2WZJA

Catalytic and uba domain of kinase mark2/(par-1) k82r, t208e double mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
315
structure length
310
Chain Sequence
HIGNYRLLKTIAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDEFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Polarity-Inducing Kinase Family Mark/Par-1 within the Branch of Ampk/Snf1-Related Kinases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE MARK2
total genus 96
structure length 310
sequence length 315
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2wzjA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wzjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wzjA01
4HYSA 3MWUA 3EFKA 2YABA 1W98A 3FZRA 2C47A 5M44A 1V0OA 3GCPA 1YXUA 3QHWA 4QTBA 3SRVB 2LGCA 4ZXTA 4HNFA 2ZVAA 4DFZE 3NVKI 5A4QA 2VWWA 4FTLA 2F57A 4GFOA 4NYEA 3UMXA 4Q9SA 3IDPA 5EM8A 5BMMA 3LCVB 3K9PA 3D7TA 4QNYA 4YTHA 3SKCA 3ZFMA 4NKSA 5BMSA 4DBGB 1CSNA 4RMZA 2I7QA 3OVVA 1WFCA 5AV1A 3EQDA 4IAFA 3MS9A 4O83A 5AAFA 3VS1A 1AQ1A 4EUTA 4E4LA 3Q4TA 5IA2A 4EH6A 3LCTA 4LV5A 4CVAA 2IVUA 3MFUA 2F4JA 1BYGA 4EOIA 4MNEB 2IZRA 4GK4A 3H10A 4UXQA 4TKSA 4DEBA 1W84A 5H8EA 5IU2A 1UWJA 3WZDA 4M12A 5GZ8A 4R1YA 1F3MC 5A9UA 2NPQA 3LFDA 4AZFA 5GZ9A 4B8LA 2XUUA 4YC8A 4PRJA 4ZIMA 2FSLX 2CDZA 3R7YA 4JAJA 3N9XA 3QA0A 4TW9A 3W55A 1WMKA 3COHA 1JR3E 3K54A 3PE2A 3QTIA 4FE2A 1KOAA 2WTIA 3E62A 2BVAA 1FBNA 5HU3A 4EK6A 2AYPA 4S31A 3CGOA 3CEKA 5EDQA 1I44A 5DT3A 4ANQA 3GU6A 3IW6A 5LMBA 3NUSA 3LLTA 1GZ8A 3G5DA 2OU7A 3LXNA 3ULZA 4AF3A 4BDFA 5A54A 3VBTA 3TACA 5KMOA 1UA2A 4FSYA 5HBEA 3DZOA 3F2RA 3C4FA 2B9HA 5JGDA 3U6HA 2HELA 4FG9A 5CENA 3TDWA 4GYGA 4CD0A 2OBJA 3HGKA 4ZEGA 4ANOA 1YHWA 2XA4A 2VZ6A 2V62A 2X7FA 2BIKB 4ZY4A 4EI4A 5E8VA 5HQ0A 4M8TA 3TUDA 3NPCA 2WIPA 3D7TB 3MVHA 4I6HA 3UODA 5JGAA 2OLCA 5CZIA 1XHAA 1KE8A 4WG5A 5GIOE 3EQIA 4C4HA 5DIAA 3HUBA 3MN3A 4WG3A 5FBOA 4CSVA 3KRXA 3NNXA 4EK3A 5J1WA 4N0SA 2FH9A 5IEVA 3HA8A 1IM2A 4RZVA 4YHFA 4D0XA 1TVOA 4I0RA 4BDEA 1APME 2YDIA 4FTOA 4XG7A 4D0WA 3C1XA 3QBNA 4OAUC 3PZEA 2O3PA 2FGIA 4J99A 4FZDB 3WZUA 2DQ7X 4BCFA 3ID6C 3EQFA 4CFMA 3PJ3A 4C62A 4FKVA 2DAKA 2IW9A 4GT3A 5CALA 4JDKA 4CRLA 5HNBA 2XRWA 4CCBA 4LOPA 4XX9A 2W99B 5FEDA 5IUGA 3CE3A 4DCEA 3GXLA 2XKCA 1YXTA 3WF5A 1OI9A 2F2CB 5AUYA 2HAKA 4F1OA 5BYYA 4JIAA 4J97A 3UOJA 1WIVA 3EMGA 3IS5A 1H28A 4FTIA 4GL9A 4R3PA 5AR3A 3VS5A 4I22A 5TOZA 4KB8A 2OH4A 1WVWA 2EB3A 4IFCA 1LUFA 2BKZA 5J7BA 1FOTA 3R1SA 4LL0A 4ZSJA 4ANBA 1PGYA 5M53A 3P7AA 4WNKA 4PUZA 4RFYA 2A1AB 5FXQA 2BZIB 2CGXA 4RWLA 4C4IA 1AGWA 3KXGA 4JBVA 1XBAA 2R3OA 5DR6A 4CFXA 2E9VA 4CMOA 4HZRA 4ALVA 4O6EA 4H05A 5EG3A 4X2JA 3A8XA 1K3AA 1XH7A 3WYXA 5HO7A 2XIKA 2ETRA 3C5IA 1ZYLA 3KA0A 3W16A 2R3GA 5KBQA 5J1VA 1PXKA 2E9PA 4IVCA 5GJGA 4DC2A 1UKIA 1XWSA 4G3OA 5I9UA 1NV9A 2UVZA 3HKOA 3KCKA 5JMSA 4YBKA 3Q9YA 5J8IA 2P2IA 3HX4A 4MWHA 1L8TA 2ETKA 2W05A 4A9UA 2IG7A 2C6EA 3O8PA 5AEPA 1J7UA 4XHKB 5GIPE 2DNAA 4M68A 4RX9A 1JKKA 5BYLA 4DEIA 2W1IA 4O7SA 3NCGA 5M55A 1VEKA 4O22A 4BKYA 3RAIA 2P0CA 5D10A 2PE0A 5ANDA 2ZM1A 4L3PA 4YO4A 3OCTA 4J7BA 3ZC6A 3V5WA 1H4LA 2WOUA 3FLQA 4GVJA 4JG8A 4ID7A 3QD4A 4U43A 4DH8A 3ZUUA 4MWIA 3R8UA 5GINE 4CXAA 4A7CA 4F1TA 4PNKA 2YCQA 3EL7A 1Q3WA 4LQMA 3FQSA 4QRCA 4ZJVA 4Z3VA 3PE1A 1PW2A 2VTHA 3ACJA 4Y8DA 4UZDA 2XYUA 5EI2A 5B7VA 5CEPA 2BRNA 4DFBA 2B9FA 5LCKA 1REKA 2CPKE 4BCPA 4RQVA 3UOKA 2YZAA 2DYLA 4W4VA 2R0IA 2DAEA 3M1SA 4XNEA 4DAWA 4DITA 5CNNA 3T9IA 2ERKA 4JR7A 5C8NA 3FJQE 3NUUA 4D5HA 4EH7A 3OWLA 2EWAA 2ITNA 2PYWA 2CN8A 4IZYA 4IAAA 3QKKA 1DV0A 2UZDA 3CTQA 2FUMA 4KINA 5HE3A 4V04A 3S2PA 3R7UA 4U3ZA 4GRBA 3GC7A 5K4IA 2QO2A 3LKMA 2QU5A 3LQ8A 4L01A 3VWAA 2ITWA 2WNTA 3V6SA 5L2TA 4IAYA 2XNEA 4M69A 1OIQA 4FTNA 5HLWA 1WAKA 2Y4IB 4XV1A 1M14A 4QTDA 1OAIA 3Q2MA 3R9HA 4MVFA 5TO8A 4FMQA 4TWPA 4GFMA 4YZDA 1NV8A 3LIJA 4FV3A 3S4QA 3IGGA 4IX6A 5JN2A 5DA3A 4NU1A 3LMIA 4I21A 3VBVA 1YQJA 3LCDA 4NK9A 2R3NA 3PSDA 3QLFA 3GLHE 3G6GA 2WTCA 4QP2A 4RX7A 3Q9ZA 4UMTA 2GNJA 3VS6A 4XRLA 4AZSA 4MTAA 2WPAA 5BPYA 3RALA 4ZSEA 2A0CX 2PVHA 3NIZA 2A27A 3BI6A 3VBWA 5LVOA 3R0TA 4EWQA 4FL1A 4HGSA 2J0MB 3W2RA 1OL2A 3I0QA 3HVCA 3MPAA 2R3JA 3TV4A 5CVHA 4FEWA 1H1QA 1H25A 5E4HA 4LMUA 4YJTA 3OUNB 1U59A 5IUHA 3CC6A 4P5ZA 5FWKK 2PVRA 3GT8A 3W1FA 4CFNA 1PRYA 1PXOA 2X2LA 3TJDA 1G8AA 1FQ1B 3QC9A 5ETAA 4HW7A 3JY9A 2PVKA 2WKMA 4X6QC 4Y95A 4EORA 3WOWA 4FTMA 4D9UA 3AGLA 1PXPA 3QTRA 3R7GA 5E8XA 4FBXA 4MX9A 3R1YA 4QMPA 4XCUA 4C36A 2B3TA 2C6DA 2CKQA 5EYDA 2BZHB 4QMQA 4J52A 5HVYA 4NFMA 4WNMA 4DT8A 2BRGA 4GMYA 3EYHA 1OUKA 3FPQA 4HVGA 2F7ZE 3L9MA 3ORKA 4JOAA 3WF7A 1O6KA 4AA5A 3RNYA 3QCYA 4OBOA 2C6LA 2X8EA 3N4UA 5IH4A 1JSTA 4FICA 4Z7GA 4ZLOA 3M2WA 4I5HA 5E90A 2QG5A 4UZHA 1KYIA 1VJYA 4R7IA 4BZOA 1Q5KA 5I0BA 1AD5A 2HW6A 5M09A 2QOBA 4UY9A 5HOAA 2CSNA 1RE8A 3C13A 3E87A 3MA6A 3WZKA 3UIUA 4DLIA 3POZA 4MNEA 1GZKA 1P2AA 2QONA 4A9RA 2ZB1A 1YOLA 1OM1A 4ALWA 5KMIA 5LWMA 3HL7A 4K9YA 4DINA 5C9CA 3GUBA 1WZYA 4MXOA 4D2SA 3CTJA 4NIFB 3MFSA 2YCFA 4OT5A 1GOLA 1HCKA 4GUEA 2ITZA 4IBMA 4X3FC 3ENHA 3LFQA 4UB7A 3UVRA 3E8DA 3IO7A 5DBXA 4Y72A 4NCTC 2J0LA 4XEYA 4L00A 3QFVA 5AM7A 4DEGA 3G90X 2LVAA 5CAOA 3ZFYA 3FLSA 3QTXA 2XKFA 3D5WA 4EOSA 1WVXA 2C0OA 3KXXA 3P0MA 4U45A 3H9FA 2XBAA 2G2IA 3GOPA 2QOIA 3AMBA 3OP5A 2C6TA 2R3PA 1XH4A 3QTSA 4IB0A 1MRUA 1WBSA 5FLFA 4PTGA 4GW8A 3I60A 5M4UA 1YW2A 3AC3A 2VTRA 3OXTA 2ZTDA 4U5JA 4W8DA 4FGRA 2XCHA 5DPVA 4C4GA 1WBVA 5DFLA 2PMIA 3DBEA 4E6AA 4ZSGA 4DFLA 4O2PA 3DKCA 4AT3A 3QX2A 1ZMVA 2XIYA 3OD6X 3UPZA 4AGDA 2B55A 3Q2JA 4FV9A 3U8WA 1JQHA 3NX8A 3QGYA 4MD7E 4EONA 4FTRA 5CU0A 2W1DA 4WHZA 3RK9A 2XEZA 2OJFE 4LYNA 5BYZA 2C30A 1IA8A 2PVMA 3EKKA 4QP7A 1JWHA 2YJRA 5ACBC 5KUPA 4E26A 2W4OA 3FHRA 3WARA 2ZDUA 1UKHA 2A2AA 4EQMA 2DAIA 2PUUA 3S1HA 5AUUA 4WNOA 2G2HA 5CF6A 5AM6A 4EH5A 4G6LA 3HMMA 4N6YA 2DI0A 5IG1A 1A5TA 5AP7A 2ZDTA 4XG3A 2MGWA 4C7TA 1F0QA 3KU2A 2OWBA 3A8WA 5AUXA 3UPXA 2X2KA 3DPKA 4FTJA 4EYMA 4RJ7A 4MKCA 4DTKA 5IQDA 4IC7A 2VV9A 3UG1A 4EBWA 4H36A 4I0TA 4YJSA 3UQGA 2GHGA 3G2FA 4MXAA 3ZUTA 3NYVA 3SQQA 3MYGA 2VTMA 5I9YA 1UWHA 2X4ZA 4X2NA 4GG7A 2YWVA 4KS7A 4AX8A 3HP2A 3L8PA 3T8OA 3ZO4A 4J8MA 3TUCA 2PULA 2ZTCA 1OIYA 1ZZLA 2WIHA 5K4JA 5HG8A 3VS3A 1OITA 3E5AA 1OPJA 4L8MA 3UIMA 4ASDA 4FIEA 2WGJA 4KS8A 3BPRA 5IQIA 4TYIA 3VW8A 5KNJA 4IJPA 4M15A 3R7EA 1AIPC 5B0XA 4BL1A 2VNWA 2QOQA 4BTMA 4M7IA 3G51A 4RVKA 4R1VA 3TIZA 2PZYA 2BZKB 1Z9XA 1HT1E 2DAMA 2PZ5A 4AW2A 1UU7A 4G3CA 4HCVA 5EM6A 1L3RE 2GQGA 2H34A 5D9HA 1QMZA 3F92A 4G6OA 3Q52A 5CU4A 4TZRA 3WF8A 1JSUA 2Z60A 5AUWA 4BCNA 5A46A 3HAMA 3LCOA 3RPOA 2C1AA 2OJJA 4F2LA 4ZY5A 4V0GB 5FDXA 1UFZA 4FKRA 5M4IA 4DGLC 4PTEA 5J7HA 3ALOA 4PMTA 4QYYA 4IHPA 2R7IA 4FUXA 4HYHA 5EYCA 3Q6UA 1GZNA 4RFZA 3KGAA 4BTFA 5KKRC 5IDNA 3PJCA 1QPJA 4FOBA 3FKNA 1NVQA 3JY0A 3KF4A 4HCTA 3KVWA 3NW5A 5HE0A 3HMNA 5K5XA 3UYSA 3EIDA 2EKFA 3GFEA 3FMMA 4TN6A 5A3XA 3TNWA 3W8LA 3U87A 3AC1A 4YJVA 1RDQE 4DE4A 3RWPA 5CEOA 2GHMA 4Z16A 3DJ5A 3V5LA 5L6PA 4Y73A 3KEXA 5FRIA 2DZLA 2IWIA 3V8WA 5IA3A 3QQGA 4PMSA 3R8ZA 1A9UA 2PUPA 5CQWA 5JZNA 2WMTA 3QCQA 4I6BA 4YR8A 2EB2A 4C33A 4PX6A 5BUEA 3ZRLA 3NR9A 3UNJA 1BX6A 4C59A 1FVRA 2XK8A 4TT7A 1R4GA 1U54B 4XS2A 3R83A 3UO6A 4EJ7A 3PLAE 5EDRA 2HY81 3OWJA 2HZ0A 4EL9A 4RFMA 4CZUA 3WILA 4FA2A 4TYEA 5DI1A 2QOKA 2QO7A 4WBBB 4CCUA 4HGTA 4QQCA 5T6KA 3SD0A 4WNPA 1YHVA 4UMUA 4IB3A 2K0BX 3PPJA 2X9EA 1NXKA 5HGIA 2JDRA 4O7ZA 5AA8A 4ZY6A 4CNHA 2B9JA 4D58A 2Z7LA 3U6IA 4FIJA 3UVPA 1QPDA 3FMKA 3GVUA 3SX9A 4C57A 5HZNA 3FQHA 3BU3A 3QC4A 5BVNA 4PNIA 4YJRA 4FI1A 3KMUA 4NTTA 4ACMA 3ZOSA 5K9IA 4E4XA 2CNUA 2FSOX 1ZOGA 4XV3A 2OZAB 4U3YA 2AUHA 2XM9A 2Y4PA 1IR3A 4MBJA 4K33A 3QUPA 2R2PA 3HECA 1OB3A 4DGNA 1H1RA 3EN7A 3KCFA 4HYIA 3QKLA 1S9JA 2Y8OA 4U41A 3PY3A 4JI9A 2I0EA 4GK3A 5AWMA 2VWXA 2QR7A 4GEOA 2CNVA 3JVSA 3AC2A 4FZFB 4OT6A 4A07A 4G34A 4IZ7A 3RWQA 4IH8A 1BI7A 2JY5A 5CSXA 2UW8A 3GU7A 3P79A 5KMLA 2Z2WA 3QZFA 4TYHB 1ZXEA 3JS2A 3VUGA 3GGFA 3GC8A 5JGBA 3KXHA 3NRMA 3PIZA 3EQHA 2QHMA 5CNOA 3GU5A 2HWJA 4CKRA 4TNDA 3MFRA 1KV2A 4ITHA 4XG6A 4BCJA 4FV7A 4C61A 5C8MA 3WIKA 3LXLA 1K2PA 4NSTA 4U42A 4FIHA 2IPXA 2IZTA 2UZWE 3FMDA 4J95A 4YTCA 4FVQA 4O0SA 5CSVA 3UO5A 4RIWB 3WYYA 3U54A 4YTIA 3R8VA 5DG5A 3BEGA 2HZNA 3H0ZA 3I81A 4TYHA 4CQEA 3BX5A 1GIJA 3PP0A 2HXLA 3ANQA 3QRIA 3FMEA 3Q4CA 4FEQA 5JH6A 3OOGA 3LJ0A 1PJKA 2PVJA 5H2UA 3HRCA 2BRMA 5AUTA 3OG7A 4NWMA 3F5UA 4ENYA 1SNUA 5IH5A 1JBPE 3PG3A 4RVLA 4APPA 4E7WA 2RRUA 1M17A 4IW0A 4FV4A 5JK3A 3PDTA 2GS7A 5A4CA 4JJRA 4UEUA 1R1WA 2C5VA 3Q9WA 3VIDA 4W9WA 4F64A 5CF8A 2QR8A 3MH1A 3ENMA 3UYTA 1WBOA 4F7SA 4ZOGA 4MAOA 3G6HA 2J90A 3SA0A 5KMJA 4KWPA 4CZYB 3R63A 4L9IA 2FB8A 2WMQA 4QP9A 4WSYA 4E1ZA 3PRFA 3L9LA 4TTHB 4EH9A 1H00A 2WMBA 4KIOA 4P7EA 3PXQA 5HBJA 3MPMA 3C51A 3HAVA 4ZK5A 4HCUA 2JKKA 4DTAA 1J91A 4NJ3A 2R3KA 1O6LA 4FKOA 1OKVA 4C4JA 4PDOA 2YCRA 4KIQA 3IKAA 4LG4A 4M3QA 3OWKA 4DG2E 3R1NA 2JAMA 5IQBA 2JY8A 4F09A 1FGIA 5F95A 4RZWA 2R3IA 3LZBA 2YIWA 2QI8A 3CXWA 3F69A 2XEYA 4HVDA 5HVKA 5HCYA 4E5AX 1R3CA 5CZHA 4BCHA 5TR6A 4IX4A 2BWBA 4ZAUA 4X3FB 4AT5A 3A62A 3K3JA 3ZRKA 3MMPA 4RWIA 2ZAZA 3SC1A 4HEOA 2QU6A 1OMWA 5HESA 2J6MA 4AN9A 3ZH8A 2PZPA 2JEDA 2V7AA 2OJIA 3C4EA 3ZO1A 3QX4A 1YDTE 2C3JA 3KN5A 2OXYA 4EOJA 3M42A 5BVEA 1Q62A 1ZYDA 2UZOA 4QMSA 3H4JA 2DENA 3D83A 3RAHA 5A4TA 2JKQA 2V0DA 3HV6A 4PTCA 4UYNA 4FTUA 2F9GA 3NYNA 2KNAA 5AP3A 5E8TA 2YAAA 2CJMA 3RVGA 3ZM4A 3UQFA 4GV1A 3EL8A 5K0XA 2MROB 2UZTA 2XMYA 4MBIA 5HCXA 3JYAA 3UP7A 4AOJA 1I09A 3EQBA 3PXYA 3HLLA 2LVPC 3BIZA 4U8ZA 3NW6A 3KXMA 4WKQA 4UN0C 5BVWA 3VBQA 3ZS5A 3FWQA 4XP3A 3G15A 3C50A 2RG5A 5L2SA 3HNGA 1CMKE 1CKJA 1ZY5A 3IW4A 4FKSA 5EM7A 4U97A 4V05A 2C0IA 3A7IA 3NZ0A 4IC8A 4IWOA 1YXSA 4ITJA 3RAKA 3ZTXA 2BILB 3BLHA 3K9OA 3I79A 4DF3A 3VHKA 1CM8A 2OIBA 4UN2B 2KULA 2PVNA 5HNIX 5HTBA 4QT1A 3QQUA 2RKUA 1ND4A 3BHUA 2I40A 1ERKA 1EH4A 1JKTA 4G3EA 2B1PA 3RPSA 4V01A 5F4NA 2WMSA 3FC1X 4OLIA 2JY7A 4PF4A 1Y6BA 3DLZA 4OTQA 4F6WA 4DGMA 4UMRA 5DMZA 1MRYA 4GT4A 5JT2A 1DO2A 5CVGA 4NM7A 3KKVA 4YLJA 1UNHA 2X6EA 1KUTA 2JIIA 3LAUA 3WE8A 3KC3A 5F20A 4GFGA 2XK7A 5IQHA 3RI1A 2J4ZA 2YLEA 4NFNA 3E8EA 2C6IA 4UALA 4PDYA 5EH0A 4ASZA 3EZVA 2B4SB 2R3HA 5CSPA 2FSMX 3OBGA 4GS6A 4JT3A 4L45A 5F9EA 5CU2A 3PP1A 3EH9A 4JS8A 2RL5A 5FTQA 3L9NA 3S95A 4FV1A 4DN5A 3NS9A 5FP6A 4DFUA 2I6LA 4M67A 5GNKA 3VUTA 4Z55A 5BVDA 4F6UA 4BDKA 3MH0A 4S2ZA 2P3GX 2DS1A 5DN3A 1GIHA 4HPUE 5IQCA 5M06A 3QGWA 2WEIA 5I3OA 2DAGA 1P14A 5L6OA 4M0ZA 4XLIA 1H24A 3BBWA 3BBTB 2NRUA 3PVUA 4CEGA 1IRKA 2P2HA 3UMWA 2UUEA 4JBPA 1OTRA 3W2OA 5LCJA 4ZZOA 2WAJA 4KRCA 3LMGA 4UMPA 4LGHA 3QRJA 4XOZA 4DGOA 3B8RA 3UTOA 4NW5A 2EXCX 2WQBA 3OS3A 3BWFA 2A19B 2WEVA 2XNBA 1Q8ZA 5L8KA 3E88A 2CCIA 3MDYA 2XNOA 3AXWA 3NNUA 3O71A 3NAYA 3F2AA 3AQVA 1U4DA 3NUNA 4RJ5A 2VWYA 4X3JA 3F88A 4F1MA 2Z8CA 5D41A 3GP0A 5FBNC 4DBNA 4F63A 5B2MA 1IASA 4LUDA 2QHOB 1OIRA 3QTUA 4XV2A 2OGVA 4EHVA 4JG6A 3TV7A 1J1CA 1GIIA 4FTKA 4J98A 3P23A 3TNQB 3ELJA 5DYJA 4WT6A 2VD5A 3TKUA 4FIIA 3VAPA 4Q5EA 1XB2B 3RM6A 5E1EA 3II5A 1G41A 3PVWA 5C4LA 3SG9A 2YIYA 3MH2A 4CKIA 3KULA 4F9WA 4EOQA 4FKPA 3DU8A 3R9DA 5KHWA 1CUKA 1UU3A 5AX9A 2Y6MA 4CQGA 4S30A 4QYGA 4A4OA 1GNGA 2PUIA 2WELA 3QZHA 1URWA 4FYNA 4EZ5A 3TZ8A 3NW7A 4K6ZA 1O9UA 2W1CA 2PVLA 5DLSA 2XK9A 5AV3A 4IACA 5C01A 1PHKA 4JR3A 3QTQA 4FV2A 2EUFB 4RJ4A 4HVIA 5E9EA 3ZRMA 3EZRA 4D4YA 4KA3A 4C3RA 2GTMA 3GLGE 3R1QA 5CAUA 1VYWA 2ITQA 1H08A 4I6QA 1Q99A 2OIDA 5T3QA 3PIYA 2YWPA 2BAQA 2CLXA 3PVGA 2OXDA 3FPMA 2GNHA 3SV0A 4BI2A 4BVUA 3G9NA 4GK2A 4QQ5A 4PL3A 2XIXA 3U9CA 1KOBA 3NYXA 2VX3A 4L44A 4EHEA 2O25A 4FV6A 4RC3A 3ZZEA 2VTQA 3K3IA 4TWOA 4TPTA 4XMOA 3LFFA 4TXCA 2VX0A 4AP7A 2PZIA 3MVMA 4DGGA 3QL8A 4JRVA 2NNWB 2BCJA 4I93A 3MGYA 4TY1A 4AFEA 4XYFA 1YI4A 3AMAA 3ZSGA 1E94E 2J2IB 4AT4A 1H8FA 4J53A 4U79A 3V01A 3LOKA 5LQFA 2WMRA 3NGAA 2R0UA 4BZNA 1UV5A 1V1KA 3Q4ZA 3DQWA 3D5XA 4FSWA 3E64A 3DBQA 4QMZA 4TWNA 2B54A 2VU3A 4IADA 3OXIA 4QP3A 3BZ3A 4FKTA 2LTUA 1ZOHA 4F08A 4GUBA 4JLCA 4YJPA 3GCQA 4PL4A 2XBJA 4YHJA 3Q53A 3DTCA 1R0EA 4O82A 4LRJA 4YO6A 2HENA 3HYHA 5CSHA 4AZVA 2C6OA 3MBLA 3D9VA 4GU6A 3G9LX 3VS0A 3E3PA 4N4SA 4GVAA 4NEUA 3LVPA 4HZSA 5EI6A 5JZJA 3RPVA 1Q4LA 3E46A 2WMAA 2CN5A 4Q5HA 3HRBA 1A48A 3BHHA 4AWIA 1DO0A 3WIGA 5LMKA 1YRPA 4AW5A 3C4XA 2G1TA 2XKDA 2PWLA 3LXKA 2QLUA 1DAYA 3ZO2A 5D11A 3O0GA 1W8CA 1OVEA 4ACHA 1QCFA 5HX6A 2HCKA 3DBFA 5J9LA 4J71A 4UWBA 2XK3A 4MH7A 3BV3A 2R7BA 3PXRA 4NKAA 4PDSA 4C4EA 3E3BX 4FT5A 5I9VA 3B8QA 1PXLA 2BIYA 4IJ9A 2IN6A 4G3DA 4F9CA 3L9PA 2VUWA 1WCCA 4H3QA 3DXQA 3QD2B 5IISA 3D0EA 1OL6A 4RIXA 3VJNA 3OW4A 4RA5A 2W17A 3I1AA 4P5QA 5CF5A 3IOKA 3AC4A 3F5PA 5HO6A 4S32A 2UW4A 3U4UA 1LPUA 4MNFA 4DEEA 4QMYA 4KAOA 1PXIA 4NTSA 3DXNA 1URCA 2JD5A 4WG4A 5IA0A 3KMMA 1P4OA 3N4TA 3RCDA 3HDNA 4O0UA 4L46A 5BNJA 3AT3A 3JPVA 3QYWA 1BVSA 2PVYA 1YXVA 2YM3A 3TN8A 2CKOA 3VUIA 5KMMA 5ETFA 3FI8A 2W1ZA 3VF8A 1Q8WA 3ZLYA 3HV7A 3L1SA 1WBNA 2W4KA 1JOWB 3KFAA 3OT8A 4GU9A 3PY0A 4RIYB 2GFCA 4XG8A 3SXRA 4AQCA 4WBOA 4C4FA 4E4MA 2HIWA 3ZSIA 3L8SA 4O91A 5BUJA 3LCSA 3K5UA 5K0KA 4BDHA 3VS7A 3R02A 3BHVA 5CQUA 4N57A 4NL0A 3COIA 4RIXB 2NP8A 2WHBA 4O7WA 4OW8A 3IGOA 3CJGA 3FL4A 3C5UA 4OTGA 4E5BA 3VN9A 3MB6A 5FQDC 3DCVA 3CPCA 3QQJA 3DT1A 4BIBA 5HD4A 5HIEA 3KREA 2Y4IC 5KO1A 1WHCA 3TIYA 1JAMA 2W5HA 2WXVA 4RWKA 3O96A 2L2DA 4FTAA 4IEBA 3IPHA 4ANMA 5C4KA 3NUXA 5DR2A 2I1MA 3DB8A 5HIDA 4KBCA 2IZSA 2FA2A 1TR8A 2ONLC 3QCXA 3DZQA 3TI1A 4D2WA 3E8NA 2X0GA 1PXMA 3R71A 4R6VA 4XG4A 3ORIA 4APCA 4F9YA 1OKYA 3NUPA 5AAEA 3ATTA 4BWKA 3CTHA 1H26A 3EFLA 1STCE 4HYUA 4O21A 2P33A 3W2PA 4MCVA 4D1ZA 5JSMA 2G15A 5EDPA 2XNPA 4ZTQA 2VX1A 3OY1A 3RTPA 3MFTA 4BIDA 4A4XA 4KNBA 3U55A 1PMUA 4IAZA 5AR5A 1DM2A 4AU8A 4B8MA 4BCIA 3DA6A 5M51A 4QD6A 4XH6A 4PDPA 5HNGA 3ZONA 4FODA 2WMWA 5GHVA 5LMKC 1DI8A 2BHHA 2W9FB 4RJ8A 3Q3BA 1M7NA 4QP8A 4X0MA 3AC5A 3POOA 3EB0A 4O0XA 5AJQA 5IDPA 5M08A 2XRUA 4FVRA 5J79A 2ZMCA 1Y91A 3ETAA 4IZAA 3RZBA 4ZTLA 1CTPE 1M52A 2E9OA 4IWPA 3V5JA 4R5YA 1YWNA 5FEEA 3RBWA 2F2UA 3F6XA 4JRNA 2BALA 3CJFA 1OZ1A 2R3MA 4EZ3A 4U6RA 4JBQA 3LJ2A 2VTOA 1V92A 2C5XA 3CD8A 3P7BA 2L4FA 2RFEA 1Z5MA 5HG5A 4I92A 3WZEA 4IFGA 2JKMA 4YUQA 4UX9A 4IANA 5EQPA 3ZDIA 3BWJA 2R4BA 3T9TA 3ODZX 1SVHA 2KNZA 3A7JA 3VQHA 5K5NA 3KRJA 3V5PA 2JGZA 2W4JA 4ANSA 1FGKA 3DXPA 5D7VA 3U9NA 2VTNA 4E20A 4RPVA 4I3ZA 1M2RA 1T45A 5AR7A 3V04A 3UOLA 3KRRA 2O8YA 1JPAA 5EI8A 4E73A 2LVNC 3LM0A 3Q5IA 2X4FA 3OCGA 1EFUB 4XJ0A 4EBVA 5A4LA 2DWBA 3F82A 1G3IA 5CTPA 4H3PA 3ET7A 4EC9A 1SMHA 2VO6A 3BRBA 1XH8A 4L6QA 2ITPA 4NW6A 3TTJA 1XH5A 3ROYA 3BYUA 3NMUF 3BYSA 3I6UA 2G9XA 2JZ0A 2AC5A 2V5QA 5K3YA 3HV5A 3ZM9A 3EJ1A 3SRVA 4V0GA 2OXXA 3QKMA 4H1JA 4MQ2A 2H5XA 1X8BA 4MD9E 4UYAA 4LFIA 1NVRA 4OBQA 3R30A 3VUKA 3FYJX 3FMNA 2RSVA 3D2KA 2BRHA 5AP5A 1SZMA 5HVJA 4BICA 4DH1A 5CI7A 1OPLA 3AD6A 4D2RA 3O7LB 3L8XA 4AACA 4B7TA 4QYHA 1BKXA 1SG9A 2R9SA 2X9FA 2Z7SA 3LFAA 4IWQA 4O0RA 4OTPA 3ZDUA 4E93A 1UNGA 5CEMA 4WRSA 4J8NA 1M2QA 5ANJA 3RPYA 2OKRA 3TG1A 2JP7A 4LMNA 4C3FA 4IM3A 4R71A 4K77A 4PPBA 4EYJA 2B53A 3HZTA 1BL7A 4ERWA 2FO0A 3UDBA 3OF0A 3GCSA 1Y8YA 4IMYA 4M66A 1W83A 4KBKA 3KN6A 4RWJA 4YTFA 2YHVA 4O96A 3ZEPA 4HJOA 3OHTA 4YMJA 5HTCA 5A14A 4N6ZA 2C5NA 2XF0A 2BROA 1JSVA 1JKSA 3BLQA 4I23A 5D1JA 5EQYA 2VTJA 3MJ2A 3FRIA 3IDCA 2PMNX 5KZIA 4DEDA 3TNPC 3PRIA 3DBDA 5EHOA 3SLSA 3FI4A 3TKHA 1Q97A 3UC4A 3DJ7A 5L2WA 1OUYA 4FG8A 2R3RA 1OL1A 1VYZA 5E91A 4A06A 4ZP5A 3ORNA 4JDIA 3ZEWA 2YACA 3F5GA 1FVTA 2ZV7A 3AD4A 1LEZA 2F7XE 4OAVB 3BHYA 5H3QA 4FSUA 4FNYA 2A4LA 5E8UA 5AP6A 4OTWA 5DEYA 2YM6A 4NM0A 5LARA 4BFMA 3EQRA 1XKKA 3TDVA 2ZMDA 5EYKA 2E9NA 3I4BA 5DVRA 4EKLA 1TQMA 4PP7A 3E7VA 3CGFA 5CXHA 2MJ5B 2G01A 2OZAA 3DKFA 4DG0E 5I9XA 4FEXA 3MB7A 4CRSA 2UZLA 2CP8A 2UZBA 3VHEA 3T3VA 5M57A 1VEJA 3FDNA 3ZLSA 2UW6A 2PK9A 3AG9A 3R28A 4F4PA 3WBLA 1KV1A 2ZJWA 3HUCA 3EHAA 3ORMA 4JXFA 5L6WL 3EYGA 4IVAA 3FQEA 3VBXA 2XK6A 3A4PA 2OZOA 2W5AA 3MVLA 1PY5A 1W7HA 3RCJA 4HOKA 3A4OX 1ZAOA 3AT4A 3ZO3A 4USDA 2YM8A 5JEBA 3KULB 3D4QA 3RP9A 3GEQA 1ZARA 2R3FA 3VUMA 4EH4A 3TUBA 2O5KA 2C3KA 2HZIA 3NCZA 4LL5A 3EN6A 2YJSA 3AT2A 2QG7A 3TZ9A 4LOOA 4X3FA 2GNLA 3AOXA 2YLFA 4NJDA 2YITA 4EK5A 3O17A 1YXXA 5HIBA 2HWOA 3LFSA 1OQYA 1Q02A 3SHEA 4BDBA 5L8LA 2QD9A 4Y85A 4FT9A 2RIOA 3LXPA 4BC6A 4FKUA 2XIRA 4GT5A 3P08A 4AGCA 5HLPA 3DY7A 1ZZ2A 3QXPA 4QPAA 4CG8A 2VWZA 4M13A 4H3BA 3MVJA 4RJ3A 2GCDA 1P3QQ 2ZM4A 2VTTA 3FV8A 2LVOC 4QYEA 5GJDA 4O81A 1FMKA 4JL9A 5IA5A 5DRDA 4LRKA 2UVXA 3ZLWA 4FTQA 4B4LA 1KE9A 2VO3A 5TE0A 2GNGA 3LQ5A 1P4FA 4X2GA 4KKGA 5CU3A 4DT9A 3TJCA 4BGGA 1F4IA 4FT0A 4YSJA 2PHKA 4ENXA 2QLQA 1QPEA 3AD5A 3C4ZA 4W4XA 4EC8A 4B6LA 2IJMA 3CY2A 3OEFX 3QUDA 2WTVA 4RVMA 4BWXA 3W2SA 5C26A 4QMTA 3NDMA 5H9BA 3DLSA 5CS6A 2KNVA 3IW8A 1MN3A 4HGEA 3UZTA 3I6WA 3LFCA 2XJ0A 2BRBA 2ITOA 3DAKA 4D2TA 3ACKA 4NT4A 2QC6A 3OEZA 4W4WA 5CAPA 4YZNA 4QPSA 3OC1A 4WD5A 3V8TA 4ZS4A 3CIKA 3F66A 4FKIA 5M4CA 4GJ2A 2C3LA 5M56A 3ZHPC 4AZEA 3UNKA 2GQSA 4CV8A 2YISA 4DYMA 2PMLX 1XH6A 4QMNA 2OF4A 3BYOA 1YVJA 4M14A 5CSWA 1R78A 3UC3A 1M2PA 1TKIA 4XP0A 1WGNA 2OFUA 4EOPA 3N51A 4EWHA 5EKNA 3PFQA 3QUEA 2VTAA 1U46A 3BQCA 4U7ZA 1OKSA 2G3QA 3LE6A 5AFVA 4IAKA 4YJUA 1SNXA 3CBLA 5DRBA 5IF1A 1XR1A 1NVSA 4F7LA 3GC0A 1VDLA 4L52A 3W2CA 5EHYA 4D4VA 3NLBA 2JY6B 5ANOA 3ZLXA 3F61A 4DFNA 1U54A 3EN9A 5LOHA 2VTSA 3PY1A 5DGZA 2O64A 3C4CA 2UW7A 5IMEA 2YZLA 1MQ4A 2BDWA 3ZZWA 4M84A 1PYEA 4X2KA 4EH2A 3R9RA 2BTRA 2WTKC 4OTRA 1GAGA 1Q41A 4QO9A 2CCHA 3ZBFA 4D4RA 2O65A 2HYYA 4EOLA 5IQAA 1IEPA 3VRZA 5IA1A 5KMNA 1ZV1A 4KD1A 4EK4A 4FEVA 4DFYA 5BQ0A 1H01A 4XG9A 4F65A 3NUAA 4BHNA 4CG9A 2Z02A 4F9AA 4EH8A 2YIQA 3O7LD 4O0TA 5C27A 4ZZNA 5EK7A 4C34A 2PPQA 4CMUA 4OTDA 4BIEA 3BBZA 2YEXA 4M97A 4MXCA 4ZTHA 3MH3A 2IW6A 3DDPA 3W32A 1UNLA 3BELA 2VWVA 2YM4A 3OBJA 3FLZA 3JXWA 1YDRE 4ZLZA 2OFVA 3QQHA 1J1BA 2QO9A 2QODA 4LUEA 4PMMA 1H0WA 4IDTA 5FGKA 4D2VA 4F7JA 3DTWA 2SRCA 4W4YA 3CQWA 4USFA 4RSSA 2IO6A 4WO5A 2RGPA 2YIRA 4QMLA 3NNWA 3QA8A 1NT2A 1NW1A 2G2FA 4WIHA 2JC6A 2ZV2A 3VULA 4I41A 4BWPA 4YSMA 3IW5A 4FZAB 2QHNA 4XOYA 4C02A 2I0VA 3FSFA 5CLPA 1Q8UA 5TF9A 4D1XA 4EEVA 3LFEA 4AGUA 5AP0A 4I24A 4G31A 2IW8A 3SXFA 4BR3A 3E92A 2OO8X 3DS6A 4BDIA 5HE1A 2C3IB 3LMHA 3TWJA 1WBWA 4FF8A 4Y5HA 3SGCA 2OF2A 2WFYA 3FKOA 1H07A 4QMXA 3P9JA 3C4WA 2Z7QA 4ZTRA 3VVHA 4FSNA 4DH7A 4BZDA 3PJ8A 2JKOA 5AUVA 1BL6A 1R39A 4G2FA 3TZMA 4AXAA 3HEGA 4BCOA 1FVVA 5I4NA 4ANLA 4XRJA 3QTWA 3C7QA 4LRMA 1OIUA 3R7IA 5IQGA 3E8CA 4G16A 4TYGA 4IIRA 3MSSA 1OKZA 2PVFA 2W1FA 4U40A 3JR1A 4BB4A 4NIFA 4PY1A 3OTUA 1DS5A 1UU8A 5IQFA 5CT7A 4BDAA 5A4EA 5JQ8A 3FI3A 5GJFA 4E8AA 4FKGA 5E92A 3TKIA 4ZSAA 3I7BA 4BCQA 4AOIA 2C69A 2HXQA 2WU6A 4KKHA 4K18A 2XP2A 4EQCA 2IVSA 3QYZA 3PJ1A 3BGPA 2H8HA 3COKA 5EM5A 3NSZA 4BI0A 4F7NA 4O7VA 2UVYA 5FTGA 1OECA 4JDJA 2XNGA 2JLDA 5EYMA 2CMWA 5AV0A 3FEGA 4L42A 4ZMEA 4YJNA 3H9RA 4QTEA 3ORTA 3GC9A 2J0JA 2LAVA 3QHRA 4O7YA 2OG8A 3LQ3A 4PWNA 1GO5A 4Y46A 3DB6A 3C0GA 5IPJA 2R5TA 1J3HA 1ZMWA 2EVAA 2NRYA 4RGJA 3UVQA 3MIAA 4CLJA 2PMOX 4IQ6A 4AE6A 4DTBA 2J7TA 4KIPA 5JFSA 3OXZA 1CKIA 2BZJA 3BHTA 3DFCB 5E8YA 4LOQA 2CGWA 4FZ7A 3VUDA 2V55A 5KE0A 4I6FA 2L4EA 3FRHA 4DH5A 3NIEA 4G5JA 4BTKA 4K8AA 5EW9A 4L43A 3F3WA 5DHJA 3NYOA 3FMLA 1V0BA 2QSFX 3Q9XA 3VNTA 2OIQA 3W2QA 1E1VA 2QNJA 2XKEA 1MP8A 1NY3A 1W0XC 2PTKA 3GU8A 4HPTE 3CQUA 4G3GA 3JVRA 4M0YA 4YHTA 5J87A 4AS0A 4GCJA 5B2LA 3QWKA 3RJCA 3ORLA 5CYIA 4EQUA 1PF8A 4RG0A 4YC3A 1C7YA 4P4CA 3K5VA 4U81A 2JDVA 5CEIA 4CZTA 2PL0A 2YFXA 1RJBA 3NVMB 4DBXA 4C38A 2PUNA 4UMQA 5IMXA 2QOFA 2YERA 3CKXA 3R01A 4I4EA 5CAVA 3F7ZA 4IZ5A 2XH5A 2J51A 3SOCA 4JBOA 4ZJJA 3EQPA 5FEQA 4ALUA 2P4IA 5C03A 4ZTNA 3SVVA 2B9IA 3RNIA 2VGPA 4JQ7A 2OW3A 1T46A 1E1XA 5CWZA 4IE9A 5J95A 3TCPA 5M4FA 1WR1B 4GKHA 4FT7A 3KF7A 3CD3A 4QMWA 3RINA 2EXEA 3MJ1A 2WU7A 3MIYA 2X6DA 4AA0A 4F0IA 4F9BA 5DNRA 4FV0A 4CT2A 3QCSA 5AMNA 2JBOA 2H9VA 3EKNA 4PQNA 5C1QB 5LJJA 3FMJA 2WZJA 2CKEA 4M69B 4S34A 5DWRA 2C4GA 3NAXA 2DHYA 4C2VA 3OCBA 3R22A 1SYKA 3FZOA 4CFVA 1YKRA 3CY3A 2VAGA 4NCTA 3QQFA 3HDMA 3OY3A 4BYIA 2C6KA 3GI3A 4KABA 4O27B 4XBUA 1DI9A 1WBPA 3DK6A 3FC2A 4RQKA 2QKWB 4C8BA 4I0SA 3FAAA 4K0YA 3T3UA 3LHJA 1S9IA 4O0VA 4IWDA 3QTZA 1T43A 4BF2A 1H1PA 3B89A 4ZZMA 2PZRA 5FTOA 2BDFA 5CAQA 1PMVA 3V5QA 5CT0A 2PE1A 5A6OA 3V51A 2JUJA 4UXLA 5FG8A 4PP9A 5H8BA 1HCLA 4Z9LA 4LGDA 3R9OA 4BN1A 1YLAA 1H0VA 2BUJA 4O1PA 1B39A 3FUPA 3P78A 3R8LA 4DA5A 3IW7A 5M07A 3LW0A 5JI2E 1W82A 2ZV9A 4FL2A 5FD2A 4BCMA 1B38A 4EJNA 1OBDA 1YWRA 2VTPA 5BX0A 1QL6A 4MHAA 3UE4A 3QD0A 4QP6A 1ZMUA 1VZOA 2WB8A 4ACGA 3GNIB 4G3FA 4WOVA 2OICA 5H8GA 3VUHA 5LVLA 4BBEA 4UWCA 4AN3A 3DK3A 4YNEA 3QLGA 5AA9A 2XVDA 3UZRA 3HV3A 4KKEA 1YDSE 3CP9A 3IONA 4RLLA 3BV2A 4AA4A 5HORA 1PKDA 3I5NA 3SG8A 4X2FA 1OKWA 3MI9A 5EHLA 5LXMA 2J5EA 5HX8A 5E8SA 5DT4A 2ESMA 4NM5A 2YM5A 4QP4A 2WOTA 4FKWA 4YU2A 5LVPA 3F3VA 3GENA 4L7SA 3DOGA 3PWYA 3DKOA 3FZPA 2GDOA 1SM2A 3WE4A 4RIWA 3LCUA 4PL5A 2JDSA 3O2MA 1H27A 3D5VA 3QRTA 4Y5QA 3ZBXA 3QRKA 5AR4A 5KKRB 1OGUA 4BY9E 1WVYA 3I0OA 4I5PA 4C3PA 2GU8A 4CV9A 1NA7A 3PZHA 2W96B 4HGLA 2Y0AA 3GLIE 5L4QA 5CF4A 3BYMA 1A06A 4MQ1A 3DFAA 1TQIA 3QD3A 3NNVA 5CU6A 5EW8A 2LBCA 3UZPA 1YWVA 4GEWA 2UZVA 4H1MA 2CGUA 4XG2A 5F1ZA 3VS4A 3R21A 4YPDA 5IH6A 3CS9A 1PYXA 4F0GA 4L3JA 3OT3A 4WP2A 3DGKA 4O38A 5CY3A 4RX5A 2JIVA 3DV3A 4FT3A 4MYGA 5G6VA 3Q5ZA 1SVGA 3E63A 5CI6A 5DH3A 3BCEA 4D9TA 4AGWA 2F49A 1J7IA 5CASA 2W06A 2JDTA 3Q32A 2H6DA 4BKZA 3HMPA 5ITAA 1ZYSA 4BRXA 4EOKA 3BGZA 4USEA 2YAKA 3Q96A 3F3ZA 4TWCA 5AADA 3EQCA 4YLKA 3P4KA 3OCSA 2WTJA 4MEDA 1IFYA 3PA5A 1JNKA 3R73A 4ERKA 3R00A 1J7LA 5FM3A 3SOAA 4BHZA 2CNQA 2NO3A 3W10A 5JQ5A 3OZ6A 4FNXA 3FLWA 3BKBA 1Q8YA 3FMHA 3MV5A 3SW4A 3VS2A 4OTIA 3ZUVA 2QVSE 1LEWA 3V5TA 1SVEA 3TM0A 1VQ1A 3QXOA 3P86A 4QMUA 3RMFA 3V6RA 4IDVA 4N70A 4E6QA 1IAJA 2OO9A 4G9RA 1VG5A 5ICPA 2RFNA 2ZV8A 3FZTA 3RGFA 4FL3A 1JLUE 4TNBA 4O7NA 2CWBA 4CTBA 4O0WA 1TTEA 5J5TA 2X39A 3ZFXA 3N4VA 4G5PA 3MA3A 5HI2A 4YC6A 4RVTA 3MESA 2WQOA 3E7OA 3F9NA 2WD1A 4D2PA 3RK7A 3PA4A 2Q0NA 1CDKA 2VWUA 3PUPA 1F5QA 4II5A 5J9ZA 4EH3A 4BI1A 1V0PA 2UV2A 5FXSA 3EOCA 5L2QA 3K2LA 2R3LA 2XYNA 5AP1A 4X21A 3QZGA 2DUVA 1BMKA 4K11A 4L68A 1XBBA 1YHSA 4FTTA 1HOWA 4J1RA 4KRDA 3EFWA 3R2BA 2VTLA 3PXZA 2XCKA 4EZ7A 4MBLA 2BFYA 4JQEA 5AR8A 2UW0A 4QMOA 4RIYA 5HU9A 4QYFA 2XM8A 5EOBA 2XS0A 2EXMA 3BE9A 4JVGA 4MF0A 2XIZA 2REIA 4DH3A 5LVNA 5IEYA 2O0UA 2AC3A 4MF1A 3V8SA 2RFDA 3SW7A 2ZB0A 4W8EA 2HY0A 3Q6WA 4RC4A 4X6RA 5E1SA 2BDJA 4FV5A 4WSQA 1Z57A 2WTDA 2BMCA 4BGHA 2XNMA 4XBRA 3LLAA 5AV2A 1JKLA 1ZRZA 3IK3A 3PIXA 3FE3A 2W0JA 3FZ1A 3D7ZA 4QMMA 4QTAA 3U51A 5DT0A 5E8WA 4FUYA 4O7TA 1FPUA 4BDGA 5HCZA 5CVFA 4B9DA 1R0PA 2C1BA 5AIRA 4GH2A 2JNHA 2J0KA 3BGQA 4U0IA 1M7QA 2BFXA 3D14A 3EWHA 4RRVA 5GZAA 2YIXA 4ANNA 1RW8A 3CLYA 3PG1A 1HJPA 3VC4A 2C68A 4C37A 4GSBA 2JFMA 4RX8A 1LR4A 2J50A 4DEAA 3R9NA 1Y57A 5AP4A 4F70A 2WQNA 3MY0A 4G17A 3A7FA 4QQJA 5IUIA 3BE2A 3EN4A 4IAIA 3R7VA 4QTCA 1OBGA 1REJA 4UBAA 4FV8A 4GIHA 3MTLA 2UW3A 3A61A 2CLQA 1Q24A 1XBCA 3LFNA 4I5MA 2CKPA 5KZ0A 2WMXA 5JRSA 4OTFA 4BYJA 3UNZA 2ONLA 5G1XA 3OMVA 2GMXA 1Q61A 4O7LA 3FYKX 1PKGA 2GS2A 2W1EA 2ITYA 1OPKA 4IX3A 3FY2A 4GG5A 4J96A 3TTIA 2H96A 3GQLA 5KX8A 3DAEA 3ROCA 1YI6A 2I0YA 4H39A 4YNOA 4JG7A 3RPRA 3KB7A 2GNIA 4KBAA 4U80A 4A9TA 2DKLA 2B7AA 5TT7A 2EU9A 2GSFA 1VEBA 4E5WA 3GCUA 4FTCA 3TXOA 3S3IA 4F99A 3I7CA 2O2UA 3B2TA 3Q4UA 4ARKA 4G1WA 4EOMA 4WRGA 4AZTA 3D2IA 4LI5A 3F3TA 3KRWA 2X7OA 3FZSA 4WA9A 4L67A 4E3CA 3O23A 1WBTA 3DBCA 2QOHA 3DNEA 1YOJA 3W18A 3ZU7A 4CMTA 4PV0A 3QQKA 2IZUA 3FY0A 4FX3A 5LWNA 3COMA 3DDQA 3ZC5A 3REPA 4BDJA 1WJ7A 1XXHE 5ETCA 1UU9A 2QQ7A 3OFMA 4LGGA 2OH0E 2Y6OA 4RT7A 5CANA 2UW9A 1CKPA 1XO2B 1QZEA 2Q0BA 3NUYA 3PLSA 3ITZA 4I1ZA 4YZMA 3V3VA 5KHXA 4ORKA 4D4SA 3HRFA 3RAWA 3TT0A 2F7EE 4I94A 3KRLA 5ANGA 2HOGA 3C0IA 4EUUA 2PY3A 1VEGA 4JX7A 4YLLA 5ETIA 4GYIA 1XQZA 3ORPA 3TNHA 3CQEA 4YURA 2Z7RA 3DQXA 1G8SA 3PSCA 2VN9A 4DEHA 4A9SA 4L53A 5JRQA 4OGRA 5HEZA 4C35A 5JFXA 4HNIA 2OOAA 2C5YA 3VRYA 4FSQA 4E6CA 4BDDA 4JAIA 3H0YA 3HMIA 1XH9A 3MY5A 4P2KA 3KK8A 2ITTA 5HKMA 2B0QA 1ZOEA 4DCAA 2XK4A 4R78A 3FBVA 1IXSA 3FLNC 4DLJA 4FSTA 2MR9A 2CHLA 4FVPA 1PMEA 1UVRA 2ACXA 4PPAA 4YZ9A 3ODYX 3R7OA 4ASXA 4DG3E 5AAGA 3NWWA 2OJ9A 3PPKA 4KSQA 3KXZA 2HK5A 3KY2A 3OUKA 3P7CA 4NZWB 4QPMA 3VO3A 3CCNA 5E7RA 2HWPA 2UZNA 4U9AA 5A6NA 1GZOA 2BWEA 3VW6A 3QF9A 3UO4A 3OTVA 4FG7A 2UW5A 5AIKA 3HMOA 5F94A 5TKDA 3JUHA 1U5RA 3GBZA 4NH1A 4AFJA 4BCGA 2FYSA 2E2BA 3BU5A 4NUSA 4B0GA 2J0IA 3EN5A 5I5ZA 5EFQA 2ZOQA 3QAME 3E93A 3MPTA 4LV8A 4QQTA 2C6MA 2CGVA 4YGAA 3ZYAA 5D7AA 1Y8GA 3ERKA 4BKJA 3S0OA 4L7FA 3KXNA 2JITA 4AZWA 5IEXA 5DR9A 4YJOA 4ONAA 5ACKA 1RQQA 2EJSA 4MK0A 3QQLA 2X1NA 2YA9A 3WI6A 2QOLA 3LCKA 4QNAA 4AN2A 4U44A 1BI8A 4F1IA 5EW3A 1MRVA 2BAKA 2Y7JA 3GFWA 4P90A 1P5EA 2VNYA 2VO0A 3I5ZA 3MW1A 2QURA 4FSRA 4ZTSA 2QOOA 4PMPA 5I3RA 4DHFA 4CFWA 5ANKA 1GY3A 2OOBA 4BCKA 1Q8TA 3ORXA 1KE5A 2FSTX 4FKLA 4KIKB 4BBFA 4O86A 2YCSA 2GTNA 4R3RA 2ITUA 4IVBA 4TYJA 4JNWA 4D5KA 4IM0A 2XNNA 3CR0A 4Q7JA 3R8PA 4RC2A 4UWYA 3P5KA 4R7BA 4FSZA 4BTJA 3PYYA 4F0FA 3QALE 3VQUA 4CFFA 3CSVA 3KQ7A 4IVDA 1WGLA 2EKKA 3DK7A 3EQGA 5HO8A 3UBDA 1G3NA 2X8IA 5BUIA 2W9ZB 2GNFA 3PSBA 4MXXA 4RA4A 3HP5A 3TL8A 2OI4X 3ZXTA 4FIGA 3KMWA 4O0YA 4FYOA 2Q83A 4FOCA 4YZBA 4EKKA 3PPZA 4IM2A 1JVPP 2X81A 1GJOA 3C0HA 4UV0A 3ZXZA 5AP2A 3WF9A 3GOKA 4MXZA 4O6LA 3UP2A 5HG9A 1ZYJA 3U6JA 2JAVA 2JIUA 4Y83A 4ZS0A 4B99A 5DOSA 2KHHA 4R5SA 3F7WA 3A7HA 4AW0A 3PTGA 3LM5A 3F3UA 1FMOE 1Y6AA 1DAWA 4S33A 4Z7HA 1ZYCA 4QOXA 4BDCA 2B52A 4W9XA 5L3AA 4G6NA 4FIFA 4FKQA 4GIIA 3FKLA 3R6XA 4LM5A 4O2ZA 2RFSA 4EK8A 3IG7A 2RG6A 5CXZA 3EFJA 2P55A 3E21A 2XJ1A 5E8ZA 4CT1A 4BGQA 2UZUE 1B6CB 3A7GA 4AG8A 3VBYA 3AC8A 4QP1A 3VJOA 5BVOA 5L8JA 2YM7A 5CEKA 4FZ6A 3TV6A 3W8QA 2VWIA 4FKJA 4WUAA 4F6SA 3U4WA 3DKGA 5JFWA 2YDJA 1T6OA 1KSWA 3LFBA 5CEQA 2ZYBA 5DFPA 5HICA 5AX3A 2ITXA 4XLVA 3UJGA 3HA6A 4CYIA 3O51A 3P1AA 3RHXA 5L2IA 2OK1A 2R64A 4EHZA 4OTHA 4XUFA 2HW7A 1O6YA 3O50A 3ZMMA 2GFSA 4C58A 5FM2A 1PXNA 1XJDA 3UG2A 3TNIA 3A2CA 4Q2AA 3QWJA 1K9AA 2BTSA 4CKJA 3BQRA 3FL5A 2K9DA 4IXPA 3UIBA 5FDPA 4JQ8A 1MUOA 4GJ3A 4R8QA 3F2NA 3H9OA 3IHPA 2I0HA 4FNWA 4R7HA 5KBRA 5HHWA 4E4NA 4D1SA 2JFLA 4NM3A 3GQIA 2Y9QA 1YI3A 2XZSA 3FI2A 5EKOA 3S00A 4CTCA 2ETMA 3NEWA 3GU4A 4I4FA 2PU8A 4H58A 2X8DA 5LVMA 5IA4A 4JIKA 3UIXA 1G5SA 2KTYA 4HVHA 5EOLA 5J5SA 5AV4A 5FUTA 4HVSA 5BVKA 4RJ6A 2BAJA 1ZY4A 4JX3A 4KSPA 4FSMA 3AGMA 1PXJA 4K1BA 5DE2A 5AR2A 2YN8A 5D12A 4X7QA 2HZ4A 2R3QA 2C0TA 4YBJA 3WZJA 1IG1A 3F5XA 2J5FA 4IX5A 3FSKA 1IA9A 1U5QA 3BEAA 3CPBA 4ZLYA 4ACCA 3H3CA 3MY1A 5IZFA 4ZMFA 5I9ZA 3H30A 5CX9A 2ITVA 4A4LA 3PXFA 2W1GA 3C9WA 3Q60A 3BU6A 1TQPA 4FNZA 5FP5A 3A60A 5KCVA 4FGBA 2W5BA 5FXRA 4ZTMA 3ULIA 2V7OA 2QOCA 5JFVA 4FR4A 3A99A 1Q3DA 2WQMA 4Q9ZA 3KL8A 4XV9A 4AAAA 3D94A 3PXKA 3TZ7A 2GHLA 3MTFA 5BVFA 4AUAA 4RBLA 1KE7A 1PMNA 3ALNA 4ITIA 2E9UA 1OL5A 2GQRA 3AMYA 2WTWA 4D55A 3OW3A 1G4AE 3HV4A 2PE2A 2X7GA 4CLIA 3W33A 4PPCA 2WMUA 2UZEA 3LPBA 1BUHA 1ZLTA 1IAHA 2FVDA 2GPHA 4BBMA 4YP8A 2JZ1A 3QRUA 5I9WA 2ERZE 5C8KA 2BR1A 3G0EA 1VR2A 4AOTA 4EHGA 3RZFA 4G9CA 1ATPE 3O8UA 4IB1A 4I20A 3KVXA 2IVTA 1LP4A 2C5OA 4ZSLA 3FXXA 5HLNA 3L8VA 3OROA 2WQEA 2PSQA 4AW1A 2OJGA 3ANRA 5HTIA 4OR5A 1BLXA 3T6PA 4AE9A 3GLFE 2GS6A 3SDJA 2JBPA 3QU0A 3G0FA 4DFXE 2WTKB 2QCSA 3FLYA 5AUZA 4KUJA 2XB7A 3ORZA 2W1HA 4MD8E 3R2YA 3RM7A 2RF9A 5B2KA 2WO6A 4CYJA 3PVBA 3PJ2A 3TEIA 3IQ7A 4ACDA 3D5UA 4RIOA 1QPCA 4FK3A 3ZSHA 4TRLA 4ASEA 4O84A 3BLRA 3ATSA 3G33A 4R77A 2YDKA 2BPMA 4OUCA 4KIKA 4R3CA 4XP2A 2LVQD 3IECA 2X2MA 4GKIA 3O8TA 4JDHA 2VRXA 3D15A 4L3LA 5T68A 3FXZA 4FC0A 5ANEA 1HQYE 3M11A 1MQBA 2QKRA 3UOHA 1ZWSA 4C0TA 2WMVA 4OBPA 3KK9A 2J9MA 4ZJIA 5LMAA 4A9YA 5J9YA 3CKWA 2JDOA 2OSCA 4O1OA 4QMVA 4RLKA 4YPSA 4E6DA 4WUNA 5HE2A 5HD7A 3DAJA 3IDBA 1KE6A 5ANIA 3R8MA 3UGCA 3OWPA 4IB5A 3DNDA 4O7RA 5EQEA 3DJ6A 1H1WA 4FK6A 1YOMA 5IQEA 1H1SA 5DEWA 1FINA 2W7XA 3FHIA 1E9HA 4YZCA 2O63A 4MXYA 5HG7A 3UQCA 4CFUA 5HBHA 3SAYA 2ZM3A 3RHKA 5KMKA 3Q04A 1KWPA 2VGOA 3GCVA 2BHEA 3QZIA 3THBA 2VWBA 1HT2E 3IOPA 3ZCLA 4C2WA 3RKBA 3R04A 4EOOA 2IVVA 2BKKA 3OOMA 3PA3A 3RK5A 3SXSA 3B2WA 3GB2A 3PWDA 3LJ1A 4I5CA 3FXWA 2V22A 2VTIA 5IKWA 2VO7A 3VF9A 4FEUA 4YJQA 5JKGA 2XJ2A 3WF6A 1OL7A 4TL0A 4CGAA 4K2RA 4D28A 3BYVA
chains in the Genus database with same CATH superfamily
4HYSA 3MWUA 3EFKA 2YABA 8CATA 1W98A 3FZRA 2C47A 2ZAOA 3GPYA 1V0OA 3GCPA 1YXUA 3QHWA 4JI6M 2VQFM 5M44A 4QTBA 3SRVB 2LGCA 4GIPA 4ZXTA 4HNFA 2ZVAA 4DFZE 3NVKI 5A4QA 2VWWA 4FTLA 2F57A 4GFOA 4NYEA 3UMXA 1L2CA 4Q9SA 3IDPA 5EM8A 3R9RA 5BMMA 3LCVB 3K9PA 3D7TA 4QNYA 4YTHA 3SKCA 3A46A 3ZFMA 4NKSA 5BMSA 3R9XB 4DBGB 1CSNA 4RMZA 2I7QA 3TYKA 3OVVA 1WFCA 5AV1A 3EQDA 2X0QA 3AKLA 4IAFA 3MS9A 1WXQA 4O83A 2FOIC 5AAFA 3VS1A 1AQ1A 4AKHA 4EUTA 4E4LA 2ZFYA 4O4EA 3Q4TA 5IA2A 4EH6A 3LCTA 4LV5A 3MHVC 4CVAA 2IVUA 3MFUA 2F4JA 1BYGA 2GQFA 4MNEB 2IZRA 4GK4A 4EOIA 3LQRA 3H10A 4UXQA 4TKSA 4DEBA 4DHZA 1HNXM 1W84A 5H8EA 2NNWB 4AXDA 4YY3M 1UWJA 3WZDA 4M12A 1Q39A 4R1YA 5GZ8A 5IU2A 1F3MC 5A9UA 2NPQA 3LFDA 4AZFA 4WA9A 5GZ9A 4B8LA 2F5OA 2XUUA 4YC8A 4PRJA 2VQEM 4ZIMA 2FSLX 2CDZA 3R7YA 4JAJA 3N9XA 3QA0A 4TW9A 3W55A 1WMKA 3COHA 1JR3E 3K54A 3PE2A 3QTIA 4FE2A 1KOAA 2YR0A 2WTIA 3E62A 2BVAA 4MGYE 1FBNA 5HU3A 4EK6A 4GITA 4ZPXA 2AYPA 4S31A 3CGOA 3CEKA 5EDQA 1I44A 5DT3A 4ANQA 3GU6A 2R46A 2EA0A 3IW6A 5LMBA 3NUSA 3LLTA 1GZ8A 1ST4A 3G5DA 4LJ4A 2OU7A 3LXNA 3ULZA 4AF3A 4BDFA 3VBTA 3TACA 5A54A 5KMOA 1UA2A 4FSYA 5HBEA 3DZOA 3F2RA 3C4FA 2B9HA 5JGDA 3U6HA 2HELA 4FG9A 5CENA 3TDWA 4GYGA 4CD0A 2OBJA 3HGKA 4ZEGA 4ANOA 1YHWA 2XA4A 2VZ6A 2V62A 2X7FA 2BIKB 4I81A 4ZY4A 4EI4A 5E8VA 5HQ0A 4M8TA 3TUDA 3NPCA 2WIPA 3D7TB 3MVHA 4I6HA 5JI3E 4G4QA 3UODA 5CZIA 5JGAA 2WSCF 2OLCA 1XHAA 1KE8A 4WG5A 5GIOE 3EQIA 4C4HA 5DIAA 3HUBA 3MN3A 4WG3A 5FBOA 4CSVA 3KRXA 3NNXA 4EK3A 5J1WA 4N0SA 2FH9A 5IEVA 3HA8A 1IM2A 4RZVA 1G71A 4YHFA 1TVOA 4I0RA 4BDEA 4D0XA 1APME 2YDIA 4FTOA 2C96A 4XG7A 4D0WA 3C1XA 3QBNA 4OAUC 3PZEA 3BL7A 2O3PA 2FGIA 4J99A 4FZDB 3WZUA 2QPAA 2DQ7X 4BCFA 1Z6TA 3EQFA 2KEBA 3PJ3A 4CFMA 4C62A 4FKVA 2DAKA 2IW9A 4GT3A 5CALA 4JDKA 4CRLA 5HNBA 2XRWA 4CCBA 4LOPA 4XX9A 2W99B 5FEDA 5IUGA 2UU9M 3CE3A 4DCEA 3GXLA 2XKCA 1YXTA 2FE8A 3WF5A 1OI9A 2F2CB 5AUYA 2HAKA 4F1OA 5BYYA 3AKZA 4JIAA 4J97A 3UOJA 1WIVA 2CV2A 3EMGA 1H28A 3IS5A 4FTIA 4GL9A 4R3PA 1TFFA 5AR3A 3VS5A 4I22A 5TOZA 4KB8A 2OH4A 1WVWA 2EB3A 4IFCA 1LUFA 2BKZA 3FYDA 5J7BA 2M60A 3HHWA 1FOTA 3R1SA 3GLFA 4LL0A 4ZSJA 4ANBA 1PGYA 2V6ZM 2MH8A 3P7AA 4PUZA 4RFYA 2A1AB 3KP1E 4WNKA 5FXQA 4NC6A 2BZIB 2CGXA 4RWLA 3SHFA 2CE7A 4C4IA 1AGWA 3KXGA 4JBVA 1XBAA 2R3OA 5DR6A 4CFXA 2E9VA 4CMOA 4HZRA 4ALVA 4O6EA 4H05A 2RGHA 5EG3A 4X2JA 3A8XA 1K3AA 1XH7A 3WYXA 5HO7A 2XIKA 2ETRA 3C5IA 1ZYLA 3KA0A 3W16A 2R3GA 5KBQA 5J1VA 4I8OA 4DV1M 4LF7M 1PXKA 2E9PA 4IVCA 5GJGA 4DC2A 1HNWM 1TH3A 1UKIA 1XWSA 4G3OA 3U6OA 1NV9A 5I9UA 2UVZA 3HKOA 3KCKA 5JMSA 4YBKA 3Q9YA 5J8IA 2P2IA 3HX4A 1JR3A 4MWHA 2ETKA 2W05A 4A9UA 1L8TA 2IG7A 2C6EA 3O8PA 5AEPA 1J7UA 1I94M 2RGOA 4JYAM 3EIEA 4XHKB 5GIPE 4M9XA 2DNAA 4M68A 4RX9A 1JKKA 5BYLA 4DEIA 2W1IA 4O7SA 3NCGA 5M55A 1VEKA 4O22A 4BKYA 3I01M 3RAIA 2P0CA 5D10A 2PE0A 5ANDA 1L1TA 2ZM1A 4L3PA 4YO4A 3OCTA 4J7BA 3ZC6A 3V5WA 1H4LA 2WOUA 3FLQA 4GVJA 4JG8A 4ID7A 3QD4A 4U43A 4DH8A 3ZUUA 4MWIA 3R8UA 5GINE 4CXAA 4A7CA 4F1TA 4QOZC 4PNKA 1N33M 2YCQA 1Q3WA 3EL7A 4LQMA 3FQSA 4QRCA 4ZJVA 4Z3VA 3PE1A 1PW2A 2VTHA 3ACJA 4Y8DA 4UZDA 2XYUA 5EI2A 1L2BA 5B7VA 2BRNA 5CEPA 4DFBA 5KPZA 2B9FA 5LCKA 3KS8A 1REKA 2CPKE 4BCPA 4RQVA 3UOKA 2YZAA 3MK6A 2DYLA 4W4VA 2R0IA 2DAEA 3M1SA 4XNEA 4DAWA 4DITA 1X37A 5CNNA 3T9IA 2ERKA 4JR7A 5C8NA 3FJQE 3NUUA 4D5HA 4EH7A 3OWLA 4P16A 2EWAA 2ITNA 2PYWA 3TL4X 2CN8A 2F4VM 4IAAA 4IZYA 3QKKA 1DV0A 2UZDA 3K1JA 2FUMA 3CTQA 4KINA 4V04A 5HE3A 3R7UA 4U3ZA 4GRBA 3GC7A 5K4IA 4JI2M 2QO2A 3LKMA 2XGNA 4D80A 4LGYA 2QU5A 3LQ8A 4KHPM 4L01A 3VWAA 2ITWA 2WNTA 3V6SA 5L2TA 4IAYA 2XNEA 4M69A 1OIQA 4FTNA 5HLWA 1WAKA 2Y4IB 4XV1A 1M14A 4QTDA 1OAIA 2F5SA 3Q2MA 3R9HA 4MVFA 5TO8A 4FMQA 4TWPA 4GFMA 3U6LA 1E9RA 4FVMA 1NV8A 5EXXA 4YZDA 3LIJA 4FV3A 3S4QA 2X8AA 4FCWA 3IGGA 4IX6A 5JN2A 5DA3A 4NU1A 3LMIA 4I21A 3VBVA 4GKIA 1YQJA 3LCDA 4NK9A 2R3NA 4KO8A 3PSDA 3GLHE 1IQPA 2DWMA 2WTCA 3G6GA 3Q9ZA 3QLFA 2GNJA 4RX7A 4UMTA 2DVWB 4XRLA 3VS6A 4AZSA 4MTAA 1IBLM 5A2QS 2WPAA 5BPYA 3RALA 4ZSEA 2A0CX 2PVHA 4I5SA 3NIZA 2A27A 3BI6A 4LDTA 3VBWA 5LVOA 3R0TA 4EWQA 4FL1A 4HGSA 2J0MB 3W2RA 1OL2A 3I0QA 3HVCA 4MGZE 3MPAA 2R3JA 4QHTA 3TV4A 5CVHA 1QAMA 4FEWA 1H1QA 1H25A 5E4HA 2APLA 4LMUA 4YJTA 3OUNB 1U59A 5IUHA 3CC6A 1XMOM 4P5ZA 4FD2A 5FWKK 3T38A 2PVRA 3GT8A 3W1FA 4CFNA 1PRYA 1PXOA 2X2LA 3TJDA 1G8AA 1FQ1B 3QC9A 5ETAA 1SXJA 4HW7A 3JY9A 2PVKA 2WKMA 4X6QC 4Y95A 3CF2A 4EORA 3WOWA 4FTMA 4D9UA 3AGLA 1PXPA 3QTRA 3R7GA 5E8XA 4FBXA 4MX9A 1RU3A 3R1YA 4QMPA 4XCUA 2B3TA 2C6DA 4C36A 2CKQA 1NHGC 5EYDA 3W0SA 2BZHB 2KZSA 4QMQA 4J52A 3VLFB 4NFMA 4WNMA 2R62A 5HVYA 4DT8A 2BRGA 4GMYA 3EYHA 1OUKA 3FPQA 4HVGA 2F7ZE 3L9MA 3ORKA 4JOAA 4O4BB 3WF7A 1O6KA 4AA5A 3RNYA 3QCYA 2XARA 2R45A 2C6LA 4ITQA 2X8EA 4OBOA 4DDGA 3GQ5A 3N4UA 5IH4A 1JSTA 4FICA 4Z7GA 4ZLOA 3M2WA 4I5HA 5E90A 2QG5A 4UZHA 1KYIA 1VJYA 4R7IA 4BZOA 1Q5KA 5I0BA 1AD5A 2HW6A 5M09A 3SBJA 2QOBA 4OT5A 4UY9A 2CSNA 1RE8A 3C13A 3E87A 3MA6A 5HOAA 3UIUA 3WZKA 4DLIA 3POZA 1G8PA 1GZKA 1P2AA 2QONA 4MNEA 4A9RA 2ZB1A 4DR5M 1OM1A 1YOLA 4ALWA 4B7FA 3HL7A 4GMQA 4K9YA 4DINA 5KMIA 5LWMA 5C9CA 3GUBA 1WZYA 4MXOA 4D2SA 3CTJA 3AOGA 4NIFB 3MFSA 4PDGA 2YCFA 3J80S 1GOLA 1HCKA 4GUEA 2ITZA 4NL4H 4IBMA 4X3FC 3ENHA 3LFQA 1W5TA 3D8LA 4UB7A 3UVRA 4PT5A 4DV4M 3E8DA 3IO7A 1TDHA 4Y72A 4NCTC 5DBXA 4IBKA 2J0LA 4XEYA 4L00A 3QFVA 1K3WA 5AM7A 4DEGA 1VLRA 3G90X 2LVAA 5CAOA 1ST0A 3ZFYA 3FLSA 3QTXA 2XKFA 3D5WA 4IBDA 4EOSA 1WVXA 2C0OA 3KXXA 3P0MA 4U45A 3H9FA 2XBAA 2G2IA 3GOPA 2QOIA 3AMBA 3OP5A 2C6TA 2R3PA 1XH4A 3QTSA 4IB0A 1MRUA 1WBSA 5FLFA 4PTGA 3BOSA 3I60A 4GW8A 5M4UA 1YW2A 3AC3A 2VTRA 3OXTA 2ZTDA 4U5JA 4W8DA 4FGRA 2XCHA 5DPVA 4C4GA 1WBVA 5DFLA 4IBFA 3GLHA 2PMIA 3DBEA 4E6AA 4ZSGA 4DFLA 4O2PA 3DKCA 4AT3A 3QX2A 3RE8A 1ZMVA 2XIYA 3OD6X 3UPZA 4AGDA 2B55A 3Q2JA 4FV9A 3U8WA 1JQHA 3NX8A 3QGYA 3MESA 1DGHA 3DA1A 3AOEA 4MD7E 4EONA 3TPZA 4FTRA 5CU0A 2W1DA 4WHZA 3RK9A 1J7KA 2OJFE 2XEZA 4LYNA 2C30A 1IA8A 2PVMA 3M7GA 3EKKA 1JWHA 2YJRA 4QP7A 3B7ZA 5ACBC 4E26A 5KUPA 2W4OA 3FHRA 2N35A 3SAUA 2ZDUA 1UKHA 3WARA 2A2AA 4R7GA 4EQMA 2DAIA 2PUUA 3S1HA 5AUUA 4WNOA 2G2HA 5CF6A 5AM6A 2Y21A 4EH5A 2VIIA 5ITXE 3HMMA 4G6LA 4N6YA 2DI0A 5IG1A 1A5TA 3LVVA 2ZDTA 5AP7A 2XSZA 2MGWA 4XG3A 1F0QA 3KU2A 2OWBA 2ZBKB 3A8WA 3I04M 5AUXA 3UPXA 2X2KA 3DPKA 4FTJA 4EYMA 4RJ7A 4MKCA 4DTKA 5IQDA 4IC7A 2VV9A 3UG1A 4EBWA 2D7HA 4H36A 4I0TA 4YJSA 3UQGA 2GHGA 3G2FA 4MXAA 3ZUTA 3NYVA 3SQQA 3RGSA 3MYGA 2VTMA 2CHQA 5I9YA 4RF1A 3UZUA 1UWHA 2X4ZA 4X2NA 4GG7A 5AUTA 4KS7A 4AX8A 2YWVA 3HP2A 3L8PA 3T8OA 3ZO4A 4J8MA 3TUCA 2Y20A 2PULA 2ZTCA 1OIYA 1ZZLA 1IXZA 3MJ5A 2WIHA 5K4JA 5HG8A 3VS3A 1OITA 3E5AA 1OPJA 3ZQJA 4CGYB 4L8MA 4FIEA 2WGJA 3UIMA 4ASDA 4KS8A 3BPRA 5IQIA 4IJFA 1NVMA 4TYIA 3VW8A 5KNJA 4IJPA 4M15A 5FTJA 3R7EA 1AIPC 5B0XA 4BL1A 2VNWA 2QOQA 3TWMA 5FTKA 4BTMA 4M7IA 3G51A 4RVKA 4R1VA 3TIZA 2PZYA 3PFIA 2BZKB 1Z9XA 1HT1E 2DAMA 2PZ5A 4AW2A 1UU7A 4G3CA 4HCVA 5EM6A 1L3RE 2GQGA 2H34A 4LJAA 5D9HA 3B7QA 1QMZA 3F92A 4G6OA 3Q52A 5CU4A 4TZRA 3W67A 3WF8A 1JSUA 1MU5A 2Z60A 5AUWA 4BCNA 5A46A 3HAMA 3LCOA 3M0EA 2AHMA 3RPOA 2C1AA 2OJJA 4F2LA 4ZY5A 1HR0M 4V0GB 5FDXA 1UFZA 4FKRA 5M4IA 4DGLC 4PTEA 5J7HA 3ALOA 2HCBA 4LF8M 4PMTA 4QYYA 4IHPA 2R7IA 4FUXA 4HYHA 5EYCA 3Q6UA 1GZNA 4RFZA 3KGAA 1N34M 4BTFA 5KKRC 5IDNA 3PJCA 1QPJA 2HHHM 4FOBA 3FKNA 1NVQA 3JY0A 3KF4A 4HCTA 4X64M 3KVWA 3NW5A 5HE0A 3HMNA 5K5XA 3UYSA 1IY2A 1Z5AA 2EKFA 3RGPA 3EIDA 3FMMA 3GFEA 4TN6A 5A3XA 3TNWA 3U87A 3W8LA 3AC1A 4YJVA 3U6DA 1RDQE 2Q2EB 4DE4A 3RWPA 5CEOA 2GHMA 4Z16A 3DJ5A 3V5LA 5L6PA 4NXMM 5EP2A 4Y73A 3KEXA 3H4MA 5FRIA 2DZLA 2IWIA 3V8WA 5IA3A 3QQGA 4PMSA 1AUAA 3R8ZA 1TH4A 1A9UA 2PUPA 5CQWA 5JZNA 2WMTA 4LJ5A 1K3XA 3QCQA 4I6BA 4YR8A 2EB2A 4C33A 4GKJM 4PX6A 5BUEA 3ZRLA 4CISA 3NR9A 3UNJA 1BX6A 2XAMA 4CHTB 4C59A 1FVRA 2XK8A 4TT7A 1R4GA 1L2DA 1U54B 4XS2A 3R83A 2BJVA 3UO6A 5EDRA 4EJ7A 3SARA 2HY81 3OWJA 2HZ0A 4EL9A 1XNRM 4RFMA 4CZUA 3Q8XA 1NNUC 3WILA 4TYEA 5DI1A 4FA2A 2QOKA 2QO7A 4WBBB 4CCUA 4HGTA 2BNKA 4QQCA 5T6KA 3SD0A 4WNPA 1YHVA 4UMUA 4IB3A 2K0BX 4DR1M 3PPJA 2LWXA 2X9EA 1NXKA 3FUXA 5HGIA 2JDRA 4O7ZA 5AA8A 4ZY6A 4CNHA 2B9JA 4D58A 1GL7A 2Z7LA 3U6IA 4FIJA 3UVPA 1QPDA 3FMKA 3GVUA 3SX9A 4C57A 5HZNA 3FQHA 3BU3A 3QC4A 3QYEA 5BVNA 1HNZM 4PNIA 4FI1A 3KMUA 4NTTA 4YJRA 3ZOSA 4ACMA 4E4XA 5K9IA 2CNUA 2FSOX 1ZOGA 4XV3A 2OZAB 4U3YA 2AUHA 2XM9A 2Y4PA 1IR3A 4MBJA 4K33A 3QUPA 3I51A 1NNJA 2R2PA 2C5RA 1OB3A 3HECA 4DGNA 2ZANA 1H1RA 3EN7A 3KCFA 4HYIA 3QKLA 4X66M 1S9JA 2Y8OA 4U41A 3PY3A 4JI9A 3GP1A 2I0EA 4GK3A 5AWMA 2VWXA 2ZAMA 2QR7A 4GEOA 1J09A 2CNVA 3JVSA 3AC2A 4FZFB 4OT6A 4A07A 3VKHA 1PJSA 4G34A 4IZ7A 3RWQA 3J2PB 4AAYA 2DZNB 1BI7A 4IH8A 2JY5A 4GH9A 5CSXA 2UW8A 3GU7A 3P79A 5KMLA 1PJIA 3HHYA 2Z2WA 3QZFA 3U60B 5DYIA 1ZXEA 3JS2A 4TYHB 3GGFA 3VUGA 1G8JA 3GC8A 3IG5A 4LFCM 5JGBA 3DFZA 3KXHA 3NRMA 3EQHA 3PIZA 5DNYA 2QHMA 5CNOA 3GU5A 2HWJA 4OX9M 4CKRA 4TNDA 3MFRA 1KV2A 4ITHA 4XG6A 4BCJA 4FV7A 4C61A 5C8MA 3WIKA 3LXLA 1K2PA 4NSTA 4U42A 4FIHA 2IPXA 2IZTA 2UZWE 3FMDA 4J95A 4YTCA 4FVQA 4O0SA 5CSVA 3UO5A 1ORYB 4RIWB 3WYYA 4I6LA 4YTIA 3R8VA 4L16A 3U54A 5DG5A 3BEGA 2HZNA 3H0ZA 3U60A 3I81A 4TYHA 4CQEA 3U6EA 3BX5A 1GIJA 3PP0A 2EUCA 2HXLA 3ANQA 3QRIA 3FMEA 3Q4CA 4FEQA 5JH6A 3OOGA 3LJ0A 1PJKA 3GLGB 2PVJA 3PNYA 2BRMA 3HRCA 3OG7A 4NWMA 3F5UA 5H2UA 1SNUA 4ENYA 1JBPE 3PG3A 5IH5A 4RVLA 4APPA 4E7WA 2RRUA 1M17A 4IW0A 4FV4A 5JK3A 3PDTA 4HL4A 4IBGA 2GS7A 5A4CA 4JJRA 4UEUA 1R1WA 2C5VA 3Q9WA 3VIDA 3W68A 1L1ZA 4W9WA 4F64A 3ML1A 5CF8A 3SASA 2QR8A 2KXEA 5IQGA 3MH1A 2VF8A 3ENMA 1WBOA 2XF3A 3UYTA 3GO8A 1XHBA 4F7SA 4ZOGA 4MAOA 3G6HA 2J90A 3SA0A 4CIZA 1PM5A 4KWPA 4CZYB 3L28A 3R63A 4L9IA 5KMJA 2FB8A 2WMQA 4QP9A 4WSYA 4E1ZA 4G4OA 3PRFA 1IN8A 3L9LA 4TTHB 4EH9A 1H00A 2WMBA 4KIOA 4P7EA 3PXQA 5HBJA 3MPMA 3C51A 3HAVA 4LY6A 4ZK5A 4HCUA 3E4RA 2UXBM 1J91A 2JKKA 4DTAA 4NJ3A 2CHVA 2Z4SA 1O6LA 2R3KA 1OKVA 4FKOA 4C4JA 4PDOA 4JI7M 2YCRA 4KIQA 3IKAA 2KDLA 4NOOB 4LG4A 4M3QA 4F7JA 2Z3XA 3OWKA 4DG2E 3R1NA 2JAMA 5IQBA 2JY8A 3BLAA 4F09A 1FGIA 5F95A 4RZWA 2R3IA 3LZBA 2YIWA 2QI8A 3CXWA 3F69A 2XEYA 4HVDA 5HVKA 1G8KA 5HCYA 4E5AX 1R3CA 5CZHA 3C3DA 4BCHA 5TR6A 4IX4A 2BWBA 4ZAUA 1MX0A 4X3FB 3A62A 3K3JA 3ZRKA 3MMPA 4AT5A 3L27A 4RWIA 5FSWA 2ZAZA 3SC1A 4HEOA 2QU6A 3PXGA 1OMWA 2J6MA 5HESA 3ZH8A 4AN9A 2PZPA 4DUZM 2JEDA 1NHWC 2V7AA 2OJIA 3C4EA 3ZO1A 3QX4A 2F5QA 1YDTE 2C3JA 3KN5A 2OXYA 4EOJA 3M42A 5BVEA 1Q62A 1ZYDA 2UZOA 4QMSA 3H4JA 2DENA 3D83A 3RAHA 5A4TA 2JKQA 2V0DA 3HV6A 2UUAM 4PTCA 4UYNA 4FTUA 2F9GA 3NYNA 2KNAA 5AP3A 5E8TA 2YAAA 2CJMA 3RVGA 2A98A 3ZM4A 3UQFA 3ZCBB 4LJ7A 3EL8A 4GV1A 2MROB 2UZTA 2XMYA 4MBIA 5HCXA 3JYAA 5K0XA 4FWGA 3UP7A 4AOJA 1I09A 3EQBA 3PXYA 3HLLA 2LVPC 1QVRA 3BIZA 3NW6A 3KXMA 4U8ZA 4UN0C 5BVWA 3VBQA 1QUTA 3FWQA 2YQZA 3ZS5A 4XP3A 3J81S 3G15A 3C50A 4JI0M 2RG5A 5L2SA 3HNGA 1CMKE 1CKJA 1ZY5A 4AKGA 3IW4A 4FKSA 5EM7A 4U97A 5E6JA 2C0IA 3A7IA 3NZ0A 4IC8A 4IWOA 1YXSA 4ITJA 4V05A 3RAKA 4R3DA 2L7IA 5LMNM 2BILB 3BLHA 3K9OA 3NWLA 4GHLA 3I79A 4DF3A 3VHKA 1CM8A 3FKEA 2OIBA 4UN2B 2KULA 2PVNA 5HNIX 5HTBA 4QT1A 3QQUA 1XC8A 2RKUA 1ND4A 2UUBM 4DR4M 3BHUA 2I40A 1ERKA 1EH4A 1JKTA 4G3EA 2B1PA 3RPSA 4V01A 5F4NA 2WMSA 3FC1X 4OLIA 2JY7A 4PF4A 1NY5A 4GC5A 1Y6BA 3DLZA 4OTQA 4F6WA 4DGMA 4UMRA 3KFUG 5DMZA 1MRYA 4GT4A 4QDVA 5JT2A 1DO2A 5CVGA 3GLGA 4NM7A 3KKVA 3B7NA 1UNHA 4YLJA 2X6EA 1KUTA 4NSOB 2JIIA 3LAUA 3KC3A 3WE8A 5F20A 4D28A 4GFGA 2XK7A 5IQHA 3RI1A 2J4ZA 2YLEA 4NFNA 3E8EA 2C6IA 4UALA 4MGIE 1OAOC 4PDYA 1NJFA 5EH0A 4ASZA 3EZVA 2B4SB 2R3HA 5CSPA 2FSMX 3OBGA 4GS6A 3THGA 4JT3A 4L45A 5CU2A 3PP1A 3EH9A 4JS8A 5F9EA 2RL5A 5FTQA 3L9NA 3S95A 4FV1A 5FTMA 4DN5A 3NS9A 5FP6A 4DFUA 2I6LA 4M67A 5GNKA 3VUTA 4Z55A 5BVDA 4F6UA 4BDKA 3MH0A 4S2ZA 2QCUA 2DS1A 2P3GX 1GIHA 4HPUE 5DN3A 5IQCA 5M06A 5DYGA 3QGWA 2WEIA 5I3OA 1L8QA 2DAGA 1P14A 5L6OA 4M0ZA 4XLIA 1H24A 3AKJA 5KQ8A 4TUWA 2O01F 3S2PA 3GRUA 1GJSA 3BBWA 3BBTB 4IBIA 2NRUA 3PVUA 4CEGA 1IRKA 2P2HA 3UMWA 2UUEA 4JBPA 1OTRA 3W2OA 5LCJA 4ZZOA 2WAJA 4KRCA 3LMGA 4UMPA 4LGHA 3QRJA 3CTWB 1Z5BA 4XOZA 4LJ9A 4DGOA 3B8RA 3UTOA 2J7NA 2FH0A 4NW5A 5EQTA 2EXCX 1LTMA 2WQBA 3OS3A 2L7HA 3BWFA 3W0OA 2A19B 2WEVA 2XNBA 1Q8ZA 5L8KA 3E88A 2CCIA 3MDYA 2XNOA 3AXWA 3NNUA 3O71A 3NAYA 3F2AA 3L29A 3AQVA 1U4DA 3NUNA 5EXPA 4RJ5A 2VWYA 4X3JA 3F88A 4F1MA 2Z8CA 5D41A 3GP0A 5FBNC 4DBNA 4F63A 5B2MA 1IASA 4LUDA 2QHOB 1OIRA 3QTUA 2X0OA 4XV2A 2OGVA 4EHVA 4JG6A 3TV7A 1J1CA 1GIIA 4FTKA 2XSZD 3P23A 4J98A 4FWDA 3ELJA 3TNQB 1H6UA 4WT6A 5KPTA 4D81A 2Y0TA 2VD5A 4FIIA 3TKUA 4Q5EA 1XB2B 1IN7A 5E1EA 3RM6A 3II5A 4QEBA 1G41A 3PVWA 5C4LA 3SG9A 2YIYA 3MH2A 4CKIA 3KULA 4F9WA 4L6V6 4EOQA 4FKPA 4A9TA 3DU8A 2UXDM 2LHCA 1XMMA 3R9DA 2CV0A 5KHWA 1CUKA 1UU3A 5AX9A 2Y6MA 4CQGA 4S30A 4QDEA 4FCTA 4QYGA 4A4OA 3KOWE 1GNGA 2PUIA 4I4LA 2WELA 3QZHA