2WZJA

Catalytic and uba domain of kinase mark2/(par-1) k82r, t208e double mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
315
structure length
310
Chain Sequence
HIGNYRLLKTIAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE MARK2
publication title Structure and Function of Polarity-Inducing Kinase Family Mark/Par-1 within the Branch of Ampk/Snf1-Related Kinases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 96
structure length 310
sequence length 315
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2wzjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wzjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wzjA01
3H10A 4BGQA 1IAHA 4I3ZA 2FGIA 2P2IA 4NIFB 4BTFA 3NUYA 2OXDA 4FV3A 1SNXA 2J5EA 1OBDA 1ZYSA 3A60A 1BKXA 4R78A 1NVSA 3IW8A 4AFJA 1A5TA 5AR7A 3OWJA 1OM1A 3Q9XA 1YXTA 2X6EA 5CANA 4PUZA 3QHWA 4CFMA 3T3VA 2KULA 3QU0A 5HG7A 4BDIA 1KE9A 2ETRA 4YBKA 4GK2A 3UZRA 3PJ3A 1VZOA 3COIA 1PXMA 4YSJA 2J0MB 3ATTA 4MXXA 2I0EA 4U7ZA 5L6PA 1CM8A 4HYHA 5CNNA 2CKOA 4ITHA 3WYXA 1I44A 2P3GX 5AUVA 2ZV9A 4QQ5A 2QR7A 4EJNA 3HNGA 2QI8A 3TEIA 2Y8OA 4EUUA 2QURA 3R8UA 4DAWA 1OPLA 1GOLA 2CDZA 4IDTA 3V8TA 2OI4X 2X2MA 4LUEA 3ZSGA 2IW6A 1TQPA 3BBTB 3IDPA 4CEGA 2VN9A 1KE8A 4BIDA 4DG3E 5IISA 4YO4A 5CASA 4FT7A 5IA5A 3Q2JA 4QRCA 3AXWA 2GDOA 4C62A 4CLJA 1F0QA 3MIAA 2P0CA 3KA0A 3ALNA 5EOBA 1YI3A 4P2KA 3GBZA 4G3DA 4FNYA 4FTTA 3KL8A 3GQIA 4H3BA 4MXZA 4EK8A 4F08A 3BGZA 1UV5A 2RG5A 3ZUUA 1R1WA 1ZOHA 1WBSA 4EZ7A 2W99B 5EM6A 2HY0A 3QQUA 2B54A 2V55A 2OIQA 3I7CA 4IACA 3ZDUA 3MESA 3MFSA 3VRZA 4F7NA 1URWA 4PQNA 3PXYA 2H96A 1GZKA 2JIIA 4AP7A 4F0GA 4Y5HA 3OW3A 1S9JA 3WBLA 5CQWA 4O7ZA 2QO2A 2Z60A 4EQMA 3IW7A 3F3TA 4KKEA 3O7LB 3TUBA 3FMHA 4S31A 1OB3A 4IC7A 3SKCA 5CSXA 2VO3A 4QMVA 2OICA 4F6UA 5DT4A 3SAYA 4AT4A 3FQEA 4NTTA 2X7FA 4CFNA 4CCBA 2ETKA 4K8AA 2GQSA 1ZYCA 4K77A 3K54A 3QCYA 4YZCA 4TN6A 3WIKA 3Q6WA 4IBMA 5HHWA 4D5HA 3CC6A 5E92A 1WCCA 3KVXA 3PUPA 4RX8A 2XK7A 4DINA 2IVUA 3EN7A 3C0HA 4M8TA 5KMLA 4BCHA 5DFPA 3FLNC 2R3FA 3PSCA 5M53A 2BDWA 4ZP5A 3RKBA 3LCUA 3SC1A 4O84A 4I92A 5ETFA 4DH1A 4H36A 3F5UA 1BMKA 3ERKA 5ANKA 2OSCA 2RSVA 2ZOQA 4USDA 3U6HA 4ZXTA 2R3IA 2WZJA 3BYVA 4LRKA 3HMOA 1CMKE 5HKMA 2MJ5B 2O25A 4QNYA 5E4HA 4EOMA 1LUFA 1OUYA 4GS6A 1V0OA 3TG1A 3ETAA 2YZAA 4CKRA 5GJDA 5CQUA 3DB8A 3DCVA 1IFYA 4GKIA 4U80A 4YZDA 2WIPA 5LWMA 4OBPA 4RC3A 5CSVA 4NYEA 1XH8A 2W1GA 1IXSA 1ZMUA 3T6PA 2WB8A 2QO9A 4FL1A 2XCKA 4N6YA 4OTFA 2VWBA 3VJNA 4DH8A 1TR8A 2BMCA 2ITZA 4FKSA 5HORA 5CVGA 4AW0A 3EN9A 2PHKA 1Q62A 3UODA 5BYLA 2GPHA 1PGYA 3REPA 5IEVA 3BLRA 3IDBA 3ULIA 4BL1A 1DI8A 3RTPA 4HEOA 4K1BA 4QPAA 4EL9A 4C4IA 3OT8A 3KRLA 2XNEA 4V01A 3NW6A 4FEQA 3MY1A 3R8LA 3LZBA 1OL6A 4EJ7A 4ZSJA 4FKOA 5DEWA 5ANIA 3Q32A 3BLQA 3QHRA 4A9TA 4BTKA 2OF2A 1VR2A 4DH5A 4BYJA 2R2PA 3HP2A 1OL7A 1OPJA 2B7AA 1PXJA 1URCA 4G5JA 2XRWA 2WOUA 1IEPA 1WZYA 4XG4A 5HVYA 4WNKA 3DKFA 4BCOA 3M1SA 2EVAA 4NSTA 1OKVA 3E87A 2PY3A 3NEWA 3KRJA 3W18A 3S4QA 4JIAA 3MB6A 5I9WA 4FNWA 3DKOA 3KXXA 3PVGA 2ITOA 3EQBA 2BAQA 3RBWA 2JY6B 1JSVA 1SYKA 4MHAA 3OOMA 4O7NA 4WG3A 3PYYA 3TV6A 5HE1A 2KHHA 1GZNA 1K9AA 2F2UA 4RFMA 5K3YA 5LMAA 3BHHA 3MY0A 1NY3A 4QP7A 3R9NA 4QO9A 4U0IA 3A61A 1R0PA 3ORPA 2HZ4A 2VNWA 3PWDA 4W4WA 5DNRA 4MKCA 3SG8A 2J0KA 2EB3A 3FI3A 3ZS5A 4DT9A 1FGIA 1WGNA 4JS8A 5LCJA 5KMMA 4DFBA 1UNHA 1OQYA 5KKRC 3KMMA 3OVVA 1E1XA 1UKIA 2C69A 3OZ6A 3LFNA 3MSSA 3BYSA 4FL2A 4DGMA 5IA4A 2XK3A 3UVPA 2QO7A 3DNEA 4B7TA 3H9FA 4CMUA 2VTSA 4IDVA 4BTMA 4M0ZA 2C6MA 4LM5A 2LAVA 3UG2A 3LXPA 3MFUA 4KS7A 2W4KA 4PTCA 2ZMDA 3EQCA 3MMPA 3WILA 4CCUA 4BKYA 3UPZA 3LFQA 2W96B 2Y0AA 3E63A 2YIQA 3PJ2A 4FVPA 2H8HA 3TL8A 5A9UA 2WQOA 4JR3A 3AT2A 4E8AA 4WRGA 1ZXEA 4IIRA 2WTDA 3CLYA 3ZUTA 2JIVA 3GC0A 5BUJA 2CKPA 3MN3A 3E3PA 4L67A 5ACKA 4GMYA 4BCKA 4FSMA 3MH3A 5HG5A 2YIWA 3E8CA 5BVEA 3HECA 2HW6A 2VNYA 3R6XA 5BPYA 4JT3A 2YIRA 3DXNA 3PWYA 4FMQA 4MD7E 2QLQA 4YJTA 3Q4CA 3CPCA 3PJCA 3I5NA 4FOBA 3VBTA 3ZLSA 5HCXA 3W32A 5AA8A 3D0EA 3CP9A 3LLTA 4RSSA 4AACA 3FMLA 3AT4A 3GUBA 1PMVA 4NJ3A 2X9FA 4TNDA 5DBXA 3T9TA 5HLWA 5HG8A 5K4JA 3ANRA 4IFGA 1WBTA 5JZJA 1CSNA 4IZ5A 3FDNA 1OAIA 4UMUA 4BWPA 1TVOA 4RQKA 4L9IA 3PE1A 3EL8A 1YXVA 2EKKA 4ZZNA 3DPKA 4FEVA 4UEUA 4U41A 3R8VA 4TYEA 3QFVA 4TY1A 3O51A 4UYAA 2WTKC 5EQYA 2Q0BA 2R4BA 3BRBA 4IB0A 5CX9A 2CP8A 2MR9A 1GZOA 3BYMA 3NUNA 4FODA 3ZFXA 3VUIA 1SVHA 5JSMA 5E9EA 3FHIA 3OCGA 2UUEA 3TM0A 4FKUA 1XB2B 4D4VA 3RK7A 5IUIA 1JQHA 2FSLX 3BV3A 3FXXA 3VBQA 1CUKA 2PUIA 2UZEA 2G01A 1B6CB 1V1KA 2CHLA 3ORZA 1FQ1B 4IMYA 4L3LA 4C3PA 3OBGA 3FMJA 2P55A 4MF0A 5L8KA 4DA5A 2Y9QA 4G34A 4MD9E 3GCPA 3MVMA 1YHSA 2ZVAA 4C0TA 4IX4A 1H00A 5I4NA 1MRUA 3G2FA 3R22A 3LMHA 3QYZA 4ZTSA 2C6TA 2Z2WA 4JLCA 2QR8A 4FV4A 5HVJA 3OFMA 4X3JA 3ZMMA 4ANLA 2PVFA 3BIZA 4EOOA 4NL0A 4CMTA 4TTHB 2IJMA 4RGJA 2R3HA 2J9MA 4PTGA 3MH0A 1XO2B 1OKZA 4RLLA 2ZV7A 3FKNA 4F70A 2FA2A 2YEXA 3HEGA 4J99A 2VTAA 3LMGA 5GIPE 4JG8A 4LOOA 1DM2A 5AV1A 4R7IA 2W4JA 1R39A 5FG8A 2GU8A 3ZRMA 1XBCA 3SOCA 5J9ZA 3KXZA 4G17A 2E9NA 4FG9A 5IH5A 3PVBA 3ZXTA 4WKQA 5ANEA 2LVOC 3VBVA 4LG4A 5DPVA 5I0BA 3U9CA 2DAEA 4CGAA 3QRJA 4WNPA 3TNPC 2ZAZA 3R1QA 2DI0A 1PKGA 1KE6A 4GL9A 1DAWA 3IW6A 2BDFA 2BHEA 5F9EA 4PP7A 4IWOA 2DAGA 2RFDA 3HX4A 4GT5A 3I79A 1P5EA 4O2PA 1XHAA 3SLSA 2CGWA 4N6ZA 1L8TA 4KRCA 4DF3A 3TTJA 4GVJA 1UU8A 2DAIA 2XK9A 4DCAA 4WUAA 2HENA 2X6DA 4RJ5A 4A4OA 3SW7A 3A7JA 3PPKA 4V05A 3SGCA 4G5PA 1G8SA 4O6LA 1YXXA 3JS2A 4RWKA 4FIJA 4XEYA 3HYHA 3SRVB 3OROA 4RBLA 5AUXA 4YTIA 2NO3A 2OG8A 3ZO4A 4DEGA 4C61A 5D11A 5E8XA 2UW6A 3CXWA 3NWWA 5JRQA 4NWMA 5B7VA 1UFZA 5CLPA 4P90A 4RC4A 3Q2MA 4FZDB 3FZRA 3O0GA 4C37A 4QQJA 4MNEA 3BGPA 3OEFX 2BILB 1X8BA 3CKXA 3EYGA 4MYGA 3W55A 4UXQA 1DO2A 4O86A 2UW5A 4O21A 3QXOA 5HQ0A 3MTFA 3KXGA 2E9UA 5KO1A 4P5ZA 3UO4A 5CAUA 2VX1A 2W5BA 4YURA 3TZMA 4CMOA 4O7LA 4RIYA 4IJ9A 3TZ7A 4FOCA 4BRXA 3HV7A 4FYNA 4DYMA 5IMXA 2PVMA 5KMIA 3ZM9A 4IE9A 4YJRA 4BCPA 4A4LA 1E9HA 5DE2A 2BWBA 2XKDA 1LP4A 2W06A 2AYPA 3RHKA 3FZTA 3P5KA 4EK3A 4PWNA 2UW8A 2UZDA 2HWJA 5CY3A 4EBVA 1VJYA 3PLSA 4BKZA 1ZARA 2QOKA 5M4CA 2WHBA 3FYKX 3KRRA 5D9HA 4XV3A 4JG6A 5BQ0A 4GJ2A 2RIOA 5DT0A 4QMOA 4H39A 3UPXA 2ZM1A 2XIYA 4IB1A 4FK3A 2F57A 2VWUA 1NV9A 1ND4A 2Y4PA 3ENMA 3NYNA 1L3RE 3R83A 1J1CA 3ZBXA 4GU6A 3R7IA 3ORXA 5C4KA 2C3IB 4QP1A 4MK0A 2C30A 2UZLA 5CVHA 3LCDA 3CE3A 3R1YA 2DZLA 4GEOA 4RFZA 2JP7A 2PE1A 2OWBA 4MAOA 2XP2A 4ZS0A 1OECA 2ZTCA 4C33A 4I5CA 4RIWA 4BWKA 4C4FA 2PMIA 1AD5A 4O7VA 3VHKA 3H0YA 4EYMA 4M7IA 2WU7A 3VF8A 2I0VA 3UVRA 4MX9A 4CT1A 5HU9A 2F9GA 4L3PA 1JWHA 3CY2A 2C3LA 5AR4A 5K0KA 3VW6A 2J0JA 4ZTHA 3RNYA 4FZAB 2YN8A 3QC9A 3OW4A 4XOYA 3V01A 4ZK5A 4XV9A 5B2LA 5IQEA 2QVSE 3ZO3A 4QTCA 3VO3A 2VWXA 2BRNA 4BFMA 4J96A 2B52A 3OG7A 4WUNA 3E88A 3WE4A 3RP9A 4RA4A 3P1AA 3QTUA 4OTPA 5IG1A 4L00A 4TWOA 3UTOA 3BWFA 3R63A 3HMPA 3KK8A 3R00A 3O2MA 4FTIA 4GUBA 4JBOA 3CIKA 4R3PA 2X39A 3R8MA 4C36A 4DLJA 4H05A 4QOXA 5LQFA 3UQFA 2R0UA 2J51A 3LCKA 3MW1A 4TW9A 3TN8A 4FIIA 2W9FB 3G6GA 4QTEA 3MH1A 3ALOA 2JIUA 3Q3BA 5AUUA 5CAVA 4PDSA 3GLGE 2R3QA 3QRIA 3EYHA 2X1NA 3AD5A 3MY5A 1REKA 2O64A 3M42A 5CEKA 3FPMA 5JFWA 5DEYA 4EONA 2XS0A 3QRUA 2C0TA 3SXFA 3DJ5A 3F6XA 3NUUA 3BYUA 3Q4TA 3PXQA 1Y6BA 4RA5A 3R9HA 3UE4A 3NW7A 1CKPA 5JN2A 3PVUA 4WP2A 1QL6A 2EUFB 3TKHA 2WMQA 3QCSA 4FKGA 5M55A 3VUHA 4V0GB 4A06A 4JJRA 5EYKA 1WGLA 2CNVA 2RFEA 2P33A 2IZUA 3ZOSA 1OIRA 3JR1A 5C8NA 2C5OA 2UV2A 1W82A 3FI2A 3NAYA 4FI1A 4X2JA 3G9NA 4C4GA 4UN2B 4D28A 4D9UA 4ZMFA 3GP0A 2WMBA 3RPYA 3NNWA 3VQHA 5I9YA 4NU1A 4JAJA 4UX9A 3C4XA 3F2NA 4FTKA 2NPQA 1PMUA 3K2LA 4LMNA 2IVVA 3QD0A 4USEA 1ZOGA 3AMYA 4FNZA 4CG8A 3RHXA 5EHOA 4HZSA 4BVUA 4CTCA 2WMUA 4CFFA 3OHTA 3LCTA 4JDHA 4MXYA 3FAAA 3Q4UA 4JBVA 3G51A 4AAAA 4TWCA 2W4OA 4YZ9A 4AN2A 5LVPA 3AOXA 4TNBA 3QQJA 2CCHA 5HIDA 3FLZA 4HPTE 5EHYA 3VN9A 1SVEA 3O96A 3SG9A 2J4ZA 3ORTA 3U4UA 4ZZMA 3QD4A 3MBLA 1UWJA 3FC1X 2PVLA 4XG9A 3R8PA 2J0IA 2XKFA 2V62A 4EHGA 4OTRA 1H1QA 5K4IA 5GZAA 1YHWA 1FMKA 3PJ8A 2DWBA 3BHVA 1FMOE 3Q5ZA 4ZTRA 5DMZA 5EHLA 5HICA 1KWPA 5LMKC 5LVMA 4BCFA 1FBNA 5FLFA 2OZOA 4CKJA 3HMNA 1MUOA 4HVDA 2AC3A 4YC3A 3KKVA 5M4UA 2DAKA 1MRVA 1YWRA 4G1WA 4O7WA 2OGVA 5EQEA 2QOQA 1IASA 1JSUA 2BZKB 4OTHA 5KNJA 2UZNA 3L9NA 2BUJA 1UU7A 2Z8CA 3MJ1A 4QQCA 1W7HA 4BC6A 4JIKA 2O63A 3KGAA 5EW8A 4KRDA 4Y5QA 5HE2A 2QHOB 3W10A 4S33A 3QQGA 4S30A 4GT3A 2IW9A 3ACKA 2GS7A 2VTMA 1WHCA 1OKSA 1YDSE 1YW2A 4I1ZA 4MTAA 4QMLA 4IAYA 2DUVA 4R8QA 3VW8A 2PZIA 2BTSA 2REIA 2PZRA 4FKPA 4FZ7A 3KU2A 4JRNA 3QX4A 3SA0A 5KCVA 5CALA 1GIIA 2ITYA 3C5IA 3EB0A 2CN5A 1NXKA 2YIYA 4HGLA 3L9PA 5LMKA 5C03A 5CEQA 4MWHA 4Z3VA 4AZSA 4X2KA 4UY9A 4F6WA 4CFWA 1XJDA 3AGMA 5HNBA 3UNJA 3NUXA 3H9RA 4QMWA 2GS2A 2X4ZA 3FXWA 5CF5A 2KTYA 4L3JA 2KNZA 4M68A 1EH4A 4NZWB 3SHEA 5C01A 4BDDA 3TXOA 3QUDA 1GO5A 4JBPA 2JKKA 2ERZE 4LV8A 4ZEGA 2ITPA 3ZO1A 2R0IA 4MF1A 4XG8A 2HCKA 5FM2A 1H26A 3B8RA 3QA8A 4BIEA 2OO9A 4NM5A 5BVFA 2W1HA 3F5GA 2PUUA 5A3XA 1SZMA 4JOAA 5IQFA 3R02A 3ORIA 2JDTA 4Y46A 2Y7JA 3W2SA 3WF5A 3HV6A 2UVZA 2GNIA 2XUUA 3CR0A 2UZUE 3EMGA 3QTIA 1WJ7A 3KF7A 3ORNA 4FICA 4R77A 5FUTA 3WZEA 5AP5A 2WQEA 4DBNA 2NP8A 3ZZEA 4WIHA 5E1EA 5M56A 4AN9A 4B8LA 4UMRA 2ITNA 3EH9A 3PG1A 5CU0A 3TNWA 4FKJA 3FY2A 1ZRZA 1Q3WA 3KN5A 4ZTNA 1WVYA 4HGSA 5FEQA 4QMMA 3WF9A 4X2FA 2QHNA 4GRBA 5AIRA 2W1EA 3QAME 4AZWA 1OI9A 3QCXA 2WTJA 5CF8A 4APPA 1HJPA 3UP7A 2X4FA 3C0IA 3D14A 5JFVA 3OY3A 4EOLA 3TKIA 2DKLA 5HZNA 4NH1A 3DA6A 4GG7A 4W8DA 4F2LA 3HA8A 1QCFA 5BVKA 2HZNA 3E7VA 1YOLA 1ZY4A 4FSYA 4BY9E 2OW3A 3HZTA 3MH2A 4W4VA 4BWXA 4DFZE 4ORKA 3I6UA 1V0BA 3LFFA 2JDSA 4Z55A 4FV7A 4ZY6A 2PVKA 5FP5A 4FF8A 4RX5A 4FIFA 5HBEA 1YRPA 3FZPA 4BI0A 3N9XA 5HO8A 5AV2A 3DDPA 5ANGA 1BUHA 2GNLA 3K9PA 4FT5A 3UGCA 3NUPA 4RJ4A 4YZMA 3FHRA 3I81A 4F9WA 5K5XA 4ITJA 3ZFYA 2BIKB 2WEIA 3QQHA 3EQIA 3D2KA 2L4FA 4HOKA 5CXHA 1R4GA 4IAZA 4WT6A 2JKQA 3V04A 2YM3A 1U46A 1JOWB 4C3FA 1LEZA 1IR3A 4KINA 5CU2A 4R5SA 2MGWA 1MQBA 2XJ1A 3VUGA 5IDPA 1MN3A 5IQIA 3RZBA 4H1JA 2IG7A 3E5AA 1PY5A 3RAIA 3HRFA 1M14A 4DTKA 4E4XA 3EN6A 3QTSA 4FTUA 3P23A 4PDPA 2WXVA 4KIQA 1OBGA 3W2RA 4JR7A 1KE7A 3VS7A 2UW3A 4F09A 4F0IA 1GNGA 4N70A 2XYUA 3CQUA 4RRVA 5HO6A 3R7UA 4ZTQA 2G2FA 4C38A 5D7VA 4ZSAA 1XKKA 2VRXA 5KZ0A 2XIRA 4U6RA 2XB7A 2XK4A 3VWAA 2QONA 4EH2A 4FSRA 2VO7A 4RIXA 1E1VA 4EHVA 2EB2A 2XNOA 4R1VA 5JH6A 2AC5A 2NRUA 4L8MA 3CY3A 5FTQA 4YU2A 1H28A 2AUHA 1Q02A 4U3ZA 3VS2A 3LM0A 3OXIA 2W5AA 1PW2A 5F94A 1GY3A 3VS1A 5KUPA 4XBUA 2BAKA 2WNTA 4ANSA 2IO6A 2QOFA 4YLKA 4Y95A 2JY5A 2YA9A 5L8JA 4F9AA 1A48A 4QYGA 3AD4A 5FDXA 4CV8A 4FV8A 4D55A 3VJOA 4PNIA 2B0QA 2OJFE 4F1TA 4FK6A 3RPVA 4DE4A 3ZZWA 4UYNA 4C8BA 4OAVB 1Q61A 2VWIA 2XK8A 4I5HA 3LFBA 2XMYA 4IWQA 4K6ZA 4IB3A 5HI2A 4KA3A 4E4MA 4FZFB 5JZNA 2RFSA 3F2RA 5IA3A 3FXZA 1YKRA 5IH6A 4FYOA 4MCVA 5HNGA 4O91A 2X81A 4DEBA 3DFAA 3GOKA 3M11A 1ERKA 4DH3A 4B8MA 4DTAA 2C68A 3H3CA 3L8PA 5F95A 2C6DA 4X21A 2BZIB 3WI6A 4ERWA 2VWVA 2GHMA 4ZOGA 3HAMA 1PMEA 4BYIA 4DBXA 5I9XA 1Q99A 3EN5A 4J98A 5M4FA 2G3QA 4Z16A 3PTGA 4UMQA 1QPJA 1OIUA 4WSYA 3C5UA 5FGKA 5H8EA 4Q9ZA 2I6LA 2YACA 3UMWA 5HTIA 5J7HA 5EOLA 3RI1A 1J3HA 3EJ1A 1TQMA 4J53A 4K9YA 2R3GA 4O96A 3GB2A 3G90X 4OT5A 4QMZA 3DT1A 3OWKA 2WMRA 4HYUA 4S2ZA 4XV2A 4AQCA 1JPAA 1OVEA 3C0GA 3TUCA 4EZ5A 5T6KA 4P5QA 1ZY5A 4E5BA 3VS6A 4L7SA 3HV5A 4UWBA 3NNVA 5HGIA 3VAPA 4BBMA 3ZEWA 4ACGA 2GHLA 2PUPA 1QPEA 5LXMA 4CQEA 2QNJA 4GT4A 1KOAA 3QC4A 3R04A 4MBLA 5IH4A 5KKRB 2E9VA 1VEKA 3GLFE 5B2MA 2XM9A 4HGEA 2R3JA 4F1MA 4CVAA 4E7WA 4OLIA 4EQUA 3EQDA 4L6QA 4MH7A 3F5PA 3VQUA 3QX2A 3R7EA 4U97A 3PJ1A 3AC2A 3OBJA 3LFEA 4OAUC 1PXIA 4AE9A 2ZM4A 4BBEA 5A54A 3KN6A 1U5QA 2ITUA 5IQCA 2YDKA 4U8ZA 3R7YA 1YXUA 3IK3A 2A19B 3L8SA 4DEEA 4EH3A 2OO8X 3G0EA 4RJ8A 2YM4A 2VTRA 5GZ8A 3FWQA 2ZJWA 4FSTA 4DEDA 2J5FA 2YABA 4O82A 4CYJA 3LFSA 3H0ZA 3SD0A 2X7OA 4YTCA 3ZLWA 4MBIA 3CTQA 4U3YA 4AOIA 2Z7SA 3LPBA 3OWPA 2OJGA 4YJNA 3D7TA 3U55A 4CTBA 4BCJA 3MS9A 3FMDA 3L9LA 3TI1A 3WF6A 5J79A 1H1SA 2Y4IB 3MIYA 3QXPA 4E20A 4YHJA 1Z57A 1UA2A 2YFXA 1T45A 3C4CA 3D5UA 3GFEA 4O0XA 3U8WA 4ACHA 3MA6A 4I23A 2L4EA 4CFVA 4I21A 5E7RA 5HX8A 5L2IA 4TKSA 3BQCA 4F9BA 3HKOA 4X6QC 4PNKA 4L43A 4IVAA 2R3KA 3E21A 4YZBA 3N4TA 3Q53A 4EBWA 3GT8A 2UZBA 3LIJA 5HD4A 2VWWA 4TPTA 4BDGA 4L42A 3DJ7A 4YC6A 2JBOA 4EORA 1KV1A 5J87A 5EYCA 5GINE 2C6LA 3NIEA 1Q8TA 4F9YA 5KBQA 2WTKB 4I6BA 3UC4A 5DN3A 1J91A 4AGWA 2WGJA 5DWRA 4JBQA 3IHPA 3DGKA 2JNHA 3P7AA 3QGYA 2DQ7X 2CN8A 4FSUA 4BB4A 4QMSA 1ZV1A 3KMUA 4RMZA 4RPVA 4XLIA 4KSQA 4E73A 4XJ0A 3F2AA 3BPRA 2GCDA 4FR4A 4U42A 3Q04A 3R9OA 5M4IA 3MGYA 3C51A 2A4LA 3GQLA 1Q5KA 3VBXA 3KRXA 4C3RA 2CJMA 4TYHA 3O8UA 4NKAA 4PMPA 4CG9A 4LOPA 3LKMA 2JKOA 4AZFA 2ZM3A 5J9YA 2BRMA 5BX0A 1WAKA 4XP3A 1QPCA 5BUEA 3DBFA 2YCRA 2X8DA 5BMMA 3U4WA 2JKMA 3GC7A 4AN3A 3BU6A 3MVLA 3KB7A 2ITQA 2XEZA 3UNKA 1PHKA 2JAMA 4IZYA 4IW0A 4HVIA 5JQ5A 4M15A 1BVSA 2UW9A 2X9EA 3A2CA 5TR6A 4PDOA 4O0RA 4UWYA 4MNEB 3B2WA 3P7BA 2QHMA 3GU7A 3KCFA 2EU9A 3LQ8A 3G0FA 3PXRA 5F1ZA 3WZJA 4D4YA 3Q9YA 5L3AA 4I93A 1P14A 4RVTA 2JGZA 4C35A 2OJJA 2QU6A 4F0FA 3LLAA 1AIPC 3ODYX 4EH6A 2HYYA 4EH5A 2VTNA 2Y4IC 1G8AA 3F3ZA 4GIHA 4IANA 3FL4A 4FT0A 5FQDC 2VWZA 2FSMX 3MJ2A 2B3TA 4JL9A 3OF0A 4X2NA 4Z9LA 3LHJA 4JX3A 5CVFA 5F20A 4M84A 2C0IA 4RIYB 4I0TA 4G3OA 3DFCB 4WSQA 3HDNA 4A9YA 4CYIA 5HD7A 3N4UA 4XUFA 2QKRA 3QD3A 4M12A 3W2QA 2X8IA 4RZVA 4KD1A 1SNUA 1P4OA 1Q8YA 1O6LA 4I20A 5AJQA 2ZV8A 2QODA 4I5PA 3OMVA 5M06A 3BHYA 3VS3A 2IZSA 1LR4A 3UNZA 3EFWA 4NT4A 3L8XA 5JGBA 1ZWSA 4N0SA 3HA6A 4DITA 3WF7A 2QSFX 4GJ3A 5DRDA 5KBRA 3F7WA 1W84A 2I40A 3VUMA 3BU3A 5E8YA 3TJDA 2JBPA 2HY81 2JLDA 2OF4A 1PYXA 4XX9A 3UIXA 4BCIA 5IQBA 4KB8A 5BYZA 2EKFA 4AW1A 1IAJA 5GJGA 3D15A 2PVJA 2XJ0A 2XCHA 4BI1A 2H5XA 2XIXA 3RWPA 4FVRA 2F7EE 2OJ9A 2E9PA 5C1QB 1FVVA 2GMXA 5EQPA 5LVNA 5IF1A 1A9UA 3FJQE 4R6VA 3A8WA 4UWCA 4YR8A 2MROB 4RIWB 3DZOA 2PVNA 3KC3A 1APME 5CU3A 3NVMB 1SG9A 4XP2A 2LTUA 3BYOA 3LXLA 1H0VA 3IW4A 2PVHA 1PMNA 3KF4A 4WHZA 2JFLA 2PVRA 4ZLZA 1WBOA 5JQ8A 1LPUA 4FTAA 1G3NA 5CU4A 2A1AB 3GCVA 2WKMA 5HG9A 2R3OA 2WMSA 3PA4A 2IW8A 2B9IA 3A7IA 5CEIA 5IQGA 3W33A 2GFSA 2BZHB 3E92A 5D12A 2BALA 2YJSA 5HU3A 1JAMA 3U6IA 2LVNC 5E8SA 5AP2A 1IRKA 2HWOA 4ZY4A 2WQNA 3OCBA 1VYWA 4FUYA 3TNIA 3LFCA 1R78A 4RWLA 1C7YA 5A4EA 4PDYA 2LVPC 4X0MA 4XMOA 4CKIA 3D83A 3F66A 4L52A 2C6OA 4YUQA 5HTBA 1ZYDA 5FBNC 1OIYA 3PA3A 2VO0A 2VTJA 3OCTA 2RFNA 3MPTA 4ZSEA 4EKLA 3QQLA 4FSNA 5J8IA 4AW5A 4YLLA 4LMUA 1WBVA 1PXPA 2VTLA 1Q24A 2YZLA 5CZIA 4AZTA 4E6CA 5TF9A 3LW0A 4CLIA 5EFQA 4F99A 4FV6A 5AAFA 3MVHA 1XQZA 3LJ0A 2GNJA 4LL0A 1AQ1A 5HE0A 4MEDA 4CFUA 5CF4A 2NNWB 2JFMA 2VTOA 2HXQA 5AP3A 5ACBC 1OL5A 3B2TA 2W1IA 3PIXA 4YJVA 3F7ZA 4ANBA 4I6QA 3POOA 3BBWA 2IZTA 3UBDA 2XZSA 4KIKB 4O22A 4DFLA 5KX8A 5LVOA 3QTXA 4ZS4A 1UU3A 3DXQA 1BX6A 1DS5A 2X7GA 3BKBA 3HGKA 3ZEPA 4FIHA 5CYIA 3P0MA 3K3JA 4KS8A 1KOBA 4EK4A 3NDMA 1H01A 3ZC6A 3R01A 4FT9A 4QTDA 3FI4A 1GJOA 1GAGA 5A14A 3G15A 4AS0A 4RX9A 5CEPA 4M69A 4EQCA 4U5JA 4RIOA 3KRWA 3NNUA 4C7TA 3ORLA 1CDKA 2OU7A 3OTUA 4CXAA 5BMSA 3FYJX 4XV1A 5E8WA 3RMFA 2P4IA 3FLWA 3I1AA 5FWKK 3P08A 4F9CA 5IQDA 4OBQA 3ZRLA 2XM8A 4G6NA 4F7SA 4EH4A 2O8YA 2WMXA 5CSWA 4DEHA 3S00A 3UJGA 3GLIE 2W1DA 4ZMEA 2X2KA 3EQFA 3VUKA 5HO7A 4KUJA 4D2SA 4HCUA 2YLFA 2OXXA 3DLSA 4Y83A 3WOWA 1ZYJA 2FB8A 2J7TA 4ALWA 1YI6A 2UVYA 5D7AA 3UMXA 4UBAA 1M52A 2YM6A 3GCQA 3KXMA 4ARKA 4B99A 3G5DA 4BDKA 3LOKA 1U5RA 4CSVA 4C4JA 2PZ5A 2Q0NA 4HZRA 4YHFA 4GFMA 2JZ1A 4J97A 2V0DA 2BDJA 4FIEA 4LRMA 5HBHA 3ZCLA 4BICA 4ZAUA 3QZFA 1J7LA 4J8MA 1GZ8A 2VTIA 4HVHA 4XS2A 4YJOA 5TE0A 5HIBA 3IECA 3C13A 3CS9A 5EDQA 3RINA 4CNHA 5FBOA 2F7XE 2QLUA 3MTLA 3F3VA 3PA5A 4JAIA 4WA9A 1VYZA 3RAHA 3LMIA 4V04A 3JVRA 3QRKA 4HJOA 2O65A 3R9DA 1P4FA 2W05A 3F61A 4LYNA 5AWMA 5J95A 3UYTA 4AGDA 4JNWA 3E7OA 3WZUA 4IVCA 2WMAA 2W1CA 4UN0C 4DGNA 3ZONA 3QALE 3FZSA 3QF9A 3CPBA 5HIEA 4GCJA 4I0SA 3LXKA 1RDQE 5AMNA 4C4HA 4EH8A 3C50A 3TIZA 5FXQA 2B1PA 2JEDA 4PX6A 5EW9A 4RX7A 4R3CA 3ZDIA 4ZLYA 4BN1A 1MP8A 2BRBA 2C6KA 2DHYA 3D5WA 4IM2A 5HLPA 3ZSIA 2O0UA 3I0OA 4D2TA 4R5YA 4G6LA 5AV0A 2QG5A 4YPDA 2E2BA 3AT3A 4XNEA 4FE2A 3F3WA 4QNAA 4G3EA 2B9HA 1F4IA 3A4PA 4PMSA 5CNOA 3C9WA 3E3BX 1BI7A 2PE2A 1XH7A 2I0YA 3IO7A 4FTOA 2C1AA 4FV1A 2W5HA 4E1ZA 2RKUA 5AIKA 3D5VA 3KVWA 3DTCA 4E93A 3A99A 3O8TA 2YCQA 1F5QA 3Q9WA 3KK9A 3U51A 2FH9A 3LQ3A 3H9OA 3V8WA 1YOMA 4FG7A 4JQ8A 3IONA 4QP9A 3ZM4A 5DR2A 4FA2A 3DDQA 2HWPA 3PRIA 3HMIA 1AGWA 1HCKA 4G9RA 2GQGA 3FL5A 1B39A 1S9IA 2W0JA 1H24A 2HIWA 3ULZA 4DT8A 2PTKA 4M66A 2QU5A 4D0WA 1FVTA 4FV2A 1NA7A 1FVRA 1OL2A 4IB5A 1SM2A 3FY0A 3P7CA 3RK5A 3S95A 2OOBA 3HVCA 3V5QA 4A07A 4ANOA 2YHVA 4O7YA 1PXLA 1R0EA 4KIKA 1IM2A 3MA3A 4B4LA 3IG7A 1H27A 3QA0A 4A9UA 1RE8A 4PMTA 1P3QQ 4E6QA 3U6JA 3QWJA 5AUTA 3NS9A 4M97A 3SX9A 3CQWA 1IA8A 3DTWA 2WMWA 2CNQA 4NM0A 2OOAA 3ZTXA 4ZJJA 5A4CA 4GV1A 4U9AA 2GHGA 4ITIA 4PL5A 5CEOA 5K0XA 2BAJA 4RVMA 4RVKA 5KHXA 4XG6A 4TZRA 2QC6A 2R64A 3AC4A 3RNIA 4ACMA 2L2DA 4A9RA 4H58A 4BHNA 4DGGA 3U9NA 4AGUA 3NVKI 4FV5A 4GU9A 2J0LA 1YWNA 3FZOA 2XNNA 4G16A 2XF0A 4QP3A 3UP2A 5JGAA 3SVVA 3UZTA 3DAJA 4XG2A 3EOCA 5JGDA 2FVDA 2OH0E 5EM5A 2GTMA 4WRSA 1PF8A 3FSFA 4O81A 2ZB0A 3V5LA 1O6YA 1MQ4A 3DK6A 2HXLA 5A4QA 5CF6A 2WELA 3O71A 4YJUA 5L8LA 2R3RA 5JEBA 3E64A 3K3IA 5AP1A 4EOSA 3TUDA 3D7ZA 2O2UA 3EKNA 3OTVA 4XRJA 3UG1A 3PDTA 2BFXA 2OBJA 2WTCA 3Q5IA 4FSQA 4MXCA 3Q6UA 3O8PA 3COHA 4FNXA 4QYFA 4D2RA 3NZ0A 3QYWA 3GGFA 3JYAA 1YXSA 3JVSA 3VC4A 5HBJA 3FMNA 3LCSA 3F88A 5CENA 4E4LA 3FV8A 5IQAA 2VU3A 1G4AE 3NPCA 2KNAA 5BUIA 2QOOA 5DR6A 5AP6A 2XH5A 3P9JA 4Y85A 4N57A 4BCMA 3ZYAA 4ASXA 3VBWA 1XBAA 3K5VA 3NR9A 5L2QA 4O0VA 1FOTA 4J52A 3RAWA 3DU8A 5H3QA 2VGOA 3M2WA 3KQ7A 1ATPE 3DY7A 4J1RA 4AOJA 2JDRA 2WD1A 1Q97A 2GNHA 5CAOA 3VULA 2XJ2A 2OFUA 5FTGA 2OJIA 4RIXB 1NVRA 4FTLA 3PXFA 3AG9A 3CGOA 1ZZLA 5EDPA 1OPKA 5GZ9A 5DHJA 1OZ1A 1H08A 4BCGA 4O0TA 4QMYA 3DNDA 4L68A 4IAIA 3MFRA 1OKYA 2YJRA 4BDCA 4D5KA 1PRYA 3FRHA 4BDBA 3E8EA 4FKVA 1UVRA 3S2PA 4FEXA 4UZHA 1WBPA 1T43A 5IMEA 1E94E 1DV0A 1MRYA 2QOCA 4ID7A 4L44A 2YWVA 4DG2E 5CEMA 4QTAA 2UZTA 2EXCX 3A7FA 2BPMA 2ZDTA 4HCTA 3T9IA 4UMTA 5EI8A 4IEBA 1HQYE 3U54A 4XRLA 4DC2A 1UKHA 3BEGA 2ETMA 4G9CA 2HAKA 5HLNA 1VEJA 4C59A 3I60A 4L45A 4O1PA 4X3FC 4X6RA 3G9LX 1YQJA 1F3MC 3PLAE 1Y6AA 2YM8A 5ETIA 4EKKA 4FVQA 4AXAA 2JY7A 5CWZA 4UMPA 3L1SA 4AT3A 3CSVA 2XIZA 3IGOA 1PJKA 3SDJA 1Y91A 1JR3E 2YM7A 2I7QA 1W8CA 3KFAA 2I1MA 1ZMWA 4EHZA 1IA9A 4PPBA 3COMA 4IX5A 5DR9A 3TZ9A 5CAPA 4BI2A 4BF2A 4CQGA 1VEBA 4L01A 1YDTE 4MWIA 2F7ZE 4W4XA 5L2SA 2OFVA 4USFA 2YM5A 3V51A 4E3CA 4I4FA 4QYYA 4X7QA 2XNMA 1QZEA 3QZGA 4PF4A 3PZHA 3LE6A 4ASZA 3V3VA 1R3CA 4L46A 4ZTLA 3VIDA 5C26A 3ZC5A 2WAJA 4KABA 3QKKA 1J1BA 3EQRA 4FTJA 4X3FA 1BL6A 2WQMA 3CJFA 4S34A 3QL8A 4CZUA 1O9UA 4EYJA 2YLEA 3LQ5A 4IH8A 5IZFA 2R9SA 3RPRA 1DO0A 2X0GA 1XH9A 4LGHA 3HL7A 5JT2A 1GIJA 3E46A 4QPSA 4AW2A 3P86A 4MXOA 2PK9A 4OTDA 4XP0A 5M08A 3R1SA 4BTJA 3BZ3A 4EWHA 3FEGA 5F4NA 3Q52A 3MB7A 4UB7A 4Z7GA 3PFQA 5GIOE 4KBAA 4MNFA 3UOJA 1J7UA 2JD5A 2J2IB 1HCLA 2F2CB 2J90A 4ONAA 4FEWA 3IW5A 4G3CA 4NKSA 3NCGA 5CXZA 1PXKA 4LOQA 4F6SA 3GU6A 2CLQA 2XNBA 3MV5A 3NUSA 3ELJA 3QRTA 4QT1A 4EZ3A 4QD6A 4D2VA 3CTHA 2PL0A 1H25A 2GNGA 4IQ6A 4YNOA 4FKIA 3NYOA 4FTNA 5AP7A 4BZNA 3ZHPC 1OITA 3VRYA 5J1VA 4QP2A 1WR1B 3D7TB 3DAKA 3F82A 1SMHA 2RG6A 4OGRA 2IWIA 4Q5HA 4FC0A 5CT7A 1ZYLA 4J95A 4RWIA 4QQTA 1XH4A 2R5TA 3IPHA 3PP0A 3ODZX 2OZAA 2PSQA 4PP9A 4YO6A 3SQQA 5I5ZA 4Y73A 4JQ7A 3LAUA 2VZ6A 4FKRA 1JKSA 5TO8A 4UXLA 4DLIA 4D4SA 3FI8A 3GXLA 3I5ZA 4AGCA 3DZQA 4RQVA 4BZOA 4AA5A 5CTPA 2BFYA 4YJSA 4YNEA 3WZDA 4AX8A 5BVOA 5E8ZA 1RW8A 2JDOA 3AMAA 3S1HA 4GYGA 1Q8ZA 2XA4A 3PXZA 4NW6A 4IFCA 4PTEA 4QYEA 4S32A 4M0YA 5CI7A 5H8GA 5IPJA 4I94A 3PIZA 4GYIA 5HEZA 3TJCA 3EZRA 2SRCA 4AG8A 2BHHA 3C4FA 2XBAA 4RVLA 5AV4A 3MPAA 2JY8A 2Z7RA 5TT7A 4QYHA 2HZIA 4FT3A 3PG3A 2Y6OA 2ITWA 4AWIA 2R3LA 3RALA 3OXZA 4U43A 4FUXA 4MXAA 5ANJA 4AZEA 5B2KA 4A4XA 1G5SA 4TRLA 3FLYA 4KIOA 4KNBA 2R3NA 4IAAA 4ZY5A 1H1WA 3CD3A 4O0UA 4LUDA 5AR8A 3DOGA 5HOAA 4A7CA 4AFEA 3HV3A 5J7BA 4BDHA 4TYHB 5I9ZA 1M2PA 4LRJA 1H4LA 1UNGA 5L2TA 2BKZA 2PYWA 3WE8A 3UO6A 3MWUA 2HW7A 1YOJA 5E8TA 3VNTA 3UZPA 1RJBA 4R3RA 3ZO2A 3QCQA 4DTBA 1WBNA 2JAVA 1UNLA 2V7AA 3DAEA 2Q83A 4FV9A 3R21A 4K11A 1A06A 4C57A 2P2HA 4M13A 4OW8A 2W1FA 5AP0A 2HELA 2BIYA 3JY9A 5LVLA 4E26A 4EK5A 3RCDA 5JMSA 4O7TA 3FQSA 4LQMA 3QD2B 2LVAA 5DVRA 4XLVA 2H9VA 3FSKA 4FSWA 2XYNA 1OTRA 1Q8UA 4G3FA 4GEWA 5AP4A 3RWQA 1M17A 3BHTA 3OWLA 3Q96A 3VF9A 3ZLXA 4IJPA 2OLCA 1Y8YA 2WQBA 4YPSA 3R0TA 3TKUA 2DAMA 1KE5A 1NW1A 3G33A 5H2UA 3QWKA 3R28A 3QZIA 3NUAA 2CGVA 3K9OA 4MBJA 3HP5A 3NYXA 3NGAA 4LGDA 4XH6A 3L8VA 4IC8A 3ZU7A 3QUPA 1XXHE 4D58A 5JI2E 3BWJA 5EKNA 3PY1A 5I3RA 4DFXE 5A46A 3VHEA 4KKHA 4TL0A 4E5AX 3IDCA 1KV2A 4IZ7A 4I0RA 4C4EA 4ZTMA 3KREA 5HCZA 3DXPA 4U45A 2G15A 2I0HA 3S3IA 5CSPA 4JVGA 4IM0A 2X2LA 1YHVA 2YCFA 2LBCA 3EQHA 1U59A 3D5XA 3QTWA 4BR3A 1BYGA 3EFKA 4QMTA 5TOZA 2PMNX 5I9UA 3FQHA 3O23A 1H1PA 1M7QA 4GH2A 1P2AA 5FM3A 3SW4A 1JLUE 2VTQA 3DLZA 3SOAA 2XNGA 5A6NA 2UW7A 2C4GA 4FTMA 1ZMVA 3V6RA 4O7RA 2WEVA 1NVQA 5E8VA 1XWSA 1Z9XA 2E9OA 5HX6A 5CS6A 1U4DA 1T46A 4CZYB 4G3GA 2YIXA 4RC2A 1DI9A 3H4JA 5FXRA 4FGRA 4RT7A 3I4BA 5HTCA 5BVWA 3BV2A 4C2WA 5L6WL 1G3IA 3R73A 4NIFA 4FTRA 4DGOA 1FINA 4HPUE 3VBYA 3T8OA 5IUGA 3PP1A 3KXNA 4KSPA 4ASEA 5EYMA 5LWNA 2O5KA 5J5TA 3QKMA 4IAFA 4R7HA 4U44A 2FYSA 2C5YA 3EL7A 3IGGA 3O17A 5EKOA 4FBXA 4Y8DA 4CRSA 4C34A 5JKGA 5HVKA 3RM6A 3PIYA 3EQPA 1K2PA 3ZRKA 1ZLTA 3SXSA 3HUCA 4I6FA 4IX3A 4F7LA 4HNFA 2CGUA 2BRHA 2QOBA 3B8QA 2YDJA 3RPSA 4J7BA 4FGBA 3ORKA 4NK9A 4TYGA 4W9XA 4PY1A 1XH6A 5A6OA 3ID6C 3GU8A 4XOZA 5FEEA 5JFXA 3UOHA 3H30A 4U81A 5DI1A 3OY1A 3RJCA 5IQHA 4C02A 2IPXA 4F65A 3ZUVA 3QQKA 4YZNA 4ANNA 3NAXA 5KZIA 4Q7JA 3JY0A 3DBDA 3FBVA 3GLHE 2PVYA 3MI9A 3PVWA 4UZDA 5AR2A 4I22A 5IKWA 4FV0A 3V5JA 3FLSA 4TWPA 2C5XA 4XBRA 2ITXA 3LJ2A 4QMQA 2HZ0A 2OIBA 3ZLYA 1TKIA 4KAOA 1M7NA 4QPMA 5DRBA 4NTSA 5DYJA 3HRCA 4AA4A 4X2GA 3TIYA 4GFOA 3A7HA 3PPJA 2VV9A 3ROYA 2W1ZA 5D41A 1Q4LA 2WTVA 3NX8A 3AD6A 2W7XA 3KULB 2GS6A 2UZOA 3QLFA 3QGWA 5EM8A 4HVSA 5GJFA 3SXRA 4W8EA 5AUZA 5LMBA 2G2HA 2VAGA 3UC3A 4ZJIA 5TKDA 3LM5A 3Q60A 4LL5A 4EOKA 3DK3A 3AMBA 2W9ZB 1GIHA 1STCE 5G6VA 3P4KA 4YC8A 4YTHA 3I6WA 4FX3A 3PY3A 2CNUA 4E4NA 5A4LA 2RL5A 4B0GA 1BLXA 2CGXA 5BVNA 4I6HA 3FC2A 2CWBA 3FMKA 5I3OA 4DN5A 1VDLA 1W98A 3BX5A 3JPVA 4KBKA 3R8ZA 4I41A 2B9JA 4H3PA 4EOPA 4M69B 4N4SA 4NM7A 4TT7A 5LCKA 1FPUA 1H8FA 4QP4A 4PV0A 2CCIA 3PRFA 4RWJA 5FP6A 4IVBA 2QQ7A 4WBBB 3JXWA 3E93A 4BCNA 5FD2A 3HUBA 3C4EA 4EHEA 3ATSA 4TYJA 4JDJA 4WD5A 3R9RA 4F1IA 4AZVA 5AM6A 5IA2A 5HESA 4DEAA 1B38A 2JUJA 5FXSA 2VTHA 4M67A 4MD8E 4CV9A 5ICPA 1OIQA 1JVPP 1CKJA 4WG4A 5AX3A 3TDVA 1YVJA 5KE0A 3CJGA 2RRUA 3AC8A 4AOTA 3GU4A 3AC3A 1WVWA 5DIAA 3U87A 3FPQA 2RGPA 3IOPA 1XR1A 4BGHA 1OGUA 1KYIA 1Y8GA 2PMOX 2QOHA 5T3QA 5L4QA 3FMEA 3MVJA 4BCQA 1EFUB 3MPMA 3ET7A 3OP5A 3OS3A 1QMZA 1RQQA 2CSNA 2DS1A 4IHPA 4DH7A 4QMNA 1TQIA 4I5MA 2CKEA 3PE2A 4GUEA 4OTGA 1ZZ2A 3OEZA 4R1YA 3A7GA 3KEXA 3R71A 1CTPE 4EI4A 3NRMA 4O27B 4OT6A 4ENYA 4EOJA 2WPAA 4OBOA 3HDMA 1H07A 5AEPA 3BCEA 1TTEA 4DFYA 1JKLA 2V7OA 2Z02A 2PZYA 4TXCA 4ASDA 4CZTA 4Y72A 4ENXA 5E1SA 3R7GA 2YWPA 5LOHA 2LVQD 1YI4A 4O83A 1LEWA 4RLKA 2JDVA 3R2BA 4CD0A 4P7EA 4PMMA 5AFVA 3GEQA 2B55A 2VO6A 5CSHA 4IVDA 3LFAA 4LFIA 5GHVA 2BTRA 1HT1E 2ERKA 2XEYA 3DKGA 3HRBA 3V5TA 3VS4A 5AUWA 1FGKA 2VUWA 4ANMA 4DGLC 4PPAA 5IDNA 2X8EA 2VTPA 3V8SA 5BYYA 3MYGA 1JSTA 1YDRE 5AX9A 5DH3A 5C27A 1JKKA 2C3KA 1VG5A 2F49A 3A8XA 4IZAA 4JX7A 3JUHA 4KWPA 3EN4A 4W4YA 3TT0A 3UYSA 4BDEA 3GNIB 5J9LA 5AAGA 4Q9SA 4EH9A 5J5SA 1XBBA 2QCSA 3N51A 3OUNB 4L7FA 4QTBA 4XG3A 3QZHA 4APCA 4C2VA 4DFUA 3CCNA 4IADA 4IXPA 4J71A 4C58A 4D1SA 2ZV2A 2HOGA 3C1XA 4II5A 2BCJA 2K0BX 3BU5A 3KULA 2HK5A 2XIKA 5CI6A 2V5QA 3K5UA 5FTOA 5B0XA 5FDPA 5K5NA 2CLXA 5BNJA 4HNIA 5DT3A 2WO6A 1W0XC 4EK6A 2YAAA 3IOKA 3PSDA 2VGPA 4O0YA 1K3AA 3TTIA 1H0WA 3E62A 3LJ1A 4GW8A 1J7IA 4GKHA 5M07A 1HT2E 3TCPA 5CU6A 5ETAA 3EIDA 4LGGA 2C5NA 3RAKA 3PY0A 1JKTA 1PYEA 2OXYA 3RZFA 4EOQA 3GI3A 4DCEA 3S0OA 1WMKA 3Q9ZA 3CD8A 3DS6A 3ACJA 2WU6A 3D4QA 2GTNA 2QKWB 2J6MA 4NM3A 3MDYA 3EFLA 3A4OX 3AQVA 4WO5A 4MQ2A 3UIBA 5EYDA 3GENA 3W2CA 2UVXA 3F69A 2EXMA 5AADA 3F3UA 3UOLA 1ZOEA 3DBEA 4Q2AA 5AV3A 4LI5A 2GSFA 3ANQA 4NFNA 4KBCA 3C4WA 4RJ3A 3I0QA 1SVGA 4WG5A 2NRYA 4I24A 3GU5A 4QP6A 5KMOA 5M44A 4FKQA 4D4RA 4F64A 3RK9A 4OTWA 4FEUA 3E8DA 3IKAA 3L9MA 3B89A 2K9DA 3BI6A 1NT2A 3RPOA 3DBCA 4JI9A 3FRIA 2CMWA 5EM7A 5E91A 4ALUA 1KSWA 3V5WA 2B9FA 4IAKA 4RJ7A 3NYVA 4PPCA 4QMPA 2H34A 3BLHA 5AR3A 4YHTA 2EXEA 4RFYA 5AA9A 3NLBA 1PKDA 2FSTX 3KCKA 4I4EA 3O7LD 4GK3A 3VUDA 2OH4A 5IU2A 3ZSHA 5GNKA 5J1WA 2O3PA 3FLQA 2OIDA 1HOWA 4FKLA 3W2PA 2ZMCA 4R7BA 4A9SA 3TZ8A 2Z7LA 3IS5A 3OC1A 3QTZA 4NUSA 3TNHA 1REJA 2C1BA 3FZ1A 3GCSA 3W8LA 4EC8A 3D94A 4AU8A 3VVHA 4O38A 2R7IA 3OT3A 4W9WA 2C6IA 1G41A 5KMJA 5E90A 4HGTA 3HLLA 3VS5A 2V22A 4IM3A 5AM7A 4K18A 4XHKB 5IA1A 1Q8WA 5A4TA 5FEDA 4YP8A 3G6HA 4AE6A 2YDIA 2ONLC 3TWJA 4AUAA 3QQFA 3NCZA 4GVAA 5EI2A 3LCOA 1OMWA 1UU9A 2FUMA 4ZIMA 4BZDA 4YGAA 2OKRA 2Z7QA 2RF9A 4FTQA 3V5PA 1QPDA 4ANQA 4XG7A 1V92A 4XCUA 5EG3A 3THBA 3VUTA 5G1XA 4D2PA 2YCSA 4H1MA 1IG1A 3RCJA 4QP8A 1Q3DA 3F9NA 1CKIA 3DQXA 1VQ1A 5CT0A 3KY2A 1U54B 3UDBA 4NJDA 4FKWA 2XNPA 3DKCA 5EK7A 3W16A 3ZH8A 4ACCA 4DG0E 5ITAA 3Q4ZA 5JK3A 2WOTA 3UOKA 5HE3A 3FE3A 2LGCA 3C4ZA 4YTFA 4EH7A 2DNAA 3NMUF 3UIUA 5ANOA 1VEGA 2FSOX 4NCTC 3GOPA 4FG8A 4FL3A 4K33A 2VD5A 3AC1A 3KMWA 3R7VA 3QTQA 5D1JA 3W2OA 2IZRA 4JRVA 3O50A 5C8KA 1DAYA 4K2RA 5T68A 2BRGA 4HW7A 3CBLA 2BVAA 5AAEA 2VTTA 2UW4A 5AUYA 2ONLA 4HYIA 3F92A 2VX0A 3BEAA 2BWEA 5KMNA 3EHAA 3BE2A 3P78A 3QBNA 4IWDA 3DBQA 3GCUA 3COKA 4BDFA 4E5WA 2PWLA 4FIGA 3LXNA 3ZBFA 2QOIA 4G6OA 4MQ1A 3ENHA 3R7OA 4KIPA 5EH0A 5HCYA 3RVGA 3SRVA 2G1TA 3ZXZA 2GNFA 2KNVA 4MVFA 2UW0A 3BELA 3II5A 3DJ6A 5DFLA 1UWHA 3GVUA 2XRUA 4K0YA 4B6LA 5IUHA 3OD6X 4BDJA 4X3FB 3WF8A 3WYYA 5CZHA 4YBJA 2B53A 4HVGA 2WIHA 4CFXA 3UQCA 4NCTA 2A2AA 4OTQA 5DOSA 4RZWA 2G9XA 4XYFA 3UQGA 2BR1A 4QMXA 2WFYA 3FUPA 3ORMA 5KMKA 2ACXA 4F4PA 5HNIX 4WNMA 4GIIA 3FKOA 4DFNA 2ZDUA 4U40A 2XKCA 2WMVA 3PPZA 1WBWA 4KKGA 1H1RA 1I09A 2ZYBA 4EOIA 4EWQA 5AR5A 3LVPA 4U79A 4JXFA 2XBJA 1BI8A 2BROA 2WTIA 2PPQA 4GSBA 4E6DA 4EC9A 1M2QA 1OL1A 3NSZA 3VS0A 1ZAOA 4CRLA 3BE9A 1JBPE 2A0CX 4ZSGA 4YMJA 3QUEA 5M51A 3QTRA 2GQRA 2G2IA 2R3PA 5L2WA 3PSBA 4IWPA 3MFTA 5BVDA 4AF3A 2C47A 5DGZA 2OZAB 3TACA 4LV5A 3R1NA 4GK4A 1PXNA 2C6EA 3D2IA 3OUKA 4TWNA 3QLGA 3HMMA 2JC6A 2YISA 4OTIA 5E8UA 3DQWA 4WNOA 4F7JA 5LJJA 3SV0A 3NIZA 2CPKE 3BGQA 4F63A 2R7BA 1Y57A 1PXOA 4L53A 3GC8A 2ITTA 4AA0A 4P4CA 3NW5A 3EQGA 3RGFA 4BHZA 2W17A 3KXHA 2EJSA 4BIBA 4H3QA 4PL4A 2QD9A 4F1OA 4JDIA 4D9TA 3UO5A 4O0SA 1KUTA 3R2YA 4M3QA 2YAKA 4PL3A 4HCVA 2WTWA 5JRSA 1BL7A 2ITVA 1T6OA 4GFGA 5C8MA 4NW5A 4ACDA 1M2RA 5D10A 4ZSLA 4BKJA 5CAQA 4NFMA 2VX3A 2UZWE 3BBZA 4NEUA 3WZKA 1YWVA 2F4JA 1O6KA 5EI6A 2C5VA 4YLJA 2XK6A 1U54A 4D1XA 5K9IA 5L6OA 4OR5A 4Z7HA 3E8NA 4BDAA 1YLAA 2IN6A 4CT2A 3P79A 5I9VA 3DK7A 3EFJA 4Q5EA 3DV3A 3W8QA 4EEVA 3TDWA 3GC9A 4D1ZA 1NV8A 3GFWA 2JZ0A 2VWYA 4JDKA 4TYIA 4AT5A 3W1FA 2PU8A 2B4SB 3BQRA 5H9BA 3WIGA 4ZLOA 2ESMA 1XH5A 2DYLA 5M57A 4E6AA 3N4VA 4WBOA 2J50A 3QKLA 3AGLA 3WARA 4ZJVA 2UZVA 4O6EA 2Y6MA 2BKKA 1Q41A 4UV0A 1OKWA 5KHWA 5IA0A 1JNKA 5LARA 4FTCA 4RJ6A 4B9DA 2WMTA 3PZEA 1V0PA 2XKEA 4FKTA 2YITA 1OUKA 4O1OA 3TV7A 5ETCA 5EW3A 2FO0A 3EZVA 1WVXA 3R30A 4IX6A 4RG0A 1WFCA 4EUTA 3EWHA 1Z5MA 4QMUA 5DA3A 3DB6A 3TV4A 1WIVA 4DBGB 3OOGA 2C0OA 4M14A 4JQEA 3TNQB 2JITA 5ANDA 2IVTA 2R3MA 3T3UA 2PULA 3NNXA 4YJPA 5DG5A 4V0GA 2QOLA 5DLSA 2YERA 4GG5A 5IEXA 3HAVA 4O7SA 4D0XA 2BZJA 4JG7A 3HV4A 3FKLA 3F5XA 5H8BA 2A27A 3UIMA 4OUCA 3ITZA 3UVQA 2DENA 3LCVB 3POZA 3CKWA 2PZPA 3AC5A 4BGGA 3I7BA 5C9CA 4DEIA 4YJQA 4FZ6A 3CEKA 1W83A 3RM7A 4DHFA 2CKQA 2PMLX 3CGFA 4G2FA 4UALA 2ZB1A 3D9VA 4FSZA 4YSMA 3A62A 4O0WA 2PE0A 4ZZOA 2H6DA 4J8NA 4ERKA 2QG7A 3V6SA 3PXKA 4D2WA 5C4LA 5JFSA 4BBFA 3IQ7A 4ALVA 2PUNA 2OK1A 2GFCA 3CQEA 3OCSA 4G31A 4HYSA 3LFDA 2ZTDA 4O2ZA 4PRJA 4WOVA 2C3JA 3BHUA 5EDRA 3EKKA 2EWAA 3ROCA 3ZFMA 4R71A 3C7QA 2IVSA 3CTJA 3FMMA 5IEYA 5M09A 5FRIA 3OXTA 2XVDA
chains in the Genus database with same CATH superfamily
3H10A 4BGQA 4NIFB 4BTFA 2LXEA 3NUYA 1BKXA 3U61A 3IW8A 2X6EA 4PUZA 3T3VA 3QU0A 4GK2A 3AOEA 4YSJA 2J0MB 4HYHA 4ITHA 2ZV9A 4QQ5A 2FS1A 4EJNA 3HNGA 3TEIA 1OPLA 4LUEA 2IW6A 1TQPA 3IDPA 4FT7A 3Q2JA 4CLJA 1YI3A 4P2KA 4H3BA 4MXZA 4EK8A 1ZOHA 3T38A 2HY0A 2B54A 2OIQA 3MESA 4LCBA 2H96A 1OIZA 2JIIA 2QO2A 4KKEA 3TUBA 1OB3A 4DUYM 3SAYA 4K8AA 3FUXA 4YZCA 3PUPA 4RX8A 2C96A 4M8TA 3CTWB 4BCHA 5M53A 4YY3M 2BDWA 3ERKA 1J5EM 2RSVA 2ZOQA 3VK8A 2R3IA 3PFIA 5GJDA 5CQUA 3DCVA 4YZDA 4M9SA 4FL1A 2XCKA 3VJNA 2ITZA 4FKSA 4AW0A 3EN9A 3UODA 1PGYA 3REPA 3BLRA 1DI8A 4HEOA 4K1BA 1NHWC 3FD9A 4EL9A 3KRLA 4FEQA 3R8LA 2XF3A 4FKOA 5ANIA 4A9TA 3Q32A 4DH5A 2R2PA 1OL7A 2WOUA 5HVYA 4NSTA 1OKVA 3W18A 3KRJA 3MB6A 4FNWA 3DKOA 3EQBA 1GJTA 2JY6B 2P5TA 1SYKA 4MHAA 1R2YA 3PYYA 2KHHA 5EP4A 1NY3A 1R0PA 2HZ4A 2EB3A 4JS8A 4CIZA 4DFBA 1E1XA 3BYSA 4FL2A 3VFDA 4B7TA 4M0ZA 3MFUA 2W4KA 3EQCA 3LFQA 4JR3A 4IIRA 5BUJA 2CKPA 4L67A 4FSMA 3MH3A 3HECA 2VNYA 2R18A 5BPYA 1C1KA 4KLNA 5HCXA 3W32A 5AA8A 3D0EA 5DBXA 4TNDA 3ANRA 4IZ5A 1OAIA 4L9IA 2EKKA 4CISA 3DPKA 4U41A 4TY1A 2EO2A 3GLIA 2R4BA 3BRBA 2MR9A 4L4UA 3VUIA 2AEGA 4AXFA 4B3MM 3RK7A 1JQHA 3FXXA 3VBQA 2G01A 3ORZA 1FQ1B 4IMYA 4OU7A 2P55A 4DA5A 4G34A 3GCPA 3MVMA 1YHSA 4ZTSA 4M0WA 2C6TA 2QR8A 3ZMMA 2PVFA 4NL0A 4PTGA 4RLLA 2ZV7A 3U6SA 4JG8A 5FG8A 2W4JA 3KOXE 1XBCA 5IH5A 3PVBA 2LVOC 3U9CA 2ZAZA 2DI0A 5F9EA 1TFFA 1L8TA 3TTJA 4GVJA 4QHTA 2XK9A 3ZO4A 5D11A 5E8XA 4FZDB 4C37A 2BILB 4UXQA 2UW5A 4O21A 3QXOA 3MTFA 3KXGA 3TZMA 4CMOA 3HJ8A 4DYMA 2PVMA 5KMIA 4YJRA 1E9HA 5DE2A 4EK3A 2AQXA 3U6OA 4IBCA 1VJYA 3PLSA 2QOKA 1ST0A 2WHBA 3FYKX 4GJ2A 5ITXE 2VWUA 1ND4A 1L3RE 3ZBXA 2XFTA 2C30A 3CE3A 3R1YA 4GEOA 4RFZA 2PE1A 4RIWA 4EYMA 2WU7A 2I0VA 2C3LA 5AR4A 5K0KA 4ZTHA 4FZAB 2YN8A 3OW4A 4XOYA 2VQEM 3VO3A 4BFMA 2N35A 4TWOA 4GUBA 4JBOA 4R3PA 3R8MA 4H05A 3TL4X 3UQFA 2R0UA 4I81A 2J51A 4FIIA 5AUUA 5CAVA 2R3QA 4XBOA 2X1NA 5DEYA 2XS0A 2C0TA 3F6XA 3Q4TA 3PXQA 1Y6BA 3R9HA 1CKPA 2EUFB 1VDDA 2CNVA 2RFEA 2P33A 2IZUA 3ZOSA 3W0FA 2C5OA 4D28A 1W82A 3NAYA 4X2JA 4D9UA 3G9NA 1GVNA 3GP0A 3RPYA 1JR3A 3F2NA 4FTKA 4LMNA 3QD0A 5EHOA 4CTCA 2WMUA 3OHTA 3LCTA 3FAAA 4TWCA 3AOXA 3QQJA 5EHYA 1SVEA 2DWMA 5GZAA 1FMOE 4DDGA 3JR4A 5LMKC 3U61B 2QCUA 4DR3M 3KKVA 1JSUA 4OTHA 5KNJA 2UZNA 4BC6A 5EW8A 3KGAA 2EA0A 4S33A 3QQGA 1TH4A 3ACKA 1FNNA 4MTAA 4QMLA 1Z5CA 2DUVA 2PZIA 2BTSA 2REIA 3KU2A 3SA0A 3C5IA 3EB0A 2CN5A 2YIYA 5LMKA 5CEQA 4X2KA 3E9SA 3AGMA 3UNJA 3H9RA 3FXWA 2KTYA 1FJGM 4M68A 3SHEA 2JKKA 2OO9A 1SZMA 4JOAA 5IQFA 4Y46A 3WF5A 3HV6A 3ZC6A 2XUUA 3WZEA 3B7NA 3SYKA 5M56A 5IREB 3FY2A 1ZRZA 1Q3WA 4ZTNA 1WVYA 2QHNA 5CF8A 1OI9A 2WTJA 4APPA 3UP7A 2X4FA 3OY3A 4F2LA 4DFZE 1XNRM 5IT9S 5FP5A 4FIFA 3N9XA 5AV2A 4JI0M 4LJAA 2BIKB 1XXHA 3EQIA 2VQFM 4HOKA 4WT6A 2CHGA 1JOWB 5CU2A 5IDPA 1MN3A 5IQIA 2IG7A 4DV0M 4FTUA 4A3VB 2WXVA 3W2RA 4F0IA 5HO6A 3ZC7B 4ZSAA 1XKKA 2XIRA 2XB7A 2XK4A 4RIXA 4R1VA 1Q02A 2BAKA 2IO6A 4Y95A 1A48A 4CV8A 3VJOA 2B0QA 2OJFE 4FK6A 3RPVA 4DE4A 3SBJA 1Q61A 4IWQA 4KA3A 4NXNM 5IH6A 4MCVA 4B8MA 4ERWA 3H3CA 3L8PA 2R44A 4X21A 2BZIB 2VWVA 4ZOGA 3HAMA 4DBXA 5M4FA 1OIUA 3UZRA 3C5UA 5H8EA 5J7HA 5HTIA 1L1ZA 5EOLA 4QMZA 3G90X 1OVEA 3C0GA 4E5BA 5HGIA 3VAPA 4BBMA 3ZEWA 1QPEA 1SXJD 4MBLA 3QC4A 4F1MA 3R7EA 3PJ1A 3OBJA 3LFEA 4BBEA 2ZM4A 5A54A 3KN6A 1U5QA 1NVMA 5IQCA 3R7YA 3IK3A 3L8SA 2YM4A 2YABA 4CYJA 3LFSA 3H0ZA 4MBIA 3GLIB 3CTQA 3LPBA 4YJNA 3D7TA 3WF6A 3MIYA 1T45A 3GFEA 2L4EA 4I21A 4F9BA 4PNKA 3N4TA 1L2CA 2VWWA 4TPTA 4BDGA 4L42A 2FOIC 5J87A 2YFQA 5EYCA 4I6BA 4AGWA 2WGJA 3IHPA 3DGKA 3K1JA 4QMSA 1ZV1A 4XLIA 4KSQA 3BPRA 4U42A 3C51A 3VBXA 3KRXA 1PJJA 4NKAA 2JKOA 5J9YA 2ZM3A 1WAKA 4XP3A 1IBMM 2KA6B 2YCRA 5BMMA 2JKMA 3NBXX 2KRKA 4IZYA 2UW9A 5F1ZA 3GU7A 2EU9A 3PXRA 4D4YA 3Q9YA 5L3AA 1P14A 4RVTA 1AIPC 3ODYX 3W0SA 4EH5A 1G8AA 4GIHA 4IANA 1QAMA 4G3OA 3DFCB 3W2QA 2X8IA 3TWMA 1P4OA 1O6LA 2ZV8A 2QODA 3BHYA 1NSFA 4DITA 3WF7A 1N78A 5DRDA 5KBRA 2OF4A 3UIXA 4KB8A 1IAJA 2H5XA 2XIXA 4FVRA 2GMXA 5LVNA 1A9UA 4RIWB 2Y0TA 3KC3A 1LV7A 4XP2A 1Z5AA 1H0VA 2RGHA 3GCVA 2WKMA 2GFSA 2LVNC 2D7HA 5E8SA 1IRKA 3OCBA 1VYWA 5FTMA 4RWLA 1C7YA 1DGGA 4PDYA 2LVPC 4L52A 3W0OA 1OIYA 2VTJA 4AW5A 4YLLA 5H37D 1OFHA 2YZLA 3BOSA 4AZTA 4F99A 5AAFA 3MVHA 2GNJA 2A98A 5CF4A 4GC9A 2HXQA 5LMUM 1OL5A 3PIXA 2IZTA 4DFLA 4O22A 4ZS4A 1BX6A 3P0MA 4FT9A 4LGYA 3G15A 4RX9A 4EQCA 3ORLA 1CDKA 5BMSA 4XV1A 5E8WA 3I1AA 3P08A 3ZRLA 4G6NA 3AKLA 3U5ZB 3GPYA 2X2KA 3VUKA 4KUJA 4DHJA 3DLSA 4ALWA 1YI6A 2UVYA 1G8JA 4B99A 4BDKA 4CSVA 4J97A 4LRMA 4J8MA 3CS9A 4ANRA 3F3VA 3RAHA 3QRKA 3R9DA 4GKJM 2W05A 3M0EA 2W1CA 5HIEA 1RDQE 2B1PA 2BRBA 4YPDA 4XNEA 2B9HA 3D5VA 3O8TA 3Q9WA 3U51A 1YOMA 3PRIA 3HJQA 3HMIA 1AGWA 2GQGA 2HIWA 2PTKA 1NJFA 3S95A 2OOBA 4O7YA 1IN5A 2YHVA 4IBKA 4PMTA 4E6QA 3QWJA 5EJCA 3CQWA 3PNVA 4DR6M 4GV1A 5K0XA 4ITIA 5KHXA 2R64A 3NVKI 4QP3A 3DAJA 4WRSA 1XXHB 1MQ4A 3DK6A 2WELA 3K3IA 4EOSA 3UG1A 3PDTA 3COHA 3QYWA 3FMNA 5CENA 3K5VA 4O0VA 1FOTA 1OIPA 3DU8A 5H3QA 3KQ7A 2WD1A 2GNHA 2XJ2A 4RIXB 5GZ9A 3W67A 2D7EA 4O0TA 3HHWA 3DNDA 4D5KA 1PRYA 4BDBA 1IN8A 1E94E 1DV0A 1Q3BA 4DG2E 2ZDTA 5EI8A 4X66M 4G9CA 1YQJA 3PLAE 1Y6AA 2YM8A 5ETIA 4FVQA 3SDJA 3ML1A 1Y91A 5CAPA 1YDTE 5L2SA 2YM5A 4FW9A 4X7QA 1QZEA 4PF4A 3PZHA 1NJGA 4ASZA 4L46A 3ZC5A 3CJFA 4S34A 5IZFA 1GIJA 4QPSA 3P86A 2PK9A 5M08A 3LVWA 3U60A 3BZ3A 4EWHA 5F4NA 1HQCA 4KBAA 2F2CB 1XC8A 4G3CA 4DUZM 5CXZA 2XNBA 4EZ3A 5LQFA 2GNGA 4QP2A 3D7TB 3F82A 1SMHA 2RG6A 4RWIA 4QQTA 3ODZX 2OZAA 4PP9A 4YO6A 4BZOA 4AA5A 2BFYA 4YJSA 5E8ZA 2JDOA 1Q8ZA 4PTEA 5IZ7D 4S32A 4M0YA 3TJCA 4IJEA 2CE7A 5AV4A 3C3EA 3MPAA 2Z7RA 5ITYA 3PG3A 1NY5A 4TRLA 2R3NA 1H1WA 3DOGA 4AFEA 1H4LA 1UNGA 5L2TA 3UO6A 3MWUA 2HW7A 3ZO2A 3UZPA 4DTBA 2V7AA 2Q83A 2HHHM 4M13A 4GH9A 2W1FA 3JY9A 1H6UA 3FSKA 4FSWA 1Q8UA 3RWQA 1M17A 2WQBA 3R28A 5IWAM 3NUAA 3K9OA 3HP5A 4LGDA 3NGAA 4XH6A 3L8VA 4IC8A 4D58A 5JI2E 3FKEA 4TL0A 4IZ7A 4I0RA 5HCZA 2G15A 2X2LA 4PDIA 3EFKA 2F5OA 3O23A 1H1PA 1M7QA 3SW4A 2VTQA 3J2PB 2WEVA 2DZNB 5BVWA 4C2WA 5L6WL 4ASEA 3IGGA 2C5YA 1MU5A 4CRSA 5HVKA 3PIYA 4F7LA 2BRHA 4TYGA 4PY1A 5JFXA 3UOHA 3ZUVA 5KZIA 3JY0A 3PVWA 3GLHE 4XBRA 2ITXA 3LJ2A 3ZLYA 4GFOA 3KFUG 1NY6A 1Q4LA 3AD6A 2J7NA 3QGWA 5AUZA 4EOKA 1GIHA 1STCE 5G6VA 3P4KA 3I6WA 2CNUA 3W0MA 2CWBA 3FMKA 4I41A 4H3PA 4TT7A 5LCKA 1HR0M 3E93A 3C4EA 4JDJA 4WD5A 3R9RA 5IA2A 5ICPA 2VTHA 5KE0A 3GU4A 4MGYE 3AC3A 5DIAA 4BGHA 1L1TA 1KYIA 2PMOX 4KODA 4BCQA 4LGMA 2DS1A 4QMNA 4GUEA 3KEXA 2M60A 4O27B 4L8RC 2R6FA 2V7OA 2Z02A 4ASDA 3R7GA 1LEWA 1VLRA 4CD0A 3GEQA 5GHVA 2BTRA 3DKGA 3V5TA 5AUWA 5IDNA 2WSEF 4PPAA 5AX9A 1YDRE 1VG5A 5J5SA 4APCA 1S3SA 4IXPA 4C58A 2ZV2A 4II5A 4Z6YA 2HK5A 2XIKA 2YAAA 3IOKA 2VGPA 4O0YA 1K3AA 4GW8A 5M07A 2OXYA 3GI3A 4DCEA 1WMKA 3ACJA 3DFZA 3EFLA 3A4OX 3BL7A 2W82A 4NL4H 3I0QA 1SVGA 4I24A 5KMOA 4FKQA 2R46A 4FEUA 3BI6A 3DBCA 4JI9A 5E91A 1KSWA 3V5WA 3NYVA 4PPCA 4YHTA 1PKDA 4I4EA 3PVSA 3VUDA 3ZSHA 5GNKA 1HOWA 4A9SA 3AV0A 2R7IA 3OT3A 2C6IA 1G41A 1WXQA 5E90A 3HLLA 4IM3A 5AM7A 4GIPA 4XHKB 4L16A 5IA1A 5A4TA 3G6HA 5EI2A 4BZDA 1UU9A 2OKRA 4FTQA 3VUTA 3RCJA 1Q3DA 5CT0A 3W16A 4ACCA 3ZH8A 3Q4ZA 3UOKA 3FE3A 2FSOX 3GOPA 3KMWA 3QTQA 2IZRA 3U6PA 4K2RA 5T68A 3CBLA 4HYIA 3EHAA 3QBNA 4E5WA 2PWLA 4MQ1A 2C9OA 3R7OA 2RGOA 5EH0A 4RF0A 2UW0A 3BELA 2XRUA 3OD6X 1W5SA 2B53A 2WIHA 4QMXA 3VKGA 2WFYA 5KMKA 3U60B 3UDTA 4EWQA 4P17A 4U79A 1BI8A 2PPQA 4EC9A 3VS0A 3BE9A 1JBPE 3QUEA 3QTRA 3MFTA 4AF3A 2OZAB 3R1NA 2C6EA 1YE9A 3LMMA 4MGIE 2YISA 5E8UA 4WNOA 5LJJA 3NIZA 3PUFC 2CPKE 4L53A 3GC8A 5L8RF 3NW5A 4BIBA 2EJSA 2QD9A 4JDIA 5JRSA 1T6OA 4ACDA 4IBEA 1M2RA 3AJIB 2UZWE 2RKOA 1YWVA 4YLJA 2XK6A 4OR5A 3E8NA 1YLAA 3DK7A 3W8QA 4EEVA 3GC9A 4D1ZA 2VWYA 3W1FA 2B4SB 3WIGA 2DYLA 4E6AA 1MJGM 4WBOA 4LFAM 2J50A 3WARA 2X4AA 1OKWA 5KHWA 5LARA 4FTCA 3PZEA 5BR8M 1WVXA 4BBAA 1Z5MA 1W2FA 4DBGB 3OOGA 5ANDA 2IVTA 2PULA 3KSJA 4G4QA 3HAVA 3HV4A 3FKLA 5H8BA 4OUCA 3UVQA 2DENA 2PZPA 4BGGA 4JI7M 4DEIA 4YJQA 3CEKA 1W83A 3RM7A 2CKQA 4FSZA 2PE0A 3U6LA 5C4LA 3V6SA 4WOVA 4O2ZA 2ZTDA 3BHUA 5EDRA 3B74A 4JI4M 3ZFMA 3C7QA 3FMMA 5FRIA 2Y20A 1IAHA 4I3ZA 3O5AA 3A60A 1NVSA 4AFJA 3PNYA 1YXTA 5CANA 2KULA 5HG7A 4BDIA 1KE9A 3PJ3A 1PXMA 4U7ZA 2CKOA 5AUVA 2QI8A 2Y8OA 4EUUA 1GOLA 4IDTA 3V8TA 2OI4X 3BBTB 2VN9A 1KE8A 4BIDA 4DG3E 4XK8F 3AXWA 2GDOA 1F0QA 3MIAA 2P0CA 3ALNA 2X0QA 2Z4SA 4FTTA 3KL8A 2F5PA 3ZUUA 1R1WA 1WBSA 5EM6A 4JI1M 3PXYA 1GZKA 1S9JA 4DV1M 4O7ZA 2Z60A 3IW7A 1D0MA 4F6UA 1IQPA 5DT4A 3FQEA 4CCBA 2ETKA 3HY5A 4K77A 4TN6A 2XK7A 4DINA 2IVUA 2GNOA 4LF5M 3V76A 2R3FA 4AKHA 3SC1A 1BMKA 4ZXTA 4LRKA 2WZJA 4X65M 5E4HA 4EOMA 1LUFA 1OUYA 3TG1A 2YZAA 4CKRA 3DB8A 1IFYA 1D0KA 4OBPA 1IXSA 2QO9A 4OTFA 2VWBA 2CV2A 4O4BB 5CVGA 5IEVA 4QPAA 3OT8A 4V01A 3MY1A 3LZBA 4ZSJA 5DEWA 2B7AA 1IEPA 3DZDA 3S4QA 3GRYA 5I9WA 3KXXA 2ITOA 3RBWA 3OOMA 4WG3A 1K9AA 5K3YA 3BHHA 4QO9A 1PJTA 4W4WA 3PWDA 3FI3A 5LCJA 2C9CA 4IBBA 2HL7A 3OZ6A 5IA4A 2XK3A 3UVPA 3H9FA 4LM5A 3LXPA 4PTCA 4CCUA 3UPZA 2W96B 3E63A 2YIQA 4FVPA 2WQOA 4E8AA 4WRGA 2WTDA 5ACKA 4BCKA 2YIWA 5BVEA 2HW6A 3R6XA 4JT3A 4NRVA 3CPCA 3PJCA 3ZLSA 3CP9A 4RSSA 3AT4A 2X9FA 1WBTA 1CSNA 3FDNA 4HLQA 3H4MA 1YXVA 4UEUA 4QDEA 3ZFXA 1SVHA 1XB2B 2AHMA 3AOGA 1CUKA 1V1KA 1D2NA 3OBGA 3FMJA 4MD9E 5I4NA 1MRUA 3FUVA 2Z2WA 4ZAUA 4ANLA 4FV4A 3OFMA 4EOOA 3BIZA 3HU1A 2IJMA 4TTHB 2R3HA 4JV5M 3CF0A 4I5SA 1OKZA 4F70A 2FA2A 3HEGA 5GIPE 2VTAA 4LOOA 1DM2A 5AV1A 4R7IA 3SOCA 4G17A 2E9NA 4FG9A 3ZXTA 2DAEA 4CGAA 4WNPA 3R1QA 3IW6A 2DAGA 3SLSA 3I79A 4KRCA 4I6LA 2DAIA 4DCAA 4A4OA 3GLGA 3SGCA 4G5PA 1G8SA 3JS2A 3AFHA 3BLAA 3OROA 4RBLA 5AUXA 4YTIA 2UW6A 4NWMA 1UFZA 3O0GA 4QQJA 4MNEA 3BGPA 3CKXA 3EYGA 4RF1A 5KO1A 3J7BA 4YURA 1XMQM 4IJ9A 4FOCA 3L27A 4B3TM 4BRXA 4FYNA 3ZM9A 4BCPA 4A4LA 2BWBA 2AYPA 3P5KA 2EUCA 4EBVA 5D9HA 4XV3A 4JG6A 4QMOA 2ZM1A 2XIYA 1NV9A 3R83A 4GU6A 2C3IB 4QP1A 4C33A 4C4FA 2PMIA 3VHKA 3H0YA 3VF8A 4MX9A 3RNYA 4J96A 2B52A 3WE4A 3RP9A 4RA4A 3QTUA 4L00A 3UTOA 3HMPA 3O2MA 4FTIA 2X39A 4DLJA 1SXJB 3LCKA 4TW9A 3TN8A 4QTEA 3G6GA 3Q3BA 3GLGE 3QRIA 3AD5A 2WSFF 2O64A 3FPMA 3QRUA 3SXFA 3PVUA 1GLNA 5EYKA 1WGLA 2R62A 3FI2A 4C4GA 4ZMFA 4UN2B 2WMBA 3NNWA 5I9YA 3C4XA 1PMUA 2IVVA 5ITRA 4USEA 3AMYA 4R7GA 4MXYA 4JBVA 2W4OA 1IN7A 3OTOM 2CCHA 4HPTE 3SG9A 3O96A 2J4ZA 3MBLA 1UWJA 3FC1X 4XG9A 2J0IA 2XKFA 1H1QA 5K4IA 1FMKA 3PJ8A 2DWBA 4ZTRA 5HICA 1FBNA 4BCFA 5FLFA 2OZOA 4FCWA 4CKJA 1E9RA 4AXCA 4FWHA 1UU7A 1GL7A 4Y5QA 2QHOB 3W10A 4S30A 2VTMA 1WHCA 1OKSA 3VW8A 4FZ7A 5KCVA 4AZSA 4F6WA 4CFWA 3NUXA 5CF5A 2KNZA 5C01A 3QUDA 1GO5A 3Q8XA 2ITPA 2R0IA 4XG8A 4BIEA 2HCKA 1H26A 4NM5A 3J80S 3F5GA 3ORIA 3SW7A 2UVZA 3CR0A 5FUTA 5AP5A 2WQEA 4DBNA 5E1EA 1ZAEA 4B8LA 4UMRA 2ITNA 4FKJA 3WF9A 2W1EA 4AZWA 5JFVA 3D14A 4EOLA 4NH1A 3E7VA 1ZY4A 4W4VA 4ORKA 3RGPA 4RX5A 4FF8A 1YRPA 3FZPA 4BI0A 5ANGA 3UGCA 3NUPA 3GLFA 4RJ4A 3Q8GA 4ITJA 2O5RA 3QQHA 5CXHA 1R4GA 3HJSA 1IR3A 1IXSB 2MGWA 1MQBA 3VUGA 4H1JA 3E5AA 3RAIA 1JR3D 3P23A 4PDPA 1OBGA 4JR7A 3VS7A 1GNGA 5E26A 2XYUA 3CQUA 4C38A 5KZ0A 2VO7A 2NRUA 4L8MA 2DWZB 3CY3A 4YU2A 2W5AA 4ANSA 2JY5A 2YA9A 5FDXA 4D55A 4PNIA 4UYNA 4I5HA 3LFBA 4IB3A 4E4MA 2RFSA 4DEBA 3DFAA 3GOKA 1ERKA 4DTAA 3WI6A 2G3QA 4Z16A 3I4YA 2YACA 3RI1A 1J3HA 3EJ1A 1TQMA 4K9YA 3GB2A 4XV2A 3OWKA 2WMRA 4HYUA 4P5QA 1ZY5A 3HV5A 4UWBA 3NNVA 5IH4A 3GLFE 5B2MA 3EQDA 3VQUA 3QX2A 1IN4A 1PXIA 2ITUA 2A19B 4DEDA 2J5FA 3SARA 1TZDA 4M9ZA 3OWPA 1YSYA 3U55A 1Z6TA 3B7ZA 3MS9A 3FMDA 1H1SA 2Y4IB 1Z57A 4ACHA 3U8WA 3MA6A 5L2IA 3BQCA 4X6QC 4YZBA 2UZBA 3DJ7A 2QPAA 2JBOA 4EORA 1QDTA 5KBQA 3UC4A 5DWRA 1DGBA 3QGYA 4BB4A 4RPVA 4E73A 5M4IA 2CJMA 4TYHA 4AXDA 3UGJA 5BX0A 3DBFA 1RU3A 2X8DA 3MVLA 3KB7A 2XEZA 3UNKA 4HVIA 1BVSA 4O0RA 3JR5A 4MNEB 3G0FA 2JGZA 4C35A 2OJJA 4F0FA 4AQYM 3LLAA 4EH6A 3LHJA 4JX3A 5F20A 4A9YA 3N4UA 3QD3A 4M12A 4KD1A 1DGFA 2QBYA 4I5PA 5M06A 3VS3A 4NT4A 3GPUA 5JGBA 1Z59A 1ZWSA 4N0SA 2I40A 3VUMA 2LNHC 5E8YA 3TJDA 2JBPA 4MGHA 5BYZA 3FTFA 2PVJA 2XJ0A 3RWPA 2F7EE 2OJ9A 2E9PA 5C1QB 5EQPA 5IF1A 2MROB 5CU3A 1SG9A 2Y21A 3IW4A 2PVHA 2A5YB 1PMNA 3KF4A 2PVRA 5CU4A 3PA4A 5CEIA 3QWLA 2BALA 4ZY4A 2WQNA 3GPPA 4YUQA 2C6OA 5FBNC 3OCTA 2RFNA 4EKLA 4FSNA 1PXPA 2VTLA 3LW0A 1XQZA 4LL0A 1AQ1A 2JFMA 2VTOA 4ANBA 3F7ZA 4RNAA 4KIKB 5LVOA 3QTXA 3DXQA 1DS5A 3BKBA 3ZEPA 4IBFA 1H01A 3NDMA 3FI4A 5A14A 5EXXA 5CEPA 4U5JA 3KRWA 3OTUA 3RMFA 2P4IA 4F9CA 5IQDA 2XM8A 3LVVA 4F7SA 5CSWA 1K82A 4D2SA 4HCUA 4Y83A 3KOYE 1ZYJA 1XMLA 2UXDM 3GCQA 3KXMA 4ARKA 3LOKA 1U5RA 2PZ5A 2Q0NA 2UU9M 4YHFA 2JZ1A 3ZH9B 3ZCLA 4FIEA 5HBHA 4BICA 1J7LA 4YJOA 5TE0A 3IECA 5FBOA 2F7XE 3MTLA 1VYZA 3JVRA 4LF8M 1P4FA 3F61A 4LYNA 4AGDA 3WZUA 2V1CA 2WMAA 3ZONA 3FZSA 3C50A 3TIZA 4ZLYA 4PX6A 1MP8A 2C6KA 2DHYA 4IM2A 4D2TA 4G6LA 2QG5A 2E2BA 4FE2A 1F4IA 3A4PA 4PMSA 4FTOA 2W5HA 4E93A 3LQ3A 3H9OA 4FG7A 4JQ8A 5DR2A 3DDQA<