VACA 5ILTH 2C1OA 1MVUA 4PRID 3VWJA 1WQVT 2H5UA 2J8OA 2PUQT 3EHBD 3JUZA 3MXWH 4JQVA 4N8CH 4U1IB 3T09A 5HDQL 1TO5A 4DFIA 1BD2B 1JK9B 1Q9OB 1IC0A 1JNHA 1YQ2A 4FADA 3D85B 3N42B 2X87A 5GIRB 1CZ8L 4R7LA 3KR3H 2FAUA 3KYMB 4K9EH 4JO1L 3ET9F 4KUZL 2RBLA 1PU0A 3HMWL 5J13C 2VDKL 1BVLB 2QSCH 2Y6SD 3AROA 4ZG1A 4M7LH 2VN6A 3T0BA 1SLVA 1BM7A 1DSWA 1T0OA 3AXIA 4W9CC 1N7MH 3E1F1 3MU3A 2DQDH 5DD0H 4DKAA 3NMEA 1KY7A 3VFMB 2VSCA 1UYWH 3BH4A 4POUB 3HAEB 1WBYB 4GW5A 1BXUA 1W8NA 5TDPB 3V2AR 2YMOA 5GZND 4DGIH 3I74A 4K9EC 3KL5A 4NP4H 2OMWA 3VXRD 1XF4B 2WLHA 5GS2H 5FR3A 4DGIL 2L04A 4LVNB 3MNZB 3CZFA 4XPBL 3WIHL 5D1QD 5C0AD 3HFMH 5ISZA 3SJVA 2NNRA 1QTPA 3FQ1A 4LQFL 2UZPA 3GJFH 3MRJB 4NO0A 2LQRA 2VLKB 4LQFH 3K6OA 3MV01 1KSRA 4JHAL 3MLXL 2CJUH 3SIKA 1TVDA 2RFXA 3QORC 4L2LA 4OD3H 5E8PB 3U9UA 5IB1B 1QLFA 1Y07A 5DZLA 4NERA 1NLBL 4LDCA 3V6BR 2Q7YA 3ZQXA 4FI7A 4N85A 4NP4L 3UJJH 1USQA 1UT9A 3LS4H 1YCSA 1WCQA 2B16A 4WW2C 3VD9A 1OP9A 3KPNA 1XGYL 3HLAB 2E56A 1DQVA 2F58L 4N2BA 3ULVD 1FL3B 2PYFA 4IU3A 5BV7C 4JL1A 4EDXA 3G7TA 4EI5C 4AL8C 3QQ4A 5D7HA 5HGHA 4ZAKB 1Q9KB 1I3RA 2GB2A 4EN2A 2GY7B 5DD6B 1LEGB 4QUOA 3NPSC 4YHKL 1EO5A 1U92A 1XF5B 3C5ZD 2X38A 3ZE0F 4XXCA 2CE6A 3NCXA 3E1ZA 3VI4B 2LLGA 3HPLB 4XMKH 4CJ1A 2G2NA 3IRZA 1JF1B 4KJQD 5D70H 5A7BA 5I18H 5D1ZA 4Z23A 5K39A 3V5KA 5I2IB 3IDMB 4NC1C 3V0EA 4HCRA 3F65A 2A73B 2EIKB 1FZKB 1U8HB 2WKOF 1TMCB 3NDYE 5EO9A 3OKMA 2WWNA 2FT8A 3K1DA 2H2SC 4TLUA 3MOBH 1HDMB 3CH1B 2ZWSA 4XC1H 4ZTPH 1R24B 3CX5K 3EGXB 3LIUA 3Q3GB 4AVJA 4HAKA 3CVIH 4P9HL 5CLYA 3UAJA 5IVXE 1EAPA 4HWBL 3S3SA 1UZ8B 3PWPA 2VTFA 2V2TB 4MMXA 1MAKA 3N44F 1G94A 5AVYB 2IDTA 3QIBB 1UD4A 3QW9A 3N3EA 1AMXA 2B59B 3JWOH 3RGVC 2VW4A 3UYRL 1FNEB 3Q7JA 1CURA 5DZJA 1IVLA 1HQRA 3P0VL 1KTDA 2EH8H 3O6LH 1VFBB 4LEOA 4HG4K 4KTEH 3KPPB 4EZJA 4GRLA 4CSTA 5KVFL 2Z0BA 2OYLA 2WXKA 2EDLA 5DUBB 4OZIB 1UUSA 3MJ7B 4F15C 4UT6A 5C0BA 4I2XB 2EIEA 4W6XB 1NWPA 2ITDA 2HLEB 4HIJB 4LHUG 5GS1C 2VDPH 5HGAB 2N1TE 3TFBA 5A7EA 3SDDA 5MERA 1PIFA 3RX9A 1R24A 2APBA 32C2A 3FO2B 2VQUA 2F9BT 5CN3A 3BWUC 3HE7A 3P73A 3C6LB 3QI9C 4QRRB 3WFDH 4XPHH 3X3GL 2AQ1A 3I50H 3V6FB 4D9QE 4KK6C 4A7GF 4JM2A 3SZ6A 2A6DB 2WBJB 1C7TA 4BRJA 1UA3A 4CAGA 3L5IA 1ZWIA 2BY2A 2WTPA 4LCWD 5HHOE 2FT6A 4OZIA 1L0YA 3PY9A 1IAKB 4JY4A 4Y4KC 2VUOA 4AQAA 3FSVA 4XXDB 1X9QA 4FABL 4KZCA 1S7TB 4HCRH 4IDJH 3VFUA 5KVFE 1A6TA 4TQ8A 1WAEA 3AQXA 1E4HA 4KQ4L 5ELIA 3RWFB 1A3LH 3QAZB 4NUQA 2IQAB 1OP3K 3LEYL 1LK2B 1HH6A 1T04A 5H4ZA 4HMEA 2Z7YA 4NNYA 5FA3B 1FFNB 2YXMA 3D0LA 1QACA 2DQTH 3FB7A 2YAEA 1U3JA 2XIBA 4X0NA 4AW4A 1XAKA 2PO6A 4JS7A 5DHVA 3RU8H 1WZAA 3TT1H 4HGKC 2WKLA 1Z3RA 3BH8A 1GZHA 4XBPB 4NQEB 5FHAH 1K2DB 4KVCH 5CZVH 4OQ1A 4YO0B 5C0GB 5CGMA 3VXRE 1DE4A 1QYGL 4G42A 5FDWB 5I1GH 1FUNA 1OW0A 3LIZL 5IB1A 3CH8A 1QYGH 1E5ZA 5T1KB 5IJKC 4KKLD 1CFQA 2B0SH 3B9KB 1ZV5A 4ZMPA 2IMMA 2WVVA 4DHLA 4DZBB 1A7BA 2LAGB 2FQFA 5DLMH 5TH2A 4Q8BA 1WV7T 1ND0B 3KHOA 5AVQB 2CBOA 2OMYB 5KUKA 4Q4EA 1GXEA 5EUOA 4KHTL 3WJLA 4OU3A 2WSKA 4HS3A 5IM7B 3QA3B 3LPFA 1S7WB 4N3UA 1ZHKB 1ZANL 5DJXB 5DZ9A 4QY8A 4IKJA 2ZX8A 1OY3B 1QFUH 4GG6E 5I5MA 1BA9A 4OD2A 4XNXL 3N1PC 4KPHH 2IADA 1LWJA 4G7QB 5D6DC 2XWRA 1VB9A 2Z3FA 3MLRH 2BZCA 3M45A 2QT6A 4FXLA 4LAJH 3X1BA 5D1XC 1KIQB 1EJOL 1T5XB 2XVGA 4KK8D 4OJYA 4B5ZA 3VXSD 5KSUB 2RQ8A 5ACMA 3S37X 3NACH 3RQ3A 2XBDA 2WBJD 4PRHE 1IKNC 3HNTL 2CPCA 3CHPA 4JFZH 4TS6A 4UV4L 3D52A 1W8EA 4JVUA 4PRAB 2RA1A 3KPQB 2DL2A 4QOKD 3FQ2A 1KPRA 4Y4FC 5DJZB