2WZJA

Catalytic and uba domain of kinase mark2/(par-1) k82r, t208e double mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
315
structure length
310
Chain Sequence
HIGNYRLLKTIAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE MARK2
publication title Structure and Function of Polarity-Inducing Kinase Family Mark/Par-1 within the Branch of Ampk/Snf1-Related Kinases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 96
structure length 310
sequence length 315
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2wzjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wzjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wzjA01
1WBPA 4B9DA 4RIYB 3VS3A 1MRUA 2JKMA 4XG6A 3RAHA 5DGZA 1CKJA 2BHEA 3CD8A 5DA3A 3R7GA 1Q8UA 3DBQA 4RVKA 2GS7A 4OT5A 3VS6A 3IGGA 3VQHA 3H30A 2C6DA 5E1SA 1U54A 3PE2A 3R7UA 2W4OA 4IWOA 1KE5A 1YHWA 2YM6A 4FT7A 1SNUA 2R3MA 3D9VA 4L42A 3EYGA 4ALWA 3FWQA 4YC8A 5CU3A 2JY7A 1UNGA 3II5A 4D2PA 2IVVA 2JDOA 4UMQA 5M56A 3PIYA 3QKKA 2ITNA 2R2PA 2YM3A 4O27B 4YNEA 4TWCA 5H3QA 4BI1A 3OT3A 2R3IA 2A4LA 1GOLA 2Y4PA 4QTDA 5K5NA 3TN8A 3LMHA 3NR9A 4A06A 5JFVA 3TACA 3H3CA 4IM0A 2C47A 4UX9A 3LCDA 4DH1A 1I09A 2YWVA 4H05A 1CKPA 3GENA 3JUHA 4X3FC 5CEPA 2LTUA 4R7IA 4MD7E 4CRLA 4DGMA 1KOBA 4R3PA 5HIBA 4AQCA 5I4NA 3FXWA 3CJFA 2QKRA 4DFZE 2JUJA 4ZSEA 2IW8A 4FTUA 3A99A 1YHSA 3RKBA 4LOPA 2ITTA 3OF0A 4BYIA 5JH6A 4XYFA 4M0ZA 5EDRA 4UYNA 4QTCA 3HDMA 4CQGA 3R30A 2OWBA 5L2IA 3K9OA 3V6SA 4E3CA 4YURA 4AUAA 1PMNA 2EVAA 4AX8A 2BILB 2VTHA 4G16A 4XRLA 4K2RA 5JRSA 1ZY4A 5EHLA 4YPDA 3ZMMA 2R3OA 2J51A 2CN5A 1YQJA 2ITXA 3NNUA 4RIWB 4TNBA 3VRYA 3ORXA 2UVYA 4LRKA 1C7YA 3VUGA 1OB3A 4FTQA 3R21A 2X8EA 4XLVA 2WQNA 4FT9A 3V5PA 4CTCA 4BY9E 3OWLA 5HICA 3OS3A 4FV3A 3ZUTA 3MY1A 1OVEA 2VV9A 4DBNA 2C6KA 2VTIA 3AOXA 2YM7A 3MY0A 4MBJA 4O2ZA 2JNHA 2PE0A 2W5HA 4BKJA 2UV2A 4FTMA 4RIOA 2XB7A 3HKOA 4YZCA 4L6QA 4BCIA 5EI2A 4LRJA 2XEYA 4GUBA 2X6EA 3NZ0A 2F57A 2OICA 4RA5A 1DAYA 2GNFA 2ERKA 1W0XC 3QZFA 5H8BA 3WZKA 2PE1A 2BFXA 3QFVA 4BZOA 1OMWA 2RSVA 4O7VA 4FIJA 4K1BA 2QKWB 2HWJA 3R9OA 5L2QA 4HOKA 5ACKA 4JI9A 3RWQA 2JD5A 2QOQA 3AD4A 4G6NA 5ANEA 4ZY6A 4JQ8A 4E5BA 3TZ9A 3JVSA 4LV5A 4OAVB 3R1YA 2OZAB 2FYSA 4HVSA 3E8NA 3OCTA 2YDIA 4IWQA 4RQVA 3O2MA 3PVGA 3V6RA 3NUUA 4ANNA 3SOCA 4PDYA 4RJ3A 5AP7A 2NRYA 4DEEA 1IEPA 4HGSA 4MWHA 3R8ZA 4N70A 3BWJA 5IEVA 4EOMA 5JQ5A 2EXEA 3DK6A 1TR8A 3LLAA 2UVXA 2B9FA 2JGZA 4U40A 3ZHPC 2VNWA 5EQEA 4AXAA 5IDNA 3B2TA 1IAJA 3R8UA 3RCDA 3HMOA 3TV4A 3BEGA 4H1JA 2PZPA 3FZPA 2C6LA 4XG4A 1PW2A 3EH9A 4G6LA 4WD5A 2YEXA 4X3JA 2IVTA 1Q61A 3I60A 3R02A 2W5AA 3PY1A 5HORA 4F9CA 2F7XE 4UMPA 1ZARA 1Q99A 2X2LA 3H9FA 4PP7A 1TVOA 5CZIA 4LOQA 4DGNA 4O7NA 4O21A 5FDXA 3UZPA 3W33A 2X8IA 1UWJA 3CTJA 3C0IA 5CEMA 2BROA 4GK2A 4FTKA 1WFCA 3DTWA 4N6ZA 4MF0A 4YJPA 4QMQA 3FYKX 3ZONA 1V0OA 5LQFA 1OKVA 4R3RA 2PU8A 4NM0A 1K9AA 2QR7A 3AC3A 3F5UA 3BGPA 3DZQA 4K18A 4GJ3A 5D9HA 3CEKA 2XKEA 1JSTA 3H9OA 3AC1A 1Z9XA 2PMIA 4G3GA 4X7QA 5CSWA 5L2WA 2GFSA 3VF8A 3R2YA 1H4LA 4W8EA 4QMWA 4XRJA 3M42A 4D2WA 3NDMA 4I1ZA 2KNVA 3NSZA 4I21A 3CE3A 3EL8A 3LPBA 2GHMA 5FEEA 4F6SA 3PSCA 2PULA 3PDTA 5M51A 2EB3A 2RL5A 1OUYA 4NKAA 3QAME 3FZ1A 4J71A 5CVHA 2EU9A 5HIEA 2IZUA 4F09A 2UZVA 5CASA 2CPKE 4QYHA 4P2KA 3W2CA 3ZUUA 2C4GA 4USFA 4AACA 3UPXA 2IZSA 3TNHA 3DLZA 3QC4A 3LXLA 3GLIE 3E21A 5ANGA 1PF8A 5CZHA 4XV3A 2R4BA 3OVVA 4V0GB 3PY0A 4CRSA 1WGLA 2B4SB 2PSQA 5HG7A 5LVPA 3V5WA 5AR7A 5BVFA 4V01A 4UMTA 4N0SA 4OT6A 3VULA 5DT0A 1NXKA 3G9LX 1BUHA 3F7WA 4WNKA 2ZDTA 1JBPE 3OW4A 4D4RA 5HTIA 4QNYA 3IPHA 1WAKA 5BX0A 3E63A 1IG1A 4ARKA 2A0CX 4FT0A 5DFPA 3QQJA 1H27A 3MVHA 3IW4A 4K8AA 4CEGA 2CGVA 3FZSA 4EC8A 3SQQA 3HRBA 5LCJA 2O8YA 5EHYA 2AYPA 2EB2A 5FTQA 4L01A 3R0TA 4KBAA 2X6DA 5L4QA 3HMPA 3CR0A 3KRJA 4PTGA 2JDVA 3COKA 3PJ8A 2VTTA 4WUAA 5HE3A 5BYYA 3R9DA 3R1SA 2QG7A 3FMDA 1YWNA 2P4IA 3FMMA 3DBEA 3QXPA 5HX6A 5EOLA 3KGAA 3BWFA 4M69B 3QX4A 4EK5A 3CPCA 1HOWA 3QCQA 3FE3A 4C4EA 2LVNC 4ZEGA 2X7OA 3SOAA 4MQ1A 3VNTA 4EUUA 4KIKB 5CF5A 1UKIA 1RQQA 3HGKA 3QYWA 5A3XA 1TTEA 1VYWA 4WP2A 3EQGA 3RAKA 4AFJA 3KQ7A 5CVGA 5AAFA 4ZMEA 3OBJA 3OMVA 4YJTA 3TWJA 3GLGE 5DPVA 3EOCA 4CFFA 2P2HA 2W1DA 2XKCA 4ZSAA 3DDPA 2F9GA 3P7AA 4FKGA 3EFLA 3K5VA 4U45A 1FQ1B 4H3QA 4L46A 2XM9A 5AIRA 1JKLA 2O2UA 2W7XA 2DI0A 3NUYA 5CT7A 2UZBA 3RBWA 5BVEA 2RG6A 4DH5A 1Y8YA 4E6DA 4WBBB 4B0GA 3EQRA 3OROA 5G1XA 2C0TA 4NM5A 3FAAA 3EWHA 3I81A 3ZFXA 4EORA 4IJ9A 4PDSA 3MPMA 1BI7A 2ZMCA 5CS6A 2BALA 5IQCA 3KU2A 1FGIA 3OZ6A 2XRUA 4RWJA 2OI4X 4YHJA 3ANRA 5AP1A 3RP9A 5A14A 4IVAA 5C8KA 4KIPA 4QPSA 3RTPA 4GVAA 1ND4A 2WQMA 4EH5A 1Q8YA 2BZIB 3C4WA 1FINA 4FTOA 4BWKA 4D2SA 2EXMA 2FSTX 4WIHA 5HBHA 4OBPA 4F64A 4FK6A 3U6HA 5L6PA 3FHRA 3D2KA 4BIBA 4EJNA 1T46A 4DA5A 3Q4ZA 4FUYA 4QP2A 4I24A 3E46A 3D83A 4QP4A 4BGHA 3E7VA 4HYHA 4G3OA 2JBPA 3DDQA 4J97A 5DNRA 1S9JA 4L3PA 1PXMA 2R3FA 3LCOA 4O0XA 5GZ9A 3FKLA 3B2WA 4IEBA 5BNJA 4DCAA 3V51A 4IAFA 2GNLA 3MVMA 2PVMA 2BZHB 3BQCA 2DYLA 2Y7JA 4WRSA 3WILA 4AGCA 4XG9A 4D9UA 5A6OA 3A4PA 5DMZA 3JY9A 3CCNA 5HG9A 5J5SA 1ZV1A 2OH4A 1MRYA 2YIYA 3LFBA 3ODZX 2WTKB 3FI4A 4PNIA 3KRWA 4GK3A 4GFOA 3L8XA 4BDBA 4UB7A 3LMGA 4GW8A 2YHVA 1EH4A 3F3UA 4QP9A 1OL7A 3NVMB 4S33A 4Q5EA 4FL2A 3IO7A 1IFYA 4XG2A 3NMUF 5BUEA 2C6MA 4EH2A 3LOKA 4C58A 4EH8A 5C4KA 4X2GA 5KZ0A 3QQKA 1UNLA 3SD0A 3V04A 4GEWA 4L3JA 3BU3A 5IG1A 5JT2A 2UZDA 1HCLA 3I79A 2X7GA 4FEQA 4KAOA 4ITHA 4WA9A 2C6EA 4O81A 4TW9A 5EI6A 1NW1A 5B2KA 3EN6A 3K9PA 3S00A 1K2PA 2J50A 4P90A 3RI1A 3VW8A 5IUGA 4RFYA 5D10A 3F3WA 3R7VA 3QKLA 4AWIA 4EBVA 2RFDA 4FV9A 4MWIA 3UTOA 1VEJA 2HW7A 3QA0A 4WRGA 1G5SA 4EUTA 3UQCA 2O63A 2VTLA 2R3RA 2QHMA 3EN5A 1PXOA 3L1SA 3OXTA 3PG3A 4FK3A 2WMVA 3K54A 3O71A 4YLLA 4FTJA 3AG9A 3ZS5A 2E9OA 3GCVA 3OP5A 5ETFA 5BVOA 2DUVA 5HZNA 1WZYA 3HMIA 3DKCA 4A4XA 4F70A 3D15A 2PE2A 3E3BX 5HOAA 3R1NA 4R1VA 1HT2E 3UMXA 3ZOSA 5K9IA 4NL0A 2BR1A 3GC9A 3LFFA 1Q97A 2VX0A 3ZLXA 3PP0A 4AN3A 3SGCA 4QP6A 5DYJA 3TIZA 2WPAA 4M97A 2WTDA 2BRGA 2JITA 3SW7A 3CP9A 1R78A 2W9FB 3GU5A 4L9IA 2G3QA 1Q5KA 4MCVA 4HGLA 2WIHA 4S31A 4EOLA 5AA9A 3FC2A 4BICA 4KABA 2OF2A 1L3RE 4D4YA 4EZ3A 3FQSA 4ZK5A 4QMNA 2WNTA 2Y0AA 4F1OA 2Y9QA 3G90X 4FEXA 2PMNX 2WMBA 1P14A 2F2CB 1PXLA 2J2IB 3P78A 4BYJA 2FH9A 3OUKA 2QOHA 5J87A 3L8VA 2QOFA 2YN8A 3D7ZA 3AT2A 2UW6A 3F69A 3EFWA 2XUUA 2R0UA 1NVSA 2ZDUA 3F9NA 2O3PA 3T9TA 1OBDA 3G6GA 5HE0A 4E73A 2YJSA 4J7BA 4RIYA 1B6CB 4IB1A 4C34A 5CU0A 5AUYA 1Q41A 5F20A 5H2UA 5C27A 4OTHA 2RKUA 4WNPA 4O0SA 3KULB 3S3IA 2J0IA 5KO1A 1W84A 3DS6A 4XNEA 3UIUA 4DGLC 1JKSA 3BV3A 2XCHA 4FTNA 4U97A 1RDQE 5IA0A 3TDWA 3RHKA 4M66A 1BL7A 3RPSA 5I9VA 4M13A 3KXGA 4AP7A 1WBTA 1M7QA 4IACA 3JPVA 3FBVA 5T3QA 3HECA 1URWA 4RRVA 1R4GA 3F82A 2QD9A 4WNMA 5EI8A 4IFCA 2PVJA 2Z60A 4DT9A 2GPHA 1REJA 2C5YA 4ONAA 4M0YA 5J79A 3ULIA 5HO6A 3ALNA 1ZY5A 5ITAA 3ENMA 4DBXA 3CJGA 3U51A 4DH7A 1W83A 3ZZWA 3ZYAA 2IZRA 4ID7A 2YM4A 3C1XA 5T6KA 2GDOA 3MA6A 4BGQA 1FVVA 2CCIA 3IQ7A 3TI1A 1JLUE 1QPDA 4RBLA 3LCSA 2QOIA 4XOZA 5CNOA 3LXNA 3RNIA 1QPCA 2OG8A 4FNYA 4DG3E 4UMRA 4JT3A 3C7QA 3UVRA 3MSSA 4WSQA 4A9SA 4KIOA 3ATSA 3CGOA 1PXKA 4HVGA 3OW3A 4LI5A 3HV7A 3V8SA 1XWSA 4E26A 4UXLA 4ASEA 3AC2A 4M3QA 4PMTA 5K0XA 2X4FA 3UQGA 2JP7A 4AGUA 4CFUA 4MXZA 4G34A 2KHHA 2CHLA 3FJQE 4GKIA 4K9YA 4CT1A 3ZBFA 2NO3A 2W17A 4FNZA 2IZTA 5JSMA 1J1CA 3NW7A 4RIWA 3COHA 4UBAA 1XH5A 2O64A 3EFKA 2OXYA 3F2RA 4GU6A 2GNJA 2BAKA 4EZ7A 5J5TA 3RZFA 2ITQA 3D5VA 3DOGA 3ELJA 4U0IA 4EH9A 4L00A 5KBQA 3HL7A 3EHAA 5KCVA 3K2LA 2QO2A 3UIBA 3F3TA 2R0IA 1V92A 2HIWA 3MFTA 1E1VA 3MIAA 3W32A 4B8LA 4C59A 1SVHA 4YTCA 4RWLA 2W1FA 5LVOA 1ZYCA 2B9IA 2OO8X 1KYIA 3CGFA 2XK3A 1B39A 4AW1A 2JIVA 1XJDA 3D14A 4YZBA 3SKCA 4EEVA 3UPZA 4P7EA 5EM5A 3FI8A 2C6IA 4OR5A 1JPAA 4FV2A 3WOWA 3ORKA 1APME 3FSFA 1XHAA 5M06A 3IONA 5IU2A 2UZOA 3HRFA 3KCKA 4JX7A 3QWJA 2H34A 3RPVA 3UO6A 4XV1A 2WTIA 5CSPA 2OJ9A 2Z7QA 5DRBA 4O7WA 3SX9A 4R77A 4XG8A 5HVJA 2VO0A 5EYDA 2WU7A 3UOJA 1JNKA 3IGOA 2UUEA 3KB7A 2K0BX 4TY1A 3A61A 5DEYA 3UBDA 4ZAUA 1VEKA 1XXHE 2DZLA 1BL6A 4QQCA 3ZO2A 3ZEWA 4I94A 4C33A 4O7YA 3A62A 3MFRA 2R5TA 4I23A 4J1RA 4JBQA 4C36A 4ZY5A 4NJ3A 3W2RA 4IBMA 4CQEA 2XF0A 4QRCA 2R3PA 2I6LA 2BCJA 1WVXA 2OZAA 4WT6A 3BV2A 3F7ZA 1RJBA 4I5CA 4LG4A 3UP2A 3SG9A 5CQUA 1M2PA 4FKSA 1URCA 2H8HA 3PSDA 3E8CA 4PWNA 2QU6A 4W8DA 3D0EA 3LJ0A 1XH9A 2XCKA 5KE0A 4XBRA 5AUTA 3NIEA 1H26A 1PHKA 4NCTA 3QWKA 2XJ1A 4HJOA 4YSMA 5D11A 2AC3A 4X3FB 2JEDA 3I5ZA 5I3RA 1PXPA 5L6OA 3LJ1A 3KF7A 3QLFA 4BR3A 5GIPE 4D1SA 2C69A 3PWYA 5IMXA 2YAKA 5A9UA 3NUPA 4ANMA 3HAMA 5IA2A 2G2IA 4F0IA 1J7IA 3P08A 1DI8A 2QOKA 2R3KA 5HO8A 3U87A 1BLXA 1FVRA 1VJYA 2VTQA 4BCKA 1WBWA 2QURA 3EN7A 3L8PA 5EH0A 3R8VA 3KC3A 4UZDA 4C4GA 4JDHA 4IVDA 3VW6A 3OTVA 3MIYA 4RJ8A 2X1NA 2BRMA 2JC6A 2CGWA 5HVKA 4BDHA 2C3LA 2PMLX 4NEUA 4QMZA 2BAQA 2GFCA 3AD5A 3D5XA 5B7VA 3O50A 4FVRA 5E8YA 2EXCX 5HLWA 2C5XA 4TWPA 3GC8A 2YCRA 4FSMA 4NK9A 3A8XA 4O7LA 4C2VA 2BWBA 2JAMA 3NRMA 3SXSA 5DRDA 4FR4A 2R7BA 3C0HA 1SM2A 3DB6A 4ZSJA 1IR3A 2I7QA 1M2RA 3EL7A 5L2SA 3AD6A 4FIGA 2H6DA 3BE9A 3GCSA 3LQ5A 3ZO3A 1GIHA 4QYGA 3QTXA 4BHNA 4C4FA 4U3ZA 3H4JA 3FL4A 3QA8A 4TYIA 1OL2A 4XLIA 3QRUA 4E5AX 1YDSE 3SHEA 1TQPA 4NUSA 3ZEPA 3UC3A 2YDKA 4QP7A 3AXWA 5AAGA 4DTKA 3BYSA 3LFCA 3DNDA 5IDPA 3EJ1A 3R7EA 3VBYA 2PY3A 1IRKA 3F5GA 3NAYA 3PJ3A 4RIXB 2VNYA 3MDYA 3PP1A 1H1WA 2JZ1A 5AM7A 1Z5MA 3P7CA 4QQJA 3UP7A 4AOTA 2PVYA 5CANA 4W4WA 1X8BA 1TQIA 3FY0A 5HCZA 4JOAA 4FG8A 3W18A 2B54A 2XBJA 4I0TA 3SG8A 3KA0A 3VS4A 4DEIA 4FICA 4TYJA 3E8DA 1XH4A 5CAQA 3QQHA 3FHIA 5EW3A 2CCHA 5EDPA 4ACDA 2A1AB 4NZWB 4CCUA 4A4OA 5K5XA 3IW6A 4X6QC 4DEGA 1IAHA 1XBBA 3UG2A 2P2IA 5AADA 3NNVA 2DKLA 1HQYE 4NM7A 4O0YA 3M11A 5DR2A 3BI6A 2RRUA 1PY5A 4EYJA 4LL5A 4JQ7A 4QMMA 1ZYSA 2WD1A 3HYHA 1UKHA 4GH2A 2DS1A 3C50A 3G9NA 4Q2AA 4CCBA 4CNHA 4MXAA 4M69A 3HV3A 3V01A 1TQMA 1NA7A 1ZAOA 4F65A 2F4JA 4DAWA 4FSNA 4JRNA 3U8WA 5KMNA 4JQEA 4PDOA 3MESA 4K11A 3FPQA 2JDTA 3R9NA 4C35A 5CVFA 3AC5A 4QT1A 3PJ2A 3UOKA 4BDJA 3S2PA 2XNOA 4O7ZA 5BVDA 1ZOHA 2JFLA 5KNJA 3ZBXA 3F3ZA 4IAIA 4RJ5A 2XNGA 1ZMVA 4QMXA 1WCCA 3QQFA 2RGPA 4FBXA 5IQFA 3E87A 3DQXA 1YWVA 3DT1A 5A6NA 1Y91A 2PL0A 4G3FA 4PL3A 4NIFB 4RC3A 4YJOA 3TZ8A 3OWJA 4F9YA 3UQFA 3QHRA 1J91A 3KVXA 3WI6A 2VRXA 3A7FA 4U9AA 1XH7A 4U41A 2C1BA 3VUDA 4FV6A 4ITIA 4J96A 2HW6A 3GI3A 3VS2A 4BL1A 3KVWA 5FP6A 4FSYA 3UO5A 4HEOA 2BPMA 1DO0A 4IZYA 5E8XA 3VQUA 4BCHA 5E8WA 1H8FA 4L68A 4FKLA 5M44A 4FSWA 1HJPA 4FIEA 3ROCA 4FGBA 5BYZA 3SW4A 2HZ4A 3KMWA 2NRUA 4BI0A 3BYUA 5DLSA 5AV4A 2GSFA 3KCFA 4GVJA 2B3TA 2OF4A 3HP5A 3P23A 3P4KA 5AM6A 4LGDA 1BVSA 5AUWA 5I0BA 5IH5A 3C51A 5HG8A 3ZLSA 4B7TA 1H25A 4U42A 5ANIA 3OEZA 3LKMA 5HLPA 3GVUA 4JBPA 3MGYA 4CVAA 4ALVA 3NYNA 3BYOA 3O51A 3R7OA 4F0FA 4HW7A 4JJRA 1UU9A 4PF4A 2XRWA 1JWHA 1UU8A 2QG5A 4YZDA 4F0GA 2UW8A 4IDTA 2PVHA 5I3OA 1A06A 3MVLA 3WE4A 3BBZA 4U44A 5L6WL 4RLLA 3AGLA 2XNPA 3THBA 4D0XA 5E92A 4KKHA 1JKTA 1OBGA 4CYIA 2WELA 3BHTA 4FKJA 2ITUA 4P5ZA 4UXQA 2O25A 5F94A 3G51A 1IASA 3ROYA 4DF3A 1BI8A 3PJCA 5GIOE 3WIGA 2VWWA 3ANQA 4CFMA 3CS9A 2B1PA 3PIZA 4K77A 4I20A 3QLGA 2VUWA 5KHWA 5J1WA 5ANKA 3B89A 4D1XA 4QMUA 4I4FA 5TF9A 4ZSGA 3TKUA 4GU9A 4S32A 4CZTA 5DVRA 3CQEA 3EYHA 1A48A 5AP6A 3LAUA 2CP8A 4CFNA 5F1ZA 4RG0A 2R3LA 2BDJA 2RF9A 2RFEA 2YZAA 2G1TA 4L45A 3TUCA 4CKRA 3GU6A 3OY3A 4XUFA 4Y5QA 2YLEA 3NYXA 2XK7A 4XMOA 3LCUA 2XS0A 1ZRZA 2E9PA 4FNWA 4WG3A 4JG6A 4IAYA 5AA8A 4APPA 1MQBA 4EQUA 3FXXA 3FMEA 3WBLA 4NU1A 3ULZA 4W9WA 3MI9A 3BLHA 2G2FA 3QF9A 1ZOGA 2XA4A 2DHYA 2O0UA 3A7IA 4RVMA 3UOLA 2OK1A 1GZNA 2VWVA 4FUXA 5DI1A 1FOTA 3NNXA 5J7HA 2V55A 2ZTDA 3QL8A 3BE2A 4MQ2A 5IMEA 5G6VA 3RVGA 3U9CA 2Y8OA 2J0JA 4FZ7A 4I6FA 4ZLOA 1YXXA 4XHKB 1S9IA 4M84A 4AA5A 3D2IA 4JR3A 5IKWA 2HY81 3FQHA 4C7TA 2ZB0A 4EK4A 3GP0A 3DAKA 2ETRA 3DV3A 2CMWA 3BU6A 3OC1A 4WSYA 1WVWA 5DFLA 3FI2A 5A54A 5IA3A 3FLNC 4AF3A 4PPBA 3P5KA 3BQRA 4LMNA 4GG7A 3RAIA 2NP8A 5ETCA 5DBXA 1R39A 4RLKA 4WG4A 4F9AA 5M09A 1LEWA 3KY2A 1ZLTA 3ZM9A 3D5UA 2GMXA 4AS0A 4EHEA 4K6ZA 5DT4A 3TL8A 3UVPA 1G3NA 4IX6A 3GU8A 3A60A 5HTCA 3VJNA 3VF9A 1ZYLA 3OWPA 1YLAA 3KFAA 4FIHA 3SRVB 4O86A 3R9RA 1O9UA 3ZFYA 3KREA 2BHHA 4QMOA 5KMIA 2E9VA 2ONLA 3GFEA 4FC0A 3RGFA 4XP3A 2UZTA 1ZMWA 3D7TB 4YJSA 2OGVA 4Y73A 4B4LA 5GJGA 2X7FA 2XNBA 3GCQA 3UC4A 4AT5A 3LFSA 1BX6A 4AOJA 3HA6A 1AD5A 2KTYA 3RHXA 4A9TA 2ZM4A 2ITZA 1QMZA 3G0EA 4GIIA 2GCDA 2GNGA 4OLIA 3G5DA 1IXSA 3BGZA 4QQ5A 5DN3A 4ACCA 3CXWA 3Q4CA 3KULA 3RALA 4BDIA 4O1PA 5IA5A 3B8QA 3ORTA 3UVQA 3ZO4A 4C2WA 4EH7A 2WXVA 3C0GA 3CPBA 3L9PA 4ZZNA 4DFUA 3QHWA 3MH2A 4UV0A 4EI4A 2OLCA 2FGIA 3PSBA 4RWIA 5AV1A 4EK6A 3FMHA 3OY1A 4M12A 5B2MA 3F5PA 3I5NA 1G41A 4ZTNA 3HMNA 4O22A 3HZTA 2OJJA 4ACGA 5FXRA 3ORIA 4MEDA 5D41A 1PGYA 4N4SA 5J8IA 4Y8DA 5BPYA 1PRYA 1VR2A 5FGKA 4DCEA 4JIAA 2FUMA 5KMJA 1IA9A 2NNWB 4OTDA 4IX4A 2WQEA 3AMYA 5LVMA 1UFZA 4R78A 4RWKA 5AV3A 3D4QA 3VBVA 3NPCA 3R73A 4EWQA 3UZRA 4R71A 4ZTQA 2L4FA 2HOGA 4P4CA 4EKKA 4EK3A 1YDTE 5AP4A 1STCE 4I3ZA 5AUVA 3VBQA 3W8QA 4EH4A 3PXZA 2KNZA 3GQLA 1BMKA 5HX8A 4AZVA 3LW0A 2W4JA 1MQ4A 2HCKA 4R7BA 1YOLA 4MXXA 1CDKA 4WNOA 1XH8A 3CY3A 4C38A 2J5FA 3W8LA 4CXAA 3TV7A 2R9SA 4BHZA 3F6XA 3MN3A 4H36A 5KBRA 4TPTA 3PPJA 1OIUA 1Q24A 5E8ZA 3C9WA 2YCFA 3RM6A 2H9VA 3E8EA 3QUEA 4FVQA 2YIWA 4FKUA 4GT3A 1Z57A 4AN9A 1JOWB 2VTAA 4I92A 1O6LA 3NCZA 4RA4A 4AAAA 4GJ2A 1V0PA 4M8TA 1OZ1A 4DYMA 4YBJA 2EUFB 2CLXA 3LCTA 2CKOA 5LVNA 2X9EA 3KMMA 1REKA 3R01A 4MVFA 2JIUA 5AIKA 4A9RA 4D2VA 4PL5A 2ZV9A 4ASDA 4BB4A 2DNAA 5GINE 2BMCA 3VUTA 4CMOA 4DINA 4UMUA 4U5JA 1XBAA 4G31A 2CN8A 4JLCA 4E8AA 4AW5A 5CI7A 3C4ZA 3H0YA 2VWZA 1PKGA 3O8PA 4KINA 5E8VA 2Z8CA 5EM8A 1U5QA 5AR3A 2YM5A 5J1VA 4NH1A 4BTMA 3Q9WA 5GZAA 3NEWA 2VO3A 3F2NA 5FLFA 3IKAA 4K0YA 3ORNA 2WGJA 1O6KA 2YACA 3PVBA 4IC8A 3PVWA 5E1EA 3DJ6A 1WVYA 1U54B 2XK6A 2B7AA 2C68A 2FA2A 2UW4A 2VWIA 3O7LB 3AT3A 4Y83A 5BYLA 5K0KA 4F9BA 2OBJA 4ANOA 5AWMA 4JDJA 2Y4IC 4JAJA 4BN1A 4F6WA 5CF8A 5IQIA 1E94E 2I0VA 2OW3A 3LQ8A 3NW6A 3PRIA 4FV7A 2C3JA 3P1AA 1M14A 3VWAA 4M68A 1SMHA 2IVSA 2W96B 4M14A 4E6QA 3MPTA 3KXHA 4XBUA 2W1HA 3BRBA 3GFWA 1Y6AA 5TR6A 4TTHB 4AZTA 4AN2A 4FEWA 3EQPA 3SDJA 4DTBA 4LQMA 2C0OA 3BX5A 3VS0A 4FV5A 4FKIA 5HKMA 2XK9A 4KIQA 5IPJA 1YXUA 4ZMFA 4O83A 3KXZA 4R1YA 4APCA 2ETKA 2YFXA 5L2TA 5TOZA 1LPUA 4X3FA 4MHAA 3FUPA 5DHJA 1B38A 3MTFA 4XP2A 3VRZA 5J7BA 4DG0E 3TNWA 3SXFA 2BRNA 4IZAA 1YXVA 4BI2A 4RGJA 3WZDA 4Z55A 3UNJA 4OTPA 4XG3A 2OJIA 5KZIA 2VO7A 2RIOA 5HEZA 3IOKA 4U7ZA 3O0GA 4QTBA 3NAXA 5LWMA 2W9ZB 2PPQA 3DQWA 3QKMA 2DAGA 3UMWA 1GNGA 4D5KA 3OCGA 2CNUA 3O7LD 1WMKA 3FMLA 4CFWA 4PY1A 3ID6C 4IB3A 4TRLA 3WE8A 3OCSA 1UNHA 3R8LA 4Q9SA 2YIQA 4R7HA 4L7FA 3W16A 4V04A 3DFCB 4I5PA 3TTJA 2Z7SA 5L8LA 4CYJA 2CDZA 4RVTA 3R6XA 3PPZA 2MJ5B 2I0EA 3MYGA 2VX1A 4U43A 3FLYA 4FTCA 4ZJIA 3NX8A 4H58A 4GMYA 3FMJA 2GNIA 3I0OA 3BCEA 3PG1A 4YO4A 1GO5A 4JBOA 1ZYJA 2W1ZA 2VWXA 3LFAA 1XB2B 3JVRA 4Z7HA 2VD5A 1NV8A 5CY3A 4JS8A 2XBAA 3VBXA 5GHVA 1XH6A 5IH4A 3BHUA 4DH3A 3SA0A 5KUPA 3T9IA 1VG5A 3F66A 4IIRA 4EH3A 3O8UA 2IWIA 5H8GA 3C4EA 4EONA 5IQAA 2ETMA 4TYGA 1WBOA 2C1AA 1CUKA 2ESMA 5FQDC 2UVZA 1NVRA 4EQCA 1WGNA 3W55A 3RAWA 3MW1A 3L8SA 3PA5A 3MA3A 3ALOA 3DKOA 1SZMA 3NGAA 4XOYA 4DE4A 2W1EA 4XG7A 3U9NA 4L53A 3V8TA 3COIA 3DA6A 4G3DA 2ZV7A 4AA4A 4HCTA 5A4QA 2VGPA 4EOSA 4CT2A 4IWPA 3PA4A 3O17A 1F5QA 4NKSA 4L7SA 3MVJA 3UZTA 3LCKA 2YZLA 3QTUA 1MP8A 3MFSA 3R00A 3I7CA 4X0MA 2C6TA 2IVUA 2B9JA 3DBDA 3VS5A 3AC4A 4OBOA 2G9XA 3MJ1A 2V7OA 4ZTMA 3KF4A 3EFJA 3NIZA 4R8QA 3C13A 2ITPA 4RJ6A 5JKGA 4O96A 5CAPA 3ACKA 2ITYA 4YBKA 4MXYA 1U59A 2FSOX 1YDRE 3MPAA 4FZAB 4C37A 2VN9A 3FRHA 3C5IA 1PYEA 4O82A 1ATPE 5DR6A 3QZHA 5B2LA 4PMPA 4IQ6A 3FPMA 3U4WA 4CG9A 1DO2A 4FV8A 5A46A 4BCFA 2XH5A 2UW3A 2BUJA 2ZV2A 3Q9ZA 4G9RA 5EQYA 4FYOA 1RW8A 3MH3A 4LYNA 5LMAA 2WMRA 2YISA 4QOXA 4M7IA 2JZ0A 2B0QA 4A9YA 3VN9A 1SVEA 2QVSE 3MJ2A 3NYOA 3U4UA 3FI3A 1OPKA 4MBLA 3TKIA 4NIFA 3IW7A 4TXCA 4F2LA 4P5QA 5FM3A 1ZWSA 3GUBA 5CAUA 1V0BA 5LXMA 4IDVA 4RPVA 3VVHA 2Z02A 2OOBA 4E5WA 4FI1A 2YITA 4KA3A 3BHVA 3I0QA 4AGDA 4AW0A 3IK3A 5JGAA 4XH6A 4ALUA 2BZKB 3ORLA 3KEXA 4EBWA 1YHVA 2QOOA 2W05A 3AQVA 3CBLA 4O0TA 2Z7RA 4ZTHA 4HGTA 4G17A 3TJDA 3AT4A 3PXFA 1OL5A 2QR8A 2HZNA 3W2PA 4TYHB 4GS6A 2YIRA 3VUIA 1FPUA 1OL6A 5GNKA 3UYTA 4ZTLA 3DLSA 3PWDA 5M4FA 1OKZA 3RK5A 4MBIA 5AUUA 4IXPA 5HO7A 3IHPA 4KD1A 1H0VA 3RINA 4FKPA 3VAPA 1VDLA 4L8MA 2YDJA 4XEYA 1YVJA 4I6QA 2W0JA 2C5VA 3FC1X 2ITOA 4OTWA 3QGYA 1H07A 4C4IA 4B6LA 3BPRA 4BBMA 3G15A 1W98A 3FDNA 3QTWA 4YHTA 5EYMA 4CKJA 4HYIA 5F9EA 1KE9A 3AMBA 3CQWA 1JSUA 5TE0A 5AR8A 3S95A 4HGEA 5BVNA 5HVYA 2QQ7A 2XKDA 2WTKC 2OSCA 4Q9ZA 3QZGA 2W1GA 3EB0A 3EQCA 4FKQA 2WTWA 5AUXA 3MBLA 3DTCA 3BEAA 4DEBA 1G4AE 4BCJA 4BBEA 3MY5A 3Q2JA 4I6BA 5HCYA 3ZFMA 4BDEA 4KKEA 4Y5HA 4BTJA 3DKFA 2W5BA 2LAVA 1GZKA 1HCKA 3QALE 3Q2MA 4BCMA 4YJUA 1UU7A 5GJDA 1KSWA 4M15A 3R7YA 3R28A 4KBKA 4I41A 4YC6A 1H1RA 3TZMA 2ZM3A 4QMTA 4LUDA 3ZZEA 4LMUA 4H3BA 2HZIA 4ENXA 4RC4A 3TDVA 2O5KA 4AGWA 3R7IA 4PX6A 4GIHA 5JRQA 2VTSA 4HNFA 4MKCA 1PXNA 1YOJA 2CGUA 3PVUA 4YJQA 4R5YA 4Z3VA 3EQFA 3DU8A 1DV0A 3N9XA 1BYGA 4ZJVA 4W4VA 2WO6A 5HE2A 5BQ0A 4FTLA 2L4EA 5TT7A 3QRKA 2DAKA 2BTSA 5C26A 2WQBA 5E4HA 4MYGA 3ZRMA 4FKRA 1G3IA 4YGAA 3DKGA 4KNBA 3ZSHA 4Z16A 1HT1E 4N6YA 4PRJA 4U79A 4F7NA 4LV8A 4D9TA 4YTFA 2OXDA 4CG8A 1I44A 4D1ZA 4Z9LA 4PMMA 4ZY4A 3W2SA 5A4CA 1P3QQ 4C3PA 4EOIA 1OTRA 3LJ2A 2VAGA 4FOBA 4O2PA 3HDNA 5EOBA 3L9NA 3ZM4A 5HQ0A 2JY5A 1XBCA 1Q8TA 5AFVA 4FTAA 2Q0NA 4QTAA 4RZVA 2WU6A 4O0RA 5HTBA 5BVWA 3ZXTA 1G8SA 4OTRA 3G33A 5H9BA 3N51A 3VBWA 3FLZA 2BZJA 3CTQA 2IN6A 4FODA 5CF6A 4MTAA 2YJRA 4JX3A 4DFXE 3G0FA 2K9DA 4L52A 5FXQA 2XJ0A 4PDPA 3LFEA 2ONLC 1GIIA 3H10A 1ERKA 5CEKA 5FBOA 2QU5A 3TZ7A 4USEA 4YHFA 2GS6A 3PXRA 2J0KA 5C8MA 3B8RA 2PZ5A 5DWRA 1CKIA 1PYXA 2XIKA 4IVBA 5KMKA 2I40A 4NYEA 4AZWA 3PTGA 4BCOA 4G3EA 2C0IA 4ENYA 2F7EE 3D7TA 3R83A 1CTPE 1AGWA 2HZ0A 3FMKA 3VS7A 4U81A 4D58A 3OUNB 3QC9A 4MH7A 3QBNA 4TWOA 4X2NA 1ZMUA 3UJGA 2WIPA 3R9HA 3O8TA 2VTNA 3HX4A 3GOKA 4UEUA 4IJPA 1YWRA 4QYFA 3O23A 3QTQA 4TKSA 3CIKA 3ATTA 4D2TA 3A7JA 1OKWA 4GEOA 5E8SA 2QLUA 3DGKA 4BKYA 2QHOB 1OITA 1YI6A 3K3JA 1EFUB 4KKGA 5CNNA 3GB2A 3VJOA 2EKKA 2AUHA 5HD7A 2JY6B 3F3VA 2VO6A 3Q9XA 4L3LA 4V0GA 5IZFA 4GUEA 4F1MA 4MNEB 2PUIA 2VTRA 3C5UA 2MGWA 5FEDA 3POZA 1H1PA 5ACBC 4C3RA 2XIYA 4YLJA 5K4JA 2QI8A 1OQYA 4GT5A 4BWPA 4E6AA 3QRJA 1OL1A 4KB8A 5T68A 4DFNA 3I6UA 3OTUA 2PWLA 2OJGA 5IISA 4FSQA 2FB8A 3O96A 3A4OX 3MH1A 5KMMA 3V5QA 3E3PA 3ZH8A 2QOLA 3RM7A 4WHZA 1NV9A 3WARA 2PHKA 3ZLYA 3TUBA 2Q0BA 3PUPA 1DI9A 3MV5A 5DR9A 1YXTA 2QNJA 4IMYA 4JBVA 3ENHA 5HBEA 2HWOA 2P55A 3PRFA 4ZJJA 4C57A 5H8EA 5C01A 4I4EA 2WMWA 5CYIA 3FV8A 3N4TA 2BTRA 4FKVA 4X2FA 4CFVA 3EN9A 5KKRC 4HNIA 1VZOA 2YLFA 3TCPA 4Q7JA 5E8TA 3VUHA 5FTGA 1OIRA 3GBZA 3LZBA 5AX9A 3UG1A 1PKDA 2F7ZE 3LIJA 4Q5HA 3DXPA 3ORMA 3PE1A 5FDPA 2DAMA 3I7BA 5EW9A 1T43A 1Q62A 2DQ7X 1W82A 1NVQA 1F0QA 1YKRA 4G9CA 3ODYX 1E1XA 4KWPA 4OTQA 5FP5A 4BDKA 1OIQA 4E1ZA 4KIKA 4LGHA 5IA4A 5HI2A 3ORZA 1P2AA 2F49A 1J7UA 4GKHA 3ZCLA 2ITVA 5AUZA 2WAJA 5JI2E 4DN5A 4EQMA 3OOGA 2JDRA 3QQUA 4C61A 1FGKA 5E91A 3DFAA 1JSVA 2WEIA 2VTMA 2PVFA 2X81A 4BWXA 5CF4A 4D0WA 1PMUA 4FX3A 4YPSA 3V5LA 3ETAA 2ERZE 4HZRA 5AR4A 3UYSA 3DK3A 4WKQA 2UZNA 2J4ZA 2FSLX 3CC6A 4BDAA 4IZ5A 4KRDA 4R3CA 3DBFA 4U8ZA 3Q60A 3VBTA 4NFMA 5LVLA 2RFNA 3S4QA 3DZOA 2W06A 5JFWA 3A7GA 1U5RA 2A2AA 4DLIA 2BDWA 4RX5A 4YNOA 3IECA 5FG8A 5IQDA 3PYYA 3QD4A 3MB7A 4I0RA 4O0VA 4DLJA 3HNGA 5IEYA 4XS2A 3PXKA 4DG2E 2HXLA 2EWAA 5J9YA 1R0PA 4DT8A 2SRCA 4FTIA 2BKKA 2OH0E 3LFNA 1J3HA 4F08A 3TTIA 4ZLYA 5EDQA 4GFGA 2VGOA 2HY0A 4AOIA 4O0UA 4OBQA 4TWNA 3QRIA 4U3YA 1H0WA 4PNKA 4IC7A 1AQ1A 4RSSA 1PJKA 4FYNA 5C4LA 3QD3A 5HNIX 5AEPA 5AP5A 2ZTCA 2WTJA 3BZ3A 1M17A 4YZ9A 1DAWA 2XP2A 4BFMA 1OKYA 4PTCA 4XCUA 2CKPA 3W10A 4CGAA 4OAUC 3PIXA 5JN2A 5FWKK 5HD4A 4J52A 4KSQA 3GT8A 3Q04A 3LXKA 3RCJA 2WKMA 3GC0A 3I4BA 5LOHA 4UN2B 3Q96A 3E93A 4ZZMA 2UW5A 4FTTA 5F4NA 4FIIA 1Y8GA 3GCUA 5HIDA 4H3PA 3COMA 3Q32A 3EIDA 4W4YA 5ANDA 4B8MA 3TM0A 4FKOA 4FKWA 3OHTA 3DCVA 4W9XA 5ETAA 4TL0A 2R3QA 2IO6A 2YERA 4OTGA 3F88A 3BHYA 2PTKA 4JR7A 1WJ7A 5EKOA 5BMMA 4DFLA 3F92A 3QXOA 3EQDA 1GIJA 4E4MA 2IG7A 3HRCA 1VEGA 4YJNA 2C5OA 4X2JA 4RC2A 4AE6A 2AC5A 2REIA 2IW6A 5FBNC 4BRXA 3IDCA 3FSKA 2PVLA 3ZLWA 3TUDA 3C4FA 4E4XA 2R64A 3REPA 2WMTA 3KXMA 2XNEA 3E5AA 3E92A 3F61A 1T45A 2DENA 4II5A 5L3AA 4QD6A 2VWBA 4H39A 5E90A 3N4VA 4XP0A 5M57A 3PXQA 2ZMDA 3HLLA 3OD6X 2WOTA 4EHZA 2UZLA 3GU4A 2W1IA 2BIKB 1H01A 5GZ8A 3CY2A 4HPUE 5D12A 1Q3WA 3JR1A 3LXPA 2B9HA 4FZFB 4YO6A 4QP1A 2O65A 1ZXEA 2HELA 5I5ZA 4A07A 2WMXA 3CD3A 4YU2A 3PXYA 3LM5A 4MXCA 3Q4UA 2WOUA 4FKTA 3GLFE 4BTFA 1OI9A 4NWMA 4F9WA 3WF8A 1XR1A 2J0MB 2UW9A 2LGCA 2R7IA 3ITZA 5HNGA 4E6CA 2E2BA 3PJ1A 2PZYA 3FZOA 4E93A 1VQ1A 3U6JA 3I6WA 1VEBA 2HAKA 3WF7A 2PZIA 3Q6WA 4QMSA 4IZ7A 4GV1A 5L8JA 4KS8A 5AJQA 3BGQA 3PZHA 4HPTE 2Y4IB 3WIKA 4IE9A 3TEIA 4MXOA 4PUZA 4UYAA 4E7WA 5D7AA 5I9ZA 3A7HA 4MAOA 1H1SA 2WB8A 1IA8A 4V05A 1KE6A 1PMEA 5EK7A 5CENA 1NT2A 5CI6A 3GXLA 1XKKA 1FVTA 1P5EA 4ANQA 4BCNA 2PUUA 3S0OA 4DC2A 2I1MA 4F1IA 3W2OA 3GOPA 3LMIA 4X2KA 3HV6A 4RQKA 3UDBA 3MMPA 4BDFA 3NYVA 2BIYA 4MD8E 1CMKE 3HUCA 5FRIA 2ITWA 4FT3A 3V3VA 4BDDA 2X8DA 4AU8A 5HLNA 4PP9A 4J99A 3R2BA 2JY8A 2FSMX 4L44A 4G2FA 2HWPA 5ICPA 5M07A 2WEVA 4NW6A 4EH6A 4AZFA 5DG5A 3NNWA 4EC9A 3FEGA 4L43A 4UWBA 2XK4A 3K3IA 3ORPA 4FG7A 1WBSA 4BF2A 5EQPA 1GJOA 4UWCA 5M55A 4BBFA 4X21A 1OAIA 5CXZA 4TYEA 4AZEA 3NUNA 1GZ8A 4RMZA 3R1QA 4ERWA 1W8CA 4YLKA 1QPJA 5DE2A 2JLDA 3OCBA 1H08A 3F2AA 4OTIA 3ZDUA 2NPQA 4PQNA 1G8AA 4A9UA 3MFUA 3BHHA 5FM2A 3N4UA 5HU3A 2UW0A 5JQ8A 1LUFA 3WZEA 3Q9YA 5GJFA 2QLQA 4FZDB 4LL0A 3UE4A 4BC6A 4E4NA 2BAJA 3PLAE 2QOBA 3Q4TA 4EKLA 3WZJA 4JNWA 4YR8A 1KV2A 2GTNA 3NCGA 3KXNA 4BKZA 2XK8A 3E62A 2R3HA 3QQGA 4EK8A 4DFBA 2XM8A 3AC8A 3P79A 2W99B 5IA1A 3PA3A 4EOQA 2W1CA 5AV0A 2H5XA 2KULA 5JGDA 3QGWA 4WO5A 4ZP5A 5M4IA 4CD0A 3FMNA 1Q4LA 3BKBA 2PVNA 4GCJA 4TYHA 3TNPC 4LUEA 4AG8A 2YCQA 1P4OA 2YAAA 4N57A 1T6OA 4PPAA 3ACJA 4QPAA 2XYNA 4ZXTA 5E9EA 1WHCA 2YA9A 4J98A 4F6UA 2OIDA 1JKKA 3EQHA 1JR3E 3QZIA 4CKIA 3TV6A 2B55A 4EHGA 3VO3A 4IANA 1AIPC 4IWDA 4JIKA 1M7NA 4D55A 2J0LA 4G5JA 4HYUA 2V22A 5BMSA 3SVVA 3U6IA 4IHPA 5C1QB 3KRRA 2YWPA 4YTIA 5FTOA 3UIXA 1A9UA 4RJ4A 1L8TA 3HV4A 3A2CA 3QTSA 4ZOGA 5IUIA 2RG5A 4U6RA 3UOHA 4EOOA 1DM2A 4DBGB 5LWNA 4NW5A 2XMYA 2JFMA 5AX3A 1H1QA 4O6LA 2F2UA 4QMVA 4D5HA 2BVAA 4D4SA 5LMBA 4IB5A 1H28A 2ZJWA 4JVGA 4IW0A 2YM8A 3G2FA 3L9MA 2V0DA 2X2MA 1ZZLA 4LFIA 5CQWA 1GAGA 4HCVA 2CGXA 3SXRA 3ZC6A 4J8NA 3UODA 5CXHA 4GRBA 4IM3A 2OIBA 4QMLA 3DAJA 1U4DA 3E7OA 4QP3A 2VWYA 3RK7A 3RNYA 5LMKA 2P3GX 4GYGA 4JG7A 2B52A 4YUQA 4O7SA 3SC1A 1JAMA 3E64A 3EKNA 2XIZA 1IM2A 3NW5A 1WR1B 4JG8A 4KBCA 5AP2A 5HCXA 4AFEA 3JXWA 1PXJA 4DITA 3KKVA 3P86A 2IW9A 1ZYDA 2GHLA 3LE6A 5CU2A 1ZOEA 5I9UA 4C4JA 4OW8A 3FXZA 5IQHA 3QCYA 1SNXA 2QCSA 3FLQA 4ORKA 4MNFA 4IADA 4G1WA 4USDA 4C8BA 5DEWA 4H1MA 4HVHA 4O7TA 4OTFA 2V5QA 2P33A 4TNDA 4GT4A 1OPLA 4Y72A 5IF1A 4YP8A 4O6EA 2YCSA 5I9YA 2OOAA 1R1WA 4NCTC 3T3VA 3M2WA 1KE7A 2BRBA 2UW7A 1UVRA 3BLRA 1MUOA 2V7AA 3FL5A 2ZB1A 4NJDA 2UZWE 1GZOA 2XKFA 1FMOE 4FSZA 4IAAA 3SAYA 3NUXA 4DFYA 4YZMA 1OIYA 3QD2B 4O38A 2JKQA 1LR4A 3QYZA 4QO9A 2L2DA 4AT3A 2GTMA 4GSBA 1NY3A 3D5WA 4FT5A 5JFXA 2CWBA 3MS9A 1Q8WA 3ZRLA 3RK9A 3OWKA 2A27A 3NUSA 1Q3DA 4HCUA 1KUTA 2GHGA 4WOVA 2HK5A 5FUTA 4JAIA 4RT7A 3Q3BA 3KRLA 2EJSA 5EG3A 3BBTB 5J95A 2VU3A 3QX2A 3KK9A 3PZEA 1ZZ2A 2WHBA 3HVCA 5DIAA 3U54A 2CLQA 5J9LA 5JK3A 3Q52A 3GNIB 4PMSA 2PVKA 2OXXA 4I6HA 2OJFE 4ZS0A 5EW8A 2ZVAA 4M67A 3C4XA 3A8WA 3G6HA 5IEXA 5JEBA 3T6PA 2PK9A 3T3UA 4EZ5A 3MH0A 3C4CA 3ZO1A 1F3MC 1A5TA 2ACXA 2GU8A 3FQEA 3QUDA 3TXOA 3WF6A 3ZXZA 2E9NA 2JDSA 3EMGA 2XVDA 3BBWA 4BDGA 5J9ZA 4ZTSA 5AP3A 1KE8A 1OM1A 5CSVA 3VHKA 2J5EA 3R22A 5EM7A 1R0EA 2FVDA 3EQIA 4BIDA 2LVAA 4CZUA 5KX8A 1FBNA 4JXFA 3VIDA 1UA2A 3TNQB 2LBCA 2CNQA 2HXQA 2UZUE 2QODA 3GC7A 2X4ZA 2ZAZA 4QPMA 5EYKA 3QTIA 3V8WA 4PL4A 4DEHA 4A7CA 3V5TA 4K33A 3LCVB 5CT0A 4CSVA 4X6RA 3EQBA 4QQTA 4MD9E 4GYIA 4CFXA 5C03A 4E4LA 3L9LA 4I5MA 4RX8A 5IQGA 1YOMA 3P7BA 3Q6UA 4UALA 4CTBA 4UN0C 3NLBA 2R3GA 1R3CA 2Z7LA 3OXZA 2XIXA 4IAZA 4IFGA 4IAKA 4RIXA 3IDBA 4QMPA 3ZSIA 2C3KA 2PUPA 4MNEA 3RZBA 2GS2A 4FGRA 4F63A 4I93A 1Q02A 4S2ZA 3BLQA 4O0WA 3RWPA 3VC4A 1CSNA 5FEQA 5HGIA 4CMTA 2GQRA 3GQIA 5F95A 2VZ6A 5DOSA 3LFDA 3PLSA 2KNAA 4UZHA 2CSNA 4MF1A 4QTEA 4DGGA 3CTHA 5K3YA 3R8MA 3KMUA 2G2HA 4NTSA 4F7LA 3NS9A 4PTEA 3W1FA 4ASXA 1OPJA 5CWZA 3GCPA 4DH8A 4YMJA 4ZLZA 2XYUA 2MR9A 1SYKA 3E88A 1H00A 5BVKA 3CQUA 3H0ZA 5E7RA 3UGCA 3QCSA 4FL1A 4FV4A 2DAIA 2BDFA 4EYMA 3LHJA 3K5UA 1SVGA 5EHOA 2IJMA 4BIEA 5D1JA 3MTLA 5CAOA 3RPOA 3GGFA 5A4TA 5K4IA 2J90A 5CEIA 1Q8ZA 2VX3A 5IH6A 2CJMA 4O1OA 4KUJA 3NVKI 3NUAA 4Y85A 4RX7A 4QYYA 4A4LA 3NWWA 5JMSA 5M53A 1CM8A 2X0GA 2XNMA 1KWPA 2J9MA 1TKIA 3KXXA 4FF8A 4I0SA 1F4IA 4LRMA 4RX9A 4TZRA 2OFVA 5HNBA 4BCGA 3F5XA 4BTKA 1QZEA 1SG9A 1LEZA 2QO7A 3BYVA 2C30A 2X39A 3EKKA 3JS2A 4CV9A 1YW2A 3VHEA 1P4FA 2WMQA 3OXIA 3TJCA 4ACHA 5I9WA 5KMOA 1JQHA 2V62A 4R6VA 1QCFA 1J7LA 5BUIA 3OT8A 5HG5A 3HUBA 3IDPA 4EOKA 5LARA 2XNNA 5CEQA 3RJCA 4PPCA 2QO9A 3UO4A 4Z7GA 3Q53A 3LFQA 4ITJA 4TT7A 2HENA 4G3CA 3TG1A 3BYMA 5EKNA 2E9UA 1QPEA 5EM6A 4GFMA 4C62A 4FSUA 5KHXA 2BWEA 2WQOA 5AV2A 2QC6A 3FRIA 2XEZA 3EZRA 3U55A 3FZTA 4FOCA 3GEQA 3PFQA 3HMMA 3ZRKA 2P0CA 4BCPA 2BFYA 4FV0A 4ZSLA 5ANJA 3ET7A 4FSTA 4F99A 1UWHA 4RFMA 4I22A 3LLTA 5HESA 4AA0A 2OO9A 2IPXA 1JVPP 1M52A 2OFUA 4UWYA 1MRVA 4D28A 4LGGA 5CSXA 2HYYA 3KL8A 4YSJA 3CKXA 1WBNA 2ZOQA 4DTAA 2LVQD 3OEFX 1OUKA 3FZRA 3UNKA 3FLWA 4QP8A 5FD2A 4EL9A 4OUCA 4CZYB 4JDKA 4BGGA 5HU9A 4XV2A 1UU3A 1H24A 5BUJA 2JAVA 1M2QA 4FTRA 1Y6BA 4FIFA 2C3IB 3KN6A 3CKWA 3HEGA 2J6MA 4XV9A 2WMUA 2QONA 2Z2WA 4GK4A 4OGRA 5KKRB 4EJ7A 4GL9A 3IW8A 2JIIA 2VTJA 1XQZA 4G5PA 3RPYA 4CMUA 5CEOA 3BU5A 2WMSA 2GQSA 1KOAA 3FLSA 4I5HA 5ETIA 2WMAA 3PPKA 3HP2A 5JZNA 4GG5A 2PMOX 3OFMA 4KS7A 4IX3A 5TO8A 3HA8A 2GQGA 4B99A 4FA2A 3ZU7A 2RFSA 2I0YA 3TKHA 4HVDA 2WFYA 3D94A 5I9XA 4LM5A 3TIYA 5LJJA 4S34A 4QMYA 4J53A 1Y57A 4BCQA 4JDIA 5KMLA 2H96A 3P9JA 3Q5IA 4J95A 1LP4A 4HYSA 3QCXA 5D7VA 1QL6A 3RPRA 4F7SA 3UNZA 3FKOA 4FV1A 4AE9A 2PYWA 3DJ5A 4IVCA 3Q5ZA 3QU0A 2PVRA 1V1KA 3BIZA 4JRVA 4AZSA 2Y6OA 4S30A 2MROB 1W7HA 4O91A 4ANBA 3AMAA 2UZEA 3EZVA 1YI4A 4C3FA 4ZS4A 1PMVA 1OKSA 2X9FA 2Y6MA 3KN5A 4FE2A 5M4CA 4AW2A 2FO0A 4IH8A 4RZWA 5EYCA 3VUKA 2DWBA 2QHNA 5CSHA 4F7JA 2PZRA 2LVOC 4ZIMA 4L67A 1U46A 4RJ7A 3QTRA 4YJRA 5DT3A 5A4LA 2YIXA 3QTZA 4YZNA 2WTVA 1YXSA 2G01A 3LVPA 2JBOA 4U80A 3DB8A 1VYZA 4F1TA 5IUHA 4F4PA 4WG5A 2DAEA 4ANLA 4YTHA 5HBJA 3JYAA 4UY9A 4RFZA 5JFSA 3VS1A 4YJVA 1O6YA 3VUMA 3OBGA 4JL9A 4PV0A 5CU4A 4XX9A 5AR5A 5B0XA 4EHVA 5L8KA 3FKNA 3ZC5A 5A4EA 3SRVA 3GLHE 4IX5A 5M4UA 4D2RA 3QD0A 2OIQA 3H9RA 2G15A 3IG7A 5LCKA 5IQBA 3HV5A 3KK8A 4KSPA 4ACMA 4CLJA 5HHWA 1E9HA 3POOA 4MX9A 4Y95A 5CU6A 3WF9A 4NFNA 2BKZA 2X2KA 3AGMA 4DEAA 3ZSGA 3DPKA 5E8UA 3JY0A 4DEDA 2C5NA 4C0TA 2ZV8A 2GNHA 2XZSA 4R5SA 3WF5A 4QNAA 4D4VA 4BDCA 1OECA 3T8OA 2OU7A 3M1SA 2CKEA 2JKOA 3R8PA 2EKFA 4ASZA 1YRPA 4DGOA 4E20A 1K3AA 4YC3A 3OG7A 4RVLA 3IOPA 2A19B 3R04A 4FEVA 3KRXA 3ERKA 2QSFX 2Q83A 3W2QA 1YI3A 3LQ3A 5CALA 2XJ2A 2J7TA 3R63A 5HE1A 1PXIA 5TKDA 5IQEA 3P0MA 4TN6A 5CTPA 4EWHA 4C4HA 3FYJX 3R71A 3DJ7A 4HZSA 3DBCA 3LM0A 4ZTRA 2VTOA 4ERKA 1WIVA 2OZOA 2ZM1A 3QRTA 4FL3A 4LOOA 2VWUA 5C9CA 3DK7A 4NT4A 2B53A 5CX9A 3QQLA 3RMFA 4CLIA 3HAVA 3IW5A 2VTPA 5CLPA 4EOPA 3QUPA 1WBVA 3V5JA 2PUNA 4J8MA 3ZUVA 3GU7A 4EOJA 5JZJA 3IS5A 4BZNA 3DAEA 2OKRA 5FXSA 5CAVA 4O84A 3S1HA 3WYYA 2JKKA 5AR2A 1J1BA 5JGBA 3PY3A 2WZJA 4FNXA 3SLSA 3EN4A 3I1AA 3ZDIA 2WTCA 4WBOA 4ANSA 4C02A 2YABA 4NM3A 3CSVA 4IB0A 4WUNA 5EFQA 4ZZOA 5DH3A 4IM2A 2R3NA 2C6OA 4MK0A 4FEUA 3DXNA 3SV0A 4BVUA 1DS5A 2W4KA 2ZYBA 4G6OA 5AAEA 3DXQA 2I0HA 1RE8A 4DHFA 4NTTA 2CKQA 4QYEA 3TNIA 3CLYA 2LVPC 3WYXA 2CNVA 3ZTXA 4FZ6A 3FY2A 4BZDA 1MN3A 4Y46A 5AMNA 3WZUA 4O7RA 4FG9A 4XJ0A 3UIMA 3MB6A 4NSTA 1UV5A 2BRHA 1KV1A 3TT0A 2QOCA 4FMQA 4HVIA 1GY3A 4AT4A 4W4XA 5LMKC 4FVPA 1XO2B 3OOMA 4KRCA 3DNEA 5C8NA 3MWUA 3DY7A 4CV8A 1FMKA 1OGUA 3BELA 5ANOA 5AP0A 2XIRA 1BKXA 2R3JA 5M08A 4FSRA
chains in the Genus database with same CATH superfamily
3R7GA 4RVKA 4OT5A 3VQHA 5E1SA 1KE5A 1YHWA 3AOGA 3D9VA 2XZFA 2JY7A 4UMQA 3PIYA 4TWCA 5H3QA 1GOLA 3NR9A 3TACA 4UX9A 4DH1A 4H05A 1CKPA 3JUHA 4X3FC 1Q3BA 5CEPA 4AQCA 3FXWA 2IF8A 2WSEF 4BYIA 4DV6M 4M0ZA 3PUFC 3R30A 2OWBA 3V6SA 1PMNA 2BILB 3M6AA 1ZY4A 4YPDA 2R3OA 2J51A 2UVYA 4LRKA 3U60B 4FTQA 3R21A 4XLVA 5HICA 4JI6M 2C6KA 2VTIA 4YY3M 3MY0A 4O2ZA 4BKJA 4FTMA 2XB7A 4YZCA 4LRJA 2X6EA 2GNFA 3QFVA 4BZOA 2QOQA 2FYSA 3PVGA 4PDYA 4DEEA 4MWHA 4N70A 3BWJA 5IEVA 3ZH9B 5EQEA 3R8UA 1HQCA 2PZPA 4WD5A 1DGHA 5EP3A 2YEXA 2IVTA 1ZARA 4LOQA 5FDXA 1UWJA 1PRBA 4GK2A 3DTWA 3FYKX 3ZONA 4FCTA 1OKVA 4R3RA 1K9AA 3F5UA 3BGPA 3C3EA 3H9OA 5L2WA 3R2YA 4W8EA 4XRJA 4D2WA 3NSZA 4I21A 3LPBA 2GHMA 3E4RA 1OUYA 5DYGA 4FCVA 4J71A 1DGFA 3JAMS 3UPXA 3DLZA 3LXLA 3U6SA 5CZHA 2R4BA 5AR7A 4V01A 4UMTA 4D4RA 5HTIA 5BX0A 4G4OA 4ARKA 2ZANA 4FT0A 4K8AA 4EC8A 5LCJA 2Z4SA 2EB2A 4L01A 3HMPA 4QOSA 3CR0A 3KRJA 3COKA 5HE3A 2CV0A 3R9DA 2QG7A 1YWNA 4M69B 3UDZA 3QX4A 3CPCA 2LVNC 3VNTA 4KIKB 3QYWA 1VYWA 4ZMEA 3OBJA 3TWJA 2D7HA 5DPVA 2W1DA 3P7AA 4FKGA 3EFLA 1FQ1B 4L46A 5AIRA 1JKLA 2O2UA 5CT7A 2QCUA 5BVEA 4B0GA 3W67A 2C0TA 3I81A 4EORA 4IJ9A 2GQFA 4PDSA 3MPMA 4RF0A 2C9OA 4KIPA 4QPSA 4EH5A 1FINA 4F64A 4FK6A 3FHRA 4BIBA 3Q4ZA 4G3OA 1PXMA 3V51A 3W0SA 3BQCA 4DUYM 3JY9A 1MRYA 2YIYA 3LFBA 3FI4A 3KRWA 4GK3A 4UB7A 2YHVA 1OL7A 3IO7A 4XG2A 3NMUF 3GQ3A 5KZ0A 3SD0A 3BU3A 4AXCA 2UUBM 4KAOA 3AKLA 5B2KA 4P90A 3RI1A 5IUGA 3R7VA 4EBVA 4NL4H 4FV9A 2O63A 3OXTA 4FK3A 2WMVA 2DVWB 3DKCA 3UMXA 3ZOSA 4NL0A 3PP0A 3TIZA 2WTDA 3VONA 2BRGA 2G3QA 5LMNM 3A46A 4KABA 2OF2A 4QMNA 2WNTA 2PMNX 4D81A 2YN8A 3AT2A 2XUUA 2R0UA 1NVSA 1OBDA 4J7BA 1B6CB 5CU0A 5AUYA 5H2UA 3RGPA 3FTEA 5C27A 4O0SA 4DGLC 3UIUA 2XCHA 1RDQE 4I6LA 3KXGA 1R5LA 3FBVA 2NQ8C 1URWA 4WNMA 3F82A 4IFCA 2C5YA 2FNAA 2CHGA 5ITAA 3CJGA 4DH7A 2IZRA 4ID7A 3W0FA 3TI1A 1QPDA 5J5SA 3LXNA 4JT3A 4KIOA 3ATSA 1XWSA 4UXLA 4LV7A 2X4FA 3UQGA 4CFUA 3FJQE 4K9YA 4CT1A 4FNZA 3COHA 2GNJA 3RZFA 3D5VA 3HL7A 1L8QA 3K2LA 2QO2A 3UIBA 2HIWA 5J1WA 5LVOA 4AW1A 1XJDA 1JPAA 4JX7A 4O7SA 2H34A 4XV1A 4R77A 2OJ9A 5DRBA 4XG8A 3UOJA 1JNKA 3UBDA 1VEKA 1XXHE 2DZLA 3UGJA 3ZEWA 4I94A 4O7YA 4LGMA 4J1RA 4ZY5A 3W2RA 4QRCA 2R3PA 1WVXA 3BV2A 5CQUA 3E8CA 1E9RA 3D0EA 5AUTA 2KW0A 5D11A 2JEDA 3I5ZA 4MGKE 3QLFA 5GIPE 3VDPA 4DHJA 2KRUA 1J7IA 4F0IA 3U87A 1BLXA 1WBWA 3L8PA 5EH0A 4C4GA 1TH3A 4IVDA 2JC6A 4BDHA 2GFCA 3AD5A 5E8YA 5HLWA 2YCRA 5BR8M 2JAMA 2R7BA 3DB6A 2DHRA 3BE9A 1GIHA 3QTXA 4U3ZA 3SBJA 4XLIA 4X65M 3ZEPA 2YDKA 3AXWA 4DTKA 5EXTA 2JZ1A 4D82A 3GP1A 1Z5MA 3P7CA 4AOTA 4JI4M 2PVYA 5CANA 4W4WA 1TQIA 3FY0A 5HCZA 4FG8A 2XBJA 3VS4A 3FHIA 3IW6A 3I4YA 4O0YA 3BI6A 2RRUA 1UKHA 2DS1A 2F4JA 4FSNA 1L2BA 5IZ7D 3R9NA 4K0KM 5CVFA 3PJ2A 1MJGM 4O7ZA 1WCCA 3QQFA 2RGPA 3E87A 2PL0A 4PL3A 4NIFB 4RC3A 3QHRA 1J91A 1OIPA 5FP6A 2KXEA 1DO0A 4FKLA 5BYZA 4FWGA 2HZ4A 3P23A 5I0BA 1W5SA 5ANIA 5HLPA 3GVUA 3NYNA 3SMPA 3BYOA 3O51A 3R7OA 2F5NA 4JJRA 1JWHA 1UU8A 4IDTA 3PNYA 5BPVA 1OBGA 4UXQA 2O25A 5F94A 4DF3A 3WIGA 3PIZA 4I20A 4CISA 3QLGA 3B89A 3TKUA 3EYHA 4RG0A 2YZAA 1TGUA 3SAVA 4WG3A 4IAYA 3WBLA 4M9SA 3MI9A 3BLHA 2O0UA 3A7IA 3J81S 2OK1A 3JR5A 4FUXA 2V55A 3BE2A 2J0JA 4XHKB 4AA5A 3D2IA 2HY81 3FQHA 4C7TA 3DAKA 4WSYA 3SHGB 3BU6A 3NBIA 5DFLA 4PPBA 5ETCA 5DBXA 4RLKA 4F9AA 4CIZA 3D5UA 4EHEA 4K6ZA 4GRIA 1ZYLA 4O86A 3KREA 2BHHA 5KMIA 2E9VA 3GFEA 1I4WA 1ZMWA 3D7TB 3TDVA 2OGVA 4Y73A 3UC4A 3LFSA 3LQQA 4A9TA 1QMZA 4GIIA 3KULA 4O1PA 3B8QA 3UVQA 4DFUA 3MH2A 4RWIA 3OY1A 4M12A 3F5PA 1D0MA 1G41A 3HZTA 2OJJA 5D41A 1PGYA 4N4SA 1VR2A 4JIAA 5KMJA 4OTDA 2WQEA 5LVMA 1UFZA 4RWKA 3D4QA 2R4JA 4P4CA 3VBQA 5AUVA 4JI8M 5HX8A 1YOLA 4WNOA 1XH8A 3W8LA 3PPJA 4LY6A 1OIUA 3RM6A 2YIWA 4FKUA 1O6LA 4GJ2A 2X9EA 1REKA 4D2VA 3C9PA 4A9RA 4ASDA 2DNAA 2BMCA 4U5JA 2CN8A 4AW5A 5CI7A 1PKGA 4NH1A 4BTMA 5GZAA 4K0YA 2WGJA 2YACA 4IC8A 5E1EA 3DJ6A 4Y83A 4LJ4A 4BN1A 1E94E 2I0VA 2OW3A 3LQ8A 3PRIA 2C3JA 3P1AA 2L09A 2W96B 4M14A 4E6QA 4XBUA 4FEWA 4AZTA 2C0OA 3BX5A 5HKMA 2XK9A 4KIQA 4ZMFA 1YXUA 4O83A 4APCA 4MHAA 3GRVA 4QNMA 3GLFB 3SXFA 3UNJA 4OTPA 2OJIA 4QTBA 5LWMA 3UMWA 3FUWA 4CFWA 3ID6C 4IB3A 4Q9SA 4R7HA 4L7FA 4L16A 3W16A 5L8LA 2MJ5B 4H58A 4GMYA 3FMJA 3C58A 2GNIA 1GO5A 4JBOA 4Z7HA 2XBAA 5GHVA 3BHUA 1VG5A 4IIRA 2IWIA 5H8GA 1WBOA 1DGGA 2UVZA 3W55A 3ALOA 3NGAA 2W1EA 5ITXA 4EOSA 3O17A 1V34A 1MP8A 2C6TA 2IVUA 3VS5A 4OBOA 2V7OA 3KF4A 5JKGA 5CAPA 2ITYA 4YBKA 4C37A 1U59A 3C5IA 1ATPE 4FV8A 3Q9ZA 4A9YA 3VN9A 2QVSE 3U4UA 3FI3A 4MBLA 2CV1A 3IW7A 3UDTA 5FM3A 1FNNA 5CAUA 1V0BA 3VVHA 4RPVA 2OOBA 4JYAM 4XH6A 2QOOA 3AQVA 4ZTHA 2Z7RA 1IBMM 3W2PA 2HZNA 4GS6A 1FPUA 1OL6A 5AUUA 4IXPA 5HO7A 1H0VA 4FKPA 3VAPA 1YVJA 4FRFA 1H07A 4B6LA 5F9EA 3S95A 4HGEA 1VDDA 2Z3XA 3HKPA 3EQCA 3DOAA 4FWHA 3Q2JA 5LXMA 4Y5HA 1HCKA 3QALE 3Q2MA 4YJUA 4KBKA 2ZM3A 2F5QA 4H3BA 1GL7A 2O5KA 4AGWA 4GIHA 4MKCA 2CGUA 3PVUA 4R5YA 1DV0A 4ZJVA 4W4VA 5TT7A 3QRKA 3ZRMA 1G3IA 1HT1E 2N35A 4L6V6 4Z9LA 3SARA 3J7BA 5EOBA 5HQ0A 1XBCA 1Q8TA 4O0RA 4LCBA 3FLZA 2BZJA 4FODA 4MTAA 2YJRA 1V33A 5FXQA 2XJ0A 4PDPA 3LFEA 2ONLC 1GIIA 3H10A 5FBOA 4YHFA 3PXRA 2J0KA 3B8RA 4IVBA 1CTPE 3FMKA 4D58A 3OUNB 3QC9A 1PJIA 1ZMUA 3UJGA 2WIPA 4IJPA 4QYFA 1QAOA 3CIKA 3U6MA 3K3JA 5CNNA 3GB2A 2EKKA 5ITYA 2AUHA 5HD7A 4V0GA 3Q9XA 5IZFA 5K4JA 4E6AA 4BWPA 4KB8A 3OTUA 2OJGA 4G4RA 2FB8A 5KMMA 3ZH8A 1NV9A 2PHKA 1DI9A 3NBXX 1YXTA 4IMYA 5HBEA 2P55A 5C01A 1SXJD 4CFVA 4HNIA 2YLFA 3TCPA 3VUHA 1OIRA 4Q5HA 2DQ7X 1F0QA 3ODYX 1E1XA 4OTQA 4XK8F 4LZJA 2ITVA 5AUZA 3ZCLA 2VTMA 4YPSA 3ETAA 2ERZE 4HZRA 3UYSA 3P5JC 2G8LA 3VBTA 4NFMA 5JFWA 1U5RA 3PYYA 3QD4A 2D7GA 3HNGA 4XS2A 3PXKA 3A42A 2DZNB 1R0PA 4DT8A 2SRCA 3TTIA 4ZLYA 4O0UA 4U3YA 1H0WA 4JI1M 5ITRA 1PJKA 2ZTCA 4YZ9A 1OKYA 4CGAA 5HD4A 3GT8A 3Q04A 3RCJA 2WKMA 3VKHA 2WSCF 2UW5A 1Y8GA 4B8MA 4LFBM 3Q32A 2CRUA 3TM0A 4FKWA 3OHTA 4W9XA 1WJ7A 4E4MA 4YJNA 2REIA 2IW6A 4E4XA 4NOOB 2WMTA 3KXMA 5L3AA 1T45A 2DENA 4QD6A 3PXQA 4EHZA 4AQYM 1H01A 3CY2A 1Q3WA 1TH4A 4YO6A 4QP1A 2O65A 5I5ZA 3CD3A 3PXYA 4NXNM 1OI9A 2CE7A 3FZOA 1VEBA 2HAKA 4QMSA 2OPFA 4IE9A 3TEIA 4MXOA 4PUZA 1H1SA 5EK7A 5CENA 5JI3E 4ANQA 2PUUA 4DC2A 2I1MA 3QAUA 3MMPA 2BIYA 4MD8E 3V3VA 4PP9A 4NSRA 5M07A 3VK7A 4NW6A 4EH6A 4AZFA 3NNWA 4EC9A 3FEGA 4BBAA 4L43A 3ORPA 5EQPA 1XWIA 5CXZA 4TYEA 2XSZD 2KA6B 3U61A 1GZ8A 4RMZA 3R1QA 1QPJA 5DE2A 1H08A 3F2AA 2NPQA 4A9UA 3MFUA 3N4UA 5HU3A 1LUFA 4B7HA 2BAJA 2NYAA 3NCGA 3KXNA 4BKZA 3QQGA 2XM8A 3AC8A 5IA1A 5JGDA 5M4IA 4CD0A 4TYHA 3BKBA 4FCWA 1Z6TA 4AG8A 4PPAA 4QPAA 2XYNA 4ZXTA 2UXDM 4J98A 4CKIA 3TV6A 3VO3A 1AIPC 4D55A 3D8LA 1GKIA 3KRRA 3UIXA 3HV4A 3A2CA 4ZOGA 5IUIA 4JXJA 5LWNA 1H1QA 4S12A 2F2UA 4D4SA 4BJJA 2ZJWA 2A98A 1S3SA 3G2FA 2V0DA 2X2MA 4LFIA 5CQWA 1GAGA 3ZC6A 4J8NA 3UODA 1HNWM 2YNMD 3DAJA 1U4DA 4MGIE 3E7OA 2P3GX 1WR1B 1GLNA 4AFEA 4DITA 3P86A 2IW9A 4C4JA 1ZYDA 4XGIA 4OW8A 1GABA 2QCSA 3FLQA 4MNFA 4IADA 4G1WA 5DEWA 4H1MA 5FTJA 4GT4A 3T3VA 4NJDA 2UW7A 5HZNA 2V7AA 1NJGA 4IAAA 1FMOE 1OIYA 3QD2B 1Q8WA 1NHGC 3ZRLA 3NUSA 1Q3DA 4WOVA 2HK5A 4JAIA 4MGYE 3KRLA 5EG3A 3KK9A 2WHBA 5DIAA 3GNIB 4I6HA 4ZS0A 5EW8A 2ZVAA 3LVVA 3ZO1A 1F3MC 2GU8A 3QUDA 3ZXZA 2J5EA 1R0EA 3OTOM 4BIDA 3I4VA 2UZUE 2X4ZA 3V8WA 4A7CA 4X6RA 3EQBA 4MD9E 5C03A 3L9LA 4I5MA 4RX8A 5IQGA 3Q6UA 4CTBA 4UN0C 2UXCM 2Z7LA 4IAZA 4RIXA 4FGRA 2ZM6M 4I93A 1Q02A 3VC4A 3BLQA 2CEAA 5FEQA 3KOZE 5DOSA 1XMMA 2FFJA 4UZHA 4MF1A 3AV0A 4NTSA 3NS9A 3W1FA 3QYBA 3CQUA 3GLIB 2DAIA 3MTLA 5CAOA 5K4IA 1Q8ZA 2CJMA 2JWSA 1W2FA 4KUJA 5JMSA 1CM8A 5EXSA 4TZRA 1F4IA 1QZEA 3GRRA 5DNYA 3TJCA 1J7LA 2QO9A 3UO4A 3LFQA 2HENA 4AG6A 5EM6A 4C62A 2WQOA 3GQ5A 4FOCA 3GEQA 2BFYA 4ZSLA 2LNHC 3ET7A 4I22A 4AA0A 4UWYA 4D28A 5CSXA 1WBNA 4EL9A 4BGGA 4FTRA 4TUWA 3KN6A 2QONA 3JR4A 1TH2A 4G5PA 3BU5A 1KOAA 2WMAA 3PPKA 5JZNA 4GG5A 2GQGA 3ZU7A 2WFYA 3TIYA 4QMYA 4J95A 4HYSA 3GLHA 3RPRA 4FV1A 4AE9A 3Q5ZA 2PVRA 3BIZA 2Y6OA 4S30A 2MROB 4ANBA 4C3FA 3TYKA 3EZVA 4ZS4A 1PMVA 4LF9M 5M4CA 4IH8A 5EYCA 3VUKA 5CSHA 4F7JA 4PDIA 4ZIMA 4RJ7A 3QTRA 4YJRA 3QTZA 4YZNA 1VYZA 4F1TA 4F4PA 4YTHA 2CHVA 5JFSA 3SATA 1O6YA 3OBGA 5AR5A 4IX5A 5M4UA 3AOEA 2G15A 5IQBA 3HV5A 3POOA 4MX9A 4Y95A 5CU6A 3KW6A 2ZV8A 1OECA 4ASZA 2A19B 2QSFX 2Q83A 5CALA 2J7TA 1PXIA 3P0MA 4TN6A 5CTPA 4C4HA 3DBCA 3LM0A 4ZTRA 2ZM1A 5C9CA 3HAVA 3V5JA 3GU7A 5JZJA 3IS5A 2OKRA 5AR2A 4I81A 1J1BA 3PY3A 2WZJA 3EN4A 4NM3A 1W2CA 2C6OA 4DHFA 3CLYA 3ZTXA 4FZ6A 1MN3A 4JI7M 3TT0A 1XO2B 3DNEA 3MWUA 4CV8A 3BL7A 2XIRA 5M08A 2Y20A 1MRUA 1OAOC 3RAHA 3CD8A 1Q8UA 3DBQA 3VS6A 2C6DA 3PE2A 4IWOA 4FT7A 3EYGA 4KLNA 4ALWA 5KQDA 3FWQA 4YC8A 5M56A 2IVVA 2JDOA 3SMSA 4YNEA 3OT3A 2R3IA 4QTDA 5K5NA 5JFVA 2C47A 3LCDA 1I09A 2YWVA 3GENA 4MD7E 4R3PA 5I4NA 2QKRA 1N77A 2JUJA 2IW8A 3W0OA 4FTUA 2ITTA 4CQGA 3HDMA 3K9OA 4E3CA 4AUAA 2EVAA 2VTHA 4XRLA 5EHLA 4TNBA 5FSWA 3VUGA 2WQNA 4FT9A 3V5PA 4BY9E 3OWLA 3OS3A 4BCIA 2XEYA 2XANA 2HL7A 4GUBA 2ERKA 1W0XC 3QZFA 2BFXA 2RSVA 4K1BA 5L2QA 5ACKA 3RWQA 2JD5A 4G6NA 4HVSA 3E8NA 4IWQA 1TDZA 2NRYA 4EOMA 2EXEA 3LLAA 3ZHPC 2B9FA 1C1KA 2VNWA 5ITQA 3B2TA 3RCDA 3TV4A 3BEGA 4H1JA 2C6LA 4G6LA 4QHSA 4X3JA 3R02A 3PY1A 3QYEA 4NRWA 2F7XE 4F9CA 1Q99A 3H9FA 4O7NA 4DGNA 4O21A 3UZPA 2BROA 4FTKA 4MF0A 2PU8A 2QR7A 4K18A 3DZQA 2XKEA 1JSTA 4X7QA 2PMIA 3VF8A 3VK8A 3CE3A 5FEEA 4F6SA 2X8AA 2R44A 4OW0A 2EB3A 2RL5A 4NKAA 2EU9A 5HIEA 5CASA 4F09A 2UZVA 4QYHA 5GKNA 3R8FA 3TNHA 5ANGA 1PF8A 4XV3A 3OVVA 3PY0A 4CRSA 5HG7A 5BVFA 1ZQ9A 1NXKA 3G9LX 3F7WA 3UK6A 3IPHA 1WAKA 3E63A 4CEGA 1H27A 2CGVA 3FZSA 3HRBA 5EHYA 2AYPA 3V76A 3R0TA 4KBAA 2X6DA 5L4QA 1QQWA 4A3VB 3FMMA 4EK5A 1HOWA 3FE3A 2X7OA 3SOAA 4MQ1A 5CF5A 1UKIA 5A3XA 4CFFA 2XKCA 4ZSAA 2F9GA 4NXMM 3K5VA 4U45A 4H3QA 3RBWA 2RG6A 4WBBB 3QWLA 3EQRA 5G1XA 4NM5A 3FAAA 3EWHA 2ZMCA 5CS6A 3KU2A 3OZ6A 2XRUA 2OI4X 3ANRA 5C8KA 1ND4A 2WQMA 1Q8YA 3C4WA 4FTOA 4BWKA 2FSTX 3U6HA 4EJNA 4DA5A 2QPAA 4I24A 3E7VA 3FKLA 4IEBA 3MVMA 2PVMA 4D9UA 3CCNA 5HG9A 1EH4A 3NVMB 4S33A 5BUEA 2C6MA 3LOKA 4C58A 4EH8A 5C4KA 1N33M 1UNLA 4GEWA 4L3JA 4II7A 5D10A 3F3WA 3QKLA 4AWIA 3UTOA 3UQCA 2HW7A 1G5SA 3EN5A 2R3RA 1XNRM 3ZS5A 5ETFA 2Z4RA 4GMQA 2DUVA 1WZYA 1IBKM 4F70A 3D15A 3GC9A 1Q97A 2VX0A 4AN3A 4QP6A 2JITA 3WHLA 4L9IA 4HGLA 4ANRA 4EOLA 3FC2A 1L3RE 4EZ3A 4ZK5A 4F1OA 1IN6A 2WMBA 2F2CB 3T15A 2QQ8A 1PXLA 2QOFA 1Z5BA 1Q41A 4OTHA 2RKUA 2BJVA 3KULB 1W84A 3TDWA 3RPSA 5I9VA 1WBTA 1K82A 1M7QA 3JPVA 5T3QA 3HECA 3M7GA 5HO6A 1IN4A 3ENMA 3ZZWA 5T6KA 4BGQA 4LJ6A 1J7KA 3IQ7A 1JLUE 1PM5A 3LCSA 5CNOA 4DG3E 1PXKA 3HV7A 3V8SA 4E26A 4ASEA 4AGUA 3SAWA 1JR3D 4G34A 2KHHA 2CHLA 3VLFB 3ZBFA 2F5PA 2W17A 4UBAA 3A45A 4RIWA 3F2RA 1XH5A 2ITQA 3DOGA 4L00A 3MFTA 4YTCA 3MIAA 3W32A 4RWLA 2W1FA 2OO8X 1KYIA 2XK3A 2JIVA 3D14A 3SKCA 3FI8A 4P7EA 5EM5A 2C6IA 4OR5A 3T1HM 4FV2A 1XHAA 2XLJA 3IONA 5IU2A 5M06A 2UZOA 3HRFA 3UO6A 3QWJA 2Z7QA 5HVJA 1W2DA 3IGOA 3A61A 1BL6A 3ZO2A 4IBMA 3GPYA 2OZAA 3F7ZA 1RJBA 4I5CA 3UP2A 5EQTA 3PSDA 4PWNA 2QU6A 3LJ0A 1XH9A 1PHKA 4NCTA 4YSMA 1OJLA 3KF7A 3PWYA 5IMXA 4ANMA 5IA2A 5HO8A 3K1JA 3EN7A 3R8VA 4JDHA 3VW6A 3OTVA 5HVKA 4FVRA 2C5XA 3GC8A 4O7LA 3NRMA 5DRDA 3C0HA 4ZSJA 1M2RA 3EL7A 5L2SA 4D80A 4AI6A 3GCSA 3ZO3A 5EXXA 3H4JA 1OL2A 4E5AX 3SHEA 3UC3A 3BYSA 3LFCA 2KZSA 3MDYA 1H1WA 5AM7A 4QQJA 3UP7A 2Y21A 1X8BA 4JOAA 1WXQA 3KA0A 1ST4A 5EW3A 2CCHA 4DEGA 3HHXA 3UG2A 5AADA 3NNVA 1HQYE 4EYJA 4LL5A 4QMMA 2WD1A 3HYHA 3G9NA 4Q2AA 4MXAA 3V01A 3HV3A 4PDOA 2JDTA 4QT1A 4DV4M 3UOKA 2XNOA 5BVDA 2JFLA 5KNJA 4LFCM 4IAIA 4RJ5A 2XNGA 1ZMVA 4O4FA 1D0LA 3DQXA 1YWVA 4F9YA 3UQFA 3OWJA 2VRXA 4U9AA 4U41A 3VUDA 4J96A 3TQSA 2R6FA 4AKGA 3UO5A 4IZYA 5E8XA 4BCHA 5E8WA 1H8FA 3SW4A 2NRUA 5DLSA 2GSFA 2ZBKB 5AM6A 5HG8A 4B7TA 3MGYA 4CVAA 3L2AA 4YZDA 4PF4A 2XRWA 5I3OA 4D0XA 3DFZA 3W0QA 3G51A 1IASA 3ROYA 5GIOE 2VWWA 1NY5A 2B1PA 2XEPA 5KPTA 5TF9A 4CZTA 3CQEA 1A48A 5AP6A 5F1ZA 2BDJA 3GU6A 3OY3A 3NYXA 4XMOA 1ZRZA 4FNWA 4JG6A 2HCBA 5AA8A 4APPA 1MQBA 3GPXA 3QF9A 3UOLA 5DI1A 1GZNA 3KS8A 2VWVA 4B3SM 3QL8A 3RVGA 3U9CA 4OU7A 2ETRA 3P5KA 3RAIA 2NP8A 1R39A 1ZLTA 3ZM9A 5A2QS 4IX6A 4QEBA 1JB0F 2ZFYA 3OWPA 4FIHA 2ONLA 2UZTA 3HA6A 4YHHM 3G0EA 4OLIA 1IXSA 4QQ5A 3DZDA 3T38A 3ORTA 3ZO4A 4EH7A 3T1YM 4ZZNA 3QHWA 2FGIA 5AV1A 5B2MA 3I5NA 4O22A 4ACGA 3ORIA 4MEDA 1PRYA 4DCEA 1IA9A 1IXZA 4F78A 3W0LB 5AV3A 3VBVA 3R73A 4MM3B 2L4FA 2HOGA 1YDTE 1STCE 4I3ZA 3W8QA 3PXZA 3GQLA 1TFFA 1CDKA 3CY3A 4I8OA 4BHZA 3MN3A 4TPTA 1E9SA 3QUEA 4FVQA 3K8ZA 1Z57A 2K6BA 3NCZA 4RA4A 4AAAA 1OZ1A 2EUFB 2CKOA 3LCTA 5LVNA 5AIKA 5FTLA 3VUTA 1XBAA 4JLCA 3C4ZA 3O8PA 4KINA 3H4MA 3NEWA 2VO3A 1O6KA 3PVWA 1U54B 2XK6A 2B7AA 2FA2A 5BYLA 5K0KA 3HJSA 2OBJA 4JAJA 4JI0M 5IQIA 1M14A 5C18A 4CHTB 3KXHA 2W1HA 5TR6A 4B7GA 3EQPA 3SDJA 4LQMA 5IPJA 4R1YA 2ETKA 5L2TA 5TOZA 3FUPA 3MTFA 4RGJA 4DHIB 2W9ZB 2PPQA 3QKMA 4D5KA 2CNUA 4PY1A 3OCSA 1UNHA 3R8LA 2Z7SA 4RVTA 3R6XA<