2WZJA

Catalytic and uba domain of kinase mark2/(par-1) k82r, t208e double mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
315
structure length
310
Chain Sequence
b'HIGNYRLLKTIAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE MARK2
publication title Structure and Function of Polarity-Inducing Kinase Family Mark/Par-1 within the Branch of Ampk/Snf1-Related Kinases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 96
structure length 310
sequence length 315
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2wzjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wzjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wzjA01
2IN6A 4GFOA 3E8DA 3CXWA 1ZARA 5BVWA 3UQFA 4ZJIA 3Q4CA 2P55A 3UIUA 4IAZA 2QKWB 5E4HA 4YBKA 3EL7A 4JDKA 4QMPA 4QTDA 3R7IA 4LOPA 4MXXA 4BDAA 4PPCA 4QMVA 4I4EA 4GEWA 4E1ZA 5C1QB 3OT3A 5JFVA 3QQGA 4IFGA 2BFXA 4GJ3A 2PVLA 3ZDUA 3A7HA 1YKRA 4F0IA 1JWHA 5HO8A 2CGWA 5DBXA 3BGPA 2UZEA 3EH9A 3EHAA 1F5QA 5CXHA 5AP1A 5IEXA 4L44A 5C26A 4M69B 5IQIA 3E3PA 3M1SA 4C61A 2QOHA 2CMWA 4U6RA 4KIQA 3H3CA 4CZYB 3RPYA 3DNDA 3TZ8A 3A7GA 3EKNA 4I0SA 1UKHA 4ANLA 4YTHA 3OROA 4MWIA 2CLXA 2QVSE 4PL5A 3FZRA 3NGAA 2ETRA 3EQRA 5E7RA 5H8BA 2EB2A 3EFJA 2XKFA 4EL9A 2JY8A 4KBKA 5HGIA 3HA6A 1XH8A 2GNFA 3NNXA 4AZVA 3JR1A 5HO6A 4CQGA 2YHVA 4E26A 5TT7A 4FKWA 3EMGA 3UYSA 5IH5A 4ZSGA 4MXCA 2XBAA 2JDOA 4RJ4A 3RM6A 4E8AA 3EOCA 4HVHA 4RX9A 4C35A 4FKQA 4U8ZA 4XMOA 3ZH8A 1JKKA 1Y6BA 3HV4A 4L42A 3S0OA 3PUPA 3QQLA 3JY9A 2C0TA 4FSNA 4IDVA 4NJDA 3R02A 3W33A 4X0MA 1DM2A 4IM3A 4DGMA 2IG7A 4FEUA 5K9IA 4XJ0A 2XA4A 4RJ7A 4RJ8A 2O25A 3WF6A 3KQ7A 1OIQA 5M57A 4ZIMA 2Y4IC 3DZQA 5CEKA 3IPHA 4OTWA 3ELJA 5JI2E 2OH4A 1PXPA 1DO0A 1YI4A 5EW9A 2HIWA 5KMJA 3UQGA 3SDJA 3NVKI 4LFIA 3PDTA 2LBCA 4GRBA 3DGKA 4ACCA 3QZFA 4A4LA 4JIAA 4G1WA 5IQBA 1UU3A 3GU8A 4ZTSA 3FV8A 3DQXA 1VYZA 1YXVA 4Z7GA 2WTKC 4I5HA 2ZV9A 4QMOA 3ZFYA 3BWJA 3LFDA 3OOMA 4BDIA 5D11A 4F99A 4AA5A 5A4LA 5G6VA 2PMIA 3TV6A 3VUGA 4O22A 5ACBC 1ZOHA 3R7UA 4F9YA 2R3OA 1SVHA 1RDQE 4UZDA 5CX9A 1R0EA 1LP4A 1UWJA 4CV9A 1XBAA 3FY2A 2BFYA 3PIXA 3TNQB 4E6AA 3E8EA 4UZHA 4YJPA 3VNTA 4FL1A 3NCGA 4FI1A 3JPVA 5ANJA 3QC9A 5GZ8A 4X2NA 2XBJA 3Q04A 3ANQA 3UC4A 3HAMA 1ND4A 4ACHA 2YM8A 1L3RE 2FUMA 3UPZA 3R7OA 4HEOA 2HY81 3D5XA 4FV8A 4AZTA 1DV0A 3GBZA 3ZFMA 3UOKA 4XLIA 4FKLA 4BDEA 4RC4A 4FEQA 3P78A 2UW8A 4PMTA 3E88A 1H00A 3CTQA 4O0RA 5IDPA 5J9LA 1H1QA 4BDHA 3DXNA 2WHBA 2OK1A 4OTIA 4N4SA 1KV2A 1G8SA 4JBVA 2GPHA 4OTGA 4IWDA 2VD5A 5CVGA 4E4MA 4WG3A 5E8TA 3VUMA 4JQ8A 3F2AA 3M11A 3UGCA 2FA2A 3PG3A 3R83A 5I9WA 3D4QA 4EH7A 3QTUA 1UNLA 2F9GA 2XIXA 2NP8A 4ONAA 4K1BA 4TWCA 2A1AB 4U7ZA 3GCPA 2BUJA 1OL1A 5EKOA 4FTAA 3QFVA 4EJNA 4JX3A 5FP5A 1XH4A 2OXXA 3OFMA 3VBTA 1VR2A 4U79A 5K0XA 5DH3A 3Q52A 3KVWA 4AZSA 5CS6A 3OWKA 1KUTA 2JIIA 4LUEA 3DDQA 2OF4A 3GLGE 1QZEA 3Q9ZA 2GTNA 3VRYA 4CFFA 3HA8A 1E94E 2QC6A 4C4IA 4Q9ZA 2YM4A 2QOLA 4D55A 4AOTA 1OKYA 4UMPA 1JR3E 3TNIA 3LE6A 4M67A 4D58A 2JY7A 4WNMA 3B89A 5J79A 1JVPP 5CWZA 4FNZA 4LGHA 3LKMA 4IJ9A 4LUDA 3OWJA 4UMTA 5DVRA 5HLNA 4HCVA 2OOAA 3WF5A 1Q8WA 2CN8A 3W32A 2C6IA 3LJ1A 2BCJA 2XK8A 1I09A 2W99B 4GH2A 2BMCA 1SM2A 2JKMA 3LM5A 2VWUA 3BELA 1FGIA 4MYGA 3SXSA 4OTDA 5AV1A 3V5JA 5B2KA 2JNHA 2CSNA 4ZS4A 3IG7A 3KRXA 4KKHA 4QP9A 4WHZA 1PXIA 1XWSA 3BU6A 3D2IA 3H9FA 4XV9A 5CLPA 4EHEA 3ZONA 5HTIA 3FMHA 3PG1A 2VNWA 5F94A 3BE2A 4JDHA 3POOA 3R21A 1JBPE 3GU5A 4M7IA 2SRCA 4CSVA 4PV0A 3E46A 4FTIA 4EH3A 3PY1A 5CY3A 3BHVA 3BYUA 4J98A 3ZRKA 4W4XA 3EL8A 4RIYA 1XXHE 3NIEA 4CT2A 1DO2A 4FG8A 3F3ZA 4NIFB 1JQHA 4IX4A 3QL8A 2KNAA 2V7OA 3QF9A 4LGGA 4XG8A 4X3FB 4YJNA 2J0KA 4HGLA 4XP3A 1JSVA 3LCTA 4JS8A 4FUXA 1PJKA 5GINE 4DFZE 3R6XA 2F7XE 4APPA 3OD6X 2X7FA 1KYIA 4BYJA 5CNOA 4AZWA 4HVDA 1Q99A 3LQ8A 2CJMA 4N6ZA 3UIBA 2BRBA 4YHJA 2Z7QA 3MDYA 1TQIA 3BBTB 4IHPA 4LRJA 3TT0A 4RWLA 3MIYA 2IW9A 2R0UA 1J7UA 3D7TA 3DJ5A 3PLSA 3QX2A 3AMBA 4I94A 5EYCA 4WKQA 1OBGA 2RFEA 3C4ZA 5KHWA 5HLPA 1NW1A 2VO3A 4O0UA 2OJJA 2VTLA 2WTWA 3FL4A 1H24A 4UWCA 5HX8A 3A7IA 2BTSA 2UZBA 3E8CA 2YCSA 2RRUA 2OJFE 4KBAA 4XG9A 3SHEA 4L3LA 4HVIA 1RE8A 2C6LA 5CSPA 2VGPA 2GS7A 4TW9A 4UYAA 4RIWA 2GQRA 3PVWA 1IXSA 4Y8DA 5ETCA 3AT3A 2BIKB 1R39A 3R28A 4L53A 4I3ZA 4AE6A 1QL6A 2F7ZE 4FZ7A 4E73A 3WILA 4FTCA 3LM0A 4XS2A 4J52A 4RPVA 3BGZA 1H0WA 1YXUA 2WIPA 3RAWA 3HZTA 2JKKA 3CD3A 4QQJA 3FMJA 5IMXA 2YDKA 2YN8A 4FT7A 3M2WA 3NUPA 5AR4A 5JRQA 4K9YA 4ENYA 5KBRA 1MRUA 5I3RA 5EHLA 2DKLA 1PMNA 5HIBA 3ULZA 4ZLOA 5EQYA 4DC2A 3ATSA 3GCSA 2ETKA 3MVMA 2LVAA 1RQQA 2YA9A 3KXXA 4AOJA 5HICA 3AD6A 1IRKA 5E1EA 5LJJA 3Q4TA 4EK6A 2XK7A 2W7XA 2XNPA 2WOUA 4O6EA 2OJGA 2ERKA 2DHYA 3F7WA 2CCIA 2VAGA 3F66A 2DAMA 2VO0A 4D2WA 4RIXA 5GZAA 4N57A 2OZAB 4HZRA 3V8TA 1XH7A 5IQFA 2JKQA 5L2QA 3PXZA 3ZEWA 4GSBA 3V5PA 3DFCB 2UVXA 3Q9WA 4YHTA 2FH9A 5EI8A 5KZIA 5KMKA 5ANKA 5IUGA 2X1NA 3L9PA 4EQCA 3C0IA 3PSCA 5EYDA 4YLKA 5IQHA 1IAHA 2ACXA 4M69A 4YC3A 2ZB0A 2V62A 3RCDA 5FEDA 4I0TA 3ZC6A 2JGZA 2WFYA 2V0DA 4NEUA 4BDFA 4CFWA 3Q3BA 2ERZE 3W10A 3UZRA 1PXJA 3FI3A 4B9DA 1BYGA 1ZY4A 2IZUA 3TI1A 2EVAA 2JEDA 5DNRA 1NV8A 3MV5A 4EOKA 3I0QA 4RZVA 3RTPA 4CCBA 2OXDA 4HOKA 4BF2A 1KE9A 4F7JA 4PY1A 2EKKA 1OUYA 1YLAA 4DGLC 4FA2A 3F3VA 3H10A 4NW5A 4IADA 4QMWA 2V22A 5DRBA 4AACA 5CSWA 4FL3A 4BFMA 4YTFA 4XP2A 4DG0E 2J0LA 3C0HA 3FMEA 2PY3A 4RLKA 3WZKA 4AX8A 1ERKA 4KRDA 3RALA 1MN3A 3OEFX 1YI6A 4X6RA 3VUDA 2CKEA 3MI9A 3JYAA 4LL0A 3PFQA 4ANSA 5DWRA 3LCUA 4B99A 4AAAA 5CAOA 5M08A 2J5EA 3RJCA 3F9NA 3O17A 3IOKA 4RFZA 3FQSA 3GUBA 1P4FA 3KRRA 5EH0A 1PF8A 3E7OA 3NVMB 3LFEA 4S30A 1NY3A 1HQYE 3OWPA 3RM7A 4G17A 3CY2A 4EZ3A 2JFMA 3BCEA 4RFYA 2CGUA 3C4CA 4O7YA 5LARA 3F5UA 3QTXA 4NJ3A 3BV2A 4FG7A 4KNBA 4AW1A 4CXAA 4EHGA 5KMLA 4AA0A 2ZTCA 3QD4A 3W18A 3PYYA 2IWIA 3WYYA 4V01A 2XS0A 3SD0A 4O0SA 4R5SA 3CY3A 2B9JA 1OAIA 3BE9A 3U9NA 3R8VA 2PVHA 4OTQA 3KRWA 4YLJA 4FUYA 3IO7A 3UBDA 3NR9A 4Y85A 1P14A 2BRHA 2W5AA 3BLRA 4JG7A 4MF1A 4NH1A 3R9RA 2WXVA 3K54A 5EM5A 3MY1A 3EQGA 5BVNA 4QQTA 4LL5A 2C3JA 2PWLA 1W98A 2PMNX 2C6OA 2XRWA 3RHKA 4MBIA 4CKJA 3ZFXA 5GIOE 1QPJA 2QI8A 2WNTA 3ODYX 5LVMA 2YZAA 5K0KA 3I5NA 2UVZA 4QMLA 5DPVA 5CVFA 3R8UA 4ERKA 1HCKA 3SXFA 1KOBA 3E93A 3P0MA 4UX9A 4Z9LA 1ZV1A 4FODA 2G2IA 4JG6A 2ZDTA 2R2PA 4LGDA 4OAUC 4RJ3A 5B7VA 1G4AE 3R9OA 1W0XC 4AGWA 3SG9A 4RFMA 4QRCA 4DEHA 2B53A 4USFA 3GU6A 4AXAA 4YZBA 5EG3A 3BQRA 4GK2A 3L9LA 1J7IA 4GCJA 1SVGA 1FBNA 2YZLA 4ZTNA 3BBZA 1IA9A 1H1WA 5F1ZA 4R7HA 4AFJA 1YRPA 3NS9A 4LYNA 4AFEA 4ANMA 5FEEA 5E8ZA 2O63A 4HYSA 4IANA 4YJOA 3T8OA 3V5TA 4C57A 2YM5A 5I9ZA 4FGRA 5EYKA 3PSDA 4ITJA 4ASZA 1STCE 2XKCA 2PMOX 3QQKA 5IH4A 3C4FA 2BIYA 3P86A 5CASA 4KB8A 4FTMA 2PHKA 2L2DA 4BZDA 4W9WA 1V1KA 3EN9A 4NM3A 4WO5A 2DYLA 2GHLA 2DS1A 4X21A 2BTRA 4AWIA 5FBNC 2PVRA 2I6LA 2HZ4A 4D5KA 3HMMA 5DE2A 5E8WA 2HYYA 3PJ2A 5JH6A 4DT8A 2F7EE 2QNJA 4A06A 4EQUA 1H4LA 3KY2A 1Z57A 3V8WA 1PHKA 3S3IA 3PVBA 3WIGA 1AD5A 4FNWA 4R5YA 5DN3A 4YURA 4UXLA 3PE1A 4BWKA 2PUNA 3DB6A 2RKUA 5DR2A 3KEXA 2H5XA 5FRIA 5HESA 2ITWA 3EN4A 4RT7A 2HELA 3PE2A 3QRJA 2XNOA 3LQ5A 4FMQA 5CU2A 3VBQA 3DAEA 2FB8A 3G9NA 3W2OA 1GY3A 5DRDA 5HX6A 1HOWA 3LMIA 2OOBA 2Y4IB 3NW5A 1J1CA 4JDIA 2UZVA 4Y73A 4A4OA 4DBNA 3AC4A 1P3QQ 5DT0A 5IF1A 1PMVA 4IAIA 3C50A 4RQKA 3ZLXA 4ZOGA 4ZTHA 2BRNA 3GNIB 5F95A 3QCYA 3VAPA 4IVCA 2QOQA 3ZLWA 1DI8A 5JGBA 1G8AA 3DXQA 4NKSA 5EFQA 5CEPA 2GS2A 4FKIA 2WTKB 2G2FA 4FKOA 1UVRA 4E20A 2XNNA 2HWPA 3CJGA 2EUFB 3TUBA 1PXMA 2C6KA 4I41A 1F4IA 1KV1A 4NIFA 3KXNA 4X6QC 4XBUA 3SC1A 4AW5A 4DEEA 1ZZ2A 3MFUA 3V6RA 3NUAA 5BYLA 4X3FA 3KFAA 4BDGA 4CRSA 4FE2A 2WELA 2Z7SA 3GC7A 1SNUA 2X2KA 2VTNA 4CYJA 5AR3A 4BGQA 2GHGA 3KF4A 3EFLA 4QNYA 3R8LA 3GGFA 1I44A 2JITA 4R6VA 3R7VA 4XCUA 4IJPA 5M09A 5DHJA 2Q0BA 5JEBA 2QOFA 3LHJA 4M13A 4FIHA 4H3QA 5CU6A 2J0MB 5HVYA 4I5CA 3DKCA 3RP9A 4FIFA 4M3QA 4CQEA 1HT2E 4O7LA 3UODA 3ZZWA 2R3KA 1BX6A 1IEPA 1JNKA 3ENMA 3MW1A 4WRSA 4WP2A 5J1VA 2CNUA 1R4GA 1VJYA 2ZB1A 3TKUA 4HPUE 5T6KA 5HE0A 4BCKA 4C3FA 4H58A 1UU8A 1W8CA 4XV1A 4D9TA 5AA9A 1IASA 1Z5MA 2ZM1A 3OY3A 2P33A 4II5A 4DH7A 4F0GA 3HV7A 2CDZA 3E21A 4XOYA 3NYOA 1WGNA 1KE7A 1YDRE 4D4RA 3G5DA 4QQ5A 1X8BA 4QTBA 1YQJA 5JK3A 3AT2A 4NSTA 2V7AA 1M7NA 2GU8A 4G3EA 3RWPA 2QOIA 4GFMA 3F5GA 2PULA 2OBJA 2CP8A 2W5HA 4BKJA 2B0QA 3QWJA 5DYJA 1MQ4A 3MH3A 2ITVA 3K3IA 5HI2A 1NXKA 3N4VA 2LVOC 2R3GA 1WR1B 1MP8A 4ZTQA 5HNGA 2JDSA 3JVRA 4M14A 5DR9A 1SVEA 2JBPA 3BLHA 2OU7A 3D7ZA 1U4DA 4A9YA 2GNJA 4BKYA 3VIDA 3WOWA 4NCTC 4A9TA 1O9UA 4O7ZA 4MXZA 4OTHA 2RFSA 3HDNA 2X6EA 4S33A 3D15A 5AV3A 4MNEB 2P2IA 3S2PA 3ZHPC 5CEQA 1OKWA 5CU0A 5EDPA 3C4WA 3QD0A 3QQUA 4FYNA 3A61A 2CHLA 2UZWE 4IEBA 2XNBA 2Z2WA 4N0SA 3PLAE 4IAKA 4KABA 2DAGA 3EYHA 4RG0A 2F57A 4E3CA 4ZY4A 2Q83A 4AU8A 3EIDA 2XYNA 2YDIA 4W4WA 4I21A 5I9UA 2XUUA 4TWNA 4QTEA 4TYHB 5LOHA 2C30A 4R3RA 5CSXA 3U8WA 4CG9A 3CC6A 2OF2A 3LLTA 4IB5A 3R71A 3NAYA 4HPTE 5IU2A 1OBDA 5IUHA 3D83A 5AP5A 1EFUB 3FMMA 3COIA 4EC8A 3SG8A 4DEAA 1E1VA 4D2TA 3P5KA 4DF3A 3O96A 3VRZA 5I9YA 4IVBA 2GNIA 2YABA 2OGVA 4FTUA 2X8EA 1J1BA 3A4PA 1ZOEA 3FLSA 5AA8A 2PUPA 2JDTA 5JQ8A 5M55A 4F6SA 4BCPA 3GT8A 2YFXA 4M8TA 5C8NA 3MB7A 4FTJA 4FOCA 3BI6A 5AEPA 2CWBA 1M17A 1LPUA 3PXFA 1W83A 3NPCA 3ZYAA 4AZEA 1GNGA 4F1MA 2Z7LA 4KS8A 4BZNA 4C4HA 4QMZA 1WBSA 2XJ1A 4W4YA 5A6OA 5CT0A 4CVAA 4GS6A 2ESMA 4V05A 3ACJA 5HHWA 3OXZA 4FEXA 2I0YA 4J97A 1PMUA 3A7JA 4G9CA 2QHOB 3QTWA 3PJ3A 2X7OA 4O86A 2HXQA 1H1SA 4IWQA 1KE5A 2FSOX 3UZTA 4G3CA 3QQJA 2JBOA 4F9WA 4YU2A 5GIPE 4G3OA 2NRYA 5EI6A 3DKGA 4MXOA 4FV4A 4U42A 2X2LA 3DV3A 4C2VA 4EONA 3LFSA 5BPYA 3C5IA 4USEA 5IG1A 4PDYA 2OKRA 1JAMA 3BU5A 3NDMA 4FIGA 3ORXA 4GT3A 4MD7E 4R3CA 2BR1A 5CQUA 5BVFA 3S00A 2QG7A 3DJ6A 5L8KA 4PDSA 4BCHA 3TL8A 2B9HA 3FDNA 5CF5A 4IQ6A 5CANA 3OUKA 2EXEA 3W1FA 4DH3A 5K5XA 3VBWA 4RVKA 4C33A 1YI3A 3QGYA 3V8SA 2X4ZA 4ZTLA 4C4FA 2OWBA 1TVOA 3NYXA 4GG7A 3OF0A 4YJTA 4C62A 5LWNA 4EYMA 3CPCA 5JT2A 4QMTA 2BROA 4Z16A 2VTTA 3EZVA 2R7BA 4C34A 3SW7A 5M53A 3L1SA 5HIEA 3AGLA 4FIJA 4ZMEA 3CJFA 1C7YA 4JIKA 3EFWA 4BN1A 3FSFA 3BPRA 3QX4A 4L45A 1NV9A 1H07A 5CU3A 1CUKA 2OO8X 4BB4A 1REKA 5H8EA 3AD5A 5EDRA 4ZSLA 5AR5A 4GIIA 4TYGA 4CFNA 3GLFE 4EKKA 4W8EA 2Y7JA 3SKCA 4C59A 2G2HA 5AP0A 3SRVB 4R78A 4EK3A 4BTJA 2BPMA 4D0XA 3FZ1A 3F2NA 2Z02A 1PKDA 1CM8A 4HGTA 1GZNA 3HV6A 4APCA 4CZUA 5E1SA 3OC1A 3PRIA 5L2IA 4O27B 3DNEA 4J96A 2XRUA 2WQBA 5EM6A 1Q41A 1W82A 3RBWA 4DEDA 4FTNA 3TN8A 4JX7A 4AW2A 4O0YA 2R3MA 2WAJA 3A8XA 3EZRA 3MWUA 4OUCA 3HECA 3UP2A 4Z7HA 5CF6A 2JUJA 4MD8E 2R3IA 3KCFA 3FLWA 3OP5A 2DNAA 1PXKA 3OW4A 4A9UA 1U5RA 2IZRA 2UW3A 3HYHA 4I6BA 5E8XA 5TR6A 4CMUA 4EOSA 2RF9A 4EK4A 4PQNA 2ITOA 4FBXA 5CAUA 2A27A 3BYVA 5IA1A 5E8UA 5E92A 5C8KA 4NFNA 1H1PA 3ZRLA 3R22A 3SXRA 4UB7A 2OIQA 4QPMA 4RGJA 4QD6A 3SA0A 3FKOA 2QO9A 3GC9A 4MK0A 3FKNA 4LOOA 2IW6A 2WPAA 2EKFA 3IDCA 3W55A 4BDCA 4DH5A 2UW6A 4BC6A 4DGOA 2A0CX 3O71A 5JFWA 4DEGA 5HCZA 1T46A 4A9RA 3BHUA 3HAVA 3U6HA 1A48A 3MGYA 4FG9A 4CMOA 4BHNA 3GP0A 4GK4A 3ORMA 4RWIA 2PUUA 4C8BA 3I81A 3IQ7A 3RINA 4ZLYA 1KOAA 3HRBA 4ALUA 4FV3A 2KNVA 4R3PA 4XG3A 4D4SA 2XCKA 2C69A 2ITTA 5FXRA 4F9BA 1U46A 4HVSA 2IPXA 4BR3A 2EXMA 4JR7A 5TF9A 3BQCA 4EH9A 5IDNA 2NRUA 2IO6A 3HVCA 3R2YA 5AX9A 5IH6A 3FYKX 4A9SA 4ALWA 5C27A 1SNXA 5HG9A 3ITZA 3WZDA 4NTSA 4PMMA 3F61A 5HG7A 4FVPA 3L9MA 3U6JA 5D9HA 3IW8A 4G34A 3UQCA 2MJ5B 1WCCA 1XR1A 2F2CB 3KULB 1DAWA 3PY3A 1J3HA 4FZFB 4RX7A 4L43A 4TN6A 4EWQA 4MXYA 4FV2A 3OY1A 3CGOA 4GL9A 3QCSA 4W8DA 4D4YA 3CCNA 2HOGA 3S1HA 5I5ZA 3ALOA 4TZRA 3KXGA 3TACA 4CEGA 5F20A 4PX6A 3EN5A 5HVKA 5K4IA 2ZDUA 4EORA 4WSYA 1IM2A 4EOIA 3A7FA 4O82A 2K9DA 4BBMA 2YCFA 4IB1A 2C5OA 3CGFA 3F5XA 1V0PA 3F3WA 3TV7A 3VW8A 1MRYA 2VGOA 5M4UA 4JI9A 2YIWA 4MAOA 4I93A 4WBOA 3FHRA 4E7WA 5AADA 3ANRA 2QOOA 3G6HA 4YZCA 4AE9A 2GNGA 4FKPA 1GIIA 2WMVA 5HNBA 2C47A 4XG2A 3WI6A 4I23A 4EOOA 5K4JA 3Q6WA 5J9ZA 2XZSA 3R9HA 3NLBA 3PTGA 5I9XA 5CI7A 4EH5A 4D4VA 4XYFA 2VTAA 4O38A 4KRCA 3R7GA 1KWPA 3PZEA 3JVSA 3DCVA 5FD2A 1UV5A 3F6XA 4ZSJA 4QYEA 4JJRA 4FSYA 4JQ7A 2X39A 3LXKA 4RVTA 3REPA 4JVGA 3OTVA 4EEVA 2E9NA 3LOKA 3V04A 4E4LA 2UZLA 4FT3A 4O2PA 1URWA 4TY1A 3VBYA 3LMGA 3TEIA 3ATTA 2X6DA 3EKKA 3SAYA 4KWPA 4QNAA 1U59A 3BGQA 4MQ1A 4KIKA 3MB6A 3IDBA 5KZ0A 4EK5A 4FIIA 3R1SA 5IQEA 2F49A 1G5SA 3VS2A 1L8TA 2C6EA 4HVGA 2JZ0A 1H27A 4QMMA 5A3XA 4ACDA 3VJOA 4MNEA 5H2UA 2GHMA 3DQWA 5M06A 3RGFA 1IR3A 2GMXA 2YJRA 3WBLA 5CAVA 5CENA 2E9PA 2W1DA 3LCVB 4RBLA 3COHA 2Y6MA 3DBEA 3NIZA 2VWYA 2YDJA 1MRVA 1Q24A 3HMIA 1W84A 3E64A 4HYUA 5C01A 4C3PA 5HIDA 2YWVA 1ZXEA 3OWLA 3OXTA 1YWVA 3VS4A 4L9IA 3MFTA 4CFUA 5JRSA 4IX5A 3QC4A 4E4XA 3QXPA 3ORIA 3LIJA 4IC8A 1FVRA 5A9UA 2XEZA 3CBLA 5KCVA 4F09A 5HU9A 3HMOA 4ZMFA 2YLEA 5IQDA 4HNFA 3G0FA 2CNVA 2YACA 2H9VA 3D9VA 4IMYA 4NKAA 4S34A 4F4PA 2PZYA 5AUTA 3ZUTA 2QCSA 3GVUA 3DTWA 4O7VA 2EU9A 5EW3A 5FGKA 2B7AA 3I79A 3R9NA 3KK9A 2WGJA 4G2FA 2ZYBA 3OCGA 4WD5A 3WIKA 2E9UA 3P7CA 5ETAA 3FPQA 5J87A 2BAJA 4BTFA 4J1RA 5CI6A 4W4VA 4YP8A 2WMUA 1P4OA 2DWBA 2PVMA 3N9XA 3NNWA 3A2CA 5AUVA 2W9ZB 2F2UA 4UEUA 4YLLA 4IFCA 5E8VA 4C4GA 3FXWA 3ORPA 1Y6AA 4GW8A 4S32A 4HGSA 2VRXA 4DG2E 2WTVA 5C4KA 3GU4A 2YM7A 3V6SA 3OW3A 4XG4A 5J7HA 2UW0A 3COKA 4IZ5A 3FI8A 1H28A 4RX5A 4QOXA 3II5A 4EJ7A 2QLQA 4Q2AA 3O51A 4Y83A 3ALNA 3BRBA 3VS0A 4CT1A 1ZYJA 3TKHA 4PDPA 1NVRA 5EOLA 4I22A 1WGLA 3EQDA 3FLQA 3QTIA 4S2ZA 3AC8A 3AOXA 1ZMUA 1B39A 3P23A 4OT6A 4U5JA 3VJNA 4PP7A 2WQMA 4DT9A 1CMKE 3DK6A 3RAKA 4ARKA 3LFQA 3LLAA 3AXWA 5HE2A 3TDWA 4L68A 2J50A 3CPBA 3LJ0A 4MVFA 3EQFA 5IUIA 4ZY6A 4XH6A 5A46A 3ORNA 1R3CA 2XK9A 2VTQA 2VV9A 2VX3A 3COMA 2GS6A 4RWKA 3ZEPA 4D2PA 2UW9A 3LCOA 2DAIA 5D1JA 4BBFA 4NU1A 4YZDA 3ZSGA 2EB3A 2QO7A 2YJSA 3TTIA 3DBCA 1HCLA 2QKRA 2OJIA 2OIBA 4QTCA 3QQHA 2WU6A 3KK8A 3CKXA 2W06A 5K3YA 3NSZA 3F92A 3BLQA 1WBTA 3O8PA 4GIHA 2YM6A 4C02A 4QPAA 4F1TA 4G6OA 4AA4A 3NUSA 4L7SA 4NL0A 2PMLX 1H8FA 4NYEA 3KL8A 2IJMA 4IM0A 4IX6A 4FC0A 1FOTA 4NK9A 4ZAUA 5EM7A 1IG1A 3OEZA 2G1TA 3VF8A 5E9EA 5AP3A 3EQPA 4PDOA 4L8MA 5AUWA 2ZV8A 3ORZA 4M0YA 2BWEA 4D9UA 3IKAA 4FV6A 4KUJA 2J51A 3MVLA 4FTRA 3QHRA 4NZWB 2WMSA 4F9AA 3NEWA 2HZNA 3KA0A 3FHIA 3LFAA 1T45A 1IA8A 2BALA 2R4BA 3P7AA 4FX3A 2FSMX 3DK3A 2ZMDA 3LXPA 3QTRA 3SRVA 2ITZA 4AP7A 4YJUA 5EYMA 2V55A 3KU2A 3FMDA 5F4NA 4MD9E 1Q02A 2RG6A 4NM5A 2BRMA 2OIDA 4X2KA 4QYHA 3FYJX 5CZIA 2W4KA 5JMSA 1BVSA 1R1WA 1M2PA 3C4EA 2EXCX 4PP9A 3PSBA 2XP2A 3B8QA 3TNHA 3PZHA 4CG8A 3TM0A 4MTAA 2NO3A 1WFCA 3IOPA 4RVLA 2C6DA 3R8PA 5B0XA 4ZZMA 2B55A 3HV3A 1FINA 2QD9A 4Z55A 5BVKA 2W05A 1GZ8A 4MHAA 2DENA 4UY9A 2JIUA 2RFNA 4OLIA 5L2SA 3QLGA 2ZV7A 3FPMA 4UXQA 4O91A 1OB3A 4EK8A 4IIRA 3GC8A 5G1XA 4FOBA 3AC5A 1K9AA 3T9TA 3OUNB 5LVOA 4DN5A 3O8TA 1WIVA 3QKKA 4EYJA 3JS2A 3O23A 4FICA 4QP8A 2BRGA 4FEVA 1OQYA 2IZSA 4UN2B 4AT5A 3FUPA 2X2MA 4HYIA 4CLJA 4KINA 2J90A 3R00A 4RQVA 3U54A 4O81A 5BMSA 3TZMA 2BAQA 2R3LA 4KAOA 4FKVA 4LV8A 3OTUA 3EFKA 4FKRA 3PP1A 4IZAA 3LZBA 4IZ7A 3DBFA 5GJDA 5CT7A 1ZYDA 3A8WA 4H39A 1YXTA 1E1XA 3HDMA 4OBOA 5LXMA 3FRHA 3Q4ZA 5B2LA 4B7TA 3DA6A 3MPAA 3Q96A 4FVQA 3RHXA 4Y5QA 3SLSA 3MSSA 2J6MA 3U4WA 1A9UA 3DBQA 3QD3A 1PXNA 4BVUA 2CKQA 3IW7A 4WUAA 5DR6A 5FM3A 3UVQA 3UO6A 3HUCA 2OH0E 2VX0A 5GZ9A 3FWQA 2CLQA 3LFNA 4FV1A 2IW8A 1ZYSA 1P2AA 3KREA 5FUTA 3LFFA 4R77A 1UA2A 3BEAA 4O0VA 5JZNA 2QODA 5BMMA 3RKBA 5IPJA 4AT4A 3KMWA 4FKJA 3UIXA 2WQNA 3BHTA 4GKHA 1WBOA 5DGZA 2VWBA 4ZS0A 4N6YA 3VW6A 3ZLSA 4EKLA 4KKEA 1TQPA 4BCFA 1OUKA 4DINA 3QUEA 4ZY5A 4BDKA 5LWMA 1BL6A 2JFLA 4CKRA 1XH6A 4FTOA 2MR9A 3B8RA 2WEVA 5AP4A 2OXYA 5AWMA 2WMXA 4MBLA 3ZO1A 3S95A 2I7QA 2FSTX 5ACKA 3WE8A 2MROB 2KTYA 3AG9A 1E9HA 3KMUA 4E6QA 4O21A 4PRJA 2O3PA 2UW7A 4H05A 5AJQA 3R7YA 5A4QA 4X7QA 4M15A 2OW3A 2UZNA 3PPKA 3GOPA 1JPAA 4O1OA 5HBHA 4J95A 5HG8A 3TJDA 1ZAOA 2IVSA 2YAKA 3BU3A 5CSVA 3TZ7A 4Y95A 3P7BA 5A6NA 4NUSA 4FT9A 2J2IB 5HO7A 4A07A 4DA5A 4DCEA 2UVYA 5AAGA 5JFSA 3QA8A 5AMNA 1T6OA 3MH1A 4BBEA 4F1OA 2QONA 4FV7A 2WU7A 4BCQA 1PKGA 4OW8A 3LCKA 1ZRZA 3PJCA 4O83A 1XHAA 4JNWA 4WG4A 4C7TA 4CFMA 3UG1A 1CDKA 4IBMA 4FF8A 3BBWA 5KKRB 2GCDA 2QU5A 4FSWA 1Q8ZA 4QO9A 2R3JA 5J5SA 3HLLA 3K5UA 3ZMMA 4G3GA 4GU6A 3UJGA 4O0TA 3ZZEA 2XKDA 2HAKA 3CEKA 5IEYA 4ZEGA 3BYOA 1DAYA 3KKVA 2G3QA 4O6LA 5LMKC 2WMWA 3UE4A 3H9OA 2Y0AA 3OZ6A 3TUDA 2ITQA 4HJOA 1BI7A 4HYHA 4I5MA 3IHPA 4CFVA 3Q53A 3I7CA 3SGCA 3HUBA 4BI1A 4L00A 1AIPC 5FG8A 2PSQA 2ITYA 3ERKA 4WA9A 5AR2A 3NAXA 3QCQA 2PE0A 4TT7A 2H6DA 3EN7A 4BTKA 4EQMA 4ZSAA 4C58A 4B8MA 3WZUA 5E91A 4BWXA 3OBGA 3ZRMA 4O2ZA 2OJ9A 1BKXA 1A5TA 5EM8A 3T3UA 1M7QA 4D2SA 5AUZA 3KB7A 3TTJA 4RRVA 3W2CA 2I0EA 4HCTA 5M07A 3V01A 4D2RA 4ASEA 3CLYA 3I7BA 3JY0A 5DOSA 1SYKA 4KBCA 3QQFA 5JN2A 4L7FA 3MPMA 4BCOA 5L6WL 3ODZX 5BX0A 1XB2B 2DUVA 5GJGA 2JAVA 3ZS5A 2PE1A 3U55A 3WARA 2WTDA 3PPJA 4ACMA 2YM3A 4FTLA 3C51A 3G33A 3I6WA 3NMUF 4XHKB 4WIHA 5FM2A 2DQ7X 4PNKA 5J9YA 4OTFA 4O7NA 5JQ5A 3WF7A 1OMWA 5FEQA 2VTHA 3KGAA 3DFAA 4EOLA 5HE3A 3R63A 1R0PA 4DFXE 1Q4LA 4UYNA 2ZOQA 4DAWA 5IA4A 1PYEA 5AFVA 2XM8A 3PA4A 5J5TA 1OL6A 3D5VA 4YJQA 4IE9A 4F7SA 2CN5A 3OCSA 4DE4A 2XNGA 3DLZA 4PF4A 1XO2B 1DI9A 1V92A 3CIKA 3ET7A 3FMKA 4RMZA 3BHYA 2P2HA 4QMUA 4OGRA 3SX9A 4B6LA 4ORKA 1WZYA 4GUEA 4W9XA 5AP6A 4TNDA 3FC1X 3N51A 4FGBA 3MJ1A 4IAAA 3UG2A 4CMTA 4UMRA 2PU8A 4O7WA 4QYFA 3QXOA 2C6MA 4YHFA 4UWBA 1NVSA 2GTMA 2JAMA 2Z8CA 2BVAA 4GYGA 4YNEA 3SOCA 4FV5A 4MCVA 1FMOE 1H0VA 3S4QA 3VS5A 4G16A 1JOWB 4G5JA 4K8AA 4IB0A 2VWVA 3D5WA 3NX8A 1VEBA 3GENA 5AR8A 3ZO3A 4B8LA 5ANGA 3MH2A 1XKKA 2YITA 4E5BA 2PZPA 2XMYA 3C13A 3SVVA 4H3BA 3GFWA 2QOKA 5KNJA 4KA3A 4QT1A 5L4QA 2OZAA 3F5PA 3LFBA 1BI8A 2XM9A 3JXWA 5GJFA 5C8MA 5KMMA 5D10A 5EOBA 3I4BA 3DKFA 3GCQA 4O7TA 1NT2A 5IQCA 2W1GA 2PVKA 1T43A 1RJBA 1ZYCA 4ZZNA 4QMQA 1K3AA 1WMKA 4F65A 3T6PA 4C38A 2JIVA 4XV3A 5DMZA 3OXIA 5HTBA 2CPKE 1WBPA 3ZM4A 3RPRA 4K0YA 4LMUA 4MF0A 3VHKA 4RSSA 1YDSE 3FEGA 1UKIA 2ZM4A 2X9EA 4EH2A 3GC0A 3CKWA 1OPKA 3FI2A 3ORTA 4IAFA 5D7VA 3ZDIA 4IX3A 3D0EA 3JUHA 1YOLA 4J99A 4OTRA 1M2QA 4GG5A 5ICPA 4D0WA 3O2MA 1OIYA 2VWIA 1OKSA 1G41A 2CGXA 2ONLC 2VTPA 2VTMA 3BKBA 1ZLTA 2I40A 4B0GA 2PVFA 1GZOA 5ANDA 5HBJA 2Q0NA 4Q9SA 1S9IA 2R0IA 3UNZA 4DLJA 4Q7JA 2WOTA 3H0ZA 4XEYA 2PUIA 4F1IA 4A7CA 1ZWSA 5EHOA 2JKOA 1TKIA 4H1MA 5AM7A 1YHSA 3FL5A 4H36A 4Y72A 2MGWA 1OIRA 2LVNC 4EHVA 1G3IA 4FSUA 2X8DA 1Z9XA 2XIKA 5CAQA 5CF8A 2X8IA 3L8XA 4JAIA 3GLIE 4G31A 3FY0A 5J95A 3K9OA 3IK3A 5EQEA 3RZFA 4L01A 2QOCA 3U87A 3IGOA 5CAPA 3D7TB 3ZSHA 2XIYA 1QPEA 2W1ZA 2JDRA 3OS3A 5BVEA 2ZM3A 4BZOA 3QKMA 4M68A 2W17A 3ACKA 2PVYA 4GEOA 4KS7A 4AUAA 3IS5A 5FWKK 1SMHA 3ZUVA 2H34A 4XUFA 5IA2A 2HENA 2R3RA 4I4FA 2UW5A 3VS6A 3QTQA 3LQ3A 2GNHA 1KE8A 1BMKA 2C5YA 1BL7A 2LVQD 5AV4A 2QU6A 3HL7A 3BX5A 4RIWB 3NZ0A 5CNNA 3QUDA 4AG8A 2JD5A 4BCMA 1OL7A 4BTMA 5M56A 4U44A 4I24A 1YHVA 3NW7A 4BWPA 2QQ7A 3N4UA 1OM1A 5KBQA 3QRTA 4QP4A 4WNOA 4GT5A 4U41A 4DH8A 5EHYA 4IDTA 2W1IA 1Q61A 2BDJA 3MFSA 4YJRA 4ZJJA 1OPLA 4E5AX 3PIYA 4JL9A 3OCBA 4IC7A 2BHHA 4U43A 1LEWA 4TYIA 2R7IA 1WAKA 3DKOA 4IVAA 4F0FA 4IXPA 4C0TA 3SW4A 1FGKA 1XBCA 3UVRA 3FSKA 3R2BA 4DFUA 5FXQA 4QMNA 3Q9XA 3LXNA 4TWOA 3FAAA 5H8GA 3RPVA 3RAIA 4AGDA 2A19B 3GXLA 4S31A 1VEGA 4CLIA 3MPTA 2BKKA 3QYWA 2PZRA 4HCUA 4CD0A 4RIXB 3TG1A 2I0VA 5ETFA 2DAKA 4TXCA 4Y46A 4AOIA 5C9CA 4M97A 3LW0A 2BWBA 4R1YA 1M2RA 4JXFA 4YZMA 2X0GA 3HGKA 4RWJA 2JY5A 4RZWA 4UV0A 3TIYA 3DXPA 2JLDA 2YIRA 4FSMA 2H96A 4E93A 2KULA 2B4SB 4E6DA 4IVDA 4ZSEA 5KE0A 3OVVA 5FTGA 4DFLA 1YXXA 2RSVA 2XH5A 4BDBA 4OR5A 3WF9A 4JT3A 3MMPA 2WTIA 3FLYA 2GQGA 4DG3E 3MIAA 4F9CA 3F88A 5HD4A 1XBBA 2PTKA 5LQFA 3VUIA 5CYIA 4ITHA 3IDPA 3MH0A 2GDOA 4DH1A 5KKRC 4E6CA 4YC6A 3MYGA 5AP7A 1JLUE 4C37A 3RCJA 3ZXZA 3UMWA 3QCXA 5E8SA 3MESA 2QSFX 2FVDA 3NRMA 3WE4A 4O84A 5C03A 1REJA 1ATPE 1MUOA 3BYMA 4FNYA 5I0BA 3VC4A 4HGEA 2B3TA 1Q5KA 4ZXTA 4OBPA 3DAJA 3DJ7A 3MY0A 4F6UA 1CSNA 3CTJA 5CEOA 3UP7A 3KF7A 2YISA 3NUYA 5HZNA 3OHTA 5EI2A 1Y8GA 3E92A 5B2MA 4ZK5A 5BUJA 3PA3A 5CTPA 3QZIA 1H01A 1Q3DA 2QR7A 3R9DA 2I0HA 3ZUUA 3QKLA 2BILB 3ENHA 5D12A 2XK3A 3K2LA 4Q5EA 4LMNA 3UOHA 1FVTA 5DFPA 3TXOA 3PJ1A 3WF8A 4AF3A 4PMPA 3F2RA 4GT4A 4PL3A 1VG5A 3C4XA 2NNWB 5LMBA 4C4EA 5CVHA 3O7LD 1HJPA 1ZYLA 4XLVA 2WKMA 3DPKA 4MWHA 3EWHA 1SZMA 1KE6A 2O64A 2ZMCA 4R7BA 2WTCA 3UTOA 4IB3A 3TJCA 5EK7A 2GFCA 2BZHB 2YEXA 4N70A 1QPDA 4CFXA 5KHXA 4FSZA 5JGDA 4O7RA 2NPQA 2EJSA 5I9VA 4XP0A 4DBXA 5IISA 4KSQA 5DI1A 1UWHA 2HCKA 4QP2A 2BZKB 3UYTA 4QYYA 3CSVA 3GEQA 3WZEA 5CQWA 4P4CA 4QMSA 1GO5A 3ZXTA 2GFSA 5HU3A 3W8QA 3MS9A 3KVXA 4EWHA 1RW8A 2ITXA 5LCJA 4RX8A 3EQHA 3BYSA 3HNGA 4NT4A 2PVJA 4YGAA 3UOJA 2JY6B 3W2PA 3UO5A 3RPOA 2VTOA 1YHWA 3THBA 4FT5A 3L9NA 3R30A 4ALVA 4XBRA 2YIQA 2JP7A 4M0ZA 4DEIA 2R3QA 5AUUA 3C0GA 2J4ZA 3DT1A 4FL2A 4DFYA 3L8VA 3KXZA 3AC1A 2C1BA 2C5NA 3PWYA 4K11A 5D7AA 2Y6OA 4TNBA 2C3LA 2QR8A 2XNEA 1YW2A 2A2AA 4YUQA 1UFZA 1OTRA 3KXHA 3FBVA 3NYNA 4MQ2A 5IEVA 3G15A 4O0WA 5FTOA 4GKIA 1OGUA 2OG8A 2FSLX 2ITUA 2XIRA 3CR0A 3CQEA 3IONA 4G5PA 4GJ2A 3SOAA 4F70A 3GCVA 4C3RA 3AT4A 3PP0A 4HW7A 4V0GB 3GQLA 3IW5A 1U5QA 1ZZLA 3HX4A 3IGGA 4L3PA 2AC5A 3HMNA 3Q6UA 1W7HA 2J0IA 4YMJA 1FMKA 3ZBFA 1OVEA 3F82A 3Q60A 2HWOA 3RMFA 3ROYA 5IMEA 3RAHA 4G3FA 3G6GA 4QQCA 3I5ZA 3KC3A 4BDDA 5CALA 4FNXA 4V04A 5IQAA 3MN3A 3RK5A 4JBQA 5IKWA 2XNMA 3PIZA 2XCHA 4PMSA 5T3QA 4U97A 4CRLA 4ASXA 5DFLA 5TE0A 3G9LX 5M4IA 2CKPA 4NW6A 2W4JA 4Y5HA 3MJ2A 4R71A 3PPZA 4UBAA 2AYPA 3P79A 3BV3A 3BEGA 3F3TA 5BYZA 5EKNA 2J7TA 1U54B 1LUFA 3HRCA 3PRFA 4FT0A 4M12A 4K33A 1A06A 1XQZA 4NM7A 1NA7A 4BICA 4R7IA 2VO6A 2E9OA 3VS1A 4BI2A 3DOGA 4PL4A 3HKOA 3NCZA 4P5ZA 5AV0A 5L2WA 1WVYA 2B9FA 3C5UA 4XRLA 3VVHA 4GVJA 1YWRA 2E9VA 1YOMA 2W1CA 1LEZA 4KD1A 4ANQA 4FIEA 3VUKA 4LOQA 2G01A 4QP6A 4FV9A 4ANOA 1UNHA 4BKZA 3P4KA 3KN5A 4TYJA 4UMQA 3VS3A 5L2TA 2GNLA 1PY5A 5LVNA 4TYHA 3KXMA 4DFBA 3VBXA 3UMXA 2G15A 3VS7A 2X81A 2UZUE 1UNGA 3UDBA 1Q62A 4OAVB 2XJ2A 3Q32A 1M52A 3PXKA 5LVLA 4FVRA 1TR8A 2R9SA 1IFYA 3VN9A 5FLFA 5L3AA 5EQPA 3R1YA 3I6UA 3Q5ZA 2P4IA 2XEYA 3EQCA 5BVOA 3R8MA 4YBJA 3AC2A 2X9FA 5AV2A 1CKPA 3H9RA 3LVPA 4E5WA 4ZTMA 1UU9A 3U4UA 3LJ2A 2RG5A 5CZHA 4YSJA 2OFUA 3R7EA 1YVJA 2B9IA 2X4FA 5HORA 4GU9A 4LG4A 1JKLA 2LVPC 4EBWA 3RNIA 3C1XA 4MXAA 4M84A 2ZTDA 2WEIA 2ITNA 4R8QA 3ZO4A 2BAKA 4IAYA 3PXYA 3E63A 4B4LA 1FVVA 2WMRA 4L46A 3BZ3A 3I1AA 4G9RA 1OPJA 3RNYA 5J7BA 4I6QA 1WVXA 3FRIA 1APME 3MFRA 4KIOA 1XJDA 4YO6A 4EH8A 2JC6A 3ZTXA 2JDVA 4CNHA 2VU3A 5HNIX 4IWOA 4ZZOA 4RC2A 5DG5A 3CP9A 3OG7A 2WB8A 4G6LA 4JR3A 5DA3A 3FQHA 4K77A 3N4TA 3PVGA 4MX9A 2K0BX 4LI5A 4GV1A 4FSQA 4ENXA 2CKOA 5IA0A 2V5QA 3MTLA 4KKGA 4D2VA 5K5NA 3ZSIA 3FE3A 3L8SA 2KNZA 3DAKA 3DDPA 4USDA 5AUXA 4D1XA 4GVAA 2XF0A 3ETAA 4JG8A 4J7BA 2PZIA 4DTKA 2WMAA 3FZTA 2IZTA 1ZY5A 3VF9A 4O7SA 2C0OA 5HKMA 1SG9A 3POZA 4WNPA 3RVGA 1OECA 3FQEA 4FKUA 4JLCA 5CU4A 5EDQA 4ZLZA 5A54A 4F2LA 3OBJA 3IECA 5HE1A 4K18A 4K6ZA 3HP5A 3UZPA 4DLIA 2QHNA 3QRUA 3QLFA 1GOLA 3ZU7A 4K2RA 2VTSA 2WQEA 3QUPA 2W5BA 3PXQA 4HZSA 5EW8A 1TTEA 2C5XA 5FXSA 5TOZA 1GIHA 2XIZA 5IA3A 4CGAA 1OIUA 3FKLA 4ID7A 3TNWA 5BYYA 4JBPA 4UN0C 2OZOA 2C6TA 1OKVA 4BCJA 3IW4A 4TL0A 2DAEA 3NNUA 3NUNA 1H26A 2VNYA 4P5QA 4AT3A 3A62A 4TTHB 2L4EA 2WMQA 3FMNA 3Q4UA 4X2FA 3OCTA 4CCUA 2WZJA 5M4FA 2YIXA 4QMYA 4RA4A 4BIDA 2CNQA 4I5PA 3SV0A 1VDLA 3QALE 4D5HA 2R3NA 2VX1A 2XVDA 2W96B 3F7ZA 4J8MA 4PUZA 4UALA 4CKIA 4U0IA 4FK3A 2JZ1A 4BYIA 1AGWA 3QZGA 2Y4PA 2L4FA 2RFDA 4FTTA 4TPTA 4LM5A 2O5KA 2VO7A 2ZVAA 1Q8YA 1S9JA 2QOBA 3NUUA 4AGUA 3UPXA 4EH6A 3TDVA 3HP2A 3HV5A 4XV2A 1KSWA 3TUCA 3HEGA 4F63A 3KMMA 3QTSA 5DIAA 1CKIA 1CTPE 1NVQA 3LCDA 4FTKA 4EUTA 1BLXA 2YCRA 3C9WA 4TRLA 4G3DA 5FQDC 1G3NA 2W1FA 4L6QA 3W2SA 3ORKA 4U3YA 1JSTA 2C3IB 4MNFA 5C4LA 5FBOA 4AZFA 2VUWA 4BGHA 5HG5A 1V0BA 1OI9A 3QGWA 4FR4A 1O6KA 2PE2A 3CE3A 2H8HA 4U80A 5DT3A 4EZ7A 5A4TA 5BUEA 4DFNA 2YWPA 3FLZA 3UOLA 1PYXA 4AS0A 4UMUA 2XYUA 4LV5A 2RL5A 1F0QA 2CGVA 3DTCA 3E87A 5H9BA 2YIYA 4J8NA 5A4EA 2AC3A 1YWNA 2ITPA 3ZLYA 3R73A 5A14A 4BCIA 3D2KA 5CEIA 5M4CA 4FK6A 4I0RA 4LRMA 5ANEA 3FMLA 5IZFA 1LR4A 4DITA 4A4XA 1XH5A 1XH9A 3F69A 3Q2MA 2VWXA 4X2GA 4JDJA 3V5WA 1JKTA 3I60A 1F3MC 5I4NA 3QRKA 3LFCA 3PA5A 3RK7A 3UIMA 3QAME 2YCQA 3W2RA 3DZOA 4FSTA 5BQ0A 4MH7A 3FZSA 4UWYA 3VQHA 3VQUA 3GI3A 4XOZA 5DEYA 4CZTA 3PWDA 2UV2A 4P2KA 3PJ8A 3A60A 3E8NA 5AUYA 3QU0A 4NM0A 2I1MA 3T3VA 3SQQA 2VTIA 3QRIA 2YERA 2B1PA 2F4JA 3R0TA 3QD2B 3KULA 4I6FA 1B38A 2IVTA 3EQIA 3HRFA 1PXLA 4AGCA 1Q8TA 2PZ5A 2UZDA 2C1AA 2C4GA 3NW6A 3E5AA 3P08A 4F64A 1O6LA 5JKGA 1R78A 3K9PA 3TV4A 3F3UA 4ANNA 1OKZA 1QMZA 3LAUA 4FZDB 3GFEA 1VQ1A 3VHEA 4WUNA 5KMOA 4X2JA 4C36A 4PWNA 2HY0A 4M66A 2G9XA 3QZHA 1EH4A 1GAGA 3CTHA 4H3PA 4WBBB 4C2WA 1WBNA 1QPCA 4H1JA 1PXOA 5HOAA 4RJ5A 2WMTA 4EI4A 2W4OA 3KRLA 3DB8A 4U81A 1WBVA 3NNVA 4OBQA 5AP2A 3TKIA 4BGGA 2VTJA 2XK4A 5FDXA 5AIRA 4XG7A 5I3OA 4EH4A 3P1AA 3V3VA 2LGCA 1Y8YA 1BUHA 4V0GA 4WG5A 5KO1A 4E4NA 2O2UA 3FZPA 4HNIA 2EWAA 3KCKA 2XK6A 3VUTA 3CS9A 3R04A 1J7LA 1Y57A 3GQIA 5IA5A 1OZ1A 3V5QA 3FXXA 3QTZA 2PVNA 4L3JA 5HEZA 4WOVA 5CSHA 1Y91A 4EUUA 3A4OX 4YSMA 1Q8UA 4YJVA 2UZTA 4YTCA 3LMHA 2AUHA 3R01A 3GB2A 2FGIA 4YR8A 3DS6A 3VULA 3FI4A 5J8IA 4GUBA 1U54A 3P9JA 4P7EA 5ANIA 2Z60A 5L8LA 1GJOA 3O50A 4YZ9A 1OL5A 4WNKA 4IZYA 1O6YA 5AM6A 5H3QA 4FKTA 3VBVA 3ID6C 1MQBA 5AAEA 4YO4A 4FZ6A 3BIZA 3ZO2A 5F9EA 4YNOA 1QCFA 4R1VA 4BY9E 3E62A 2R3PA 3NWWA 2WO6A 3Q9YA 2BDWA 4RVMA 4U3ZA 4I92A 3UNKA 3PY0A 4GMYA 3AMAA 4YPDA 4CTCA 3L8PA 2UUEA 3ZOSA 4BDJA 3DY7A 2ZAZA 4GFGA 4CV8A 4F6WA 4U9AA 4EOQA 5CF4A 5LMKA 4O96A 1VYWA 3TCPA 4XG6A 4X3FC 3OT8A 3UNJA 3VWAA 3ZC5A 5HBEA 3LXLA 4PTGA 2OSCA 4YZNA 1M14A 2C0IA 3EYGA 1H08A 4RC3A 5LMAA 5KUPA 4JRVA 3G2FA 4YC8A 5AIKA 2XKEA 4XX9A 5BNJA 2UW4A 1B6CB 3K5VA 5ETIA 4ACGA 3U9CA 3D94A 1WBWA 4IM2A 4WSQA 1ZMVA 1JKSA 4JAJA 5TKDA 2FO0A 2A4LA 4DTBA 4GYIA 4ANBA 3TNPC 4Q5HA 1PW2A 2IVUA 3AGMA 2KHHA 3IW6A 2GSFA 3BHHA 3DBDA 4QP3A 4NTTA 3TIZA 4ERWA 2C3KA 3AC3A 3QHWA 4DHFA 1OITA 3D14A 2HWJA 2B52A 5E90A 4MEDA 1ZOGA 2YLFA 5ANOA 5E8YA 4BL1A 1ZMWA 1JSUA 3UO4A 4ITIA 4JBOA 2R3HA 2W1EA 3OMVA 3W8LA 2XB7A 2LAVA 3VO3A 5AAFA 2VN9A 3K3JA 4FYOA 4X3JA 2VWZA 3OOGA 4FZAB 4L67A 4RA5A 4ASDA 4C4JA 2R64A 2P3GX 4DTAA 3RK9A 2W0JA 4D1ZA 4L52A 1FPUA 4DGGA 2QLUA 3FC2A 3PVUA 4O1PA 4JOAA 4BCNA 4U40A 5J1WA 4IACA 2QO2A 4F08A 2BHEA 2B54A 3EQBA 4BCGA 4J71A 1GIJA 4G6NA 3LPBA 2OO9A 4DYMA 1PRYA 1WVWA 3ZCLA 4OT5A 4QTAA 4EOJA 2LTUA 3DLSA 3E7VA 3RWQA 4BI0A 3O0GA 5L6PA 4O0XA 2VWWA 1H1RA 3M42A 4IWPA 4KSPA 3GU7A 3I0OA 4WRGA 4RJ6A 1WHCA 2PL0A 3G0EA 3NYVA 3AQVA 4DCAA 4MBJA 4I1ZA 5LVPA 2WD1A 1PGYA 2E2BA 4F7LA 5HLWA 5M51A 3R1NA 3FJQE 4P90A 4RIOA 5FP6A 5LCKA 5KMNA 1Q3WA 2ETMA 3MBLA 2GQSA 4CTBA 1YXSA 3Q2JA 5HQ0A 3W2QA 3Q5IA 4LRKA 3EB0A 4TWPA 4FV0A 4AN3A 5DEWA 2CCHA 2J0JA 5A4CA 4YJSA 4FKSA 5JGAA 2VTRA 2DI0A 4QMXA 1VEJA 2HK5A 1AQ1A 2BKZA 2W1HA 2RGPA 5KX8A 4LQMA 5L6OA 3UVPA 3FXZA 2RIOA 4D28A 4PTCA 3RZBA 2WMBA 3KRJA 2O8YA 4QPSA 1V0OA 4BHZA 2BDFA 5JZJA 4WT6A 5ITAA 2Z7RA 2C5VA 4KIKB 4NCTA 3W16A 3O7LB 2VZ6A 5D41A 5DT4A 4BRXA 2OFVA 3U51A 2IVVA 1CKJA 4EC9A 5FDPA 2HXLA 4IW0A 4QYGA 3ZBXA 5HCXA 1YDTE 2PYWA 4PNIA 3H30A 2PPQA 2REIA 2ZV2A 5T68A 5JSMA 4QP7A 2Y9QA 3ULIA 1OL2A 4EBVA 4Z3VA 1URCA 2WIHA 4AQCA 1VEKA 1Q97A 3FLNC 5CEMA 4DEBA 2BZJA 3ZM9A 5IQGA 3MA3A 4QP1A 3QBNA 1K2PA 3ROCA 4EHZA 4TKSA 4XRJA 3WZJA 1WJ7A 2W9FB 1HT1E 3PXRA 3RI1A 4RIYB 4F7NA 4FEWA 5GHVA 3R8ZA 4PPAA 2WQOA 5DLSA 4DGNA 2PK9A 3CQUA 4NWMA 3B2TA 4GK3A 3T9IA 3HMPA 4YPSA 3AD4A 4CYIA 5HTCA 3UC3A 2Y8OA 3G90X 3DU8A 2HW7A 3WYXA 3CQWA 5L8JA 3MA6A 3MVHA 4U45A 2OI4X 4ZP5A 4ZJVA 3MVJA 2ONLA 3ORLA 4FTQA 3E3BX 4EZ5A 3A99A 3DK7A 2UZOA 5JFXA 2QG5A 2J9MA 3CD8A 4XNEA 5GNKA 4YTIA 4JQEA 2X7GA 3O8UA 4FKGA 1IAJA 1J91A 4PTEA 3G51A 4I6HA 5TO8A 4AN9A 2FYSA 1UU7A 3LCSA 3QYZA 2HZIA 2OICA 4D1SA 1VZOA 3C7QA 4FSRA 3QWKA 4I20A 4IH8A 2BZIB 3MTFA 3H0YA 2QURA 4TYEA 3U6IA 2OLCA 4KIPA 4ZTRA 3NUXA 1YOJA 4EOMA 5BVDA 3H4JA 3AMYA 5HD7A 3MY5A 3EN6A 5HVJA 4BIBA 1H25A 4PPBA 5CXZA 2HW6A 4MKCA 4EOPA 5KMIA 3GLHE 3GCUA 2YAAA 4DBGB 1P5EA 1TQMA 2J5FA 2QHMA 3KN6A 3V5LA 2R5TA 4J53A 2O0UA 5BUIA 2O65A 3QA0A 5AR7A 3FZOA 3BWFA 3VUHA 4AN2A 4OTPA 1DS5A 4BIEA 3R1QA 3RPSA 3EJ1A 3TWJA 2HZ0A 2XJ0A 5FTQA 4RLLA 4JRNA 3B2WA 3GOKA 2R3FA 1PMEA 2DZLA 1FQ1B 2WTJA 5HCYA 3TZ9A 3V51A 4AW0A 2ZJWA 5M44A 1GZKA 3D5UA 2P0CA 4NFMA 5AX3A 2C68A
chains in the Genus database with same CATH superfamily
4GFOA 1ZARA 3UQFA 4ZJIA 4LGMA 4IAZA 2QKWB 4QTDA 4BDAA 4PPCA 4E1ZA 5C1QB 1TF0B 2BFXA 1IN8A 5CXHA 5IEXA 4L44A 5C26A 4U6RA 4CZYB 3KOYE 3TZ8A 4LY6A 3DA1A 5H8BA 2EB2A 4KBKA 2W82A 3GRUA 4FKWA 4ZSGA 3RM6A 4E8AA 3W67A 4XMOA 3HV4A 3QQLA 5AADA 2C0TA 4X0MA 2IG7A 5K9IA 4RNAA 1GKIA 1OIQA 5M57A 1PXPA 3U6MA 5KMJA 4JI5M 2LBCA 4ACCA 3QZFA 4A4LA 3DQXA 4BDIA 3LFDA 3FD9A 5A4LA 3VUGA 4UZDA 1LP4A 1UWJA 3TNQB 4UZHA 4YJPA 4FI1A 3JPVA 5ANJA 3QC9A 2XBJA 3Q04A 3GBZA 3ZFMA 3UOKA 3TYKA 3SAWA 4PMTA 4O0RA 5J9LA 4OTIA 3UGCA 2MH8A 1UNLA 2XIXA 4ONAA 4U7ZA 3GCPA 5FP5A 2OXXA 2X0PA 3OFMA 1VR2A 3VBTA 5K0XA 5DH3A 4CFFA 3HA8A 1E94E 1JR3E 3VLFB 3B89A 1JVPP 4UMTA 5DVRA 1Q8WA 2CN8A 1I09A 2W99B 3LM5A 3NFFB 4MYGA 5AV1A 2JNHA 3FUUA 5CLPA 3BE2A 4JDHA 4CSVA 3R21A 1JBPE 4EH3A 3PY1A 3BYUA 3EL8A 1DO2A 4FG8A 3QL8A 4GIPA 4XP3A 1JSVA 3LCTA 2F7XE 3OD6X 4NSRA 4N6ZA 1TQIA 4IHPA 2IW9A 2X0OA 3D7TA 3PLSA 4X65M 2RFEA 4UWCA 3A7IA 2BTSA 3E8CA 2GQRA 3AT3A 2BIKB 3R28A 2F7ZE 4FZ7A 4RPVA 1YXUA 3RAWA 3CD3A 3UDTA 3M2WA 5EQYA 1PMNA 5HIBA 3ATSA 3GCSA 2YA9A 3KXXA 1IRKA 5LJJA 2XNPA 2CCIA 3F66A 2JKQA 1DGHA 4GSBA 3DFCB 4IBIA 5IUGA 4JXJA 1IAHA 2ACXA 4YC3A 2ZB0A 3RCDA 4I0TA 2ERZE 3UZRA 3RFWA 2IZUA 3TI1A 3GLHA 3RTPA 4ANRA 2OXDA 4F7JA 1YLAA 4FA2A 3CF6E 3U5ZA 5DRBA 4IBDA 2V22A 5CSWA 4XP2A 4AX8A 3RALA 2CKEA 4ANSA 4HLQA 4LF8M 4LL0A 5DWRA 3LCUA 4B99A 4AAAA 1IN4A 3O17A 1OFIA 3VK7A 3U60B 5EH0A 3NVMB 4S30A 1NY3A 3ZC7B 4G17A 2RGHA 3GQ4A 4EZ3A 3C4CA 3QTXA 3BV2A 4AW1A 4KNBA 3SMSA 3SD0A 3U9NA 4OTQA 2BRHA 4NH1A 4JG7A 3MY1A 3EQGA 2PWLA 2PMNX 2XRWA 3RHKA 5GIOE 5LVMA 5K0KA 4QMLA 4ERKA 3SXFA 1KOBA 3P0MA 1ZV1A 2ZDTA 5B7VA 2XFTA 4QRCA 4IBEA 3BQRA 4GK2A 1J7IA 2YZLA 4ZTNA 4LJ4A 1YRPA 2DHRA 4YJOA 3PSDA 3QQKA 5IH4A 3HY5A 4BZDA 4WO5A 3EN9A 4NM3A 4X21A 2DS1A 4D5KA 3PJ2A 3WIGA 1N32M 4YURA 4UXLA 3PE1A 4BWKA 5FRIA 5HESA 3EN4A 3QRJA 2XNOA 3W2OA 3DAEA 3GRRA 2FB8A 3G9NA 5DRDA 5HX6A 4JYAM 1HOWA 2OOBA 4JDIA 2UZVA 4A4OA 3AC4A 1P3QQ 4IVCA 3JR5A 2GS2A 2WTKB 4E20A 2EUFB 1PXMA 4DEEA 4BDGA 2WELA 4K0KM 1SNUA 3QAUA 4PDGA 2JITA 4R6VA 5M09A 4FIHA 1JR3A 5CU6A 2J0MB 1YE9A 4M3QA 5EP4A 3UODA 2R3KA 1BX6A 3ENMA 4WRSA 5J1VA 2ZB1A 4TUWA 5KQ8A 4II5A 4DH7A 3E21A 4XOYA 3NYOA 1YDRE 4D4RA 1X8BA 3AT2A 4NSTA 4G3EA 2GU8A 3HHZA 2QOIA 4GFMA 3QWJA 1MQ4A 2ITVA 3N4VA 2R3GA 4ZTQA 2JDSA 5DR9A 2JBPA 1U4DA 1O9UA 4O7ZA 4OTHA 2X6EA 5AV3A 5KPTA 1OKWA 3C4WA 3A61A 2CHLA 2XNBA 4KABA 4E3CA 1T3TA 5I9UA 4TYHB 5LOHA 2C30A 3LLTA 3NAYA 1OBDA 1Q39A 1NNUC 4DEAA 1E1VA 5I9YA 2YABA 3A4PA 1ZOEA 5JQ8A 5M55A 4BCPA 3GT8A 4M8TA 2CWBA 4W4YA 3B7ZA 4GS6A 3OXZA 4FEXA 3QTWA 2LH0A 1H1SA 1KE5A 3UZTA 2JBOA 4F78A 4G3OA 2NRYA 3LFSA 5IG1A 2OKRA 4FIGA 3NDMA 3ORXA 4R3CA 5CF5A 5CANA 4DH3A 5K5XA 3QGYA 2X4ZA 4ZTLA 5LWNA 4EYMA 4C34A 2XZFA 2G8LA 3AGLA 4DR6M 3EFWA 4BN1A 3FSFA 2UXCM 5EDRA 3I04M 4CFNA 4W8EA 4BTJA 2BPMA 4D0XA 3F2NA 4D80A 4JN6A 1OIZA 1Q41A 4JX7A 3UP2A 3A8XA 3ILKA 2R3IA 3OP5A 4A9UA 1PXKA 1QUSA 2ITOA 4FBXA 3U6LA 5E92A 1H1PA 3ZRLA 4UB7A 2OIQA 3SA0A 3FKNA 4DH5A 4BC6A 4DGOA 4FG9A 3ORMA 4RWIA 4C8BA 3IQ7A 3RINA 1KOAA 4ALUA 2JWSA 4FV3A 4HVSA 2IPXA 4BR3A 4JR7A 3BQCA 1N75A 4ALWA 3I4VA 3U6JA 4G34A 2ZANA 3KULB 1J3HA 4L43A 4FV2A 3OY1A 3CGOA 5I5ZA 4X62M 3ALOA 4CEGA 5F20A 4EORA 1IM2A 2JXNA 4Z8XA 4BBMA 4I81A 4WBOA 4E7WA 3G6HA 4AE9A 2WMVA 2C47A 5CI7A 1ORYB 3F6XA 4JJRA 4FSYA 4L8RC 3VBYA 3LMGA 1PJJA 4KIKA 4EK5A 5KZ0A 2JZ0A 4QMMA 4ACDA 4MNEA 2EA0A 3RGFA 1IR3A 2GMXA 3WBLA 5CENA 2E9PA 3COHA 3DBEA 3NIZA 2YDJA 3E64A 4HYUA 1ZXEA 1YWVA 4L9IA 5JRSA 3K8ZA 3QC4A 3ORIA 2E5LM 2XEZA 3CBLA 4F09A 5HU9A 4RF1A 4HNFA 3G0FA 2CNVA 4NKAA 4S34A 3ZUTA 3GVUA 3DTWA 5EW3A 4G2FA 2E9UA 4BTFA 4W4VA 2WMUA 1P4OA 3N9XA 5AUVA 2W9ZB 3FXWA 4DV1M 5C4KA 2YM7A 3OW3A 3COKA 4IZ5A 4RX5A 4Q2AA 3VS0A 4CT1A 1OFHA 3TKHA 5EOLA 4I22A 3TQSA 3AOXA 4U5JA 4PP7A 3RAKA 4ARKA 2KRKA 3CPBA 3EQFA 5IUIA 4XH6A 1R3CA 2VTQA 2DAIA 4BBFA 4YZDA 3QQHA 3KK8A 3CKXA 4LF7M 3KSJA 3F92A 3O8PA 2YM6A 4F1TA 4NYEA 2IJMA 4ZAUA 5E9EA 5AP3A 2R45A 2ZV8A 4FV6A 4KUJA 4FTRA 3QHRA 5F3WA 2HZNA 1IA8A 4FX3A 3DK3A 3SRVA 2ITZA 3KU2A 2J7OA 2RG6A 2BRMA 2OIDA 1XNQM 1M2PA 3C4EA 4PP9A 3PSBA 1L2DA 3UMMA 2EUCA 3IOPA 3FYCA 1GZ8A 3QLGA 4DN5A 3JS2A 3O23A 4AXEA 1E9RA 3R00A 3U54A 4L4UA 3TZMA 3RHXA 4Y5QA 3SLSA 3MSSA 3DBQA 2X0QA 5FUTA 1P2AA 4R77A 5JZNA 2QODA 3RKBA 4AT4A 1WBOA 4N6YA 4EKLA 4BDKA 5LWMA 1BL6A 2JFLA 5AP4A 2OXYA 2FSTX 2KTYA 3AG9A 3KMUA 4JI8M 5AJQA 3R7YA 3HKPA 2YAKA 4DA5A 3MH1A 4BCQA 4OW8A 3UG1A 3BBWA 3ZMMA 3ZZEA 2HAKA 3CEKA 2GNOA 1DAYA 4L00A 5FG8A 2PSQA 4BWXA 1BKXA 3T3UA 5AUZA 4RRVA 5M07A 4HCTA 3J2PB 4D2RA 3CLYA 5JN2A 4B3RM 4L7FA 4BCOA 2DXIA 1XB2B 2DUVA 2PE1A 3U55A 4ACMA 5FM2A 4PNKA 5JQ5A 2VTHA 5HE3A 5IA4A 1QANA 3PA4A 4IE9A 4LF4M 2CN5A 4DE4A 4PF4A 1DI9A 4RMZA 3BHYA 4ORKA 3VKHA 1WZYA 4GUEA 4QYFA 2JAMA 2Z8CA 2BVAA 3FUWA 1H0VA 3VS5A 1JOWB 5AR8A 2F5PA 4B8LA 2PZPA 3SVVA 4H3BA 3GFWA 3F5PA 3JXWA 5GJFA 4ZZNA 3FTCA 1K3AA 4MF0A 5KQDA 4LDTA 1UKIA 2ZM4A 4EH2A 3CKWA 1OPKA 3FI2A 3ORTA 4IAFA 4IX3A 2ZFYA 2CGXA 1SXJC 1ZLTA 4B0GA 2PVFA 2Q0NA 2R0IA 4DLJA 3H0ZA 1ZWSA 3RGPA 3FL5A 2LVNC 1G3IA 2XIKA 5CF8A 2X8IA 3A98B 3FY0A 3IK3A 5EQEA 4L01A 3D7TB 3ZSHA 1QPEA 5BVEA 2W17A 4GEOA 3L25A 4RF0A 5FWKK 3ZUVA 4XUFA 2R3RA 4I4FA 2UW5A 2LVQD 3HL7A 4AG8A 4BTMA 4BWPA 4DV6M 4E5AX 1OPLA 4JL9A 2DWLA 4LJAA 2R7IA 4IXPA 3R2BA 4DFUA 3E4RA 3Q9XA 5H8GA 3W0SA 3GXLA 4S31A 4CLIA 3QYWA 2PZRA 4HCUA 1IXZA 5ETFA 4Y46A 1M2RA 2X0GA 3TIYA 4RWJA 2JY5A 4UV0A 3OVVA 2WTIA 3FLYA 3MIAA 3F88A 3MH0A 4DH1A 5AP7A 3ZXZA 2QSFX 1MUOA 4HGEA 4ZXTA 4F6UA 1CSNA 3U5ZB 3CTJA 3KF7A 2YISA 3NUYA 3E92A 3PA3A 1H01A 2LXEA 3ZUUA 3QKLA 4AQKA 3TXOA 4C4EA 3DPKA 1KE6A 4R7BA 1XMLA 3TJCA 2XLJA 5EK7A 3UJNA 5KHXA 5JGDA 3HJSA 2EJSA 2C9OA 1UWHA 4QYYA 2O01F 2EO2A 5CQWA 3ZXTA 3KVXA 4EWHA 1PM5A 2JY6B 2ZAMA 4PDIA 2JP7A 4M0ZA 3PWYA 3FXZA 2C3LA 2QR8A 4MQ2A 2KDLA 4XK8F 4GKIA 1OGUA 4KHPM 2XIRA 4F70A 3GQLA 2AC5A 1FMKA 3ZBFA 3G6GA 3KC3A 4BDDA 5CALA 1G71A 2XNMA 1FNNA 5TE0A 4DR3M 4FW9A 3PPZA 2AYPA 5EKNA 3F3TA 1U54B 4K33A 4BICA 3A42A 3DOGA 4I4LA 2ZAOA 3HKOA 4PL4A 3C5UA 1YWRA 3PNVA 4FV9A 4BKZA 1UNHA 3P4KA 5L2TA 2GNLA 2UUBM 5KO3A 1Q62A 4FVRA 2HHHM 4PT5A 2P4IA 2XEYA 3GRVA 4YBJA 5AV2A 3H9RA 4E5WA 1GJSA 4ZTMA 2R65A 4YSJA 1YVJA 2B9IA 4LG4A 3VKGA 3C1XA 4MXAA 4M84A 4R8QA 3ZO4A 1I94M 2WMRA 3BZ3A 5J7BA 4I6QA 3MFRA 2JDVA 2VU3A 5DG5A 3DOAA 4G6LA 4K77A 4MX9A 4ENXA 3MTLA 4KKGA 4D2VA 3L8SA 2KNZA 3GPUA 4GVAA 3POZA 5CU4A 3FQEA 4CGYB 5HE1A 4K6ZA 3HP5A 3QRUA 3ZU7A 2VTSA 2W5BA 1TTEA 4LJ9A 1KSFX 5IA3A 3FKLA 2OZOA 2DAEA 4P5QA 4QMYA 4BIDA 4I5PA 1VDLA 2R3NA 4PUZA 4LV7A 2ZVAA 3TDVA 3HP2A 3HV5A 1D0LA 3ORKA 1JSTA 4MNFA 1V0BA 4O4FA 4EZ7A 5DT3A 4DFNA 4UMUA 2RL5A 1F0QA 5H9BA 2AC3A 2ITPA 3D2KA 5CEIA 5M4CA 4DITA 1JKTA 3PA5A 2CV1A 3UIMA 2CHGA 4MH7A 3FZSA 2UV2A 5JI3E 3T3VA 4WW0A 2VTIA 3QRIA 2YERA 2B1PA 4I6FA 2IVTA 4L78A 2C1AA 3NW6A 3P08A 4F64A 3F3UA 1E9SA 4JV5M 3GFEA 3VHEA 5KMOA 4C36A 4M66A 3QZHA 3CTHA 4WBBB 4C2WA 3KRLA 5AP2A 4BGGA 2VTJA 2XK4A 3V3VA 1BUHA 4V0GA 4HNIA 2EWAA 3CS9A 4WOVA 4YJVA 2AUHA 2FGIA 3DS6A 3VULA 4P7EA 2LHCA 5L8LA 1GJOA 3O50A 5AM6A 4IZYA 1O6YA 3BIZA 4R1VA 4RVMA 5IT9S 4GMYA 3DY7A 2ZAZA 2Z8YM 4GFGA 4F6WA 5CF4A 5LMKA 1RU3A 3VWAA 3LQRA 3LXLA 3EYGA 1H08A 3PUFC 5BNJA 5ETIA 3D94A 1WBWA 4IM2A 4WSQA 1ZMVA 1JKSA 4GYIA 4ANBA 3TNPC 2IVUA 3T15A 2GSFA 4QP3A 2C3KA 2D7HA 2HWJA 2B52A 1ZMWA 3OMVA 5AAFA 4FYOA 2L09A 3OOGA 4FZAB 4L67A 2VF8A 4RA5A 4DTAA 2W0JA 4D1ZA 1FPUA 4O1PA 4IACA 2B54A 3EQBA 4DYMA 3ZCLA 3DLSA 3RWQA 4BI0A 2XALA 4O0XA 3J80S 3I0OA 1WHCA 2DWMA 2WD1A 5HLWA 3FJQE 5LCKA 2ETMA 4X66M 1YXSA 5HQ0A 4TWPA 5DEWA 3IG5A 4CJ6A 2W1HA 3J7BA 5L6OA 4PTCA 2WMBA 1V0OA 4BHZA 5ITAA 2Z7RA 2CV0A 4AG5A 4KIKB 4BRXA 2IVVA 1CKJA 4EC9A 3ZBXA 4PNIA 2REIA 5T68A 4LRSA 1NNJA 1GJTA 1OL2A 1URCA 3ZM9A 5LMUM 4DEBA 5IQGA 3MA3A 4QP1A 1WJ7A 2F5OA 2WQOA 2HW7A 3MVHA 2OI4X 2ONLA 4FTQA 2UZOA 2QG5A 1IAJA 4AN9A 3QYZA 2OICA 4D1SA 2J5YA 3C7QA 4I20A 3MTFA 3BOSA 2XFSA 3NUXA 1YOJA 3H4JA 3EN6A 4BIBA 4PPBA 4MKCA 2YAAA 1P5EA 3V5LA 2O65A 2Y20A 1DS5A 4BJJA 3EJ1A 3B2WA 3TZ9A 1IY2A 4AW0A 4NFMA 2C68A 3E8DA 5JFVA 4IFGA 4GJ3A 1TZDA 3ZDUA 1YKRA 4F0IA 1JWHA 1HR0M 3BGPA 2UZEA 3EH9A 5AP1A 4M69B 3E3PA 3M1SA 3T1HM 3RPYA 4FWDA 3A7GA 3NGAA 3JAMS 2XKFA 5HGIA 3HA6A 1XH8A 4CQGA 2YHVA 4E26A 3EMGA 3UYSA 4RJ4A 3EOCA 4U8ZA 1Y6BA 4L42A 3PUPA 4FRFA 4DGMA 2XA4A 4RJ7A 2Y4IC 3ELJA 2OH4A 5EW9A 3DGKA 5IQBA 4QHTA 3FV8A 1VYZA 1YXVA 2ZV9A 3ZFYA 3BWJA 5D11A 3R7UA 4G4QA 1SVHA 1R0EA 4OX9M 3PIXA 2BFYA 3VNTA 1MJGM 4FL1A 2AQXA 3ANQA 3UC4A 4ACHA 3UPZA 3Q8XA 4HEOA 2H1RA 4BDEA 4RC4A 4FEQA 3P78A 1IN5A 2UW8A 1H00A 2WHBA 1G8SA 4JBVA 2GPHA 2VD5A 3F2AA 3R83A 3D4QA 2F9GA 2NP8A 5FTKA 2X49A 4FTAA 3KVWA 4LUEA 3DDQA 3GLGE 3FKEA 2QC6A 4C4IA 4Q9ZA 4D55A 4AOTA 4LGHA 2OOAA 5LMNM 2BCJA 2XK8A 4GH2A 2BMCA 2JKMA 2VWUA 4ZS4A 3V5JA 2CSNA 4WHZA 4AQYM 3H9FA 4GMQA 3ZONA 3PG1A 5F94A 3POOA 3GU5A 4FTIA 5CY3A 3HWSA 3HJQA 4RIYA 3NIEA 4CT2A 3QF9A 4LGGA 4X3FB 3UZUA 2X7FA 5CNOA 4AZWA 1Q99A 2CJMA 3BBTB 4LRJA 3MIYA 3DJ5A 3AMBA 1OBGA 5KHWA 1NW1A 3FL4A 2VTLA 2UZBA 2OJFE 4HVIA 1RE8A 2VGPA 4TW9A 1IQPA 1J5EM 3WILA 3L2AA 2WIPA 1SXJE 4QQJA 2YN8A 1MRUA 4ZLOA 4DC2A 3L28A 1RQQA 4AOJA 5HICA 3AD6A 3SHFA 4EK6A 2W7XA 2OJGA 3GQ5A 2VAGA 4M9SA 2VO0A 4JI0M 4D2WA 3LQQA 3V8TA 1XH7A 5EP2A 5L2QA 3V5PA 2UVXA 3P5JC 2X1NA 4EQCA 5FEDA 4CFWA 2JGZA 2V0DA 3Q3BA 1PXJA 4B9DA 4JI2M 4BF2A 1KE9A 1OUYA 2Z7JA 3H10A 4AACA 4YTFA 4BFMA 3C0HA 3WZKA 1EE8A 3OEFX 1YI6A 3M0EA 3PFQA 5CAOA 3F9NA 3IOKA 3GUBA 1PF8A 3E7OA 1HQYE 3OWPA 3CY2A 5LARA 4EHGA 5KMLA 2ZTCA 3PYYA 3WYYA 4V01A 3SBJA 2B9JA 3KRWA 4YLJA 3UBDA 3NR9A 4Y85A 2WXVA 3R9XB 3ZFXA 5CVFA 4Z9LA 2R2PA 3SG9A 1W0XC 4USFA 4YZBA 1FBNA 4ANMA 5E8ZA 3C4FA 2BIYA 4KB8A 1V1KA 2GHLA 4AWIA 2PVRA 2I6LA 2HZ4A 3RGSA 2QNJA 1PHKA 3FUVA 3S3IA 1AD5A 5DN3A 3DB6A 2RKUA 3SATA 4FMQA 2UXBM 4Y73A 5IF1A 1PMVA 4IAIA 4RQKA 3ZLXA 2BRNA 5F95A 3ZLWA 5JGBA 1G8AA 4FKOA 2XNNA 3CJGA 3GP1A 1F4IA 4XBUA 3V6RA 4D82A 3KFAA 2QENA 4CRSA 4FE2A 5EXXA 2X2KA 4CYJA 4BGQA 3KF4A 3GGFA 1I44A 4MGYE 2Q0BA 3LHJA 4H3QA 3DKCA 4FIFA 3ZZWA 1JQJC 1IEPA 1JNKA 4WP2A 1R4GA 1VJYA 4P17A 4QNMA 4HPUE 4C3FA 3GPYA 1IASA 2CDZA 1KE7A 3G5DA 4QQ5A 4LG2A 2V7AA 3F5GA 2OBJA 1G8JA 1GL7A 3DFZA 3K3IA 1NJFA 1NXKA 1WR1B 3BLHA 4A9YA 3WOWA 4NCTC 4MXZA 4W5WA 3HDNA 3D15A 3AJIB 3ZHPC 5EDPA 4IEBA 4X64M 4AXCA 3EYHA 5HVKA 2XUUA 4TWNA 4R3RA 2OF2A 3R71A 5IU2A 5IUHA 3D83A 5AP5A 3W68A 1SXJA 3O96A 1K3XA 4CHTB 4FTJA 3BI6A 1W83A 3NPCA 4AZEA 2Z7LA 4BZNA 4QMZA 1WBSA 2XJ1A 2VIIA 3VDUA 2ESMA 3LVWA 4J97A 3U60A 5DYGA 4YU2A 5GIPE 5EI6A 3DKGA 4MXOA 4FV4A 4C2VA 2X2LA 3C5IA 4USEA 4GT3A 3BU5A 5BVFA 5CQUA 2QG7A 5L8KA 4PDSA 3B7NA 4IQ6A 3OUKA 2EXEA 4C33A 1Q3CA 2OWBA 4GG7A 3CPCA 5JT2A 2BROA 2CRUA 2R7BA 3KS4A 3SW7A 5HIEA 3W0LB 1GABA 3BPRA 5CU3A 1REKA 3AD5A 4ZSLA 4GIIA 2Y7JA 4C59A 3SYLA 4R78A 3AKJA 1PKDA 1GZNA 5E1SA 5L2IA 2XRUA 1W82A 3RBWA 4FTNA 4AW2A 2R3MA 3FTDA 4MD8E 3AL0C 2IZRA 3HYHA 2RF9A 4PQNA 5IA1A 4NFNA 3SXRA 4QPMA 4QD6A 2WPAA 2A0CX 3BHUA 4BHNA 3GP0A 4GK4A 4ZLYA 3GLFB 2KNVA 4R3PA 4XG3A 1QAQA 2XCKA 4I8OA 2C69A 5FXRA 5IDNA 1R2ZA 4A9SA 3ITZA 3WZDA 2IF8A 3IW8A 3QYEA 3AKZA 3PY3A 4RX7A 4W8DA 3CCNA 4PX6A 3EN5A 3SMPA 4EOIA 3A7FA 2K9DA 2C5OA 3F5XA 1V0PA 5A2QS 1MRYA 2VGOA 4MAOA 3V76A 4I93A 3ANRA 2QOOA 2GNGA 4FKPA 4XG2A 4EOOA 5K4JA 3Q6WA 3PTGA 4CIZA 3R7GA 3JVSA 3DCVA 5FD2A 4JQ7A 4JVGA 4EEVA 3LOKA 4E4LA 3EKKA 4KWPA 3SYKA 1U59A 5IQEA 1G5SA 2C6EA 2LHGA 5CAVA 3M6AA 3HMIA 5HIDA 3LIJA 5A9UA 2YACA 4F4PA 5AUTA 3KS8A 4O7VA 2EU9A 3R9NA 2WGJA 2ZYBA 3P7CA 5CI6A 4YP8A 4YLLA 3ORPA 4IBCA 4S32A 4DG2E 2WTVA 1GLNA 3GU4A 3V6SA 2UW0A 1H28A 3EQDA 4S2ZA 1ZMUA 4OT6A 4DT9A 2WQMA 3LFQA 3LLAA 5A46A 2UW9A 3LCOA 5D1JA 3TTIA 2QO7A 2YJSA 4B7FA 4QTCA 2QKRA 2WU6A 4GIHA 4NL0A 4IM0A 4FC0A 1FOTA 5EM7A 1IG1A 2G1TA 3ORZA 4M0YA 3IKAA 4NZWB 3LFAA 4LFAM 2YFQA 2G5GX 1Z6TA 2FSMX 1C1KA 5EYMA 4MD9E 1Q02A 4X2KA 2Y0TA 5JMSA 1BVSA 1R1WA 1WFCA 3R8PA 2C6DA 5B0XA 3HV3A 3B9PA 1FINA 4MHAA 4UY9A 2DENA 4OLIA 2ZV7A 3FPMA 2R4JA 4EK8A 1XMMA 3OUNB 4QP8A 4FEVA 4UN2B 3FUPA 4HYIA 4KINA 4FWHA 2J90A 1GL6A 4KAOA 4L16A 5E6JA 2I7NA 4IZAA 4PD2A 1NVMA 1E1XA 3Q4ZA 3DA6A 2YR0A 3U4WA 1A9UA 3QD3A 3IW7A 5FM3A 4BJJB 3UO6A 5GZ9A 3LFNA 4FV1A 5ITYA 5IPJA 2WQNA 4GKHA 5DGZA 3ZLSA 4BCFA 1OUKA 4CKRA 1XH6A 2MR9A 3B8RA 2WMXA 4MBLA 2I7QA 5ACKA 3WE8A 2C99A 4E6QA 3TPZA 2UW7A 4H05A 5A4QA 4M15A 3PPKA 3GOPA 4DHZA 1JPAA 5HBHA 3TJDA 4J95A 5CSVA 4NUSA 3QA8A 5AMNA 4F1OA 4FV7A 1PKGA 3LCKA 1ZRZA 4FF8A 5KKRB 1Q8ZA 4QO9A 3HLLA 4GU6A 3T38A 2CFOA 3BL9A 2FNAA 3H9OA 2Y0AA 3OZ6A 5C1BA 3TUDA 2ITQA 4HJOA 1BI7A 4HYHA 4I5MA 3IHPA 5FTJA 3HUBA 1AIPC 3ERKA 3QCQA 4TT7A 4EQMA 3EN7A 2XEPA 3WZUA 3OBGA 4MUQA 4D2SA 3KB7A 3V01A 4ASEA 3JY0A 3I7BA 2A98A 3CF0A 1SXJD 4FTLA 3I6WA 2DQ7X 5J9YA 4OTFA 4O7NA 3WF7A 3KGAA 3HZJA 4DAWA 2X