2WZJA

Catalytic and uba domain of kinase mark2/(par-1) k82r, t208e double mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
315
structure length
310
Chain Sequence
HIGNYRLLKTIAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Polarity-Inducing Kinase Family Mark/Par-1 within the Branch of Ampk/Snf1-Related Kinases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE MARK2
total genus 96
structure length 310
sequence length 315
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2wzjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wzjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wzjA01
2IVSA 1JKKA 1ZMUA 3EZVA 3MIYA 3PIZA 5EQYA 4AN9A 2B53A 4D2RA 2VRXA 2ZV9A 4OAVB 3LKMA 2AUHA 3FLZA 3CKXA 3ITZA 3F5UA 3AT2A 4OTWA 3E21A 3E8DA 5BVDA 1KYIA 1YHWA 2YISA 5AX9A 4BWPA 4BDGA 2FB8A 4A9SA 2IPXA 1SG9A 2YAAA 3LAUA 3ULIA 3VBWA 1M52A 5E90A 3ANRA 4DH3A 4O27B 3TKIA 4ENXA 3MJ2A 2QLUA 1QCFA 4RQVA 3W55A 2WMWA 4YO6A 4Y8DA 4YURA 3OT8A 3RGFA 5CQUA 4FKLA 3KKVA 4FX3A 1OGUA 3LJ2A 4FKIA 4AGWA 5IUGA 2CKOA 3E87A 1YWVA 5AAEA 2WTKB 5JSMA 4FA2A 2GQGA 5AP7A 3QTWA 4K33A 2CNQA 3BHUA 4RX7A 4ZMEA 3PWYA 4KRCA 4ACDA 3VUIA 3ZTXA 2C6TA 3RNYA 1P4FA 2DYLA 4ZLOA 3UO4A 4IX3A 5D1JA 2XIKA 4RJ8A 2HZ4A 5CLPA 2Z02A 5KMMA 1KE7A 3A8WA 1Q61A 2J9MA 3BV2A 3W2OA 3QF9A 2C0OA 5HU9A 5JH6A 1RJBA 3R7IA 4QRCA 2HYYA 3CXWA 2BRGA 5CAQA 4PDOA 3TN8A 3NSZA 2K0BX 4Q9SA 5DT3A 1JWHA 5JRSA 3LXKA 2JZ0A 3MMPA 4MEDA 4FOBA 4RJ7A 1XBBA 1YXUA 3QALE 4MXOA 4J53A 3E8EA 5K5NA 3UPZA 4XV1A 4RIWA 4BDHA 5E9EA 2O63A 3Q4ZA 5J8IA 3FWQA 1W83A 4GFOA 4FNZA 2LTUA 1AGWA 3QYWA 4FV6A 4BCIA 3JPVA 4GVJA 4XHKB 3UIBA 3NAYA 2YHVA 3GU6A 4ZTSA 1STCE 2I0EA 2YM6A 4BGGA 4K8AA 4QMPA 1BYGA 4LRJA 4ZTMA 3AC5A 3ENMA 1ZYDA 3L9LA 4DCEA 1Q8ZA 4TZRA 3TKUA 2I6LA 3E64A 4WNMA 2B52A 4OTQA 2QOBA 3R7GA 3NUNA 3VUDA 1WVYA 3LFDA 3NS9A 5DOSA 4ZTQA 3KXMA 1MUOA 3R1QA 4FSZA 3ZC5A 5LOHA 1PXIA 5E7RA 3H9RA 3P9JA 2OJ9A 4J98A 2XIXA 3MSSA 5C27A 1P3QQ 1DS5A 2YCFA 3O96A 3Q4TA 4GCJA 4WG3A 2VWUA 3LQ5A 4ANMA 3OHTA 4HVSA 3BQRA 5AV0A 4FIEA 2GFSA 3KXXA 2PVLA 3G9NA 4H1MA 5DBXA 4DLIA 3ZSIA 1PXJA 5CZHA 4HVHA 5JGDA 2P0CA 4YMJA 4IX5A 5CEIA 2B0QA 4BGQA 4DTKA 3LFCA 2XK3A 3FYKX 3MB7A 5BUJA 3FV8A 3TDWA 4NK9A 4GEWA 4NJ3A 3R71A 4XBRA 3FSFA 2PPQA 2HZ0A 1FQ1B 3TNHA 2PK9A 3MTLA 3UP7A 2REIA 3NUUA 2QKWB 4AW1A 3NNXA 2YLEA 3OG7A 5D7AA 1UWJA 4ACMA 4HVGA 3MPAA 5E4HA 3D7TB 4BTJA 1PXLA 2X9EA 2YCSA 3O50A 5IUHA 3NPCA 2P3GX 1UNGA 4K1BA 3V5QA 3SG8A 2A2AA 4TWPA 2ETRA 3EL8A 2BDJA 4BCKA 4YU2A 1VYWA 4QMTA 5ANJA 3HP5A 5I0BA 2OKRA 4IAAA 4RX8A 1ZYLA 5EM7A 1GZOA 4GFMA 2JDVA 2QOLA 3ZLWA 4PP7A 2R3HA 4FKGA 2NNWB 2UZWE 5EG3A 2XCKA 4W9WA 2IW8A 4CEGA 3QD3A 2BKKA 5HCXA 4YP8A 2GNIA 4FNYA 3G33A 3M11A 3CGFA 4ZSJA 4QP3A 5H3QA 3U9CA 2VTAA 2QOHA 1TQPA 2XEYA 4OTGA 5D7VA 2Y4IB 2PUNA 1OECA 3DBQA 1J7IA 2DAKA 3DDPA 2UZLA 3ZFXA 2L4EA 2BWBA 5KZIA 3ID6C 4EH9A 2GPHA 2FO0A 1SNXA 2ERKA 4IX6A 4RZWA 3PXRA 3AC2A 4ITHA 1Q5KA 3MW1A 5A9UA 2BAQA 5HBEA 3EFKA 4O0WA 4WRGA 5KHXA 4NM0A 4A7CA 3EYHA 4X6RA 4C3PA 1DAYA 4GU9A 4JT3A 3GC9A 4AP7A 4ASDA 2OH0E 2IWIA 2DZLA 3GFEA 4RJ4A 4BKYA 2GNJA 3E62A 1I44A 2C6OA 2LVQD 4FTTA 3SAYA 3V5LA 2JEDA 2QURA 5CT0A 2I7QA 3QUPA 3D9VA 4P5QA 4FV8A 4NIFB 4YSJA 3B2WA 3UBDA 4ZIMA 2VX1A 3D14A 4PWNA 2Z7RA 1OZ1A 3CBLA 4EORA 1XH4A 3HV7A 4RC4A 2C5NA 4X3FB 5CF4A 3QXOA 4RIYB 5HVYA 3DXQA 2B55A 3QCYA 4HPTE 5EM6A 1R3CA 3OWPA 5HNGA 2UW7A 1YWRA 4U8ZA 2BZKB 4FT7A 4B99A 4ZY4A 3QKKA 3TM0A 5AUWA 3GLIE 4I94A 4DINA 3BGQA 3FZPA 1U46A 5E8ZA 5LVOA 2UZBA 3HMIA 1H8FA 1ZOEA 2YIRA 3FQEA 4D55A 3HVCA 4GT5A 1REKA 4MNEB 4I22A 3QZFA 4NFMA 2WOUA 3S95A 4GT3A 3JXWA 2XM9A 4JG8A 1XHAA 3E3PA 2PL0A 5M4FA 4HPUE 3VS2A 2W0JA 3FMLA 4E8AA 1DV0A 3G5DA 4IWQA 4QYYA 3ETAA 4CT2A 4E1ZA 2OK1A 2EXEA 4HYSA 2CPKE 4IXPA 2CCHA 2DWBA 3ACKA 4L68A 3UVQA 3HAMA 1TVOA 3WOWA 5AM7A 4QP2A 5J9LA 3Q3BA 3OWJA 5CNOA 2XKCA 3SXRA 4WIHA 3DK7A 2W1EA 3MH1A 2Y8OA 2WZJA 1RE8A 5CEQA 1E94E 1FVRA 3TKHA 5GINE 4CG8A 3F3UA 3SHEA 2OICA 3DKCA 2JDRA 1TTEA 1OL7A 3CY2A 2I0VA 3HV4A 1XQZA 4PL4A 4MVFA 4KBCA 5CU2A 5EDQA 1UWHA 4OTHA 5KMJA 2V5QA 3C4ZA 4A07A 3LCUA 4WUNA 2VTJA 2R3PA 3FKOA 3VUGA 4G3EA 3U51A 2G2HA 2PE0A 4GK3A 3KCKA 5HO8A 4WT6A 4MCVA 2X81A 5LVLA 3U8WA 2CJMA 3MTFA 3MVHA 1H1QA 3OW4A 5BMMA 5LXMA 2GNLA 4CTCA 4YR8A 3IQ7A 1BUHA 2ZAZA 3LCSA 5KMLA 3DT1A 5KUPA 3N4UA 4GSBA 2VTNA 2KNZA 4XJ0A 4DITA 2J4ZA 2OXXA 2J51A 2XIYA 3VJNA 1XH7A 1IM2A 2JUJA 1KE5A 2BRMA 2BZIB 2QOIA 4BKJA 4BN1A 4JRNA 5J5TA 3UQCA 1FPUA 3QQKA 3FQHA 4GJ2A 4JBOA 4Q5HA 5CNNA 3ORXA 5CVGA 3LJ1A 5EW3A 4AG8A 5BVFA 2YJRA 3V5TA 2WTCA 4IWOA 2ZMCA 4OT6A 3UMXA 3L8PA 4EKKA 3OROA 3EN7A 4AFEA 4OGRA 4XG4A 4WP2A 4W4WA 3G6HA 5M07A 4V04A 5IA4A 3Q9ZA 3R8PA 2OJJA 2LVPC 1IEPA 3HL7A 3EQHA 3HUCA 4FTCA 3PY3A 2W9ZB 4C4FA 4D9TA 5FDXA 4ALVA 3P79A 3R73A 4U5JA 3R9HA 4PF4A 1G8SA 4MK0A 4FIJA 3SOCA 2XKFA 3FL5A 3QZIA 4DH1A 3RHKA 3P0MA 4PPCA 1JKSA 4CTBA 2WMAA 1JR3E 3ZO3A 4MXZA 5CVHA 2R3LA 2X6EA 3RNIA 3BCEA 5HTBA 3NGAA 3QGYA 5HBJA 4ZZMA 5C8MA 2C68A 3GC8A 5C01A 3FMKA 3F6XA 3R02A 4FKVA 4M0YA 2W99B 3TIYA 4F7NA 3UZRA 3BYMA 2DAMA 1URWA 1PKDA 1ZRZA 4RLKA 1J1BA 4QMOA 4E73A 3MBLA 4BYIA 5AAFA 2X2LA 3QUEA 5I5ZA 3O2MA 1E1XA 3OWKA 2PVFA 4OTRA 2XUUA 4FT3A 3AT3A 3COHA 3P86A 4HGSA 3RKBA 3TIZA 1UKHA 4IVAA 3ZONA 4JG6A 3UNKA 5TE0A 1WAKA 4L7SA 2NRUA 1XKKA 1R0PA 4ZOGA 3EFWA 3A61A 4XLVA 5AR2A 4ZEGA 4EWHA 3FHIA 3LPBA 2V22A 4IVDA 3FRHA 2R64A 1R0EA 3GXLA 4Y72A 3A7HA 5EYKA 4G6LA 4ZTHA 3SA0A 3UYSA 3NUYA 4QYEA 5ITAA 5A4TA 2WTDA 4QTAA 4DG2E 3PXYA 2RG6A 4RG0A 1H4LA 4FEVA 5IQCA 3R8ZA 1RQQA 2OF2A 3TZ7A 4FTIA 1YLAA 3R1YA 1XB2B 3FMNA 3QA0A 1OL5A 4EOJA 1Y57A 3KB7A 3ZBFA 4QMNA 3QX2A 3R2YA 4BDJA 3ORLA 1XR1A 2RKUA 4CKIA 4UBAA 3F69A 1H08A 3DU8A 4U6RA 2DQ7X 3WIKA 2JY5A 3PLAE 4FSMA 4I0SA 1QPEA 4ZJJA 5T3QA 5EYMA 3MS9A 3UZTA 4XG9A 2JP7A 5IMEA 3UOJA 2R3JA 4WNOA 4QYHA 1L8TA 2W9FB 3HV5A 3BHHA 3ZUVA 4RC3A 4ANLA 3R9NA 1HT1E 4F7SA 2F7XE 4BF2A 2R7BA 4F6UA 3RJCA 5G1XA 4AZFA 5J95A 2I40A 4FEUA 3TUBA 4O2PA 4DFYA 1MRYA 1OPKA 1Q02A 4C4IA 4GV1A 4EKLA 3NYVA 1Q8WA 5C4LA 5GHVA 2JIVA 3PG1A 4D5KA 4CLJA 3JUHA 2HAKA 4FSWA 3UNJA 3PUPA 2R3IA 2BALA 4F08A 4BDDA 4JR7A 1V0OA 2GNGA 2BFYA 4YBKA 3BWFA 3RAIA 3BIZA 2PSQA 4IFCA 2YIQA 4MXYA 2VTLA 3L9PA 3Q9YA 2O64A 5AR4A 1YI6A 3GC0A 3DBEA 3GC7A 3RM7A 3W2RA 2VO6A 2FSMX 5CYIA 4HZSA 4WOVA 5EYCA 2ONLC 3KL8A 5HG5A 5AUTA 4AX8A 1M17A 3CS9A 3O8PA 2EUFB 3TDVA 2Y4PA 3BBTB 4I23A 4FVQA 2H6DA 4NM5A 3QX4A 4L6QA 4DH8A 2IZUA 2BRHA 5HHWA 2QONA 3PYYA 2PMLX 3NUXA 3ZRMA 5E1SA 1SMHA 2XA4A 3BHYA 5AV4A 1Z5MA 1KOAA 4KIQA 3CE3A 2VU3A 4I5PA 4OBPA 2W4JA 5DRBA 1CTPE 4TTHB 4AE6A 3WF6A 3SDJA 3PIYA 2IW6A 4R7IA 3QQGA 3OCTA 3R8VA 5DMZA 1PHKA 4I0RA 3EH9A 4ALWA 4FODA 2CKPA 3K5VA 4GW8A 3REPA 3QQLA 3P4KA 3HDMA 1MP8A 4LG4A 5FM2A 4ID7A 1OIUA 4AT3A 4XOZA 3GEQA 4KKHA 3ZC6A 2OXYA 3RHXA 3HECA 3R21A 4FTKA 3I1AA 3ZM4A 2EXCX 2RFSA 3DZQA 2C1BA 2WTKC 2VV9A 3WZJA 5KE0A 4LGGA 3ZSGA 5FEDA 1SM2A 3ET7A 2X0GA 1WGLA 2CKEA 2W1FA 4O6EA 4EOLA 3C51A 3CPCA 4LUEA 4DEHA 2UZNA 4L53A 4Q2AA 4UY9A 5AFVA 2UW5A 4FBXA 5ETFA 5AR7A 5FTGA 2XJ1A 5DA3A 3WI6A 4BIBA 1Q8TA 3ORNA 5HO6A 2JDTA 3MYGA 4J52A 3FZRA 4KABA 3SG9A 4B9DA 4EZ3A 4KIOA 3UZPA 3VAPA 1OKVA 2W7XA 3NWWA 4BCJA 2R3KA 5EOLA 4C2WA 4FIGA 3MB6A 2QHOB 4MBJA 2CDZA 3U9NA 3MH2A 2QOFA 4TYGA 4D9UA 1NW1A 3ATSA 4EHEA 3R7YA 1UU7A 3WZDA 4O1OA 5GNKA 1H1PA 4ANSA 3TUDA 2GQRA 4CFNA 3G51A 4NIFA 4PY1A 3CY3A 3PP0A 2FYSA 2EB2A 3VIDA 4AZSA 4E4NA 2A1AB 2EVAA 4TNDA 4QMVA 2HWJA 4L67A 3IGOA 5HD7A 5I9YA 3MESA 2ITZA 1JVPP 2VO7A 4FGBA 3IKAA 3BX5A 4WKQA 1H00A 4AOIA 2BWEA 2CLQA 3IW7A 3FZOA 3UQGA 3HDNA 4AZVA 3ZS5A 2AC5A 2VTIA 5DWRA 1VEKA 5L6PA 4H58A 4JAJA 5M09A 5DEWA 3ZLYA 5HU3A 3KK8A 4NKAA 2Y9QA 3A2CA 4IBMA 3DFAA 2YFXA 4YZ9A 3ZH8A 1K9AA 2X7FA 5L2SA 2ZDTA 2IZRA 2RL5A 4PQNA 5E8YA 3COKA 3EN9A 3QBNA 3E8NA 3LHJA 4FKOA 4NW6A 4OW8A 1G5SA 1BX6A 3DNDA 5AA9A 4YO4A 3OTUA 4KA3A 5JFXA 3R7UA 1YOMA 2BDWA 5GJGA 2W5HA 2GHMA 4ITJA 4G3DA 3WARA 4K77A 4F7JA 4NKSA 3BEGA 3QU0A 1VJYA 2C5OA 4TYJA 3AC3A 3AGLA 4CFFA 5M57A 4GL9A 4E6QA 3PJ8A 5C8NA 3EQGA 1VQ1A 3FC1X 5KBRA 4BYJA 3ZZEA 2E2BA 5CU4A 2YZLA 3DBFA 4QQJA 5B2LA 3VW8A 2BIYA 4JRVA 2ZB0A 5KX8A 5LWNA 1PY5A 4BI2A 1SVEA 4U9AA 4BDEA 1WR1B 4G6NA 1QPDA 4CT1A 2JD5A 4CZUA 4RBLA 3HLLA 3R9OA 5CF8A 2JFLA 2R3QA 2UW6A 3HAVA 4CGAA 5EHOA 2NPQA 2X7GA 2RFDA 3TG1A 1ND4A 3V51A 1JSTA 1OB3A 3FMJA 4R7BA 3E8CA 3NNWA 4LV8A 4AACA 4FV1A 3QA8A 4X3FC 3BLQA 1VG5A 5EM5A 4D1XA 4I21A 3BBZA 4UZHA 1YI4A 2C5XA 5HD4A 2DI0A 2LVOC 3E7OA 4H3PA 3ROCA 4DC2A 2OW3A 2B9FA 4QMSA 4ZZNA 2JZ1A 3VHKA 2VGPA 3CC6A 3V6SA 5I4NA 5FM3A 1IRKA 5J5SA 1F4IA 3LM5A 4F63A 4R1VA 3VULA 2CN8A 4XYFA 5TOZA 4IC8A 1ZWSA 2CMWA 5M56A 4IMYA 4WD5A 5FEEA 3G9LX 3SOAA 3ZDIA 5A4CA 2C4GA 2YCQA 3E3BX 4H3BA 4A4LA 4CVAA 5H8GA 2OOAA 1OITA 3E63A 3OUNB 5E8TA 4BBEA 5LMBA 3KRJA 5IG1A 2YDIA 4YGAA 3MFRA 3ENHA 5AP4A 3VBTA 3WYYA 2VTQA 2WMTA 3CGOA 5B2KA 3I6UA 3RAHA 1LP4A 1XXHE 3F3VA 4P4CA 4D2PA 2ZOQA 3I0QA 1M7QA 3W16A 4EOMA 4ZTNA 4V0GA 5AP2A 1SNUA 3C0GA 5CSXA 2X4ZA 4M67A 3CKWA 4FKTA 3VS6A 3V5PA 4QMQA 5JT2A 4HVDA 3TTIA 5M51A 4IM3A 1SYKA 2E9UA 3CD3A 4J71A 4A9YA 3ZMMA 4LGHA 4D0XA 4YTFA 1NXKA 1BL6A 4ZAUA 5IEYA 4N57A 4ZMFA 2W4KA 1UVRA 3LW0A 1VDLA 5FXSA 4GU6A 4BL1A 3RAWA 5AUVA 4DEAA 3EQDA 3E7VA 3KA0A 4XRJA 4F1IA 2I1MA 3CTQA 2YM4A 4PMMA 2F2CB 2Z7QA 2HW6A 3BPRA 3P78A 3QRIA 4QO9A 4DG0E 5A4EA 3OOMA 4BY9E 1E1VA 2WOTA 3ZLXA 1YW2A 3R1NA 3DV3A 4EHGA 2OIBA 4CV8A 3BHVA 4LRKA 5D12A 4E3CA 2VTHA 5EHLA 5KKRB 3S00A 3QTZA 3WZEA 2AYPA 4F9AA 3TJCA 3Q4UA 1V92A 4FZ7A 2QR8A 4ZP5A 2VTOA 1Q99A 3G6GA 4J99A 4CFXA 4I5CA 3W2QA 3PXFA 5FXQA 2MGWA 4W4VA 2BZHB 1ERKA 3C1XA 1X8BA 4CQGA 5J7BA 2JKKA 4G3CA 1XH9A 4R3RA 4X2GA 5HEZA 3NYXA 3OCGA 4DFXE 4FZFB 2VN9A 4YC3A 2LAVA 4DHFA 1FVTA 2HWPA 4Z55A 4ANOA 3CTHA 2UW9A 3A7IA 5CTPA 2RF9A 4LFIA 4YZDA 5AEPA 3UP2A 4GS6A 1R78A 3CTJA 2QKRA 2UVYA 2BVAA 4FIIA 1UNLA 4L01A 4MKCA 2C6DA 4DEDA 4B8MA 4F9CA 3PWDA 4CQEA 4DEEA 2XCHA 3NZ0A 3RVGA 3I4BA 3T3VA 1U59A 2O25A 1M2QA 2GTNA 1APME 2WU7A 2YDJA 3RK9A 4DT8A 3AMYA 4GFGA 4X2KA 3EFLA 3EWHA 3CQUA 3QD4A 2WEVA 4IJ9A 5JQ5A 3BQCA 4XG6A 1H28A 4XG3A 1V0BA 5K9IA 4FOCA 3RAKA 1HJPA 1PMEA 5LCKA 4FEWA 3L9NA 4I6BA 4WO5A 4DF3A 3Q53A 1U54B 3AGMA 1BI7A 4QP9A 3GUBA 4QD6A 3TWJA 5HO7A 1Q24A 3GGFA 1LEWA 1EFUB 3HGKA 4N0SA 4O0SA 5CENA 4D2SA 3H0YA 5I9UA 4ZY6A 2NP8A 4QNAA 4XV2A 3NW5A 2JDOA 2W1HA 4FV7A 3VF9A 1OMWA 4U40A 5CS6A 2DKLA 4M12A 5ANGA 4C57A 2QHMA 5JRQA 4NT4A 5EDPA 2QOCA 3DLSA 3LXLA 4FG7A 5CASA 1PXPA 5D9HA 2C6LA 4EYMA 2YDKA 1NVRA 3NUAA 2OFUA 1OUKA 4O7TA 3NNUA 3R63A 2LGCA 4N6ZA 2J7TA 4RZVA 2ZJWA 2JY7A 3LFNA 4GRBA 2P55A 2X9FA 4D2VA 5TO8A 1ZZLA 2ZV8A 3DB8A 5EHYA 4R8QA 2LVAA 3EHAA 4H36A 5DLSA 5D41A 2X39A 3BV3A 5JGAA 4XS2A 3IS5A 2ESMA 2JFMA 4DFBA 2WQBA 4IJPA 3LZBA 3P7CA 4DGLC 1FBNA 3W8QA 4I20A 2QHNA 2ZTDA 1PXKA 2X8EA 2P2IA 3KREA 2B1PA 3EN6A 3MVJA 4JQEA 5IF1A 3LCTA 3QL8A 5IISA 4DGGA 3E92A 3Q60A 5E8VA 4FK3A 4ALUA 3KRLA 5IQFA 3CJGA 3D7TA 2OF4A 5F94A 4AGDA 4UMPA 4J96A 3VBXA 4BWXA 3NCGA 5J79A 4EJ7A 3MVMA 2I0HA 3UODA 4JR3A 3PSBA 1Q4LA 1QMZA 4FTOA 2F9GA 4ANBA 4XNEA 4AT5A 5AP3A 2ITYA 1WVWA 3HX4A 4LYNA 1ZXEA 5AAGA 5KMNA 4QYFA 4JDKA 1WGNA 2PMOX 3QC4A 5D11A 3VNTA 4C37A 4Z16A 5JQ8A 4BTKA 4JJRA 3SRVB 5CALA 3COIA 2C3JA 4W4YA 1YHSA 4I93A 3C4CA 4EOOA 1WZYA 3W2SA 3PXKA 4OBQA 4YJOA 4E4LA 4NFNA 2JAMA 4RSSA 5BUEA 5EQEA 4NTSA 1IR3A 3PP1A 4PPAA 4I41A 3TNQB 3DKOA 4YZCA 4F1TA 2ITNA 3GI3A 2GDOA 5KMIA 3NUSA 1P5EA 4FICA 4OT5A 3O8TA 4DGMA 4QQ5A 5IA1A 4IZAA 4CV9A 4E93A 5JFWA 2BRBA 4CKRA 5EQPA 1GIHA 3C13A 3W18A 5J9YA 4D4YA 4DBGB 2V62A 2YLFA 3DOGA 2WAJA 2AC3A 4HOKA 2BAJA 4NM3A 4YBJA 3OMVA 3VQUA 2WMRA 4E6CA 4QP1A 2ONLA 1SVGA 4DA5A 2UZEA 3OUKA 3BEAA 3E88A 1KV1A 4G2FA 4MX9A 4XBUA 1LUFA 2H5XA 4YJUA 1XH5A 2W96B 4NEUA 5FWKK 4F65A 4G31A 3KXZA 3C9WA 4RC2A 3WF7A 4D1SA 4DGNA 1KUTA 3LMHA 4O7NA 5HIBA 2R3OA 2GMXA 4YJRA 3GU5A 4L3PA 2PVYA 2UW0A 2OLCA 3BU3A 2CP8A 4B6LA 4RIOA 1OVEA 4FV0A 5HTCA 4O7ZA 1J7LA 3A60A 4BIDA 4I5HA 3EKKA 2QO2A 5A46A 3ZM9A 3F66A 2J6MA 4KSQA 3GNIB 5AUYA 2XNNA 4U41A 2IVVA 4CMOA 5IPJA 5FTOA 5L8JA 3IG7A 2XIRA 1GZKA 2GTMA 2ZVAA 4R5YA 4BDFA 3DB6A 4QTBA 5CANA 3C5IA 4PDYA 5E8XA 4KINA 1UNHA 1OPJA 3GVUA 4DH7A 2WO6A 3EB0A 3EMGA 2YABA 3IGGA 2E9OA 3UE4A 4D58A 5BUIA 5K4JA 4TYHB 3TT0A 5CAUA 3GT8A 3MIAA 3FLSA 5HLNA 5HX8A 5KMOA 2OZAA 1A48A 5FRIA 1ZOGA 5BMSA 4UN0C 4FSRA 4M15A 2XJ0A 5JFVA 3U6HA 3AT4A 2XNEA 1YXSA 4IX4A 1QPCA 2FSTX 4WSQA 1DO2A 1ZYCA 2JKOA 4GK4A 3M42A 1SZMA 4V0GB 3HMPA 3ALNA 4FEXA 3FE3A 5M08A 4F70A 2I0YA 2WIPA 3LMGA 3PRIA 5IA5A 2R5TA 4QT1A 1JKLA 1FMKA 2OFVA 3RP9A 4DFZE 3NRMA 4ZSEA 4E6DA 3HMOA 3RK7A 4AGCA 5L4QA 3HEGA 4ZLZA 4AA0A 2R3FA 4PTCA 3CLYA 1FINA 4AWIA 4I5MA 1KOBA 3U55A 5K0KA 3BU6A 4NUSA 1JOWB 2VNYA 5HE3A 1YXVA 1HT2E 4BHZA 3HRBA 4KBKA 4I4FA 3SXFA 1CKJA 2OO9A 3L8XA 4D28A 2Y7JA 3L8SA 3AC1A 3LXPA 5HG9A 5CZIA 3FY2A 2B7AA 2H8HA 4U79A 4O91A 4XV9A 4ASEA 5KKRC 2BKZA 5AA8A 5D10A 3F2AA 3IPHA 4ASZA 3DK3A 4MD9E 5DR6A 3OY1A 5HNBA 3OF0A 2WMBA 3OW3A 4C2VA 3JYAA 4F64A 5A54A 1H07A 4YLJA 4ANNA 4EBVA 2QU5A 5L2IA 3A8XA 1F5QA 2FGIA 3NW7A 4RFZA 3RMFA 2QD9A 2J2IB 4X6QC 5EW8A 5C03A 4YJVA 5FLFA 1ZZ2A 3QTRA 5HX6A 4Z7HA 3IDBA 4U7ZA 4IH8A 4BBMA 1CKPA 1TKIA 3DTWA 3RBWA 2F2UA 1ZY4A 4FKSA 4S2ZA 3PIXA 4RWLA 4PMSA 4XOYA 1DAWA 4BDKA 3NCZA 4C7TA 5A4LA 4F2LA 5ICPA 4CFMA 3R22A 2IW9A 4CD0A 2V7AA 3T9TA 2PVJA 2UVZA 2GQSA 5IQBA 4MXAA 3IW8A 1EH4A 3O23A 3FLWA 3BBWA 4IAIA 4PDPA 4AT4A 1R4GA 2JBPA 3LE6A 4GIIA 4YTCA 4EH8A 4UXQA 3MGYA 4GKIA 4GUEA 2J0MB 4NJDA 2P4IA 3BI6A 4OUCA 4PNIA 3U6JA 1XH8A 3WIGA 3ORTA 4FTLA 4E5AX 4O0VA 5E92A 2XK9A 2XNPA 3COMA 3G0EA 5TKDA 4HYHA 2DENA 3RPSA 5C4KA 3KXGA 5IQAA 5HTIA 3DJ6A 2BILB 3Q52A 4TYIA 2J90A 2PZPA 4QYGA 3K54A 2CCIA 1H0WA 3QC9A 1U54A 1XJDA 3ZCLA 3ODZX 5IQDA 5FG8A 3FC2A 5IU2A 3MH3A 4BTMA 3B89A 2XK4A 5EI2A 3ORKA 3FI3A 3P7BA 2YEXA 4PV0A 3UO6A 5AP0A 4ZJVA 2BR1A 4JIKA 4XP0A 5I9ZA 4GJ3A 2IZSA 5JEBA 2OJFE 4MXCA 5IZFA 3F5XA 1OL1A 4TYHA 5DFPA 4IW0A 5TR6A 2JIIA 4RA5A 3R00A 2C3LA 2YERA 3GOKA 2HY81 2G3QA 3R1SA 3FXWA 4O21A 2BZJA 3ORPA 1PYEA 1NY3A 1WBOA 4ITIA 4JS8A 2X1NA 1ZMWA 3QGWA 4CKJA 2EXMA 5T6KA 4MAOA 1KWPA 2OWBA 2QSFX 3QQJA 4H05A 2JY6B 4CMUA 2CN5A 2DAGA 3PSDA 2VWZA 2ITWA 2CGWA 3FZSA 4M0ZA 4M8TA 2EB3A 1GZ8A 2R3GA 2YACA 5HVJA 3TACA 4EL9A 3S1HA 2Z60A 2FSLX 3EZRA 5TF9A 1YI3A 2XMYA 3ZO1A 5CEKA 3Q2JA 4AW2A 2ZV2A 2V0DA 2R3NA 3R8LA 3VO3A 4M69B 4NW5A 4G17A 5CI7A 4QMUA 1Q3WA 2ITTA 2XM8A 3R0TA 4DAWA 5J1VA 3FZTA 4AU8A 4A06A 3FRIA 2NO3A 4BB4A 2X4FA 4Y83A 2C5YA 2VO3A 1DM2A 1WIVA 3TV6A 4XRLA 3R8UA 3TEIA 5EI8A 4O7RA 4FZDB 5DR9A 4YJQA 2NRYA 1H01A 4PL5A 5ANIA 5L8LA 3RZBA 5FGKA 4IZYA 4MD7E 3DKFA 2JLDA 2R3MA 4FE2A 1Y6AA 5M4CA 1HCKA 4L3JA 4USDA 3UNZA 3PPZA 4BCQA 4EJNA 5DVRA 5E8SA 1O6LA 5AADA 2O0UA 1OAIA 3EQIA 4FSQA 4EK5A 4MH7A 1T43A 4MYGA 5HE1A 3S3IA 4CXAA 2PYWA 1QL6A 4IM2A 3PPKA 1PMVA 3RCDA 2WEIA 4FC0A 5L2QA 2HXLA 4DG3E 3LCKA 2ETKA 1GY3A 4E7WA 2QO7A 3Q2MA 3DK6A 2R4BA 3CEKA 2OXDA 3A4PA 5BVNA 4IZ7A 4IM0A 2JBOA 1H26A 4G6OA 3K3JA 3EQCA 5C1QB 1I09A 4MF1A 4FEQA 3I7CA 5BYYA 4O7YA 3IOPA 3CR0A 4J8NA 1BKXA 3MH0A 3O0GA 3KU2A 2WTVA 4F9BA 3NDMA 4TWNA 4U80A 1VEJA 4FTMA 2Q83A 4NM7A 5KMKA 2DS1A 5ANDA 1O6YA 3V8WA 5KO1A 3ZUTA 5IA0A 3AMBA 3VBVA 5CU3A 2GS2A 4O81A 3QTIA 4DT9A 2YIXA 2VTRA 3F5PA 5A6OA 5B0XA 5KNJA 5E8WA 4FTNA 4U43A 4FNWA 4EHZA 5CSWA 2QOQA 3MY0A 4GEOA 4OTPA 4DFNA 3DBCA 4X3JA 3OBJA 3GCVA 4BBFA 2PWLA 1BL7A 4O2ZA 5CI6A 3VS1A 3KMWA 1PXOA 4KKEA 3BGPA 2QI8A 3VHEA 3IO7A 1G4AE 4AOJA 4YTIA 2O3PA 1OL2A 1B39A 2WMVA 4UALA 1Y91A 5AR8A 4AZTA 3PJ3A 5IH4A 4RPVA 4A4OA 1OIQA 3OWLA 4HCTA 5GZ9A 2VWBA 4ACHA 4ARKA 5EYDA 2O8YA 4FSUA 4DYMA 3Q04A 4ANQA 1ZARA 2VNWA 2A4LA 3LCVB 4YJTA 2ZM1A 3TXOA 4DN5A 5I9XA 2OZAB 3B2TA 2HENA 3LFBA 5JK3A 1PYXA 4PPBA 2W06A 2E9PA 3QAME 5CF6A 4LOQA 1P14A 3NAXA 4JIAA 3ZUUA 4B8LA 2HXQA 4JX7A 3C4FA 3BYOA 4E4XA 1PMUA 4YZMA 3W1FA 2XNBA 5EI6A 2GS6A 3MY5A 2LBCA 4KD1A 2OI4X 5HI2A 4WNPA 3O17A 2J5EA 3GU8A 5LMAA 1F0QA 2B9JA 2IZTA 1YDSE 3U87A 3NX8A 1W7HA 3OEFX 5JZNA 2W05A 3GQLA 5TT7A 2BIKB 5JN2A 5IKWA 2J0JA 1OTRA 4C3FA 5DIAA 1NA7A 2Y6MA 1WHCA 5AJQA 4GT4A 4YZBA 4TNBA 3OCSA 2VGOA 4U97A 2JIUA 4CZTA 3OP5A 2QC6A 4D2TA 3LFFA 1ZAOA 3ELJA 3ZHPC 1U4DA 1Y8YA 2ZDUA 3C4XA 4L44A 3RWQA 3ZO2A 4F9YA 5CQWA 5HICA 4LUDA 2P2HA 3I5ZA 4M13A 4FTQA 4IWPA 4R5SA 5EDRA 3C0HA 4ZY5A 1PXNA 2WD1A 3KC3A 3DXNA 1IG1A 3GQIA 2WTJA 4JLCA 1H1RA 3ODYX 2Q0BA 3Q6WA 4Q7JA 3MFUA 4TPTA 4YZNA 3PVWA 5CAVA 3V8TA 3QZHA 2QNJA 5HIDA 5F9EA 4EC8A 2PVRA 4QMZA 4FT0A 2ZYBA 2ITOA 3F5GA 2JAVA 4RFMA 4O7VA 1W98A 5FP5A 3FXZA 1A5TA 4EK3A 5AV1A 2UZUE 2XKDA 5DT4A 5M06A 4O86A 3WF5A 1CUKA 4Y95A 1IASA 3VS4A 3SLSA 5FDPA 2G9XA 1T46A 2RGPA 3R7VA 2KNVA 3QWKA 4AW0A 3OS3A 3F88A 5ACKA 2PMIA 3DXPA 1UV5A 2BROA 4QPAA 4MD8E 3UIXA 3RTPA 4O22A 2Z2WA 3UJGA 4G5PA 5CWZA 5BPYA 2PVKA 3AD6A 2XH5A 4G34A 5DN3A 1WBVA 4ZXTA 5AR3A 3VVHA 3RALA 1ATPE 1PMNA 2BFXA 2CHLA 3P5KA 4FKQA 3MJ1A 1RW8A 3CSVA 1FVVA 3OFMA 1BVSA 3FSKA 2BMCA 4GKHA 3QZGA 4U3ZA 1BI8A 3DZOA 2EKKA 4PX6A 3K9PA 5LQFA 3CPBA 3FY0A 4RWJA 3DCVA 4AW5A 4B7TA 1H1WA 3UOHA 4H39A 3F2NA 2DNAA 5IQGA 3D94A 4BI0A 1REJA 5L6OA 5LMKC 1OKZA 3UTOA 3THBA 3F7ZA 5DT0A 2HIWA 1GJOA 2VTMA 3C50A 3EQFA 3K5UA 5DI1A 5AIRA 4BIEA 1U5RA 2W17A 3QTUA 3Q5ZA 4MWHA 3EOCA 3VWAA 4BZOA 4ACCA 3I60A 3D7ZA 1NV8A 1ZY5A 5DPVA 4BZDA 5HNIX 4N70A 2H34A 4JOAA 5BVWA 3R7EA 2XNOA 4XG2A 5HOAA 3VUMA 4BGHA 3QCXA 3Q96A 5H8BA 4E5BA 3OZ6A 4U44A 4Y85A 3MA6A 3B8RA 5GIPE 4LQMA 4L42A 2BTRA 2OJIA 4OTDA 3OVVA 2XNGA 5HLPA 5AWMA 2GFCA 2WKMA 4R6VA 5BVEA 2YIWA 2CGXA 4PRJA 2C6IA 1OIRA 4JVGA 2ITUA 3VUHA 4QP7A 4F4PA 1NVSA 3DTCA 3WZUA 2OSCA 4AZWA 3POOA 2K9DA 1KSWA 2EU9A 2ZTCA 3OT3A 3QWJA 3W8LA 5CT7A 4W4XA 5H2UA 3D5VA 2Z7SA 4O0UA 2OG8A 3QHWA 4NYEA 3V04A 4QTCA 2C5VA 3KN5A 1YDRE 3D2KA 2WQMA 1YKRA 2ERZE 3E93A 3UYTA 3O7LD 4G3OA 2WQEA 3NEWA 2XF0A 1WVXA 4YPDA 5AP1A 2VWYA 3I79A 1TQIA 4OAUC 4S30A 4FTUA 3I81A 1WBNA 5AV3A 4F1MA 2A0CX 2WFYA 3ORMA 3OY3A 4HCUA 5IH5A 4FNXA 4NWMA 3FKNA 5A14A 4EZ5A 1J3HA 3EIDA 3VJOA 5AP6A 4FK6A 3GU4A 2GHLA 3IHPA 1WMKA 2VWVA 4PTGA 4KIPA 3FUPA 4GG7A 1QPJA 3JVSA 1NT2A 3I0OA 3MVLA 3NYOA 4QP8A 3NLBA 3QQUA 2WTIA 4AUAA 3PY1A 3OBGA 4IDVA 1ZYSA 4QMMA 4R7HA 3LFEA 5CSHA 3ZU7A 4UYAA 4XG8A 2O65A 3B8QA 3FQSA 3KULB 4CG9A 2W1CA 4X0MA 2VTTA 3UVRA 1K2PA 4USEA 4ZZOA 5AV2A 4CRSA 3QLFA 4O0TA 5AP5A 1JAMA 4D4SA 4QTEA 3LFSA 3PVBA 3NVMB 3AD5A 4D2WA 5CX9A 2H96A 4A4XA 4EEVA 2JKQA 3WE4A 4ORKA 2EJSA 4L52A 1H0VA 5L6WL 3O71A 4AN3A 3AD4A 4HGLA 3QKMA 2WPAA 2QOKA 1NV9A 4I6QA 4IFGA 4R1YA 5ANKA 4H1JA 2F49A 3LOKA 4FI1A 3DAEA 4M84A 4BICA 3L1SA 3G0FA 4L9IA 3HMNA 3FPQA 5H8EA 4PNKA 2RFNA 1R1WA 1ZLTA 4AFJA 2ZM4A 4F0GA 2JNHA 2VWXA 4FIHA 4FUYA 3MN3A 4GIHA 4YJNA 3U54A 4DBNA 3TZ9A 3UG1A 4QMWA 3F3WA 3VBYA 2HW7A 1CMKE 3I6WA 4FL2A 3N4VA 3K3IA 3NIZA 3E46A 3GCSA 4K0YA 5FTQA 5GJDA 1M2RA 3OD6X 5EW9A 3R28A 2G2FA 4AS0A 3FMHA 4JG7A 2F57A 2WIHA 5ANEA 4JDHA 4QMXA 2OJGA 4HGTA 3SRVA 3IW4A 4KIKA 4ZLYA 1R39A 4ONAA 1LPUA 2YAKA 4I3ZA 1IA9A 4RJ3A 4QPMA 3GCQA 3A7JA 4QQTA 3OOGA 1WCCA 3DS6A 4XMOA 3RM6A 4FF8A 4UEUA 4UXLA 3CQEA 5HE0A 4F0FA 3BGZA 2OH4A 5ANOA 4EH4A 1O6KA 4IE9A 4L46A 4B4LA 2EWAA 5GZ8A 5C8KA 3CIKA 2ITVA 2R9SA 1FMOE 3TZ8A 5EKNA 1HOWA 4CMTA 4ZSAA 2FA2A 4BHNA 3CQWA 5JFSA 4C58A 4N6YA 4K2RA 4FGRA 4Z7GA 3RCJA 2YM7A 4Y5QA 3NR9A 5G6VA 5DRDA 3DJ7A 4DTBA 2CNVA 3F7WA 3DQWA 3C4WA 3DNEA 2GSFA 1P4OA 4O7LA 3ZBXA 3BHTA 4O0XA 1YWNA 2VX0A 4YLKA 2PVNA 4BCPA 4J97A 5IH6A 3MPTA 3OTVA 2W1IA 2KHHA 1H1SA 2UV2A 2X7OA 3WBLA 3G15A 3U6IA 3CCNA 1ZMVA 1W0XC 5EKOA 5B2MA 5HESA 2V7OA 3ZLSA 3GCUA 3PXQA 1FOTA 1V0PA 4I92A 4U42A 3SVVA 3NMUF 4UMUA 3EL7A 4EOPA 2B9HA 4FZ6A 4C8BA 1CDKA 2O5KA 3SW7A 4LL0A 2OU7A 4EYJA 1KE8A 4FL1A 2PU8A 2QCSA 3C7QA 4DFUA 3BYUA 5GIOE 3HV3A 4NH1A 2J0LA 4P90A 4FVRA 5FBNC 3ZEPA 2BRNA 4FKPA 3W32A 3FI4A 1M14A 3R01A 5HORA 4BTFA 1DI9A 1YVJA 2GNFA 5J7HA 2Y4IC 3UOKA 1Q62A 4BDIA 2PY3A 1HCLA 2R0UA 1YDTE 3PSCA 1Q8UA 4M66A 3UG2A 3AQVA 4F6WA 2VD5A 3D83A 4QOXA 3PZHA 1TQMA 4BVUA 2Y6OA 2JY8A 1DI8A 3UO5A 3VS0A 1IAHA 3H4JA 3FKLA 4HZRA 4O6LA 3N9XA 4RVTA 3TNPC 3K9OA 3KK9A 4YHTA 4C4JA 4IAKA 3PJ2A 4IVBA 5E1EA 1WBTA 3ACJA 5CAOA 3WILA 2HZNA 2XP2A 3KY2A 4RLLA 5ETAA 2QO9A 3A99A 2WU6A 5DHJA 2YM8A 2ITXA 3V5WA 4D5HA 2GCDA 3QUDA 4I0TA 4X7QA 3WZKA 4ENYA 1IXSA 1YOJA 3SC1A 4ERWA 4J8MA 4OBOA 5CY3A 5M55A 4EK4A 3IK3A 2IG7A 2FSOX 4LM5A 3KQ7A 5IA3A 5HCYA 3FI8A 3VRZA 2QG5A 4EOKA 2UZOA 4XV3A 5L8KA 3SKCA 1OL6A 3TNWA 4DLJA 3HA6A 3FMEA 4JDJA 4YNOA 4GMYA 4F0IA 2BUJA 2B3TA 4FV2A 3FLNC 5ETIA 2Z7LA 1ZYJA 4RIXA 2IN6A 3GB2A 2HK5A 3C5UA 4FZAB 3W33A 3VW6A 4TN6A 4AF3A 1VZOA 5I3RA 4O84A 3S0OA 1UU8A 4ZK5A 4LOOA 5ACBC 2C6EA 3E5AA 5BX0A 2X2KA 5HLWA 2OIDA 3FL4A 1GIJA 4KNBA 4GUBA 1S9IA 4QQCA 3F9NA 4TXCA 3UC3A 1OBDA 4RA4A 2BTSA 5FBOA 3KXHA 3MA3A 3SQQA 4WSYA 2R3RA 1MRVA 4CLIA 5LVPA 4FTJA 1W8CA 4O1PA 1UA2A 5CEOA 3PJCA 5AM6A 5GZAA 4FTRA 4JX3A 3FDNA 4G1WA 4U81A 3AG9A 2C0TA 2L2DA 4HNIA 3V01A 4M3QA 2RFEA 1PGYA 1OKSA 4KKGA 3KCFA 3AOXA 1WBSA 3MPMA 1H24A 5DGZA 3WF8A 3UVPA 4F99A 2R2PA 4GYGA 5DFLA 3D5XA 2BHHA 2C30A 4W9XA 4FMQA 3FMDA 3H0ZA 3DGKA 1PW2A 3FXXA 4G9CA 3R30A 3RI1A 3HRFA 1CM8A 5FD2A 4YJPA 1PF8A 1JBPE 5FQDC 5I9VA 3SV0A 4MBLA 2B4SB 4FT9A 3KVXA 3R2BA 3TV4A 3BRBA 3R7OA 1QZEA 4EHVA 4CFVA 2HY0A 3DJ5A 3ZXZA 4BZNA 4U0IA 4YNEA 3SGCA 3PRFA 4XH6A 4BCFA 2IJMA 2JDSA 3O8UA 3Q6UA 3H10A 3H9FA 5J1WA 2BCJA 2GNHA 1TR8A 2XS0A 2PZYA 2XBAA 3QD2B 4K6ZA 4C62A 1NVQA 3POZA 4PL3A 4BCMA 1Z57A 3LCOA 4FT5A 5K4IA 1XH6A 2QR7A 2QU6A 4IEBA 4FIFA 2WELA 4FV3A 2L4FA 4DBXA 4KAOA 3EN5A 3KFAA 2QODA 4G9RA 3UMWA 4A9TA 4HYIA 2PE2A 4CCUA 4EQUA 4IAFA 3DDQA 3QCQA 4M7IA 5L2TA 4KBAA 3F82A 1S9JA 4PUZA 4G3GA 4HVIA 1Q41A 3NIEA 3EN4A 3VUTA 4KUJA 3PXZA 4IIRA 3KULA 3IDPA 3UOLA 2PUPA 3EKNA 3PVGA 4R78A 3ANQA 3H30A 4IZ5A 3PA4A 3SW4A 3ERKA 2WMXA 4JQ7A 1W82A 5CEPA 4GYIA 2UZDA 3DFCB 4HGEA 2C3IB 3V8SA 2SRCA 4FSNA 5EFQA 3ZOSA 1YQJA 4XCUA 1JKTA 3D0EA 3BU5A 3F61A 1Q8YA 3ZRKA 2XKEA 2C6MA 3V5JA 2PUIA 4QPSA 3P23A 3CD8A 3FZ1A 3KMUA 4F9WA 2A27A 4CNHA 5HVKA 3WYXA 5AR5A 4KS8A 3ZSHA 4BDCA 2HCKA 2PMNX 4A9UA 2PVMA 4DH5A 2V55A 1AQ1A 4BR3A 1CSNA 4F6SA 1UU9A 2JGZA 3OEZA 3BELA 3Q9WA 5M4IA 1IA8A 2X8IA 5FEQA 4APPA 2CLXA 5KHWA 3I5NA 5CXHA 2C6KA 3UC4A 4UMRA 5BQ0A 4EI4A 2F4JA 3VRYA 2UW4A 4EUUA 2PHKA 2XRWA 2QLQA 3HKOA 3AC8A 4IB3A 1LR4A 5KZ0A 1FGKA 4NU1A 4FV5A 3T8OA 2W4OA 4Y46A 5JKGA 2HZIA 4BCGA 4O7WA 3F92A 1XWSA 4E26A 2JKMA 3C0IA 4B0GA 4C4EA 3QQHA 4HNFA 3R04A 5CSPA 4D4RA 4RQKA 1XBAA 5C9CA 3G2FA 4KRDA 4M69A 3FPMA 3VUKA 2VTSA 4NTTA 3TCPA 1U5QA 4JXFA 1VYZA 3VS5A 4AN2A 4YPSA 2W1GA 3PY0A 3KF4A 4MXXA 4NSTA 5AUUA 5LWMA 3TUCA 3GENA 4MBIA 5LJJA 3DLZA 5HE2A 5A6NA 3PA5A 4HJOA 4K9YA 4JBQA 5AUZA 5KBQA 2PULA 3QRKA 2CWBA 2XK7A 5BVOA 3QYZA 5H9BA 2PTKA 2YCRA 5F1ZA 5IDNA 1XBCA 3H3CA 4JBPA 4EH7A 5CF5A 2IVTA 2WQNA 4IDTA 4AGUA 3HYHA 3F3TA 4FV4A 5M4UA 5IQEA 3WE8A 3Q32A 4EWQA 4X2FA 3MY1A 1M7NA 4M97A 2VUWA 1JSVA 2PZIA 1YOLA 4Q9ZA 4Z3VA 3KGAA 3LFQA 3DA6A 2YJSA 3DY7A 3LQ8A 2W5BA 4LOPA 5HKMA 4D0WA 4XUFA 5JMSA 3IDCA 3QRUA 4UV0A 4USFA 2VX3A 2PZRA 1PXMA 4L8MA 4YSMA 1WJ7A 5BYLA 3FMMA 2YIYA 2XNMA 4IB0A 3FLYA 4XLIA 3N4TA 4QTDA 4J95A 1YRPA 2DAIA 2HELA 4FSTA 3UIMA 3QXPA 4DTAA 2WB8A 4IQ6A 2G1TA 2VO0A 3PTGA 1WBWA 4RX9A 5CXZA 3BYVA 4IWDA 4CZYB 4I1ZA 3PPJA 2W1DA 4TT7A 4YHFA 3RPRA 1LEZA 2RSVA 4A9RA 2JC6A 3QD0A 2XZSA 3M2WA 3NVKI 3C4EA 5AUXA 2UZTA 2XB7A 3ULZA 1YHVA 4ERKA 3ATTA 3VF8A 5F4NA 4IB1A 3Q4CA 5DNRA 3ZFYA 4FG8A 2J0KA 4LRMA 2VZ6A 5K5XA 4RT7A 4XEYA 5E91A 4D1ZA 1Q97A 4TKSA 4C34A 4RJ6A 2UVXA 1OI9A 4UB7A 3RZFA 2VWIA 3RINA 4FYOA 4AXAA 3F2RA 4X2JA 2XYNA 3ZFMA 3GLGE 3W2PA 5FP6A 1GNGA 4MNEA 5J87A 4FUXA 4FYNA 3G90X 3EQRA 3W10A 5K3YA 2C69A 1MQBA 4ZJIA 1ZV1A 3KF7A 4FVPA 2RG5A 3BE9A 2WNTA 3PE1A 4NCTC 2Z8CA 4Z9LA 3QTSA 4IB5A 1JQHA 3II5A 3NNVA 2YITA 3AC4A 2X2MA 4TW9A 4EC9A 2X8DA 1MN3A 4MWIA 2ZV7A 5L2WA 1J91A 4IAYA 4BDAA 3AXWA 3L9MA 4LV5A 3LFAA 4Q5EA 2G15A 3EQBA 3KVWA 4CCBA 2RIOA 2XK8A 5HCZA 3BLRA 3H9OA 3V6RA 1M2PA 1C7YA 3ORZA 5EOBA 4C59A 2C0IA 4GH2A 3TI1A 1JNKA 1KE6A 1VEBA 4FKUA 5FXRA 3R83A 4R71A 1PRYA 3NUPA 2MR9A 4IADA 4WHZA 5L3AA 1WBPA 4KSPA 4UMQA 4GG5A 4M14A 4GVAA 3Q5IA 3BLHA 2CGVA 2WMQA 3BZ3A 5AX3A 4K18A 3PDTA 3ZEWA 3DAJA 4K11A 3HRCA 2PZ5A 3PZEA 4MNFA 4UWCA 2A19B 4FL3A 4CYJA 4HYUA 4RWIA 3TL8A 2J5FA 3IECA 4YJSA 3UPXA 5M53A 2QG7A 4J1RA 2LVNC 4OTIA 4TWCA 3U4WA 4L00A 3OXTA 4TRLA 5AIKA 5LMKA 3GCPA 4W8DA 1GAGA 1H25A 2UW3A 3KEXA 4TYEA 3S4QA 5M44A 3LLTA 2WQOA 4LGDA 4WRSA 3U4UA 4L45A 3KRXA 3LM0A 4IACA 5T68A 5HQ0A 5IQIA 2WHBA 5IQHA 4N4SA 1WFCA 3K2LA 3QTQA 2FVDA 2WMSA 5K0XA 4L7FA 3A62A 2X6DA 5IEVA 4KIKB 3KN6A 5CSVA 2QVSE 3VBQA 4XG7A 4YUQA 2HOGA 4CYIA 4D4VA 2KTYA 1P2AA 2XIZA 2YM5A 1JPAA 4JAIA 3LXNA 4MF0A 1W84A 4S33A 1IFYA 5EM8A 2YM3A 3VS3A 4WBBB 3MV5A 2DAEA 2XJ2A 4V05A 5HG8A 5KCVA 2DUVA 4W8EA 2BPMA 3QRJA 1Z9XA 3PLSA 4R77A 3IOKA 4C61A 5LVNA 3TNIA 3MWUA 5CU6A 1AD5A 2PVHA 4AZEA 4YC8A 2PE1A 3CJFA 3R6XA 3Q9XA 3JS2A 5EK7A 3VQHA 4PMPA 4S32A 4ACGA 5BNJA 4EOSA 4FKWA 4PDSA 4UZDA 4CSVA 4BWKA 4E5WA 4IHPA 2XK6A 1CKIA 3MFSA 3D5WA 1H27A 4HCVA 4X3FA 2VWWA 4R3CA 1T45A 2F7ZE 4IVCA 2E9NA 4JBVA 3UDBA 4EOQA 4F09A 1URCA 4EONA 1K3AA 4EUTA 4F7LA 2IVUA 3SXSA 5E8UA 4OTFA 3FJQE 4FR4A 3PA3A 1UFZA 2QQ7A 3QQFA 5A4QA 2WMUA 4LL5A 4O0YA 4RVLA 1V1KA 3GOPA 4FSYA 4KB8A 2UZVA 3QCSA 4WG4A 4C3RA 4WBOA 4BC6A 4E20A 5IDPA 1HQYE 2F7EE 2XEZA 5AMNA 5ETCA 4EK8A 5IA2A 3KXNA 3HP2A 1GO5A 3HV6A 3LVPA 4WNKA 3BE2A 1UKIA 2BAKA 3JY9A 2VTPA 3GBZA 4M68A 5IUIA 4EOIA 3FEGA 2P33A 2CNUA 2ACXA 4FG9A 1T6OA 4G3FA 4RFYA 1IAJA 3LMIA 1G8AA 4DCAA 2H9VA 2OO8X 4RMZA 2VAGA 2MJ5B 3GP0A 4QP6A 4R3PA 4C35A 1L3RE 2QOOA 5JI2E 3EQPA 3DQXA 3HZTA 4RVMA 4APCA 3ORIA 4C33A 3R9RA 2FH9A 3RWPA 1KE9A 3ALOA 1OPLA 2G2IA 4FKJA 4G5JA 1A9UA 3SX9A 4JQ8A 1A06A 2G01A 4IANA 3TJDA 5DH3A 5DEYA 4HEOA 5JGBA 4IAZA 1F3MC 3LJ0A 2W5AA 4DEBA 3RPVA 1ZOHA 3FLQA 3KMMA 4G16A 4RIWB 4FTAA 4DEGA 4I24A 3QHRA 5HIEA 3LLAA 3JY0A 4ASXA 4AOTA 4L3LA 4X21A 1PJKA 3JR1A 3P08A 3IONA 3OXIA 3WF9A 4C02A 3DBDA 3T9IA 1J7UA 3ZDUA 1O9UA 4H3QA 5CU0A 4QP4A 5DG5A 5EH0A 5C26A 1Q3DA 1J1CA 4O83A 4UWBA 4EH5A 3O7LB 3QFVA 3KRWA 4P7EA 3UGCA 4BI1A 5FUTA 1OKYA 1OKWA 3D2IA 3ZXTA 4NZWB 3MI9A 4RWKA 3PE2A 4AA5A 4E6AA 4UX9A 4U45A 2OZOA 3VC4A 3A4OX 5HZNA 1FGIA 4ZS0A 4EH3A 5DYJA 2R7IA 3A7FA 1RDQE 3M1SA 1DO0A 3D5UA 3PG3A 4QMLA 4KWPA 5CAPA 3L8VA 2BHEA 4QNYA 4ZSGA 4ZTRA 3I7BA 4UN2B 2R0IA 3QKLA 5GJFA 3QLGA 4C38A 4O7SA 4UMTA 3CP9A 5F20A 4O82A 4FV9A 2BDFA 4IC7A 4S34A 3A7GA 4BCOA 3GLFE 4LMNA 5A3XA 1G3IA 3T3UA 1GOLA 2FUMA 4O38A 4OR5A 4O96A 2B9IA 4AQCA 4AAAA 3T6PA 3HMMA 1MRUA 3PFQA 2J0IA 4PP9A 2XRUA 4DFLA 3NW6A 4TWOA 4CFWA 4Y73A 3UIUA 2ZM3A 3FBVA 4EQCA 3EFJA 2EKFA 4YLLA 2C3KA 3V3VA 2KNAA 3ZO4A 3ZYAA 4EQMA 3FYJX 3JVRA 2XVDA 4P5ZA 2MROB 4FKRA 2XBJA 1OQYA 5CVFA 4JDIA 3N51A 5BVKA 3IW5A 2C1AA 4OLIA 2UW8A 4RRVA 5HBHA 1OBGA 5LVMA 3TTJA 3QTXA 4BFMA 3D4QA 2B54A 1B38A 3RPYA 3ZRLA 3F3ZA 4Y5HA 4JNWA 4UYNA 4AE9A 4EZ7A 2YWPA 4P2KA 2PUUA 3TZMA 4UWYA 2RRUA 5BYZA 2WXVA 4CRLA 3EJ1A 2HWOA 1OIYA 3BKBA 5IMXA 3MDYA 2OIQA 3GLHE 4C36A 1GZNA 3LCDA 4BCHA 4E4MA 4EK6A 4HW7A 2C47A 2KULA 5DE2A 4F1OA 3DPKA 1MQ4A 1G3NA 4S31A 4XX9A 2YA9A 2IO6A 4YHJA 4WG5A 4PMTA 5DR2A 4TL0A 2GS7A 3KRRA 4DGOA 3RPOA 3P7AA 2GHGA 5HG7A 1BMKA 1VEGA 1Y8GA 4JL9A 3TV7A 3O51A 2YWVA 3HA8A 3P1AA 2XYUA 2GU8A 3RK5A 1JSUA 4ZSLA 5I9WA 1XO2B 5J9ZA 1Y6BA 1BLXA 3AMAA 1G41A 3OCBA 3NYNA 4ZS4A 4L43A 4RJ5A 4ZTLA 1E9HA 3EYGA 3LQ3A 4NCTA 3ROYA 4LMUA 3DKGA 3VN9A 4EBWA 4EH6A 3FAAA 2E9VA 5CEMA 3UQFA 3SD0A 1AIPC 5F95A 5JZJA 3R8MA 3FI2A 4RGJA 2CGUA 3W2CA 4C4GA 4C4HA 3BYSA 4CFUA 4I4EA 5LCJA 2YZAA 4MQ2A 4DE4A 4I6HA 4WA9A 3HNGA 4YTHA 4U3YA 2OBJA 3DAKA 4WUAA 5HGIA 2OOBA 4C0TA 3FHRA 2YN8A 2Q0NA 5B7VA 1B6CB 1VR2A 4BDBA 1PKGA 3BWJA 2ZMDA 3OXZA 4RX5A 2CKQA 2DHYA 4XP3A 4JI9A 2ITPA 1JLUE 4MTAA 2JITA 1OUYA 2UUEA 3GFWA 3VS7A 4NL0A 3PJ1A 1SVHA 3LIJA 3IW6A 4RIYA 4BKZA 4DEIA 3D15A 2WTWA 4RIXB 2ZB1A 4J7BA 3QRTA 4KS7A 4MHAA 3S2PA 3HUBA 2O2UA 1GIIA 4I6FA 2WGJA 4BCNA 3PVUA 4BRXA 2ITQA 4XP2A 4YC6A 5LARA 4GK2A 3OC1A 2J50A 1YXXA 3GU7A 2CSNA 1YXTA 4LI5A 2Y0AA 3R9DA 4EH2A 1OM1A 3ZZWA 4QMYA 1KV2A 4II5A 4RVKA 2OGVA 4MQ1A 2W1ZA 5I3OA 4V01A 4PTEA 4TY1A 3MFTA 4X2NA 5IEXA 1UU3A 4O0RA 4AA4A 2ETMA
chains in the Genus database with same CATH superfamily
2IVSA 1JKKA 1ZMUA 3EZVA 3MIYA 3PIZA 5EQYA 4AN9A 2FFJA 2B53A 4D2RA 2VRXA 2ZV9A 4OAVB 4MUQA 4L8RC 2E5LM 2AUHA 3FLZA 3CKXA 3ITZA 3LKMA 3F5UA 3AT2A 4OTWA 3E21A 3E8DA 1OFIA 5BVDA 1KYIA 1YHWA 2YISA 5AX9A 2WSEF 4BWPA 4BDGA 2FB8A 4A9SA 2IPXA 1SG9A 2YAAA 3LAUA 3ULIA 3VBWA 4IBJA 2RGHA 1M52A 5E90A 3ANRA 4DH3A 4O27B 3TKIA 2JA2A 4ENXA 3MJ2A 2QLUA 1QCFA 4RQVA 3W55A 2WMWA 4YO6A 4Y8DA 4YURA 3OT8A 3RGFA 1J5EM 5CQUA 1L1TA 3KKVA 4FKLA 1OGUA 3LJ2A 4FKIA 4FX3A 3GQ3A 4AGWA 4LZZA 5IUGA 3E87A 1YWVA 4MB7A 5AAEA 2CKOA 4GRIA 2WTKB 5JSMA 2X4AA 3HJ8A 2GQGA 4FA2A 1IXSB 5AP7A 3QTWA 4K33A 1TFFA 2CNQA 3BHUA 4RX7A 4ZMEA 3PWYA 4KRCA 4ACDA 3SAUA 3VUIA 4C3RA 3ZTXA 2C6TA 3RNYA 1P4FA 2DYLA 4ZLOA 3J81S 3UO4A 4IX3A 5D1JA 2XIKA 4RJ8A 2HZ4A 5CLPA 2Z02A 1QZMA 5KMMA 1SXJA 1KE7A 3A8WA 1Q61A 2J9MA 3U6CA 3BV2A 3QF9A 2C0OA 3W2OA 5HU9A 5JH6A 1RJBA 2XFTA 3R7IA 4QRCA 2HYYA 3MK6A 2BRGA 3CXWA 5CAQA 4B08A 4PDOA 3W0OA 3TN8A 3NSZA 2DWZB 2K0BX 4Q9SA 5DT3A 1JWHA 5JRSA 3LXKA 2JZ0A 3MMPA 4MEDA 4FOBA 3B7QA 4RJ7A 1XBBA 1YXUA 3QALE 2CHVA 4DV1M 4MXOA 4J53A 2DWLA 2Y20A 3E8EA 5K5NA 3UPZA 4XV1A 4RIWA 4BDHA 4OU7A 2O63A 3A98B 5E9EA 3Q4ZA 5J8IA 3FWQA 3FTDA 1W83A 1IBMM 4GFOA 3QYEA 4FNZA 2LTUA 1AGWA 3QYWA 2V1CA 4FV6A 4BCIA 3JPVA 4GVJA 4XHKB 3UIBA 3NAYA 2YHVA 3GU6A 4ZTSA 1STCE 4DR7M 1W2DA 2I0EA 2YM6A 3QYBA 4BGGA 4K8AA 4QMPA 1BYGA 4LRJA 4ZTMA 3AC5A 3ENMA 4GKJM 1ZYDA 5KO3A 3L9LA 4DCEA 1Q8ZA 4TZRA 3TKUA 2I6LA 3Q8GA 3E64A 4WNMA 2B52A 4S12A 4OTQA 1TH3A 2QOBA 1IY1A 3CGWA 3R7GA 3NUNA 4FVMA 1WVYA 3VUDA 3LFDA 3NS9A 5DOSA 4ZTQA 2C9CA 1Q3BA 1MUOA 3KXMA 4DEDA 3R1QA 4FSZA 3ZC5A 5LOHA 1GL7A 1PXIA 3H9RA 3P9JA 2OJ9A 4J98A 2XIXA 3MSSA 5E7RA 1P3QQ 5C27A 1DS5A 2YCFA 3O96A 3Q4TA 3SFZA 4GCJA 4WG3A 2VWUA 3LQ5A 4ANMA 1NHGC 3OHTA 4HVSA 4XGIA 3BQRA 5AV0A 4FIEA 4BJJB 2GFSA 3KXXA 2PVLA 3G9NA 4H1MA 5DBXA 4DLIA 4NXMM 3ZSIA 1PXJA 2Y0QA 5CZHA 4HVHA 5JGDA 3NFFB 2P0CA 4YMJA 4IX5A 5CEIA 2B0QA 2QENA 4BGQA 4DTKA 3LFCA 2XK3A 3FYKX 3MB7A 3B9PA 3FV8A 5BUJA 3TDWA 4NK9A 4GEWA 4NJ3A 3R71A 3RFWA 3FSFA 4XBRA 2PPQA 2HZ0A 3L26A 1FQ1B 3TNHA 2VDBB 2PK9A 3MTLA 3UP7A 2REIA 3UK6A 3NUUA 2QKWB 4AW1A 3NNXA 2YLEA 5KPRA 3OG7A 1UWJA 5D7AA 4ACMA 3MPAA 2X8AA 3D7TB 4BTJA 5E4HA 1PXLA 2X9EA 2YCSA 3O50A 5IUHA 3NPCA 2P3GX 4ITQA 1UNGA 4K1BA 3V5QA 3SG8A 2A2AA 2CV1A 4TWPA 2ETRA 3EL8A 3B74A 2BDJA 4BCKA 4YU2A 1VYWA 4QMTA 5ANJA 3VLFB 3HP5A 4HLQA 2OKRA 4IAAA 4RX8A 5I0BA 1ZYLA 1L1ZA 1GZOA 4GFMA 2JDVA 2QOLA 5EM7A 3ZLWA 2R3HA 4PP7A 4FKGA 2NNWB 2UZWE 5EG3A 3I01M 2XCKA 4W9WA 4FCTA 3GQ4A 2IW8A 4CEGA 3QD3A 2BKKA 4LV7A 3EIHA 4DV3M 4PL4A 4YP8A 5HCXA 2GNIA 4FNYA 3G33A 3M11A 3CGFA 4ZSJA 4QP3A 5H3QA 3U9CA 2VTAA 2QOHA 1TQPA 4I4LA 2XEYA 4OTGA 2Y4IB 5D7VA 2LWXA 1OECA 3DBQA 1J7IA 2DAKA 3DDPA 2UZLA 3ZFXA 2L4EA 3W68A 2JXNA 2BWBA 5KZIA 3ID6C 4EH9A 3L28A 2GPHA 2FO0A 1SNXA 2ERKA 4IX6A 4RZWA 3PXRA 2CV0A 3AC2A 4ITHA 1Q5KA 3MW1A 5A9UA 2BAQA 5HBEA 2WSCF 3EFKA 4O0WA 4WRGA 5KHXA 4NM0A 4A7CA 3EYHA 4X6RA 4C3PA 1DAYA 4GU9A 4JT3A 3GC9A 4AP7A 4ASDA 2OH0E 2IWIA 2DZLA 3GFEA 3W67A 4RJ4A 2GNJA 3E62A 4BKYA 1I44A 2C6OA 2LVQD 4FTTA 3SAYA 3V5LA 2JEDA 2QURA 1GL6A 5CT0A 2I7QA 3QUPA 3D9VA 4P5QA 4FV8A 4NIFB 4YSJA 4NC6A 3B2WA 3UBDA 3KDSE 2VX1A 3D14A 4PWNA 4NRVA 5A2QS 1OZ1A 2Z7RA 3CBLA 4ZIMA 4EORA 5EJCA 4AQYM 1XH4A 3HV7A 4RC4A 4LF9M 2C5NA 4X3FB 5CF4A 4LDTA 3QXOA 1S3SA 4RIYB 5HVYA 3DXQA 2B55A 3QCYA 4HPTE 5EM6A 4L6V6 1R3CA 3J80S 2UW7A 4I81A 1YWRA 2BZKB 3OWPA 4FT7A 4U8ZA 5EP4A 3QKKA 5AUWA 3UDBA 3GLIE 4I94A 4DINA 3DZDA 3BGQA 3U6PA 3FZPA 1U46A 5E8ZA 5LVOA 3GLHA 2UZBA 3HMIA 1H8FA 1ZOEA 2YIRA 1DGHA 3FQEA 3HVCA 4GT5A 1REKA 4MNEB 1G8KA 4I22A 3QZFA 3TWKA 4NFMA 2WOUA 3S95A 4GT3A 3JXWA 2XM9A 4JG8A 1XHAA 3E3PA 2PL0A 5M4FA 2L7HA 4HPUE 3VS2A 2W0JA 3FMLA 4E8AA 1DV0A 3G5DA 3SMSA 4IWQA 4QYYA 3ETAA 4CT2A 1J7KA 3W0FA 4E1ZA 2OK1A 4JLCA 2EXEA 4HYSA 2CPKE 4IXPA 5EQTA 2CCHA 4XBOA 2DWBA 3ACKA 4L68A 1L2DA 3UVQA 3HAMA 1TVOA 3WOWA 5AM7A 4QP2A 3K1JA 5J9LA 3Q3BA 3OWJA 1T3TA 5CNOA 2XKCA 3SXRA 4WIHA 4LRSA 3DK7A 2W1EA 3MH1A 2Y8OA 2WZJA 1RE8A 5CEQA 1E94E 1FVRA 3TKHA 5GINE 3PVSA 4ZY4A 3F3UA 4CG8A 3SHEA 2OICA 3DKCA 2JDRA 1TTEA 2V6ZM 1OL7A 2I0VA 3CY2A 1XQZA 3HV4A 4MVFA 4KBCA 5CU2A 5EDQA 1UWHA 4OTHA 5KMJA 2V5QA 3C4ZA 4A07A 3LCUA 4WUNA 2VTJA 2R3PA 3FKOA 4O4EA 3VUGA 4G3EA 3U51A 2G2HA 2VIIA 2JWSA 2PE0A 4GK3A 3KCKA 5HO8A 4RNAA 4MCVA 4WT6A 3D8LA 2X81A 5LVLA 3U8WA 2CJMA 3MTFA 3MVHA 1H1QA 3OW4A 5BMMA 5LXMA 4LJ8A 2GNLA 4CTCA 4YR8A 3IQ7A 1BUHA 4FCWA 2ZAZA 3LCSA 3DT1A 5KMLA 5KUPA 4GSBA 3N4UA 2VTNA 2KNZA 4XJ0A 4DITA 2J4ZA 2OXXA 2J51A 2XIYA 3VJNA 1SXJE 5BV3A 1XH7A 2C9OA 1IM2A 1HQCA 2JUJA 1KE5A 2BRMA 2BZIB 2QOIA 4BKJA 4BN1A 5ITTA 4JRNA 5J5TA 3UQCA 1FPUA 3QQKA 3FQHA 4GJ2A 4JBOA 4Q5HA 5CNNA 2DZNB 3KOZE 3ORXA 5CVGA 3LJ1A 5EW3A 4AG8A 5BVFA 2YJRA 2QZ4A 3V5TA 2WTCA 4IWOA 2ZMCA 1NJGA 4OT6A 3UMXA 2Z7JA 3L8PA 4MGZE 3OROA 3EN7A 4EKKA 2IEWA 4OGRA 4AFEA 4XG4A 4WP2A 4W4WA 1PJJA 3G6HA 5M07A 4V04A 2XAOA 5IA4A 3Q9ZA 3R8PA 2OJJA 2LVPC 1IEPA 8CATA 3HL7A 4G4QA 5FTJA 3EQHA 3HUCA 3PY3A 2W9ZB 4FTCA 4C4FA 5FDXA 4D9TA 4ALVA 3P79A 3KFUG 3R73A 4U5JA 4PF4A 3R9HA 1G8SA 3J7BA 4MK0A 4FIJA 3SOCA 2XKFA 3FL5A 3QZIA 4DH1A 3RHKA 3P0MA 4PPCA 1JKSA 4CTBA 2WMAA 1JR3E 3ZO3A 4MXZA 5CVHA 2R3LA 2XARA 2X6EA 3RNIA 3BCEA 5HTBA 3NGAA 2A98A 1QAOA 3HHWA 3LQRA 3QGYA 5HBJA 4ZZMA 5C8MA 2C68A 3GC8A 5C01A 3FMKA 3F6XA 4PD2A 3R02A 4FKVA 4M0YA 2W99B 3TIYA 1L2CA 4F7NA 3B7NA 3UZRA 2DAMA 1URWA 1PKDA 1ZRZA 3BYMA 4RLKA 2KA6B 1J1BA 4QMOA 4E73A 3KS4A 4FWHA 3MBLA 4BYIA 5AAFA 2X2LA 4AG5A 4MGIE 3QUEA 4CISA 5I5ZA 3O2MA 1E1XA 3RGPA 1XHBA 3MJ5A 2PVFA 3OWKA 4OTRA 2XUUA 4FT3A 3AT3A 3COHA 3P86A 4HGSA 3RKBA 3TIZA 1UKHA 4IVAA 3ZONA 4JG6A 3UNKA 5TE0A 1WAKA 3LVWA 4L7SA 2NRUA 1XKKA 1R0PA 4ZOGA 3EFWA 3A61A 4XLVA 5AR2A 4ZEGA 4EWHA 3FHIA 3LPBA 2V22A 4IVDA 3FRHA 2R64A 1R0EA 3GXLA 4Y72A 3A7HA 5EYKA 4G6LA 4E20A 3AOEC 4ZTHA 3SA0A 3UYSA 3NUYA 1H6UA 3I51A 4QYEA 5ITAA 5A4TA 2WTDA 4QTAA 2XAMA 4DG2E 3PXYA 2RG6A 4RG0A 2BNKA 1H4LA 4FEVA 5IQCA 4LZJA 3R8ZA 1RQQA 2OF2A 3TZ7A 4FTIA 1YLAA 1NY5A 3R1YA 1XB2B 2ERCA 3FMNA 1OL5A 3QA0A 1Y57A 3KB7A 3ZBFA 4EOJA 4QMNA 3UMMA 3QX2A 3R2YA 3ORLA 4BDJA 4IJEA 3T15A 1XR1A 2RKUA 4CKIA 4UBAA 3F69A 1H08A 3DU8A 4U6RA 2DQ7X 3WIKA 2JY5A 3PLAE 4FSMA 4I0SA 3PFYA 1QPEA 4ZJJA 5T3QA 5EYMA 3MS9A 3UZTA 4XG9A 2JP7A 5IMEA 3UOJA 2R3JA 4WNOA 4QYHA 1L8TA 2W9FB 3L27A 3HV5A 3BHHA 3ZUVA 4RC3A 4ANLA 3R9NA 1HT1E 4F7SA 2F7XE 4BF2A 2R7BA 4F6UA 3RJCA 5G1XA 4AZFA 5J95A 2I40A 4FEUA 3TUBA 4O2PA 4DFYA 1MRYA 1OPKA 1Q02A 4C4IA 4O4CA 4GV1A 4EKLA 3NYVA 1Q8WA 5C4LA 3ZH9B 5GHVA 2JIVA 3PG1A 4D5KA 4CLJA 3JUHA 2HAKA 5IREB 4FSWA 3UNJA 3PUPA 2R45A 2R3IA 4DFUA 3L29A 2BALA 4BDDA 4JR7A 4F08A 1TH4A 1V0OA 2BFYA 2GNGA 4YBKA 3BWFA 3RAIA 4RKUF 1TDZA 2WSFF 2PSQA 2YIQA 3BIZA 4IFCA 4MXYA 3GPUA 3VFDA 4AXEA 2VTLA 4B7HA 3L9PA 3Q9YA 2O64A 5AR4A 1YI6A 3GC0A 3DBEA 3GC7A 3RM7A 3W2RA 2VO6A 2FSMX 5CYIA 2X0QA 2IF8A 4HZSA 3AFHA 2ONLC 3KL8A 4WOVA 5EYCA 5HG5A 4AX8A 5AUTA 3ILKA 1M17A 3CS9A 3O8PA 2EUFB 3TDVA 2Y4PA 1Q39A 3BBTB 4FVQA 2H6DA 4I23A 3QX4A 4L6QA 4NM5A 3HKPA 2IZUA 2BRHA 5HHWA 2QONA 4DH8A 3PYYA 2PMLX 3NUXA 3ZRMA 5E1SA 1SMHA 2XA4A 3BHYA 5AV4A 1Z5MA 4QDEA 1KOAA 4KIQA 2VU3A 3CE3A 4I5PA 4OX9M 2W4JA 4OBPA 5DRBA 1CTPE 4TTHB 4AE6A 3WF6A 3SDJA 3PIYA 2IW6A 2L6OA 4R7IA 3QQGA 3OCTA 3R8VA 5DMZA 1PHKA 4I0RA 3EH9A 4ALWA 4FODA 2CKPA 3K5VA 4GW8A 3REPA 3QQLA 3P4KA 2R4JA 2QBYB 1MP8A 3HDMA 4ID7A 1NVMA 4LG4A 1OIUA 5FM2A 4XOZA 4AT3A 4GIPA 4II7A 3GEQA 4KKHA 3ZC6A 4X3FA 2OXYA 3RHXA 3HECA 3R21A 4FTKA 3I1AA 1GVNA 3ZM4A 2EXCX 3KIOC 2RFSA 4DV0M 3DZQA 2C1BA 5EP2A 2WTKC 2VV9A 5E6JA 5KE0A 4LGGA 3WZJA 3ZSGA 4LRTA 5FEDA 1SM2A 3ET7A 1EIJA 1WGLA 2CKEA 2X0GA 2W1FA 4O6EA 4EOLA 3C51A 3W0RA 3CPCA 4LUEA 4DEHA 2UZNA 4L53A 4Q2AA 4UY9A 5AFVA 2UW5A 4FBXA 5ETFA 5AR7A 5FTGA 2XJ1A 5DA3A 3WI6A 4BIBA 1Q8TA 3ORNA 5HO6A 2JDTA 3MYGA 3JAMS 4L78A 4J52A 3FZRA 4KABA 3SG9A 1W2CA 4B9DA 4EZ3A 4KIOA 5FSWA 4YY3M 3UZPA 3VAPA 1OKVA 4KODA 1L2BA 2W7XA 3NWWA 4BCJA 1D0LA 2R3KA 1WXQA 5EOLA 4C2WA 4LJ4A 4FIGA 3MB6A 2QHOB 5IT9S 2CDZA 4MBJA 3U9NA 4CGAA 3MH2A 2QOFA 4TYGA 4D9UA 1NW1A 3ATSA 4EHEA 3R7YA 1UU7A 1IY2A 4O1OA 3WZDA 5GNKA 1H1PA 4ANSA 3TUDA 2GQRA 4CFNA 4KO8A 3G51A 4JI7M 4NIFA 3TM0A 4PY1A 3CY3A 3PP0A 2FYSA 4D80A 2EB2A 3VIDA 4AZSA 4E4NA 2A1AB 2EVAA 4TNDA 4QMVA 2HWJA 4L67A 3IGOA 5HD7A 5I9YA 3MESA 4LGMA 2ITZA 1JVPP 3C9PA 2VO7A 4FW9A 3IKAA 4FGBA 3BX5A 4WKQA 1H00A 4AOIA 2BWEA 3HU3A 2CLQA 4G6ZA 3FZOA 3IW7A 3A42A 3HDNA 3UQGA 3ZS5A 4AZVA 3TYKA 2AC5A 2VTIA 5DWRA 1VEKA 3HHXA 5L6PA 4H58A 4JAJA 5M09A 5DEWA 3ZLYA 5HU3A 3KK8A 4NKAA 2Y9QA 3A2CA 4IBMA 3GLIA 3DFAA 2YFXA 4YZ9A 3ZH8A 1K9AA 2X7FA 5L2SA 2ZDTA 2IZRA 2RL5A 4PQNA 5E8YA 3COKA 3EN9A 3QBNA 3E8NA 3LHJA 1MU5A 4FKOA 4NW6A 1G5SA 4OW8A 1RU3A 1BX6A 3A46A 3DNDA 5AA9A 3GRRA 1Q3CA 4YO4A 3OTUA 4KA3A 5JFXA 3FUXA 2XF3A 1YOMA 3R7UA 4DT9A 2BDWA 5GJGA 3FTCA 2GHMA 2W5HA 4G3DA 4ITJA 4K77A 3WARA 4F7JA 4NKSA 3BEGA 3QU0A 1VJYA 2C5OA 4TYJA 2VF7A 3AC3A 3AGLA 4CFFA 5M57A 4GL9A 4E6QA 4DHIB 3PJ8A 5C8NA 3EQGA 1VQ1A 3FC1X 4O4DA 5KBRA 4BYJA 3ZZEA 2E2BA 5CU4A 2YZLA 3DBFA 4QQJA 5B2LA 3VW8A 4NSOB 5ITRA 2BIYA 4JRVA 2ZB0A 5KX8A 5LWNA 1PY5A 4BI2A 1SVEA 4U9AA 4BDEA 1WR1B 2DVWB 4G6NA 4DV2M 1QPDA 4X62M 4CT1A 2JD5A 4CZUA 4NL4H 3HLLA 4RBLA 3R9OA 2JFLA 2R3QA 2UW6A 4FWDA 5CF8A 5EHOA 2NPQA 2X7GA 2RFDA 3TG1A 1ND4A 3K92A 3V51A 1JSTA 1OB3A 3FMJA 4R7BA 3E8CA 1E32A 4GKKM 3NNWA 4FV1A 4LV8A 3QA8A 4X3FC 3BLQA 1VG5A 5EM5A 4D1XA 4I21A 3BBZA 4UZHA 1YI4A 2C5XA 5HD4A 2DI0A 2LVOC 1YE9A 3E7OA 3SATA 4H3PA 3ROCA 4DC2A 4QEBA 2OW3A 2B9FA 4QMSA 4BLCA 4ZZNA 4GHAA 2JZ1A 5ITXE 2VGPA 3CC6A 3V6SA 3VHKA 5I4NA 3J27B 1IRKA 5FM3A 4D82A 1ST4A 5J5SA 4DDGA 1F4IA 3LM5A 4F63A 3QWLA 4R1VA 3VULA 2CN8A 4XYFA 5TOZA 4IC8A 1Z5BA 1ZWSA 2CMWA 5M56A 3HGIA 4IMYA 4WD5A 3G9LX 5FEEA 3SOAA 3ZDIA 2C4GA 2YCQA 3E3BX 4H3BA 4A4LA 4CVAA 5H8GA 2OOAA 1OITA 3E63A 3OUNB 2L7IA 5E8TA 4BBEA 3KRJA 5IG1A 2YDIA 4YGAA 3MFRA 3ENHA 5AP4A 3VBTA 3WYYA 2VTQA 2WMTA 3CGOA 5B2KA 3I6UA 3RGSA 1Z5CA 1LP4A 1XXHE 3F3VA 5H37D 4P4CA 3RAHA 4JI8M 2ZOQA 4D2PA 4DHZA 2G8LA 3I0QA 1M7QA 3W16A 4EOMA 4ZTNA 4V0GA 5AP2A 1SNUA 3C0GA 5CSXA 2X4ZA 4M67A 3CKWA 4FKTA 3VS6A 3V5PA 4QMQA 5JT2A 3GP1A 4HVDA 3TTIA 5M51A 2XALA 4IM3A 1SYKA 1NHWC 2E9UA 3CD3A 1PM5A 4J71A 4A9YA 3ZMMA 4LGHA 4D0XA 4YTFA 1NXKA 1BL6A 4ZAUA 5IEYA 4N57A 4ZMFA 2W4KA 1UVRA 2ZM6M 1VDLA 2CHQA 2X49A 3LW0A 4GU6A 5AUVA 5FXSA 3RAWA 3EQDA 4BL1A 4JI3M 3E7VA 4DEAA 3AOEA 3KA0A 4XRJA 4F1IA 2I1MA 3CTQA 2YM4A 4PMMA 2F2CB 2Z7QA 2HW6A 3BPRA 3P78A 4JYAM 3QRIA 4QO9A 4DG0E 3OOMA 4BY9E 1E1VA 2WOTA 3ZLXA 1YW2A 3R1NA 3DV3A 4EHGA 2OIBA 4M9XA 3BHVA 4LRKA 5D12A 4CV8A 2VTHA 5EHLA 4E3CA 5KKRB 3S00A 3KP0E 3QTZA 2AYPA 3WZEA 3TJCA 3Q4UA 1V92A 4M0DA 4FZ7A 2QR8A 4ZP5A 4EL9A 2VTOA 1Q99A 3G6GA 4J99A 2I7PA 4CFXA 4I5CA 2OPFA 4BJJA 3W2QA 3PXFA 2A5YB 2UXBM 5FXQA 2MGWA 4W4VA 2BZHB 1ERKA 3C1XA 1X8BA 4CQGA 5J7BA 2JKKA 4G3CA 1XH9A 4R3RA 4X2GA 5HEZA 3NYXA 5DYIA 3OCGA 4PT5A 4DFXE 4FZFB 2VN9A 4YC3A 4MGKE 2LAVA 4DHFA 1FVTA 2HWPA 4Z55A 1DGBA 4ANOA 3CTHA 1VDDA 2UW9A 1HNWM 3U6SA 3A7IA 2RF9A 4LFIA 4YZDA 5CTPA 5AEPA 3UP2A 4GS6A 3CF0A 1OFHA 4BBAA 1N77A 1R78A 2BVAA 1UNLA 2QKRA 2UVYA 2C6DA 4FIIA 4L01A 4MKCA 4B8MA 3PWDA 4CQEA 3KXEC 4DEEA 4F9CA 2XCHA 3NZ0A 3RVGA 3I4BA 3T3VA 1U59A 2O25A 4LF4M 1M2QA 2GTNA 4BIEA 1IY0A 1Z59A 1APME 2WU7A 2YDJA 1IN5A 3RK9A 4DT8A 3AMYA 4GFGA 4X2KA 3EFLA 3EWHA 2XH9A 3CQUA 3QD4A 2WEVA 4IJ9A 5JQ5A 3BQCA 4XG6A 1H28A 4AKIA 4XG3A 1V0BA 5K9IA 4FOCA 3WHKA 3RAKA 1HJPA 1PMEA 5LCKA 2UUCM 4FEWA 3L9NA 4I6BA 4WO5A 4DF3A 3Q53A 1U54B 3AGMA 1BI7A 4QP9A 3GUBA 4QD6A 3TWJA 5HO7A 1Q24A 3DOAA 3GGFA 2AHMA 1LEWA 1EFUB 3HGKA 4N0SA 4O0SA 5CENA 4D2SA 3H0YA 5I9UA 4ZY6A 2NP8A 4QNAA 4XV2A 3MHVC 4NOOB 2JDOA 2W1HA 3NW5A 4FV7A 1OMWA 3VF9A 4U40A 5CS6A 2DKLA 4M12A 5ANGA 4C57A 2QHMA 5JRQA 4EIWA 4NT4A 5EDPA 2QOCA 3DLSA 3LXLA 4FG7A 5CASA 5LMBA 4AQKA 1PXPA 2CUZA 2C6LA 5D9HA 4EYMA 2YDKA 1NVRA 3NUAA 2OFUA 1OUKA 4O7TA 3NNUA 3R63A 1C1KA 2LGCA 2J7TA 4N6ZA 2ZJWA 2JY7A 3LFNA 4GRBA 2P55A 2X9FA 1E9RA 4RZVA 5TO8A 1ZZLA 2ZV8A 3DB8A 5EHYA 4R8QA 2LVAA 3EHAA 4H36A 5DLSA 5D41A 2X39A 5BPVA 3BV3A 5JGAA 4XS2A 3IS5A 2ESMA 2JFMA 4DFBA 2WQBA 4IJPA 3LZBA 3W0LB 3P7CA 1J09A 4DGLC 2L09A 3W8QA 4I20A 1FBNA 2QP9X 2QHNA 2ZTDA 1PXKA 2X8EA 4M9ZA 5EXPA 2P2IA 2G5GX 4LY6A 2B1PA 3EN6A 3MVJA 4JQEA 5IF1A 3LCTA 3QL8A 5IISA 3KREA 2UXCM 3GLFA 3E92A 3Q60A 5E8VA 4DGGA 4FK3A 4ALUA 3KRLA 5IQFA 3CJGA 3D7TA 2OF4A 5F94A 4AGDA 4UMPA 4J96A 3SMPA 3VBXA 4BWXA 4M0WA 3NCGA 5J79A 4EJ7A 4GH9A 3MVMA 2I0HA 3UODA 4JR3A 3PSBA 1N33M 1Q4LA 1QMZA 4FTOA 1DGHB 2F9GA 4XNEA 4ANBA 5AP3A 2ITYA 1WVWA 3HX4A 4LYNA 1ZXEA 1V34A 4AT5A 5AAGA 3E4RA 4JDKA 1WGNA 2PMOX 3QC4A 4QYFA 5D11A 3VNTA 4C37A 4Z16A 5JQ8A 3H4MA 4BTKA 4JJRA 3SRVB 5CALA 1IN6A 2C3JA 3COIA 1YHSA 4I93A 3C4CA