2WZJA

Catalytic and uba domain of kinase mark2/(par-1) k82r, t208e double mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
315
structure length
310
Chain Sequence
HIGNYRLLKTIAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Polarity-Inducing Kinase Family Mark/Par-1 within the Branch of Ampk/Snf1-Related Kinases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE MARK2
total genus 96
structure length 310
sequence length 315
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2wzjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wzjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wzjA01
5JFSA 1VEKA 2BIKB 2JDVA 2W0JA 4HVIA 3PP1A 5B0XA 3OBGA 4FZDB 4ENXA 3NRMA 3VS5A 4RA5A 5EDPA 4CLJA 4G16A 3MA3A 1Q61A 3FMLA 4BRXA 5LMAA 4ANSA 3MPTA 4R78A 2PVFA 2W5HA 4CKJA 3ZFMA 3KULB 2QOBA 4L8MA 5HO8A 4ALUA 3ORIA 5JZNA 4TYHA 1TTEA 4MXOA 4RX8A 5EM6A 4V0GA 3WF6A 5JH6A 4E73A 4GFOA 4WBBB 4L42A 2G2HA 3HEGA 1PKGA 3PXZA 3PVBA 2YIRA 5H2UA 4QRCA 3HV5A 4USEA 4MK0A 3BE9A 3F3UA 3Q5IA 5AP5A 4UY9A 2W1ZA 3ACKA 4HZRA 2P33A 3U9NA 2YABA 3LXNA 5FTQA 1IG1A 4X2FA 3R0TA 4YLLA 2WMUA 5EM7A 3AD4A 3QQLA 2QC6A 5FM3A 1P14A 3ORKA 4NU1A 3K3JA 4Z7HA 2ITQA 2PHKA 5HBHA 3TXOA 3QX4A 1CMKE 1E1XA 2BHHA 3E87A 3CTJA 2JY8A 1KOBA 3L8XA 3VBXA 4BWXA 4DFXE 4DYMA 1A48A 3ZLYA 4F7JA 1PY5A 4FC0A 1CKIA 4YZDA 3CSVA 5FWKK 2FGIA 4HPTE 5BVWA 5HGIA 1QPEA 5L6OA 3GCQA 4KKGA 5GJFA 3EFJA 4AWIA 2DAIA 2YERA 3OT3A 3RPRA 5KMOA 2QLQA 2BRGA 5EHYA 3M11A 5T3QA 4DCEA 5DVRA 1OL6A 3NS9A 4O7LA 1GZOA 4J1RA 3E8DA 2QD9A 3CJFA 4OTIA 5HVJA 2WFYA 4IAAA 5BMMA 4G3DA 3NUYA 3WIKA 3W8QA 3O8UA 3I6UA 2QOFA 3LZBA 3Q52A 5IKWA 3PWYA 3HRCA 4XRJA 4ZSEA 2AC3A 3GLFE 3F92A 2WQOA 1FGKA 3PA4A 4F9WA 1Q24A 4HYHA 4GH2A 2CCHA 2XF0A 2Y4IC 3SW7A 3ID6C 3NZ0A 4AACA 2Z7RA 4QPAA 4F7NA 4FV8A 5A14A 1RW8A 2F7ZE 1GZKA 1M7QA 2WTCA 4D55A 4DTKA 5CALA 2R3MA 3R28A 3F5GA 4GYGA 5AIKA 4ZY6A 4AP7A 4R3CA 2XNMA 4JDJA 4GIHA 4V01A 5BYLA 1YHVA 2XP2A 3UIBA 4EOPA 2BAJA 2XK6A 4UXQA 2ZV2A 2J5FA 5F95A 5DR6A 1OKSA 5IA2A 5AP4A 4QMUA 4RIYB 2HELA 2QO7A 4EEVA 1HOWA 3CPCA 4TZRA 5DT4A 2GHMA 2XYNA 4BHZA 3TUBA 1MP8A 4BGQA 1H1PA 3AC2A 3FSKA 3BHYA 1BYGA 2YISA 2O2UA 5DLSA 4ACHA 2P0CA 4MBJA 3N4VA 5FTOA 3QRUA 4DFNA 5D10A 2QKRA 2G1TA 5EYCA 5TF9A 4HCVA 4ZP5A 4S34A 5HG9A 1LR4A 3RK7A 4RT7A 3UOJA 2Q0NA 3ELJA 5HQ0A 4CT1A 5M06A 4FVRA 1ZOEA 2VWVA 3KL8A 2C6OA 2J4ZA 1BKXA 3LLAA 1PKDA 2V62A 2GFSA 4G3CA 4YJUA 5J95A 2JZ0A 5FBNC 3VIDA 1ZZ2A 4HJOA 3OWKA 5K4IA 1Q8WA 3FXWA 3RCJA 2J7TA 3EKKA 2C1BA 2W4KA 4S32A 4N6YA 4I92A 4A9UA 2ONLA 2C5XA 3BI6A 4BCIA 4FVPA 3V6RA 3VS3A 4QP8A 4EUUA 2GNGA 3Q4TA 4FSNA 3Q32A 1JKTA 4JOAA 1CSNA 2XJ1A 1UNGA 2YDJA 4RPVA 3TKHA 5I9ZA 1IM2A 2XKFA 4YBJA 1SYKA 2YM6A 3UBDA 4MD8E 3LQ5A 2UUEA 5FEEA 3ZDIA 2CMWA 4O1PA 5CF8A 3LKMA 5HLPA 2YM5A 4AT3A 3OF0A 5CSVA 4B6LA 5HORA 3QF9A 4I4FA 4QMMA 5J9YA 3VVHA 1TQMA 4YGAA 3DJ7A 1XH9A 3K3IA 4U97A 1UU8A 1I09A 4X0MA 1OBDA 4CFNA 1FMKA 1VJYA 2WO6A 4YC8A 3HV6A 4FKLA 5G6VA 3R8MA 5CWZA 3LVPA 1TR8A 1P3QQ 4AOTA 1OITA 4RJ6A 4FKVA 3A7FA 1CKJA 2WIPA 4RLKA 4Z55A 1UNHA 4IWDA 4KBKA 4YHTA 4IAKA 4QYHA 4ERWA 4I6FA 4ZJIA 1FVVA 3QHWA 3R8ZA 4BY9E 2VU3A 3KF7A 2RFNA 4V0GB 3CQWA 3REPA 2YDKA 4QYEA 5EG3A 1OTRA 2C0TA 3QUDA 1T43A 2OW3A 2XM9A 3JPVA 3TN8A 4B8MA 4NM3A 4X2GA 2OK1A 2O5KA 3F82A 4GRBA 4JNWA 3CKWA 3NEWA 4D1SA 3KVWA 3EQFA 3DS6A 4QYGA 4RWJA 4YTHA 5BUIA 3GP0A 3VHEA 4ALWA 3QTIA 2OIQA 3ZH8A 2X9EA 4BDJA 3MIAA 2UW9A 5KBQA 3ZHPC 2BILB 4GFMA 1QL6A 1NVSA 1UNLA 1MRVA 4EHVA 5ANOA 4FKJA 4WSQA 2BWBA 3EQDA 4OTFA 3NNXA 2G9XA 5IMEA 4FMQA 1H1RA 1M52A 4PPBA 3DZQA 5DBXA 3PZHA 2X2KA 4JVGA 5EI6A 3LXPA 2PZ5A 2XKEA 5LMKC 2FSTX 5EOLA 2RG6A 3POOA 2WMWA 4LGGA 4E4MA 4FKQA 3PJCA 3OXTA 4CEGA 2XS0A 3R21A 1V0PA 4RVTA 2BDWA 4KSPA 3R83A 1PXMA 4ANLA 1ZYCA 4PDPA 3OD6X 5E7RA 5FDPA 4PUZA 4NWMA 1PXOA 4EOJA 3S00A 2GPHA 2JKMA 1OIYA 4FIIA 4ZSLA 4AA0A 2CKQA 1U59A 4YHFA 5HE1A 5HBJA 1NV8A 2W7XA 4LOPA 4BIEA 4F64A 2C0IA 2BHEA 3PYYA 4D9UA 4F70A 2B0QA 3C50A 3MTFA 2KHHA 1JSVA 4Z7GA 4O82A 2OG8A 1SZMA 3ZS5A 5CNNA 3HZTA 1PMEA 4J8NA 5AV3A 4F1OA 5D11A 2JBOA 2JBPA 3GCUA 5L8JA 3K5UA 1H00A 2UVZA 2WMTA 1M2QA 5EYMA 5HG8A 4EH7A 4WUAA 2NO3A 3CS9A 4WNKA 2R3NA 2C3IB 4H3PA 3UC4A 5AADA 4BVUA 4D4YA 4QTDA 5J9ZA 3V8SA 4LL0A 3KGAA 3G0EA 2L2DA 4AT5A 2WQEA 3RWQA 3VJNA 2OZAB 3UOKA 4XG8A 1PXPA 4XV9A 4BR3A 5EQYA 4M67A 4XX9A 3FHIA 5AUUA 2R3GA 3TM0A 5A54A 5CQUA 3MH1A 2CN5A 3C9WA 5CSHA 2JY7A 3ZM4A 4CCUA 4QP4A 4CV9A 5J7BA 4QMZA 2DQ7X 4PDYA 2GQRA 5HE2A 5FBOA 3P7CA 2YITA 3Q4ZA 3V5TA 2WTKB 2L4EA 3FKNA 4PTCA 3ZONA 5HU3A 2EB3A 3U9CA 4FSTA 4I24A 5L6WL 4A4OA 2VN9A 3ZBFA 3PG3A 4HVDA 2PYWA 4EOOA 5GZ9A 1FINA 2GTNA 3ORMA 4FSRA 4D4RA 4OTDA 4LYNA 4U7ZA 4XOYA 2AYPA 3AT4A 3GC0A 4CMUA 5IA3A 3MW1A 5L2SA 5GINE 3SG8A 3ALOA 4O21A 3EQRA 3R7OA 1SMHA 2A0CX 3QRKA 3U87A 4D5KA 2JD5A 3DKOA 4WP2A 3KC3A 4FODA 4U40A 4E4LA 3TNHA 4DH5A 2X4ZA 5IISA 4Q9ZA 3KULA 4F1TA 3PSDA 3VAPA 4QTBA 2GMXA 5FDXA 5C8NA 1YWRA 4YPSA 4BKZA 4C38A 4Y8DA 5C4LA 1KOAA 4JDKA 3CQUA 5FQDC 3ZC6A 4CRSA 2J0MB 2JDTA 4G31A 5ETCA 4USDA 4NM7A 4HCTA 4TYIA 1XKKA 1R4GA 1RE8A 5FXRA 4YPDA 4OTQA 4YBKA 4Z9LA 2OH0E 1NA7A 4XP2A 4YC3A 1REKA 2ERZE 4YP8A 3QTZA 4LOOA 3P7AA 2XIZA 4R3RA 4XP3A 3SW4A 3F5PA 3OZ6A 2XB7A 3NYNA 4FV5A 3W2CA 1GIJA 4AW2A 3QRJA 3OC1A 5HG5A 1Q8TA 4ZLYA 5F20A 4FOCA 3QTSA 4HNIA 4C3FA 4RWIA 3EIDA 1H1SA 4F0GA 3V5LA 4HZSA 4FTIA 4D4VA 1XO2B 4RWKA 2YCRA 3WF5A 5DFPA 4LGHA 1WBPA 4IADA 3ODZX 2MROB 2JIIA 2SRCA 3DKGA 3FYKX 4TRLA 5IEXA 4RIOA 5JRSA 4BDKA 3GU6A 1TVOA 2GTMA 3RK9A 4TNBA 2QG7A 4FV2A 3VJOA 4USFA 3C4ZA 2LTUA 1OBGA 4KRCA 1NW1A 2F49A 2B55A 3KXXA 1L3RE 1YXUA 4FV7A 4FV6A 2BRMA 4KSQA 5E8ZA 4HOKA 1K9AA 3C13A 5HZNA 1V92A 2EWAA 4LG4A 3R9OA 3RNIA 4TY1A 3TDVA 4RIYA 1K3AA 1JOWB 4OBPA 2BTRA 4YZ9A 1URWA 4BDCA 4EZ7A 4I93A 4UXLA 2OOBA 1PMNA 4GW8A 1WHCA 3D2KA 4AG8A 1CKPA 2ACXA 3EOCA 2BFYA 2UZVA 2IW6A 1Z9XA 2C1AA 5KNJA 2ZM3A 1Y8YA 1XHAA 3QCYA 2B54A 1Q41A 3TL8A 2OO8X 3D5WA 3W2RA 2VX0A 3QUPA 3AC1A 5ICPA 3ROCA 2ZM4A 4I6QA 4QMXA 4IC7A 4XNEA 4AQCA 1SVHA 2BRNA 4X2JA 5CTPA 4C58A 2W5AA 3R63A 4F6SA 2CNVA 1XXHE 3TNIA 1OI9A 1P4FA 4DG0E 4XLIA 4FTAA 3LFFA 4XV1A 4RC2A 1O6KA 4KS7A 4FNYA 2DS1A 3A60A 4EH8A 4F1MA 5B2MA 3ZO4A 3F66A 2Y4IB 3EYHA 3QD0A 4C4FA 1H27A 4S31A 4ZY5A 4O81A 3QZIA 3Q4UA 3UGCA 4D1XA 3GU8A 4G6NA 4EH4A 5GJDA 2PZYA 3BIZA 3UYTA 5DR9A 5HLNA 2P3GX 3DKCA 4ZZNA 4IB1A 4DG3E 1ZY4A 2C4GA 5IQIA 4O83A 4OLIA 3QTQA 1PW2A 1DAWA 1QPCA 4EL9A 3H10A 4D2WA 1H0WA 3EQHA 3JXWA 3JVRA 4FKIA 1KWPA 2OXYA 5J7HA 1HT2E 2XCHA 5BUJA 2IZRA 3M2WA 2PVRA 4XG6A 2BZKB 1UKHA 3WZUA 3MDYA 3VRZA 2DKLA 4MQ2A 4BDAA 5ANKA 2C6DA 5HESA 1H1WA 2EKFA 4PL3A 4BCHA 3IK3A 3D2IA 4O7YA 2Y4PA 2B7AA 2VWWA 1M14A 4Y72A 3D5VA 4JIAA 4N4SA 4FNWA 1BLXA 3DK6A 2V22A 3LFAA 4B9DA 4FV4A 3HP2A 3TZ9A 4HW7A 2H96A 3ACJA 4C02A 3CGFA 4LMNA 4M7IA 4ZTSA 4FVQA 4BYJA 4WHZA 3V01A 3AC8A 4ZY4A 5CEPA 2X8DA 5DE2A 4X6QC 3QALE 4FTJA 2BZJA 1FVRA 4NFMA 4QYYA 2LVAA 5LWMA 1OB3A 4FSWA 4G3FA 5FD2A 4EYJA 2PE1A 4W4XA 3RM7A 3MI9A 2HZ0A 5FEQA 3OOMA 2PUUA 4UZHA 2YM3A 1YWNA 2EKKA 4ZMFA 3ZTXA 3R7EA 4J71A 3NUPA 3E8CA 3TEIA 3PPZA 1IASA 3PXYA 4FSZA 4C2WA 3FY2A 5I3RA 5A6OA 3G2FA 3L1SA 2OF4A 3UC3A 4ZS0A 3ZO1A 5LVNA 4HVHA 5L3AA 3TG1A 2J5EA 3BU3A 2HZNA 3OS3A 4J98A 4CTBA 5ANIA 4FT5A 3UMWA 3S1HA 1O9UA 3O96A 3SX9A 4RMZA 5T68A 3LFCA 3P08A 4NIFB 3ZRKA 4CMTA 2DI0A 4O2PA 5CEQA 3QKKA 4L44A 1MUOA 1ZYDA 1WVWA 5B2LA 3P5KA 4FSYA 3F9NA 2H34A 2Y6OA 4K1BA 4YJSA 4ZZMA 3DB6A 3ZLXA 3C4CA 4AZSA 5CAOA 4DH7A 5B2KA 2J50A 2WMSA 2ZDTA 2RSVA 4YZCA 2WU6A 3DFCB 4I22A 4J7BA 3QAME 3PA5A 4U79A 4QMQA 4GIIA 5IPJA 4GJ2A 5DT3A 3R22A 3QQUA 4TNDA 1J7IA 4RGJA 4FTQA 3O7LB 2HXQA 2WOUA 3R04A 4NKSA 3MSSA 3GGFA 5M55A 3HYHA 3O51A 4AZEA 3C0GA 4CFUA 5JI2E 1PRYA 3MY1A 4M14A 2CSNA 4A4XA 4XCUA 3KRLA 5BUEA 3NR9A 2KNAA 3ORZA 4M3QA 5HO6A 4XBUA 5J5SA 4YNEA 3NVKI 4O7VA 1U54A 3BHVA 1DM2A 4U9AA 4XG9A 3AOXA 3RNYA 1V0OA 2VWBA 2QVSE 4RQVA 3TACA 4CSVA 3NDMA 2XNNA 3L9MA 2PVMA 2QQ7A 1VG5A 1UVRA 3FPQA 3C5UA 4DGMA 5LJJA 2HENA 5ANJA 4NJ3A 3ERKA 4Z16A 2R0UA 3I1AA 4RFYA 2BCJA 3BKBA 4FIJA 3KREA 3BRBA 4WIHA 5H8BA 3MMPA 4F09A 1OMWA 4OTWA 3PJ8A 2J2IB 4CRLA 2I0VA 4E5AX 2PZRA 3UDBA 3VQHA 4X3FB 3VUKA 1JWHA 3P7BA 2JIUA 4AXAA 3PSBA 3QD4A 4FGBA 4JDHA 4AN9A 4L7SA 3DLSA 3Q4CA 1G3NA 2FSOX 4EONA 4LRJA 3FUPA 3KMWA 4ZTNA 2UW7A 4PMSA 5TKDA 4YJRA 2DYLA 3W33A 5E8VA 1IRKA 2VTIA 1R78A 5HVYA 4CFXA 5CASA 4IBMA 4FKTA 4WNMA 3PUPA 5L2TA 3RINA 1JAMA 5JKGA 2BALA 3E46A 4K11A 3RMFA 2YFXA 3CQEA 4N6ZA 3P4KA 4W8EA 4A9SA 3U6JA 2JDOA 2E9OA 3HV4A 4JR7A 2VTMA 5HCXA 3D94A 4BICA 1H26A 2QODA 2GNLA 1Q5KA 2QLUA 2XMYA 4AZFA 3RALA 2X39A 2IW8A 4XOZA 3HA8A 4RC4A 4U44A 4E4XA 4JLCA 4IZYA 3M42A 4RJ3A 3UZTA 5EW8A 3G90X 1AQ1A 1P4OA 1OKZA 1PHKA 2VV9A 2Z7LA 2ESMA 5CQWA 3O8PA 4LOQA 3U51A 4BGGA 4FTOA 2R3HA 4IW0A 3O71A 4AF3A 2QHMA 4D0WA 3QQHA 2ZYBA 4KIQA 2XA4A 3Q53A 4F9AA 4EWQA 4W4WA 5IMXA 2ETKA 5AX9A 3QGWA 4MCVA 4QMSA 2LVOC 3II5A 4BCOA 4ITJA 4QP3A 1H24A 4P2KA 4D2RA 1B39A 4O27B 2PPQA 3QBNA 3ZLWA 5BVNA 3F7WA 4ZSAA 3FQSA 1YXVA 2XRUA 3BU6A 3GFWA 4BKJA 1JSTA 5K5NA 1H1QA 2BRHA 4BIDA 4CQEA 5JZJA 2VX1A 2UW5A 5CEKA 1OAIA 3OG7A 4QPMA 4AW0A 2UZDA 4LMUA 3MH3A 1GIHA 5I9UA 3HAMA 1X8BA 3NYVA 3NNVA 4H1JA 3L9LA 3WF8A 5TR6A 4O6LA 3TKIA 3TNQB 1U46A 4RVKA 3ZEPA 3RHXA 4GEWA 4EHGA 4FG9A 5AM6A 3U6HA 1REJA 3R9RA 2IVUA 4EBVA 4G3GA 3DFAA 1JVPP 2ZV7A 3FL5A 4BDDA 5GIOE 3SRVA 1Q4LA 4KB8A 4CXAA 2OOAA 4IJ9A 4IVAA 2CN8A 4AGDA 4TTHB 3VQUA 2I1MA 4IVCA 3R01A 3BYUA 1FPUA 3ENHA 3D7ZA 5HICA 1NVRA 2PL0A 4MXAA 2QU5A 4GCJA 1UU3A 3NW7A 4YLKA 5FTGA 1WGNA 3ZM9A 2UZOA 4BDHA 3MPMA 4D2PA 4RZVA 4BTJA 4D28A 5DFLA 2ZDUA 2R3FA 3PXQA 2Q83A 3RGFA 4I94A 2WEIA 4BWPA 1ZV1A 5E1SA 3W55A 3KFAA 4FEWA 2XK3A 3BYMA 3KF4A 3ULZA 5BVEA 1PXJA 4EH2A 2L4FA 3HRBA 1OVEA 3EYGA 4DITA 2C3KA 3GLGE 3IGOA 2PULA 1WAKA 4RBLA 1OL5A 1OL1A 1PF8A 3CKXA 4IC8A 4JL9A 4BBEA 4CFVA 2J90A 3PA3A 3DXPA 5I9XA 5K3YA 3KMUA 4K8AA 4IX5A 4XHKB 1SG9A 4GT3A 1ZOGA 4F6UA 3ZUVA 3VN9A 5JQ8A 5M53A 4QMLA 4HEOA 5IQBA 1VEJA 3U8WA 4B8LA 1MQBA 3DTCA 2VWXA 2C5OA 3UODA 3GU5A 1SNUA 1U54B 2JY5A 3GNIB 3JY9A 4RJ4A 3CGOA 4D4SA 5KBRA 5IQDA 1UKIA 2GHGA 2Q0BA 2RFDA 3KK9A 3L9PA 3A7JA 4S30A 5DI1A 4MX9A 4R6VA 2HWJA 2CNUA 3MJ2A 4IM3A 4L6QA 5C01A 3R9DA 1LUFA 5IDNA 4F63A 3IW7A 3G9NA 2IO6A 1WFCA 3LMHA 2XNEA 3GFEA 1OIUA 3KRXA 3GXLA 4AZTA 4C34A 5J79A 2GS6A 3LJ1A 4MKCA 3QTUA 3DKFA 4X2KA 4D2TA 4FV1A 4O91A 4XJ0A 3LFSA 4ZJVA 3NVMB 4O0UA 3OHTA 3NMUF 2V5QA 2FUMA 3A8XA 4KIPA 4Q7JA 3ETAA 3L8PA 3WZJA 3SGCA 3P23A 5F1ZA 3BV2A 4HYUA 3W16A 5GIPE 4OT6A 4NCTC 3PTGA 4KNBA 3POZA 2O0UA 4QP2A 3QCXA 4R7HA 5JEBA 4DGGA 1PJKA 3A2CA 3AC5A 2X4FA 1CUKA 3HUBA 2CDZA 5IA0A 1J3HA 1ZY5A 4Y5HA 5AAFA 4UMRA 4CCBA 5CF4A 4AX8A 1LEWA 3C0IA 1E94E 2CNQA 1PXKA 4APCA 3IOKA 2YIXA 3NCZA 4FTLA 3O8TA 1CM8A 4AFEA 3I5NA 1JPAA 3T3UA 2VNYA 4QP7A 3ZDUA 1WBOA 4JBPA 3D7TB 3OBJA 1WZYA 3EZRA 3T8OA 3W18A 4XUFA 3AC4A 5EH0A 3VBVA 4MQ1A 4N57A 2ERKA 4RX5A 5LXMA 1VEBA 4HVSA 4FUXA 4FEVA 3LW0A 4G34A 1TQPA 2HIWA 1JKLA 3GEQA 4TYGA 1VYWA 1XBAA 1ZYSA 1IAJA 1Y6BA 3ORNA 4PF4A 2XK9A 4DAWA 4HCUA 1YI6A 3ANQA 5AWMA 4O22A 3SHEA 2XZSA 3UNJA 2EVAA 4FNXA 2C69A 3F3TA 4NM5A 2EB2A 3A99A 3DAJA 4D2VA 4DFLA 4LRMA 2A27A 4MXYA 5H3QA 3SQQA 4BGHA 3MESA 4W9XA 2WHBA 5E91A 3Q04A 3V8WA 2HWOA 4AGWA 3TDWA 2JKKA 3A4OX 4XLVA 5A4LA 2X9FA 4G2FA 3DAKA 5BPYA 5IEVA 5M07A 3W2OA 5CZHA 2R64A 5M09A 3MY0A 1MN3A 2XUUA 4YO6A 3I81A 4FTNA 2X2MA 3EQPA 2JKOA 2VTHA 4U45A 2CKPA 3PSCA 5TOZA 4DF3A 4ZZOA 5M51A 2HW7A 2FO0A 2XYUA 4WNOA 3AT3A 1GJOA 3H30A 2ZTDA 4ZOGA 1YVJA 4Y5QA 3K9PA 5C9CA 5A4EA 5IUHA 4B0GA 1YI3A 3WZDA 5KMNA 4YSMA 3MWUA 1XJDA 4JAIA 4IACA 4M0ZA 4QMOA 2IW9A 4DGNA 3D4QA 4IEBA 3QQJA 2IVTA 4QTEA 3UO5A 2BVAA 5JFWA 4NEUA 3FI4A 3F6XA 4I6BA 4WNPA 4O84A 1J1BA 2XCKA 4CD0A 4EZ3A 3FQHA 3HL7A 5DA3A 3VRYA 5AA8A 5F94A 4BCGA 4I5PA 5FLFA 4DEBA 1JQHA 4FTKA 4JBOA 3FHRA 4RRVA 4PTGA 3ZMMA 1BMKA 3COMA 4E7WA 4EOIA 5IQHA 4CZUA 2WMXA 3VHKA 3DJ6A 4WRSA 3PJ2A 5E90A 1Y57A 2RFSA 1H07A 2W4JA 4GUBA 3SVVA 3VWAA 4Y95A 2O65A 4CKRA 5M4FA 3EQIA 4KKEA 5EM8A 4IDTA 1XH4A 3EFLA 3QKMA 4IM2A 2G15A 4IZ5A 5C8MA 3RPVA 2WQMA 1Y6AA 2ZM1A 5IU2A 4R1YA 2IZUA 3F5XA 1QZEA 2Y0AA 4IWOA 4NCTA 5EHOA 2RL5A 3F2RA 4ALVA 5CVHA 3KXNA 3WILA 2GHLA 3M1SA 4GSBA 3LAUA 4FYOA 3FXXA 4O0RA 4GVAA 4TN6A 4BDIA 2X8EA 3NGAA 4X3JA 3OEZA 4F0FA 3ZEWA 3EN6A 1Q8UA 3IOPA 4IAIA 2XM8A 4YZMA 5H8EA 3ZZWA 4C4JA 4C57A 3NYXA 2BAKA 3NUAA 2C6MA 1G4AE 3OMVA 4M84A 4AZVA 4CKIA 5A4TA 3LM5A 5BQ0A 4CTCA 3GB2A 3DK3A 4LM5A 4EWHA 3OUNB 1OKVA 4HGSA 4TW9A 4O86A 4EOMA 4HVGA 4MEDA 5HVKA 3FE3A 3T9IA 2VTJA 5DGZA 5FRIA 4RZWA 4O0SA 3DZOA 2RG5A 4FE2A 3QCQA 4A9RA 3IECA 2WTJA 4RVMA 3EWHA 5CF5A 5CT7A 3DXNA 3RTPA 3WBLA 3BYSA 4CZYB 4U81A 4RIWB 1EFUB 3KXGA 1U5QA 1A5TA 3A8WA 4GS6A 3NW5A 4G3OA 1XR1A 5BNJA 2JIVA 2WD1A 4KRDA 2UW4A 4DBNA 4K18A 5IG1A 4EC9A 4QP1A 2CGVA 4JX7A 5EYDA 4U42A 3UIXA 3DCVA 4H05A 1OPLA 2OXDA 1R0PA 4JBVA 5F4NA 3V5WA 3GC8A 4BDBA 4M69A 3F7ZA 4EOSA 4NIFA 5KMMA 4M8TA 4PRJA 5C26A 3SD0A 3HDNA 4X21A 5IQFA 2YDIA 4FGRA 1WGLA 2MR9A 4IJPA 5AUTA 5H9BA 5CYIA 4CQGA 3FMDA 3MGYA 4W8DA 1HQYE 4IAYA 4IIRA 5AR2A 3MVHA 3VW6A 3ZO2A 4BZOA 2XKDA 3BGZA 2OBJA 4LUDA 3HMOA 4KWPA 2XK4A 3GBZA 4IWPA 4YZNA 4BI2A 4YO4A 3R1YA 1OIQA 4FIGA 3IG7A 5KE0A 3NAYA 4OTPA 3SXFA 2J0JA 2OIBA 2WQNA 3FDNA 4ZTLA 4KINA 1EH4A 3DOGA 3H0YA 1O6YA 4ZXTA 4JQEA 3BHUA 2CGUA 1YWVA 1ND4A 4CLIA 4NFNA 4O0YA 3LFBA 3ATSA 3KXZA 1E9HA 4G9RA 5FG8A 4HYIA 4BTFA 3QX2A 2ITXA 2R3LA 5L2QA 4GG7A 4I0SA 4ZAUA 4AOJA 2XH5A 5HEZA 3SXRA 3FC1X 2BZHB 4FV3A 4L7FA 4ASDA 4BBFA 2GQGA 5IH5A 4BDEA 3DBDA 4E6QA 3OCGA 2HCKA 3GC7A 4OUCA 5HIBA 2WTDA 3FLYA 5JQ5A 2NNWB 1R39A 4FKRA 2XBAA 4KAOA 4PMMA 3O0GA 3N9XA 3UIUA 3OW3A 5ANEA 3RAKA 5EW9A 4DG2E 4B7TA 4FI1A 2QR7A 3FPMA 2QOKA 1R3CA 3A7GA 3BYVA 5KO1A 2CPKE 4TWNA 1OPJA 1XWSA 3TWJA 2UW3A 3KRJA 3C4FA 3V8TA 5CVFA 4L68A 1XH6A 1DS5A 3EZVA 5CXZA 3HRFA 4UEUA 3E64A 4BDFA 4MXXA 2ONLC 2JZ1A 3QKLA 3H9RA 2FB8A 3MH0A 5A46A 4IB0A 4IH8A 3CTQA 3AMAA 5AV0A 3UNKA 1BL7A 1FVTA 4Y73A 5AV2A 5A3XA 5JSMA 2OICA 2X1NA 3FI8A 2C5VA 4FOBA 1U4DA 5H8GA 1J1CA 4YURA 3QXPA 1H01A 4O7NA 2BAQA 2XJ2A 4UV0A 3COIA 2IZTA 2ZOQA 3K9OA 2JY6B 5I4NA 1JSUA 2QG5A 4KIKA 3WARA 4C7TA 5HTCA 5IDPA 3EN4A 2E9VA 2GNHA 4DEDA 2ITOA 4JS8A 4L45A 4FA2A 3ANRA 4FL3A 1ZZLA 4I5HA 4EOQA 3QL8A 3FMKA 5LWNA 3QU0A 1DO0A 3L8SA 4C2VA 5IA1A 4EUTA 2WMRA 3TUCA 3HKOA 2YZLA 3K54A 4F65A 4QP9A 4JRVA 4WO5A 3COKA 3F2NA 1G8SA 2QOHA 3D15A 3QC9A 3VBWA 1GNGA 2E9PA 1B6CB 2AC5A 4FG7A 2YM4A 4MD9E 1JR3E 3BQRA 3JS2A 4C33A 2EU9A 3EH9A 3TNWA 3TZ8A 4FKWA 4ARKA 4PV0A 3RZFA 4UBAA 5E8SA 3MY5A 3TT0A 2QU6A 3RAIA 5M44A 4O38A 1Q02A 2O64A 2ZMDA 4G6OA 5ETAA 5K5XA 2ITVA 2JUJA 3LMGA 1KUTA 2J51A 3O2MA 1H28A 1S9IA 4MF0A 4L46A 4EKKA 5J1WA 1S9JA 4J95A 3B2WA 3C4EA 3I60A 3QFVA 3IONA 4XH6A 4D2SA 1XH8A 3BEAA 1R0EA 2EUFB 5DMZA 3W1FA 5L2WA 4FZAB 5ANGA 3R9NA 3CBLA 2OKRA 4MHAA 3VS4A 3KN5A 1K2PA 4FK3A 4YJVA 5CEIA 5B7VA 2HZIA 4IM0A 3E8EA 5K0XA 2W96B 5EQPA 1ZMVA 2UZNA 3EQGA 2RRUA 1APME 2H5XA 5J1VA 2R3IA 2F2CB 1JKSA 4M0YA 3ZFYA 3VBQA 3R02A 2YIWA 3KN6A 5AAGA 3MB6A 5HIEA 3ZUTA 3IDPA 3PXFA 3DPKA 4BBMA 2QURA 4O0TA 2W17A 3U6IA 5FM2A 3RPOA 1KE6A 1OM1A 1YI4A 2QOCA 2XBJA 4L43A 4XMOA 3UZRA 4E4NA 1NXKA 4KD1A 1OL2A 5AP7A 4RX7A 5I9YA 5CVGA 4YTCA 4PX6A 4CFFA 3PWDA 4AE6A 3GQLA 5A4QA 4U43A 2IZSA 3C51A 4M69B 2ZVAA 5GZ8A 3FZSA 2OJIA 2FSMX 4JXFA 3BWJA 2Y6MA 4ANMA 1UA2A 3PVGA 2OH4A 3R8UA 3UIMA 2W9FB 4A07A 3EFKA 4YSJA 4PY1A 4H36A 3MBLA 3OXIA 3QTXA 4EQCA 4F08A 5DH3A 3I0OA 4H58A 4BC6A 3FXZA 2R3JA 3PE1A 2YACA 1CTPE 2JFMA 2W1HA 3I5ZA 3NIZA 5AR4A 2WTWA 4F6WA 5KMIA 4V05A 4MVFA 1CDKA 3Q9ZA 4I0TA 2OZAA 1MRUA 4ID7A 3BGQA 4JG7A 3R7VA 4ASEA 3UE4A 3OWJA 2OSCA 2O8YA 2JEDA 2UZLA 4OR5A 3I0QA 4A9TA 3MV5A 4R1VA 4YC6A 3UVPA 3G15A 5LVLA 4NSTA 2BPMA 4WT6A 3GU7A 4EK8A 5HNGA 3VS7A 2UVXA 3RZBA 5L8KA 2K0BX 2QOLA 3HMPA 5L4QA 5JFXA 3FSFA 4CFMA 4K2RA 3UVQA 2P2HA 2W1IA 4P4CA 3L9NA 4DEAA 2WTVA 1B38A 1JLUE 4EH3A 4FEUA 3LCUA 2VGPA 2OFUA 2A19B 1ZLTA 4L01A 4EHEA 3PIZA 3LFNA 4DTAA 1IAHA 3ZUUA 2CWBA 3R1QA 3V3VA 5L6PA 2VWYA 1C7YA 2X7OA 4TYJA 4D5HA 4LGDA 1YOJA 4L52A 2R2PA 4E5BA 2F2UA 1ZRZA 4AA5A 4RVLA 5HKMA 3UPZA 2EXCX 3BU5A 4CYIA 5ITAA 4TWOA 4FSUA 1KV2A 3H9FA 4IVBA 5D12A 5CU6A 3RBWA 3ZU7A 4DLJA 3LQ3A 1Q99A 2GFCA 4IFGA 4JJRA 4MXCA 2CP8A 4G5PA 3QZFA 5C4KA 1XBBA 4F7SA 2JAMA 2LVPC 3NPCA 4EK6A 3EJ1A 2I0HA 2NRUA 3F5UA 4L3PA 1AGWA 3OUKA 4FT7A 3PLAE 2F7EE 3CPBA 3D0EA 3BBTB 3UTOA 4P90A 4QD6A 2VUWA 3CE3A 5C03A 3R8LA 1T46A 2VZ6A 4ASXA 3NAXA 3MN3A 4N0SA 4AGUA 5LCJA 3AXWA 4ANQA 2XIXA 2LVNC 3ZXTA 1YXXA 2I0EA 2OZOA 4UWBA 3VBTA 1WVXA 3G6HA 3MFSA 4FT9A 2KTYA 3R9HA 3FMHA 3NUXA 2DAKA 4KABA 5HE3A 5TE0A 4EQUA 5CEOA 2G3QA 1T6OA 2B53A 1A9UA 5DG5A 5FEDA 2C3JA 2H8HA 2YLEA 4M13A 1KE7A 2XJ0A 3QLFA 4J8MA 3O50A 4Y85A 3R7YA 3VS0A 4OAUC 1Q8ZA 2ITNA 5CAPA 2O25A 3RJCA 4F9CA 3CR0A 3BHHA 4I20A 1NVQA 2HY0A 3P9JA 2DWBA 2PWLA 2YM7A 2XIKA 4U6RA 4R7IA 3AD5A 3PZEA 1W83A 3D5XA 5CZIA 3Q9XA 4FZ7A 3DXQA 4DEIA 2RFEA 3ORTA 3Q9YA 3NUSA 4JAJA 1LEZA 3LIJA 4EHZA 3PRIA 2BDJA 3C5IA 4O7TA 4DBXA 4J96A 4IQ6A 3NUUA 3ULIA 4LUEA 4DEEA 4NYEA 3LJ0A 5GHVA 1G3IA 3UP7A 4MH7A 5AMNA 5AR5A 4MAOA 4ITIA 4M66A 2VO7A 3IHPA 3Q3BA 4DBGB 1ZMWA 2QOQA 3QD2B 3CEKA 4GU9A 4NW5A 2W06A 4BZNA 2C5NA 4LRKA 4GVJA 5DRBA 5FGKA 5ACBC 4WSYA 1STCE 2QO2A 2XNBA 3KU2A 3E92A 1DAYA 1E1VA 2OXXA 2NP8A 4I6HA 3IS5A 4YJOA 1H0VA 1YOLA 2F7XE 3BPRA 1URCA 3U55A 1KSWA 3IQ7A 3PG1A 2JP7A 2LAVA 3KXHA 3LJ2A 4NT4A 1YDTE 1AD5A 3ATTA 5D41A 4QMNA 5KZ0A 2JAVA 3O7LD 2OWBA 4ZTHA 2Y9QA 3F2AA 2PVNA 2WAJA 3LLTA 4FIHA 5K9IA 4ZLOA 3OTUA 5D7AA 5HTIA 2LBCA 4MYGA 4BKYA 5KMJA 3LHJA 5AEPA 3DBQA 3RAHA 2VTSA 2B3TA 5AUXA 3Q9WA 2X7FA 4FF8A 3HNGA 1ZAOA 1WBWA 3QZHA 2XK7A 2V0DA 5D1JA 5E8TA 4E6CA 4H1MA 2VO6A 4EORA 1SM2A 3G6GA 4IAZA 4DH3A 4XG2A 4JIKA 4OTGA 4EJNA 2BR1A 1YHSA 5TO8A 4J53A 3I7BA 2GNJA 3VW8A 4C4EA 5JGBA 2BIYA 3P79A 3AD6A 2UV2A 2JDSA 1I44A 3KA0A 4A06A 4O7RA 3KCKA 3DGKA 3ZZEA 3FLNC 2YCFA 3KK8A 3QCSA 3COHA 2XNPA 3DQXA 4CNHA 3R8VA 3CD3A 4TWPA 2C6KA 3MFUA 5EW3A 3ZYAA 1UFZA 1WBVA 5C1QB 5AR8A 3RHKA 4QQ5A 3KRRA 5K4JA 4FG8A 2VO3A 4I21A 4KBCA 2C0OA 4II5A 1WJ7A 2F4JA 3JUHA 4G1WA 3RK5A 4IB5A 4O2ZA 1YDSE 4BHNA 2WU7A 3EL8A 3KCFA 3ZCLA 3R30A 2BKZA 4RJ8A 2RIOA 5DR2A 4O0XA 4BIBA 3VUIA 2I0YA 1LPUA 3V04A 5KMLA 4GKIA 4RIXB 4FV0A 3R7UA 2BWEA 5AIRA 5FP6A 4EOKA 4YMJA 2UZTA 2CLXA 4Q5EA 4GT4A 3SKCA 3BLQA 5KKRB 4NZWB 4BCNA 3V6SA 2YHVA 3FY0A 2C30A 2C5YA 2R3QA 4DEGA 4K6ZA 4IZ7A 4C61A 5DN3A 4AFJA 3I4BA 1ZYLA 2VTPA 4ACMA 3IO7A 2LVQD 3TI1A 2FA2A 1JBPE 4TWCA 4GKHA 2KNVA 1WMKA 2C6IA 4ZK5A 1NY3A 2PUNA 4E8AA 3RKBA 5IQGA 2Z7QA 2WXVA 2JLDA 2QR8A 4IZAA 2R7BA 3LCOA 2NRYA 5BVDA 4OW8A 3E8NA 3ZC5A 2PSQA 4YTFA 3HDMA 4A7CA 3G9LX 1YXTA 2V7OA 3VS6A 2HOGA 1VDLA 4BDGA 4GMYA 3EN5A 2AUHA 4FTCA 4MBLA 4OBOA 2XNGA 5AP6A 3ROYA 3CP9A 5KMKA 3OY1A 2IWIA 2WMVA 3TZ7A 4UMTA 3I79A 4CG8A 3SG9A 2OJJA 2QCSA 4YNOA 4DFYA 2JKQA 1VR2A 2C3LA 3FZPA 4U3YA 1FBNA 3NYOA 3CXWA 3SV0A 3PXKA 3QYWA 4BB4A 2V7AA 4I4EA 2A4LA 3ZRLA 3QLGA 2OJFE 4QT1A 4AUAA 4QQJA 3P1AA 2WNTA 3ZSIA 3R00A 1GZ8A 1BX6A 4PP7A 3KEXA 1FOTA 4NW6A 3FKLA 1DI8A 2IVSA 4AAAA 2C6EA 4D0XA 2YJRA 2OJ9A 4QMVA 4K9YA 4KS8A 5KHXA 2MGWA 3W2QA 4ZSGA 3TZMA 5CSWA 2PY3A 2VAGA 1UU7A 2W99B 3PP0A 5CAQA 2W1CA 2VWZA 2CGXA 5E1EA 5AUVA 2HAKA 3FRHA 4NUSA 3GENA 3NCGA 2GNIA 2ZJWA 3DDQA 3PFQA 4PNIA 5DEYA 5BMSA 2E9NA 3SOAA 3QQKA 4PNKA 1ZMUA 4ACCA 3N4TA 2WMQA 3HP5A 4UMQA 4V04A 4CVAA 3IW5A 4WKQA 3WIGA 4K77A 4QNYA 3UOHA 5M4IA 4MTAA 4CYJA 3D14A 1OIRA 3SDJA 4E26A 1FQ1B 4D1ZA 4L9IA 3Q96A 4BFMA 5E4HA 3PRFA 3R1NA 4FTUA 3OWLA 3B8QA 3MVJA 1JKKA 1GO5A 1HJPA 2VTTA 3VUGA 3PY1A 1YRPA 3T3VA 3AMBA 5K0KA 4FZFB 4F0IA 4R7BA 2ETRA 4L3LA 1SVGA 5HHWA 2WTKC 1Y8GA 4ASZA 3QGYA 2XEZA 3ZO3A 2PVHA 2XEYA 3C4WA 3LPBA 2ZV9A 2DNAA 3HMMA 2OIDA 2HYYA 4XV2A 2H9VA 2WELA 2G01A 1G41A 2YM8A 1Q3DA 3QRIA 1NT2A 3FBVA 3H0ZA 3PDTA 2C6LA 4ANOA 4R77A 2QNJA 1W84A 4FTTA 4JR3A 1H8FA 5BVFA 3BELA 3EN7A 5AM7A 3PIYA 1Y91A 1BL6A 3DV3A 5IQAA 3W8LA 4J52A 5AJQA 4DN5A 3Q5ZA 4EZ5A 5I9WA 3LCDA 2CLQA 4FZ6A 5AX3A 3TKUA 5LVPA 4LV8A 4PPAA 3P86A 1Q3WA 3RVGA 4AGCA 2GS2A 4EK5A 4DE4A 2DHYA 2QHNA 3PE2A 3K5VA 3SA0A 4MWIA 1M17A 5CU2A 3ORLA 5GJGA 2GNFA 3VS1A 2VTLA 3CCNA 5DYJA 2VRXA 5DT0A 5LVOA 4JDIA 2Z2WA 2YA9A 3OFMA 5BYYA 4C8BA 5KKRC 3U54A 4E5WA 3WYYA 3UO6A 4GUEA 3A4PA 4QOXA 2R4BA 2BFXA 3GOKA 4PL5A 4PWNA 3VUDA 5M4CA 3OEFX 4ACGA 4F9BA 4IMYA 4TKSA 1W8CA 3WI6A 4ZTMA 2PMIA 5HG7A 3UO4A 2ITTA 3NIEA 1OGUA 3V5JA 4AZWA 4NTSA 4FIFA 2PVJA 1FMOE 4NJDA 3BHTA 3BX5A 5J5TA 4OAVB 4W9WA 3LFQA 1GZNA 2I40A 5HI2A 2YIQA 2WZJA 2PE2A 5CSXA 4I23A 4YHJA 5CENA 4C37A 5AP2A 5JK3A 5IH4A 1ATPE 2GU8A 5HBEA 4DHFA 5DEWA 3VULA 3W2PA 3FEGA 4KKHA 5E8WA 2R9SA 4BCJA 1RQQA 4I0RA 4P7EA 4DH8A 5CU4A 3V5PA 3TNPC 4YU2A 1OUYA 5EHLA 5IZFA 2W1DA 1H25A 4RWLA 1W82A 1V1KA 2BDFA 2E2BA 5ACKA 3AMYA 4ITHA 2Z7SA 3ALNA 3S4QA 4Z3VA 3F3WA 4APPA 2ZB0A 4EOLA 3VF8A 2F57A 1DI9A 1O6LA 2VTQA 1HCKA 2Z60A 3GUBA 2DAEA 2OO9A 4WG3A 2QSFX 3HLLA 2WEVA 2ITZA 3DK7A 4XRLA 3QTRA 5F9EA 3B2TA 4NK9A 5AUYA 3OOGA 4MNFA 5I9VA 1PGYA 1Q97A 4DA5A 2R3RA 1W7HA 3TUDA 4DGOA 3ORXA 4Q5HA 3ZLSA 1TQIA 4QYFA 3G51A 3MFRA 4X2NA 4F7LA 3I7CA 2R3OA 2YJSA 4OTHA 4B4LA 5LMBA 4FKUA 4H3BA 4ACDA 3D83A 1T45A 3UMXA 2QKWB 2PK9A 3KXMA 4S2ZA 3JYAA 3N51A 2DAMA 3LFEA 4XBRA 3OW4A 3WE8A 4BCFA 2WTIA 3GC9A 3DBCA 2G2IA 4FL2A 2QI8A 2REIA 2YAAA 3AGLA 4W4YA 4DH1A 2Z02A 5CX9A 5JGAA 5HD4A 5CXHA 3TTIA 5IH6A 3LOKA 3PLSA 2VTRA 3KY2A 3BGPA 4I3ZA 2DUVA 4JG8A 3WOWA 3ZXZA 3FLQA 2YCSA 3UOLA 1JNKA 4FT3A 3AT2A 4L00A 1VZOA 4U80A 2UZBA 3RM6A 3DLZA 3T9TA 3DAEA 4O0VA 4YZBA 4F99A 4C3RA 5EDRA 4XEYA 2VNWA 3BYOA 3G0FA 4U8ZA 5HO7A 2XIRA 1QPJA 4EQMA 3ET7A 4FSMA 4OGRA 5IUIA 4FIEA 3O23A 4YJQA 4IWQA 4FKPA 2PZPA 3ORPA 3E62A 5EM5A 4E20A 5E8YA 4ZTRA 4AW1A 3SOCA 4JG6A 4G5JA 1F4IA 2CKOA 2W9ZB 4CZTA 2ZMCA 5J8IA 4CGAA 1ZYJA 4O7WA 3OTVA 2JNHA 2QHOB 2OFVA 2J0LA 4XG4A 4AU8A 4QTAA 2PVYA 5LMKA 2OI4X 3GT8A 5CT0A 3HVCA 3KKVA 4L53A 3LCKA 3UQGA 4O1OA 2IN6A 4BYIA 1VQ1A 4E1ZA 3DA6A 1M2RA 4LL5A 3FZTA 3ITZA 5AP1A 4PPCA 3UVRA 3TV6A 1VEGA 3MVMA 4TXCA 3E63A 5DRDA 2BTSA 3NWWA 3G33A 2YZAA 5BVKA 3R8PA 4PDSA 3A7IA 3CC6A 3IDBA 3FMMA 3MFTA 1KV1A 3IDCA 4JI9A 2B9FA 4FT0A 4I5MA 2E9UA 4IAFA 3DBEA 2UZWE 4YLJA 4F2LA 4BCQA 5CF6A 4KIOA 1IA9A 2BKKA 3I6WA 3MJ1A 4DCAA 1UWHA 2UVYA 4FKGA 3BZ3A 4OTRA 2OGVA 3AQVA 4ONAA 3E21A 2KNZA 3E7VA 4TL0A 3SRVB 3H9OA 3FZRA 5L2IA 3FJQE 4GEOA 2FVDA 2QO9A 4UALA 3IKAA 5HTBA 2I7QA 3QA0A 3IPHA 3OWPA 5CU0A 2KULA 2VTAA 4TT7A 3GVUA 3BLRA 4Q2AA 3R71A 4CG9A 4R71A 2UW6A 2Y8OA 4O96A 3SAYA 5ANDA 4QO9A 3TTJA 4IHPA 1BI7A 4WBOA 5GZAA 4FNZA 4TYEA 2LGCA 3EN9A 1V0BA 2W5BA 1HCLA 3WZEA 4DT9A 4ANNA 5HIDA 1OPKA 2O63A 5IQEA 5EI2A 3MVLA 4IE9A 2VX3A 1J7UA 4GK3A 5DWRA 4LI5A 4BL1A 3Q60A 4OT5A 4BCMA 4K0YA 5A6NA 3FI3A 4N70A 4W4VA 3BBWA 5CSPA 4HYSA 4MNEB 3GCVA 1PYXA 5A4CA 5IEYA 3PIXA 2VGOA 3DY7A 4OBQA 4PTEA 1Z5MA 3EQBA 4F4PA 3UQFA 4U3ZA 2IG7A 4XS2A 1R1WA 5IA4A 4YJNA 3CIKA 5JFVA 4NTTA 4XP0A 3ZOSA 2I6LA 3CLYA 3OROA 4GG5A 2PU8A 4JT3A 4M97A 3KB7A 3SLSA 2C68A 3OVVA 4ENYA 3RI1A 4ERKA 3HA6A 4BCPA 3NUNA 3E3PA 1XBCA 4O7ZA 2YLFA 5JMSA 4M12A 5FXQA 4ZEGA 2OU7A 3QZGA 3FLWA 2ITWA 4ZIMA 4U41A 5DIAA 4FTMA 3GI3A 4B99A 2B9HA 3RPSA 4NH1A 1XH7A 1U5RA 3D7TA 1WIVA 2B52A 3E7OA 4GK4A 3VUTA 3W32A 4C36A 3JR1A 3S0OA 3BE2A 4HGEA 2X6EA 4R5SA 4FUYA 3WYXA 3VS2A 1MRYA 2A1AB 2PTKA 5CI6A 4EC8A 3QWKA 5AUZA 3TJCA 2VD5A 5EKOA 4C35A 3VBYA 5KHWA 2XK8A 3HV7A 4IB3A 2VWIA 3EKNA 3QC4A 3U4UA 5ETIA 3KMMA 2YWVA 1F3MC 3SC1A 4FK6A 3AC3A 5EDQA 4RA4A 3ZFXA 2HXLA 2GCDA 4FV9A 5LVMA 2EXMA 2YAKA 2X81A 4QMYA 4G9CA 1XH5A 3RP9A 3TV7A 3MTLA 4Y83A 5E8UA 3JVSA 2CHLA 5G1XA 2A2AA 4KUJA 2HK5A 1ZXEA 1YLAA 3WF9A 4MF1A 3R2BA 3K2LA 3MPAA 5IQCA 4IDVA 1IXSA 3QD3A 4ANBA 4RX9A 4NKAA 4C4HA 5CEMA 1PXIA 2R0IA 2QOIA 3HUCA 3CY2A 1GOLA 4GV1A 2YWPA 4BI0A 1OECA 4LQMA 5D9HA 5BX0A 1SNXA 2PZIA 1PYEA 3RPYA 5I5ZA 3EHAA 3OCSA 2WGJA 4L67A 5A9UA 4O6EA 2JC6A 4IFCA 1MQ4A 3PY3A 4AOIA 2UW0A 3QUEA 4FEQA 4M15A 1QPDA 2WMBA 1AIPC 1Z57A 4RSSA 4QMWA 1PMUA 3GU4A 1XQZA 4AA4A 1OL7A 2J0KA 3DBFA 3FMEA 5CANA 2DZLA 4H3QA 2VO0A 1M7NA 5HNIX 4ZS4A 4FBXA 2VWUA 4RLLA 3FLSA 2VTNA 4EH5A 2YEXA 4DFUA 2V55A 4U0IA 4WOVA 4F1IA 1M2PA 2P4IA 2WQBA 3LXKA 4UWCA 3LMIA 1ZOHA 3NX8A 4IVDA 4PDOA 3QRTA 4QQCA 4FX3A 5AP3A 2RKUA 3EB0A 3GOPA 4GK2A 4BZDA 2OJGA 1W98A 4MD7E 4E3CA 2BZIB 3HV3A 3ODYX 3QXOA 1FGIA 2IVVA 3R1SA 2X7GA 3G5DA 3UJGA 3WZKA 5IA5A 4RG0A 5JT2A 2WMAA 3UP2A 3N4UA 5FP5A 3FKOA 4AE9A 5LARA 4BTKA 1XB2B 3FV8A 3F88A 3VF9A 4YR8A 2RGPA 4R3PA 4H39A 1SVEA 5CLPA 2CGWA 2CKEA 3TJDA 1P2AA 4GU6A 4FEXA 2DAGA 4PP9A 2MJ5B 2DENA 1Q8YA 3DNDA 3UYSA 4UMUA 4Q9SA 1KE8A 5HOAA 2XVDA 3DNEA 2G2FA 5E8XA 2CJMA 3UG2A 3FI2A 4FYNA 3PJ3A 4GYIA 2HWPA 2GDOA 3MB7A 4BI1A 5AFVA 3O17A 3PXRA 4JRNA 2IJMA 4MNEA 3TCPA 3BEGA 3QA8A 3HECA 4UN0C 3LFDA 1RJBA 2BROA 3MYGA 3QHRA 3OXZA 2OLCA 1YQJA 2QOOA 4TYHB 4K33A 3LXLA 2GS7A 4HNFA 4LFIA 5KUPA 4NL0A 2EJSA 4RFMA 4X6RA 1OUKA 3R2YA 1ZARA 4A9YA 1IR3A 1YW2A 2HZ4A 4GT5A 3HMNA 2YIYA 4U5JA 5J87A 3U4WA 1IEPA 1OZ1A 2X0GA 5EK7A 3VNTA 1WBNA 5EQEA 5EFQA 4E93A 3OY3A 3B89A 1NV9A 4XG3A 3R7IA 4LV5A 3IW6A 4AW5A 4X3FA 4C4IA 3EQCA 4DTBA 4D9TA 1OKYA 3TIYA 5BYZA 4DEHA 5JRQA 2K9DA 4BTMA 3NSZA 4C62A 4O7SA 1W0XC 4P5ZA 3P0MA 5M56A 2J0IA 3PVUA 5M08A 1UV5A 4YUQA 5HLWA 5CI7A 5M4UA 1GY3A 2PMNX 4DFZE 4QTCA 3BV3A 3S2PA 1YXSA 5CY3A 3OP5A 2XIYA 3FZOA 3ZBXA 1VYZA 3PPJA 4JQ8A 3UG1A 5LOHA 4JBQA 3Q6UA 3HMIA 4FL1A 5I3OA 4YJPA 4UYNA 2X8IA 3KQ7A 3F61A 3ZSHA 5ETFA 4YTIA 1KE5A 4L3JA 2X2LA 5TT7A 4D58A 3AG9A 5KCVA 2PE0A 2ITPA 2PVKA 4EH9A 4J97A 3C7QA 3DT1A 2ZB1A 2ZV8A 3CD8A 3DTWA 1J91A 1F0QA 2R5TA 5CNOA 5AR7A 3OCTA 2JGZA 4FKSA 1PMVA 4HGLA 4J99A 4O0WA 2GQSA 4GL9A 4CMOA 4MXZA 5EYKA 4I41A 4XYFA 1LP4A 3S3IA 2ETMA 1G5SA 4WUNA 4G17A 4DGLC 4IX6A 5C8KA 3JY0A 4UX9A 5AA9A 3THBA 1BI8A 3OT8A 3BLHA 3RCDA 3E3BX 3F3ZA 3CJGA 3ENMA 5DPVA 5C27A 1ZWSA 1L8TA 4AN2A 3EFWA 4G3EA 4DT8A 2PUPA 5EKNA 3DQWA 3FWQA 5CAVA 3H3CA 5HCYA 3UZPA 3CTHA 3MH2A 4DINA 2R3PA 5E9EA 1PXLA 2NPQA 3V5QA 3UQCA 3LCSA 5E92A 5EI8A 3HX4A 4IX4A 3TIZA 2UZEA 2HY81 4EBWA 3LQ8A 5FUTA 4GJ3A 4PL4A 1ERKA 4C59A 2XKCA 4QPSA 3DU8A 1QMZA 3LM0A 3EMGA 3FL4A 5LCKA 3S95A 5M57A 4XV3A 5AP0A 3C4XA 4ZLZA 1WBSA 4FR4A 2W1FA 3FZ1A 3QYZA 2PMOX 1UU9A 4AS0A 4YJTA 4QMPA 2PMLX 5DOSA 4PMPA 4R5YA 3VO3A 3Q6WA 3MIYA 4PQNA 5DHJA 3F3VA 2YCQA 4BF2A 3TV4A 1DO2A 2FSLX 2XNOA 4NM0A 5D7VA 4C3PA 4CT2A 1YOMA 4BCKA 5CAUA 2WIHA 5KZIA 5GNKA 3C1XA 3DB8A 2ITUA 1IA8A 4FSQA 4RJ5A 3FC2A 3RAWA 2Z8CA 4QQTA 2PUIA 5HD7A 4C4GA 3VUHA 2ZAZA 2J9MA 5FXSA 3FMJA 1KE9A 1G8AA 3HGKA 1OQYA 3Q2JA 3QQGA 2CCIA 5KX8A 4WG4A 3GLIE 5L8LA 3OCBA 4ZTQA 4RIWA 4UYAA 3WE4A 3MA6A 4ORKA 3GLHE 4WG5A 3C0HA 3FLZA 4Y46A 3KVXA 4EJ7A 3PY0A 1WR1B 2C6TA 3VC4A 1P5EA 3FRIA 2H6DA 4CFWA 3KRWA 3ZRMA 1BVSA 3R6XA 1GAGA 2ITYA 3LCTA 3PJ1A 4FICA 4R8QA 3IGGA 2GSFA 4RFZA 1A06A 2B9IA 2R3KA 4HGTA 3ZSGA 3BCEA 4JQ7A 3UNZA 5AUWA 5AV1A 2FH9A 2WPAA 1UWJA 2B4SB 4XG7A 5AAEA 1WVYA 4WA9A 2F9GA 5BVOA 2JFLA 3IW4A 4QNAA 4ZJJA 4WD5A 3EL7A 5T6KA 5JGDA 3NNUA 5EOBA 2J6MA 3W2SA 2R7IA 1RDQE 4EKLA 2UW8A 2ZTCA 1OKWA 2BUJA 2BRBA 2XRWA 5DNRA 3MS9A 3VUMA 2IPXA 5LQFA 2PVLA 4RQKA 1KYIA 2WB8A 5HE0A 3R73A 3QTWA 4JX3A 3BBZA 2HW6A 2EXEA 3FYJX 4ZSJA 3SXSA 2WOTA 5HU9A 5I0BA 4EH6A 4UMPA 4QMTA 3GCPA 2W4OA 2B9JA 2WKMA 4I1ZA 4WRGA 2B1PA 4MBIA 4RIXA 1F5QA 4RC3A 5HX8A 1TKIA 4EK3A 4EYMA 3PVWA 3CY3A 3FAAA 5J9LA 1IFYA 3NNWA 4DC2A 1J7LA 2W1EA 4X7QA 3AGMA 3LCVB 1YDRE 2JITA 2P55A 3E93A 2O3PA 5CS6A 3R7GA 5CU3A 3UPXA 1Q62A 3DDPA 4HPUE 4CV8A 4KBAA 3IW8A 4IX3A 4KIKB 4QP6A 4M68A 4FTRA 4DLIA 5AV4A 3W10A 2RF9A 2W05A 1WCCA 4I5CA 3T6PA 1QCFA 3V51A 4BWKA 4IANA 4UN2B 4FKOA 4RJ7A 5JN2A 2X6DA 3A62A 3DJ5A 2YN8A 4IXPA 5HNBA 1YHWA 5HX6A 4P5QA 4E6DA 2C47A 2UZUE 3E5AA 4AN3A 4UWYA 3P78A 4F9YA 1BUHA 2VTOA 4G6LA 3E88A 3NLBA 4A4LA 3A7HA 2FYSA 1WBTA 4AT4A 3HAVA 4UZDA 3Q2MA 4C0TA 5IUGA 3FQEA 2OF2A 4PMTA 4E6AA 5AR3A 3QQFA 5IF1A 3BQCA 3H4JA 1H4LA 4GFGA 3L8VA 3BWFA 4EI4A 2QONA 4ZMEA 4BN1A 2Y7JA 3D5UA 5HCZA 3PPKA 4S33A 1GIIA 4EK4A 1YKRA 3A61A 3F69A 3D9VA 1HT1E 2JDRA 2P2IA 3LE6A 3QWJA 4KA3A 4UB7A 3RWPA 1DV0A 3GCSA 3NW6A 2BMCA 3B8RA 4DFBA 2W1GA 3GQIA 1PXNA 4X3FC 3WF7A 1H08A 4TPTA 4MWHA 3FMNA
chains in the Genus database with same CATH superfamily
5JFSA 4AG6A 1VEKA 1PJSA 2BIKB 2JDVA 2W0JA 3PP1A 5B0XA 3OBGA 4FZDB 4ENXA 3NRMA 3VS5A 3KP0E 4RA5A 5EDPA 1K3WA 4CLJA 4G4RA 4G16A 3LVVA 3MA3A 3LW5F 1Q61A 3FMLA 4BRXA 5LMAA 4MGZE 4ANSA 3MPTA 1GJSA 2PVFA 2W5HA 4R78A 4CKJA 3ZFMA 3KULB 2QOBA 4L8MA 4LGYA 5HO8A 4ALUA 3ORIA 5JZNA 3GLHB 4TYHA 1TTEA 4MXOA 4RX8A 5EM6A 4V0GA 3WF6A 5JH6A 4E73A 1D0LA 4GFOA 2CHQA 4WBBB 4L42A 2G2HA 3HEGA 1PKGA 3PXZA 3PVBA 2YIRA 5H2UA 4QRCA 3HV5A 4USEA 4MK0A 3BE9A 3F3UA 3Q5IA 5AP5A 4UY9A 2Z8YM 2W1ZA 3ACKA 4HZRA 2P33A 3U9NA 2YABA 3LXNA 5FTQA 1IG1A 4X2FA 3R0TA 4YLLA 4DGNA 2WMUA 5EM7A 3AD4A 4P16A 2QC6A 3QQLA 5FM3A 3T15A 1P14A 3ORKA 4NU1A 3K3JA 4Z7HA 2ITQA 2PHKA 5HBHA 3TXOA 3QX4A 2YR0A 4NXNM 1CMKE 1E1XA 2BHHA 3E87A 2AEGA 3CTJA 2JY8A 1KOBA 3L8XA 3VBXA 4BWXA 4DFXE 4DYMA 1A48A 2X49A 4G4NA 1PJJA 1YSYA 3ZLYA 2FS1A 1PY5A 1CKIA 2C9CA 4FC0A 4YZDA 5FWKK 4F7JA 3CSVA 4AI6A 5BPVA 2FGIA 4LJ8A 4HPTE 5HGIA 5BVWA 1QPEA 5L6OA 3GCQA 4KKGA 3VDUA 3EFJA 5GJFA 4AWIA 2DAIA 2YERA 3OT3A 3RPRA 5KMOA 2QLQA 2BRGA 5EHYA 3M11A 5T3QA 4DCEA 1ORYB 5DVRA 1OL6A 3NS9A 4O7LA 1GZOA 4J1RA 3E8DA 2QD9A 3CJFA 4OTIA 4Z9LA 2WFYA 4IAAA 5HVJA 3T9TA 1N75A 5BMMA 1W2CA 4G3DA 3NUYA 3WIKA 3W8QA 3O8UA 3AJIB 1SXJC 2QOFA 3I6UA 3LZBA 3Q52A 5IKWA 3HX3A 3PWYA 3HRCA 4XRJA 4ZSEA 2AC3A 3GLFE 3F92A 2WQOA 1FGKA 3PA4A 4F9WA 1OGYA 1Q24A 4HYHA 4GH2A 4DR7M 2C98A 1Q39A 2CCHA 1IN8A 2XF0A 2Y4IC 3NZ0A 2Z7RA 4QPAA 4AACA 4FV8A 4F7NA 1RW8A 2F7ZE 1GZKA 1M7QA 2WTCA 4D55A 4DTKA 5CALA 2R3MA 3R28A 3F5GA 4GYGA 5AIKA 4ZY6A 4AP7A 1MU5A 4R3CA 2XNMA 4JDJA 4GIHA 4V01A 5BYLA 1YHVA 2XP2A 4RF0A 3UIBA 4EOPA 4GHLA 2WSCF 4G4OA 1OFHA 2BAJA 2J5FA 2XK6A 1OKSA 2ZV2A 4UXQA 5DR6A 5F95A 5AP4A 3GRUA 4QMUA 4RIYB 2HELA 2QO7A 4EEVA 2DZOB 1HOWA 3AL0C 3CPCA 2GHMA 2XYNA 4TZRA 5DT4A 4BHZA 3TUBA 1MP8A 4BGQA 1H1PA 3AC2A 3FSKA 3BHYA 4L78A 1N78A 1BYGA 2YISA 2O2UA 5DLSA 4ACHA 2P0CA 4MBJA 3N4VA 5FTOA 3QRUA 4DFNA 3VFDA 2QKRA 2G1TA 5D10A 5EYCA 5TF9A 4HCVA 4ZP5A 2R62A 4S34A 5HG9A 1LR4A 3RK7A 2FNAA 4RT7A 2Q0NA 3ELJA 5HQ0A 4CT1A 3UOJA 5M06A 1DGHA 4FVRA 1ZOEA 2VWVA 3KL8A 2C6OA 2J4ZA 1BKXA 2X4AA 3LLAA 1PKDA 2V62A 2GFSA 4G3CA 4YJUA 5J95A 2JZ0A 5FBNC 3VIDA 1ZZ2A 4HJOA 3OWKA 5K4IA 1Q8WA 3FXWA 3RCJA 2J7TA 3EKKA 2C1BA 4KLNA 2W4KA 4N6YA 4S32A 5IWAM 4I92A 4A9UA 4H05A 4MM3B 2ONLA 2C5XA 4QOZC 3BI6A 4BCIA 4FVPA 3V6RA 3VS3A 4QP8A 4EUUA 2GNGA 3U6EA 3Q4TA 4FSNA 3Q32A 1JKTA 4JOAA 4II7A 1CSNA 2XJ1A 2R18A 3SBJA 1UNGA 2YDJA 4RPVA 3TKHA 1IM2A 5I9ZA 2XKFA 4YBJA 1SYKA 5I9VA 2YM6A 4DR6M 4MD8E 3UBDA 3LQ5A 1QQWA 2UUEA 5FEEA 2ERCA 3ZDIA 3AOEC 2CMWA 4O1PA 5CF8A 3LKMA 1N33M 5HLPA 3W0QA 2YM5A 4AT3A 3UJNA 3OF0A 5CSVA 4B6LA 5HORA 3QF9A 4I4FA 4QMMA 5J9YA 3VVHA 1TQMA 4YGAA 3DJ7A 1XH9A 3K3IA 4U97A 1UU8A 1TGUA 1I09A 4X0MA 2R65A 1OBDA 2MH8A 4CFNA 1FMKA 1VJYA 2WO6A 4YC8A 3HV6A 4FKLA 5G6VA 3R8MA 5CWZA 1GL6A 1TR8A 1P3QQ 4XBOA 1OITA 3LVPA 4FKVA 4RJ6A 1CKJA 2WIPA 3A7FA 4RLKA 4Z55A 1UNHA 4IWDA 4KBKA 4YHTA 4YHHM 4IAKA 4LY6A 1DGBA 4I6FA 4QYHA 4NXMM 1FVVA 3QHWA 4ZJIA 3R8ZA 4ERWA 4BY9E 2V1UA 2VU3A 3KF7A 2RFNA 4V0GB 3CQWA 3REPA 2YDKA 4MH0E 4QYEA 5EG3A 4JI2M 1OTRA 2C0TA 3QUDA 1T43A 4DV0M 2OW3A 2XM9A 3JPVA 3TN8A 3K92A 4NM3A 4B8MA 1FNNA 2DZNB 4X2GA 2OK1A 1GVNA 4CSVA 4DDGA 2O5KA 1ZQ9A 3F82A 4GRBA 4JNWA 3CKWA 3NEWA 4D1SA 3KVWA 3EQFA 3DS6A 4QYGA 4RWJA 4YTHA 2R44A 5BUIA 3GP0A 3VHEA 3TL4X 3T38A 3QTIA 2OIQA 3ZH8A 2X9EA 4ALWA 3MIAA 4BDJA 5EP2A 2UW9A 3SHGB 3ZHPC 5KBQA 2BILB 4GFMA 1QL6A 1NVSA 1UNLA 1MRVA 4EHVA 1IQPA 5ANOA 4FKJA 4WSQA 2BWBA 4IJEA 3EQDA 3NNXA 2G9XA 4OTFA 5IMEA 4FMQA 1H1RA 1M52A 4PPBA 3DZQA 3T1HM 5DBXA 1XMMA 2F5OA 4CGYB 3PZHA 2X2KA 4JVGA 5EI6A 3LXPA 2PZ5A 2XKEA 5DYIA 5LMKC 2FSTX 4GMQA 3L27A 5EOLA 2RG6A 3C3EA 2WMWA 3POOA 4LGGA 4E4MA 4FKQA 4IJFA 3PJCA 3OXTA 4CEGA 2XS0A 3R21A 1V0PA 4RVTA 4BJJA 2BDWA 4KSPA 3R83A 1PXMA 4ANLA 1ZYCA 4PDPA 3OD6X 5E7RA 1SXJE 5FDPA 4PUZA 4NWMA 1PXOA 4EOJA 2ZM6M 3S00A 3WHLA 2GPHA 1OIYA 2JKMA 4FIIA 4ZSLA 4AA0A 2CKQA 1U59A 4YHFA 5HE1A 5HBJA 4L4UA 1NV8A 2W7XA 4LOPA 4BIEA 4F64A 2C0IA 2BHEA 3PYYA 4D9UA 1DGHB 4F70A 2B0QA 3C50A 3MTFA 2NQ8C 2KHHA 1JSVA 4Z7GA 4O82A 2OG8A 1OFIA 1SZMA 3ZS5A 5CNNA 3HZTA 1PMEA 4J8NA 5AV3A 4F1OA 5D11A 2JBOA 2JBPA 3GCUA 5L8JA 3K5UA 1GJTA 1H00A 2UVZA 2WMTA 1M2QA 5EYMA 4G6ZA 5HG8A 4EH7A 4WUAA 2NO3A 3CS9A 4WNKA 2R3NA 2C3IB 4H3PA 3UC4A 5AADA 3PFYA 4BVUA 4D4YA 4FCVA 4QTDA 5J9ZA 3V8SA 4LL0A 3KGAA 3G0EA 2L2DA 4AT5A 2WQEA 3RWQA 3VJNA 4AKHA 2OZAB 3UOKA 4XG8A 1PXPA 4AQKA 4XV9A 4BR3A 5EQYA 4M67A 4XX9A 2KDLA 3FHIA 5AUUA 2R3GA 3TM0A 5A54A 5CQUA 4L15A 3MH1A 2CN5A 3C9WA 5CSHA 2JY7A 4IIWA 3ZM4A 1L2BA 4QP4A 4CCUA 4AOTA 4CV9A 4QMZA 2DQ7X 4PDYA 1VLRA 2GQRA 5HE2A 5FBOA 3U6DA 3P7CA 2YITA 3Q4ZA 3V5TA 2WTKB 2XALA 2L4EA 3FKNA 4PTCA 3ZONA 4LF7M 5HU3A 2EB3A 3U9CA 4FSTA 4I24A 5L6WL 4A4OA 2VN9A 3GQ3A 3PG3A 3ZBFA 4HVDA 2PYWA 4JI3M 4EOOA 5GZ9A 2AHMA 1FINA 2GTNA 3ORMA 4FSRA 4D4RA 4OTDA 4LYNA 2F5NA 4U7ZA 3SMPA 4XOYA 2AYPA 3W67A 3AT4A 3GC0A 4CMUA 5IA3A 3MW1A 5L2SA 1PJQA 5EXTA 5GINE 3SG8A 3ALOA 4JN6A 4O21A 3EQRA 3R7OA 1SMHA 2A0CX 4B7GA 3QRKA 4I5SA 3U87A 4D5KA 2JD5A 3DKOA 4WP2A 3KC3A 4FODA 4U40A 4E4LA 3TNHA 4DH5A 2X4ZA 5IISA 4Q9ZA 1XNQM 3KULA 4F1TA 3PSDA 3VAPA 3JR5A 4QTBA 1SXJB 2GMXA 5FDXA 1LTMA 5C8NA 1YWRA 4YPSA 4BKZA 4C38A 4Y8DA 5C4LA 1KOAA 4JDKA 3CQUA 5FQDC 3ZC6A 4CRSA 2J0MB 2JDTA 4G31A 5ETCA 4USDA 4HVIA 4NM7A 4HCTA 3W0OA 4TYIA 1XKKA 1RE8A 1R4GA 5FXRA 4YPDA 4OTQA 3GO8A 2WSFF 4YBKA 2OH0E 1NA7A 4XP2A 4YC3A 3SHFA 1REKA 2ERZE 3QTZA 4YP8A 4LOOA 3P7AA 2XIZA 4R3RA 4XP3A 3SW4A 3F5PA 3OZ6A 2XB7A 1QANA 3NYNA 4FV5A 3W2CA 3HWSA 1GIJA 4AW2A 3QRJA 3OC1A 5HG5A 4WURA 1Q8TA 4ZLYA 5F20A 4FOCA 3QTSA 4HNIA 4C3FA 4RWIA 3EIDA 3GPXA 1H1SA 4F0GA 3V5LA 4HZSA 4FTIA 4D4VA 1XO2B 4RWKA 2YCRA 3WF5A 5DFPA 4W5WA 4LGHA 2XSZD 1WBPA 3I01M 4IADA 3ODZX 2MROB 2JIIA 2SRCA 1JQJC 2HL7A 3DKGA 3FYKX 4TRLA 4RIOA 5IEXA 5JRSA 4BDKA 5KPZA 3GU6A 1TVOA 2GTMA 3U5ZB 3RK9A 4TNBA 2QG7A 4FV2A 3VJOA 4USFA 3C4ZA 2LTUA 1OBGA 4KRCA 1NW1A 4JI5M 2B55A 2F49A 3KXXA 4I4LA 1L3RE 1YXUA 4FV7A 4FV6A 2BRMA 4KSQA 5E8ZA 3W0MA 4HOKA 3NFFB 1K82A 1K9AA 2XANA 3M7GA 3C13A 1V92A 2EWAA 4RNAA 3U61B 4LG4A 4TY1A 3R9OA 3RNIA 4RIYA 1K3AA 5KQDA 3TDVA 1JOWB 4OBPA 2BTRA 4MD9E 4YZ9A 1URWA 4BDCA 4EZ7A 4I93A 4UXLA 2OOBA 1PMNA 4GW8A 1WHCA 4GH9A 3D2KA 1CKPA 4AG8A 2ACXA 3EOCA 2BFYA 5ITUA 2UZVA 2IW6A 3KS4A 1Z9XA 2C1AA 5KNJA 2ZM3A 1Y8YA 1XHAA 5EP3A 3QCYA 2B54A 1Q41A 3TL8A 2OO8X 3D5WA 3W2RA 2VX0A 3QUPA 3AC1A 5ICPA 3ROCA 2HKJA 5FTMA 2ZM4A 3V76A 4I6QA 4IC7A 4QMXA 4XNEA 4AQCA 1SVHA 3GRVA 2BRNA 4X2JA 4LJ4A 5CTPA 4C58A 2W5AA 4KO8A 4YSMA 3R63A 4F6SA 2CNVA 1XXHE 4OVZA 3QYBA 1OI9A 1P4FA 3TNIA 2IW9A 4XLIA 4DG0E 3J7AS 4FTAA 2CV1A 3LFFA 4XV1A 4LGMA 1O6KA 4KS7A 4RC2A 3HKPA 4FNYA 2DS1A 3A60A 4EH8A 4F1MA 5B2MA 3ZO4A 3F66A 2Y4IB 3EYHA 3QD0A 4C4FA 1H27A 4S31A 4ZY5A 4O81A 3QZIA 2KZUA 3Q4UA 1R2ZA 1W2FA 4NL4H 3GU8A 4G6NA 3UGCA 4D1XA 4EH4A 5GJDA 2PZYA 3BIZA 3UYTA 5DR9A 5HLNA 2P3GX 3DKCA 4ZZNA 4IB1A 4DG3E 1ZY4A 2C4GA 5IQIA 4O83A 4OLIA 3QTQA 1PW2A 1QPCA 4DR4M 4DV2M 2KEBA 1DAWA 1H0WA 3EQHA 3H10A 4D2WA 4EL9A 3JXWA 3JVRA 2LH0A 4FKIA 1KWPA 2OXYA 3W0FA 3B9PA 5J7HA 1HT2E 2XCHA 5BUJA 2IZRA 3M2WA 2PVRA 4XG6A 2BZKB 1UKHA 2R46A 3GPYA 3WZUA 3MDYA 3VRZA 2DKLA 5BR8M 4MQ2A 4BDAA 5ANKA 4M9ZA 2C6DA 5HESA 1H1WA 2EKFA 4PL3A 4BCHA 3IK3A 3D2IA 4O7YA 2B7AA 2VWWA 1M14A 2Y4PA 4Y72A 3D5VA 4JIAA 4N4SA 4FNWA 1BLXA 3DK6A 3U6MA 2V22A 3LFAA 4B9DA 4FV4A 3U6CA 3HP2A 3TZ9A 3U6SA 4HW7A 2I7QA 4QHTA 2H96A 3ACJA 4C02A 5FTNA 3CGFA 4IBJA 4LMNA 4GKJM 5LMUM 4M7IA 4ZTSA 4FVQA 4BYJA 4WHZA 3V01A 3AC8A 4ZY4A 5CEPA 2X8DA 4JMQA 5DE2A 4X6QC 3QALE 4FTJA 2Q2EB 1FVRA 2BZJA 4NFMA 4QYYA 2LVAA 5LWMA 1OB3A 4FSWA 1SXJA 4G3FA 5FD2A 4EYJA 2PE1A 4W4XA 3RM7A 3MI9A 2HZ0A 5FEQA 3OOMA 2CV2A 2PUUA 4UZHA 2YM3A 1YWNA 2EKKA 4ZMFA 3ZTXA 3R7EA 4J71A 3NUPA 3FTFA 3E8CA 3TEIA 3PPZA 1IASA 3PXYA 4FSZA 2J7NA 3FY2A 4C2WA 5I3RA 4X65M 5A6OA 3G2FA 3FKEA 3L1SA 2OF4A 3UC3A 3HU3A 4ZS0A 3ZO1A 4FWDA 5LVNA 4HVHA 5L3AA 3TG1A 2J5EA 3BU3A 2HZNA 3OS3A 4J98A 4CTBA 5H37D 5ANIA 4DHJA 4FT5A 3UMWA 3S1HA 1O9UA 3O96A 3SX9A 4RMZA 5T68A 4B7HA 3LFCA 3P08A 4NIFB 3ZRKA 4CMTA 2DI0A 4O2PA 5CEQA 3QKKA 4L44A 3KIOC 1MUOA 1ZYDA 5AR4A 1WVWA 5B2LA 3P5KA 4FSYA 3F9NA 2H34A 2Y6OA 4K1BA 4YJSA 4ZZMA 3DB6A 3ZLXA 3C4CA 1H6UA 4AZSA 4NRWA 4DH7A 5B2KA 2J50A 2WMSA 2ZDTA 1SXJD 2RSVA 4ITQA 4YZCA 2WU6A 3DFCB 4OU7A 3PVSA 2IEWA 4LF9M 4I22A 2L7HA 4J7BA 1GABA 3QAME 3CF2A 3PA5A 3FUVA 3GLFA 4U79A 4GIIA 4QMQA 5IPJA 4GJ2A 1E9RA 3R22A 5DT3A 3QQUA 4TNDA 1J7IA 4RGJA 3W0SA 4FTQA 2EA0A 3O7LB 2HXQA 2WOUA 3R04A 4NKSA 3MSSA 3GGFA 5M55A 3HYHA 3O51A 4AZEA 3C0GA 4CFUA 5JI2E 1PRYA 3MY1A 4M14A 1DGGA 2CSNA 4A4XA 4XCUA 3KRLA 5BUEA 4EIWA 2KNAA 3NR9A 3ORZA 4M3QA 3GRYA 4XBUA 4YNEA 5HO6A 4DA5A 4O7VA 5LMNM 1U54A 3BHVA 1DM2A 4U9AA 4XG9A 3AOXA 3RNYA 1V0OA 2VWBA 1TDZA 2QVSE 4RQVA 3TACA 3NDMA 2XNNA 3L9MA 2GNOA 2PVMA 2VDBB 2QQ7A 1VG5A 1UVRA 3FPQA 3C5UA 1TH3A 4DGMA 5LJJA 2HENA 5ANJA 1IN5A 4NJ3A 3ERKA 1ZAEA 2R0UA 3I1AA 4RFYA 4Z16A 2BCJA 3BKBA 4FIJA 2ZAOA 4GKKM 3KREA 3BRBA 4WIHA 5H8BA 3MMPA 4F09A 1OMWA 4OTWA 3PJ8A 2J2IB 4CRLA 2I0VA 4E5AX 2PZRA 3UDBA 3VQHA 4X3FB 3VUKA 2XAMA 1JWHA 3NFGB 4FWGA 3P7BA 2JIUA 4AXAA 3PSBA 3QD4A 4FGBA 4JDHA 4AN9A 4L7SA 1R2YA 3DLSA 3Q4CA 1G3NA 2FSOX 2BNKA 4EONA 4LRJA 3FUPA 3KMWA 4ZTNA 2UW7A 4PMSA 5TKDA 4YJRA 2DYLA 3W33A 5E8VA 2RKOA 1IRKA 2VTIA 1R78A 5HVYA 4CFXA 5CASA 1HNWM 4IBMA 1KFVA 4FKTA 4WNMA 4DHZA 3PUPA 5L2TA 3RINA 1JAMA 5JKGA 2BALA 3E46A 4K11A 5KPRA 3RMFA 3M6AA 2YFXA 3CQEA 2XH9A 4N6ZA 3P4KA 4W8EA 4A9SA 3U6JA 2JDOA 2E9OA 3HV4A 4JR7A 2VTMA 5HCXA 3UIXA 4LDTA 1HQCA 2Z4SA 3D94A 1H26A 2QODA 2GNLA 1Q5KA 4BICA 5HTBA 1Q3CA 3CTWB 3FYCA 2QLUA 2XMYA 3SATA 2V6ZM 4AZFA 3RALA 2X39A 2IW8A 4XOZA 3HA8A 4RC4A 4U44A 4E4XA 4JI7M 4JLCA 4IZYA 3M42A 4RJ3A 4PDGA 4XGIA 3UZTA 5EW8A 3G90X 1AQ1A 1P4OA 1OKZA 1PHKA 2VV9A 2Z7LA 2ESMA 4Z8XA 4DV6M 5CQWA 3O8PA 4LOQA 3U51A 4BGGA 4FTOA 2R3HA 4IW0A 3O71A 4AF3A 2QHMA 4D0WA 3QQHA 2ZYBA 3TWLA 4KIQA 2EO2A 2XA4A 3Q53A 4LJAA 4F9AA 2YNMD 4EWQA 4W4WA 5IMXA 2ETKA 5AX9A 3QGWA 4MCVA 4QMSA 2LVOC 3AOGA 3II5A 4BCOA 4ITJA 4QP3A 1H24A 4P2KA 4D2RA 1B39A 4O27B 2PPQA 3QBNA 3ZLWA 5BVNA 3F7WA 4ZSAA 3FQSA 1YXVA 2XRUA 3BU6A 3GFWA 4BKJA 1JSTA 5K5NA 1H1QA 2BRHA 4BIDA 4CQEA 5JZJA 2VX1A 2UW5A 5FTJA 5CEKA 1OAIA 3OG7A 4QPMA 4AW0A 2UZDA 3VLFB 3MH3A 1GIHA 4LMUA 5I9UA 3HAMA 2HCBA 1X8BA 4I81A 3NYVA 3NNVA 1L1ZA 4H1JA 3L9LA 3WF8A 2CUZA 4O6LA 5TR6A 3TKIA 3TNQB 1U46A 4RVKA 3ZEPA 3RHXA 4GEWA 4EHGA 4FG9A 5AM6A 3U6HA 1REJA 3R9RA 2IVUA 4EBVA 4G3GA 3GLGA 3DFAA 1JVPP 2ZV7A 3FL5A 2BJVA 4BDDA 5GIOE 4LCBA 3SRVA 1Q4LA 2CFOA 4KB8A 4CXAA 2OOAA 4IJ9A 4IVAA 2CN8A 4AGDA 4TTHB 3VQUA 3KOXE 1XNRM 2I1MA 4IVCA 1AUAA 3BYUA 1FPUA 3ENHA 3D7ZA 4JI0M 3R01A 1NVRA 2PL0A 4MXAA 5HICA 4A3VB 2QU5A 4GCJA 1UU3A 3NW7A 4YLKA 3B7NA 1WGNA 4IBBA 5FTGA 2UZOA 4BDHA 3ZM9A 3MPMA 4D2PA 3MHVC 4RZVA 4X66M 4BTJA 5DFLA 2ZDUA 2R3FA 3PXQA 4D28A 4LFCM 3RGFA 2Q83A 4I94A 2WEIA 4BWPA 1ZV1A 5E1SA 3W55A 3KFAA 4FEWA 2XK3A 3BYMA 3KF4A 3ULZA 5BVEA 1PXJA 4EH2A 2L4FA 3HRBA 1OVEA 3EYGA 4DITA 2C3KA 3GLGE 4DBXA 3IGOA 2PULA 3LQQA 1WAKA 4RBLA 1OL5A 1OL1A 1PF8A 3CKXA 4IC8A 4JL9A 4BBEA 4CFVA 2J90A 4KODA 4L6V6 3PA3A 5I9XA 5K3YA 3DXPA 3CF0A 3KMUA 4K8AA 4IX5A 4XHKB 1SG9A 1XMOM 1ZOGA 4GT3A 4F6UA 3ZUVA 3VN9A 5JQ8A 5M53A 4QMLA 4HEOA 5IQBA 1VEJA 3ZQJA 3U8WA 4B8LA 1MQBA 3DTCA 2VWXA 2C5OA 3UODA 3GU5A 1SNUA 1U54B 2JY5A 3GNIB 3JY9A 4RJ4A 3CGOA 4D4SA 4LJ7A 5KBRA 1UKIA 2GHGA 2Q0BA 2RFDA 3KK9A 3L9PA 1R7RA 3A7JA 4S30A 4MX9A 5DI1A 4R6VA 2HWJA 2CNUA 3MJ2A 4IM3A 4L6QA 5C01A 3R9DA 1LUFA 5IDNA 4F63A 3IW7A 3G9NA 2IO6A 1WFCA 3LMHA 2XNEA 3GFEA 1OIUA 3KRXA 3GXLA 4AZTA 4C34A 5J79A 2GS6A 3LJ1A 4MKCA 3QTUA 3DKFA 4X2KA 4D2TA 4FV1A 4AQYM 4O91A 4XJ0A 3LFSA 4ZJVA 4LJ6A 4O0UA 3OHTA 3NVMB 3NMUF 2V5QA 2FUMA 3A8XA 2UXCM 4KIPA 4Q7JA 3ETAA 3L8PA 3WZJA 3SGCA 3P23A 5F1ZA 3BV2A 4HYUA 1NNJA 3W16A 5GIPE 4JX3A 4NCTC 3PTGA 4KNBA 4OT6A 2I7PA 3POZA 2O0UA 4QP2A 3QCXA 4R7HA 5JEBA 2K6BA 4DGGA 1PJKA 3A2CA 2Y21A 2X4FA 1CUKA 3AC5A 2CDZA 3HUBA 5IA0A 1J3HA 1ZY5A 4Y5HA 5AAFA 4UMRA 4CCBA 5CF4A 4KHPM 4AX8A 1LEWA 3C0IA 1E94E 2CNQA 1PXKA 4APCA 3IOKA 2YIXA 3NCZA 4FTLA 3O8TA 1CM8A 4AFEA 3W68A 3I5NA 1JPAA 3T3UA 2VNYA 4QP7A 3ZDUA 3U60B 1WBOA 3D7TB 4JBPA 3OBJA 1WZYA 3EZRA 4QDVA 3T8OA 3W18A 4XUFA 3AC4A 1TFFA 5EH0A 3VBVA 4MQ1A 4N57A 2ERKA 2E5LM 4RX5A 5LXMA 4MGYE 1VEBA 4HVSA 4FUXA 3EIEA 3LW0A 4FEVA 2UXBM 4FCWA 1TQPA 2HIWA 1JKLA 3GEQA 4G34A 4TYGA 1HNZM 1VYWA 1XBAA 2Y0TA 1ZYSA 1IAJA 1Y6BA 3ORNA 4PF4A 2XK9A 4DAWA 2P5TA 1YI6A 4HCUA 3ANQA 5AWMA 2XGNA 4O22A 3SHEA 2XZSA 3UNJA 2EVAA 4FNXA 1XXHB 1L2CA 2C69A 1QUTA 3F3TA 2EB2A 3A99A 4NM5A 3DAJA 4D2VA 4DFLA 4LRMA 2A27A 4MXYA 4LZJA 5H3QA 3SQQA 4BGHA 4W9XA 2WHBA 5E91A 3MESA 3Q04A 3V8WA 1XMLA 4DHIB 2HWOA 5ITTA 4AGWA 3TDWA 2JKKA