2WZNA

3d structure of tet3 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
b'SMVDWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPPHLRIDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINKEGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 354AA LONG HYPOTHETICAL OPERON PROTEIN FRV
molecule tags Hydrolase
source organism Pyrococcus horikoshii
publication title The Structural and Biochemical Characterizations of a Novel Tet Peptidase Complex from Pyrococcus Horikoshii Reveal an Integrated Peptide Degradation System in Hyperthermophilic Archaea.
pubmed doi rcsb
total genus 107
structure length 338
sequence length 347
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2wznA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2wznA01
4UEEA 4OC3A 4OC1A 5CBMA 7CPAA 2JEWA 2IJZA 3B3VA 3SJEA 4G1PA 3SJGA 2PJAA 2PJCA 3BHXA 3B3CA 3VATA 4TWEA 3SJFA 4R8FA 1TF8A 2C6PA 1VGYA 1M4LA 2C1CA 2ZEFA 2CTBA 2QJ8A 4KSIA 4ONWA 3D66A 2EWBA 4MRIA 2PJ0A 4MXUA 5D29A 3PB7X 4OMEA 2JBKA 5JH9A 3CDXA 2F7VA 2I3CA 3FVLA 3PB9X 2CIJA 4PXBA 5K8PA 4EWTA 4FAIA 1F57A 1YLOA 1XRYA 5K8OA 4NGNA 2JBJA 1VHEA 3B7IA 3FEEA 4IAVA 3NH5A 5LYFA 4WWVA 2PJ3A 3D7GA 1TF9A 3NFZA 1ELLP 3S9MA 3WC5A 3KHZA 2QYVA 3ISXA 1CX8A 3B2YA 2PJ8A 4H2KA 5JM6A 1QQ9A 3WC7A 3V7ZA 1FNOA 1Q7LA 1GYTA 4P10A 5LRJA 1ZLIA 3K2KA 4DYOA 3KHXA 3I1UA 4OIDA 4PXCA 4P4JA 4OC4A 2V77A 2CTCA 1ZG7A 4BD9A 4X8IA 2V8VA 5CPAA 2V8DA 5K8MA 3SJXA 4ZI6A 2ZEDA 2GU2A 2BOAA 4P4FA 3GUXA 3T8WA 2ZEOA 1HEEA 4P4BA 2PJ2A 2PE3A 1AMPA 5D8NA 3FJUA 2PJ1A 1VHOA 4AXVA 4FUUA 2AFWA 3B35A 3V38A 3IIBA 1ARMA 3KGQA 4GM5A 2POKA 4NGRA 4PXEA 1XJOA 1Z8LA 3PB6X 3PB4X 2EK9A 4UIBA 4P4IA 3MN8A 1JQGA 1XMBA 1BPMA 2HB6A 2ZEGA 3IEHA 4FBEA 3GB0A 4UF4A 1QMUA 2ZEPA 4O23A 3H8FA 2BCOA 2Q43A 2PIYA 4NJRA 5LRKA 1CP7A 4CPAA 1OBRA 3IO1A 5LYIA 2ZEHA 4FWUA 2XEGA 2GLFA 4PXDA 6CPAA 1CPSA 4ZY2A 2PCUA 2XEIA 3CPAA 1LAMA 4P45A 3HUVA 4JYWA 5LYLA 4ZX8A 3BI0A 3NH8A 4P44A 3K9TA 3DGVA 2FVGA 2AFSA 1CG2A 1CP6A 3PFEA 8CPAA 1ARLA 2PVWA 4OKOA 3IWWA 3LMSA 2XEFA 4Q7AA 2IQ6A 4K3NA 3KR4A 3PBBA 3KZWA 2Q51A 1ZG9A 1BLLE 1YMEA 1Z5RA 2AFZA 3D67A 3WC6A 2BO9A 3SI1A 4MMOA 3CT9A 4MHYA 3MRUA 4Z65A 4R7MA 1AYEA 1VIXA 2PJBA 4YWYA 4NJQA 2QVPA 1CPXA 2ZELA 4ZX9A 2ZENA 2PJ5A 2ANPA 1CBXA 3B3TA 2AFXA 1HDQA 1RTQA 4MHNA 3H8EA 2Q4ZA 4OP4A 3FH4A 3BI1A 4MCSA 4ZYQA 1Y0YA 3VARA 1Z2LA 4R76A 4PPZA 3PRTA 3CPXA 1BAVA 1UWYA 1EE3P 1R3NA 2RFHA 3FMCA 4IHMA 3GLJA 4OIWA 4F9VA 5HVGA 2GLJA 1BPNA 3PBEA 4MHPA 2PJ9A 3KI9A 1TXRA 3HLPA 3D68A 3H8GA 2PIZA 1ZLHA 3IFEA 3S9NA 1H8LA 1TKFA 3L2NA 1XBUA 2PRQA 4P4DA 1PCAA 4ZY1A 2PVVA 1F2OA 3LWUA 4A38A 1DTDA 2GREA 2AFUA 3TC8A 3KQXA 1FT7A 1YW6A 4JZ0A 2F8HA 3IC1A 4LQGA 2G9DA 1YW4A 2ZEEA 2J9AA 2AFOA 3KR5A 1LOKA 4EFDA 5JGFA 2NYQA 5THWA 1KWMA 1TKJA 4A94A 3BXMA 2EK8A 2C6CA 3RAMA 1IY7A 5J1QA 5HVFA 4OC2A 3RZAA 4NGPA 3FF3A 3FECA 2ZOFA 2NSMA 2OR4A 2ZEMA 4NGQA 5HXDA 3B3SA 5LYDA 3D7HA 1LANA 5ELYA 3ISZA 5F09A 5IB9A 3PB8X 2PJ4A 4YU9A 4OC5A 4RUHA 2AFMA 3PEIA 3NH4A 2WZNA 3N5FA 5HVHA 4NFRA 4W9YA 1NSAA 3KL9A 3FX6A 4ZY0A 2V8GA 1IGBA 2DEAA 4IK2A 5K8NA 3D4UA 1ZG8A 2O4HA 1LCPA 4B6ZA 1PYTB 4A39A 3NA6A 4EMEA 4F9UA 5DS0A 1Y7EA 2HC9A 4UIAA 3KQZA 2C6GA 3D7DA 3SI0A 4DJLA 4NGMA 5I4MA 3B3WA 3QNVA 1Y0RA 4OC0A 4UEFA 3SI2A 2WYRA 1ELMP 4X2TA 3D7FA 2PJ6A 3JRUA 2V8HA 2XEJA 3PFOA 4R6TA 1HDUA 3WABA 1TKHA 2ABZA 1YSJA 1XFOA 2OOTA 3DLJA 5LRGA 2O53A 1LAPA 4NGSA 2RB7A 2CF4A 4TNUA 3FEDA 4P6YA 2PJ7A 3IJ3A 4MHZA 3TX8A 4MCQA 3S9LA 3RBUA 3VH9A 1DE4C 1LFWA 2VL1A 4WJBA 3WT4A 4UEZA 2IMOA 4PQAA 4MCRA 4A37A 1R43A 4X3RA 3KASA 4NGTA 4MCPA 1F2PA 2ZOGA 4P4EA 4F8ZA 4DUKA
chains in the Genus database with same CATH superfamily
2C4UA 1W35A 1WORA 4OC3A 5DWNA 3N7ZA 2D3LA 7CPAA 5JPHA 2J8RA 2OTJB 2OU2A 2JN9A 1I18A 1JB9A 4XMYA 1N08A 2BPOA 2ZZFA 1YHQB 4B43A 3SJGA 4CS0B 2PJCA 1YVOA 3IU2A 4ASUA 4TWEA 1HA3A 3SJFA 4B3FX 1I1DA 3D26A 3AVVA 4CRZB 1J4JA 2PR8A 2D3NA 1VGYA 4XL9A 1QSOA 2CW5A 2ZEFA 1YGHA 2QJ8A 2VQYA 1FDRA 4KSIA 2PSWA 2YGWA 3DDDA 3U2QA 3T90A 3CCEB 4RCYA 4MRIA 2PJ0A 1VQPB 5D29A 2YWEA 2C5HA 3PB7X 4E2AA 2OTLB 2GJKA 2F7VA 4CGPA 2I3CA 2BL1A 1ZO0A 3PGPA 4KOXA 3R9FA 4PXBA 1WP6A 1T5EA 4EWTA 4RDJA 1KQSB 3G8WA 2FSRA 2ZL6A 3BJ8A 1YX0A 4RD3A 1BMFA 5LYFA 4WWVA 3ZJ0A 3ONYA 3D7GA 3ASSA 2YWGA 4XNFA 4G5GA 3ASRA 2WZPP 3PA2A 1CJWA 4A30A 1B2RA 2OBRA 5AG6A 1K28D 1FNOA 4HIZA 2X7BA 3BY1A 3BQJA 4R71A 4JXQA 4L89A 4OIDA 3CESA 4P4JA 4OC4A 2CTCA 1M4GA 4U9UA 3GVKA 1ZG7A 2VYQA 3S6KA 1WSVA 4X8IA 2V8VA 5F4OA 3Q6RA 1EFTA 3BCFA 5K8MA 3GUXA 5HZBA 4X06A 2GFQA 4B44A 5GV8A 4MY3A 3FJUA 3JTKA 4WZEA 2PJ1A 4ZGQB 4YRHA 2AFWA 3OJXA 4DQKA 2VJIA 5GCNA 2Z3OA 4PXEA 5C82A 2XNDA 4RD4A 2QGGA 5IB0A 3OE7A 2CK3A 3MN8A 1JQGA 1UD4A 2Z3LA 4QVAA 2DCUA 1KUVA 3NE8A 4X0CA 2BSAA 2V7TA 3H8FA 1N8RD 4MBUA 2BCOA 1EP3B 2PIYA 2REFA 5B6IA 3WYAA 5LRKA 3IO1A 3AVTA 4PGOA 2XZLA 2XEGA 2BF4A 4ZY2A 4YALA 1AUGA 4BMHA 3D2MA 1IIDA 4QVJA 4MYUA 1YLEA 4ZX8A 3IU1A 3GVLA 4IF5A 1IB0A 4NF1A 1NRKA 4Y9RA 2FVGA 4JMQA 5L46A 1S7KA 2JLMA 2Z0ZA 1XF8A 4F6AA 4M6HA 2RC6A 3JQQA 2GIVA 1JA1A 2PVWA 2XEFA 4Q7AA 4CYPA 1H42A 3PBBA 3KZWA 5BWAB 2Q6IA 5F47A 1Z5RA 1M4IA 5AGEA 4Z4ZA 4G7XA 1MK4A 3TOBA 3CCMB 2QIRA 2BM0A 2BO9A 1PU9A 1IYLA 3MRUA 4R7MA 5F4MA 5KNLA 5BSXA 1AYEA 1VIXA 4NJQA 5H59A 2XOKA 1YJNB 1PJ5A 2PJ5A 1N05A 2V7UA 1G7SA 4KKSA 1FRQA 2V31A 3BCDA 5DWMA 1Y0YA 4LX9A 2QTLA 4JJXA 4X7DA 4Z4WA 3CPXA 1YK3A 3FMCA 3AGPA 2VNIA 4IHMA 1X12A 4OIWA 5HVGA 4MFZA 2VXKA 1IOFA 5G1ZA 3RNZA 2I00A 1Z8WA 3ASTA 3B8HA 3WXMA 3BC9A 1H8LA 1X10A 3CXQA 5H5JA 1AIPA 4ZY1A 2QMUA 2WJYA 2XZPA 3SEJA 3OEEA 2VBQA 1VQOB 4ACBA 3FYNA 4Q7JB 4Y49C 2AE6A 1IJEA 4ACAA 3TC8A 2W6JA 1YW6A 3SJPA 3IWGA 3IC1A 4PC7A 3FPKA 1M1KD 2J9AA 2AFOA 1QGAA 5JGFA 2NYQA 4A94A 3E20A 5E6TA 1GAWA 2C6CA 1IY7A 4OC2A 3BY2A 4X07A 2Q4YA 4CQJA 1BLIA 2NSMA 4AB7A 3JVNA 4LBYA 2X6YA 4XN3A 4UBRA 5ISVA 1BX0A 3D7HA 3CB4A 1LANA 2B5OA 3PB8X 4ZCMA 1KZFA 3TO6A 1GR1A 1KK3A 3GKRA 2GE3A 4ZY0A 3GYAA 4MHDA 4B48A 2R1IA 1IGBA 2DEAA 1EFCA 4KKTA 3Q38A 4QC6A 3QSYA 5BSYA 1PYTB 4OPOA 1I12A 4YAFA 3EO4A 4UZEA 2EUIA 1Y7EA 5TY0A 2W6IA 2Z3MA 5IYQA 3CC2B 5J3OA 1SQHA 2C6GA 1ZM3A 4XLFA 1OB5A 4KSFA 4IUSA 1DDIA 1M4DA 3H4QA 1YQEA 4NGMA 3A8JA 3QNVA 3DDYA 4CAFA 5HMNA 4YAWA 3H9NA 3I9SA 3ASQA 3SI2A 3QB8A 1WOPA 5JQ4A 1ELMP 3LODA 2Q44A 4ZV4A 4RS2A 5IK2A 4TKOB 2V8HA 4RD2A 4FK8A 3W2FA 1TVCA 3W2EA 1V0FA 3MGDA 1YSJA 2BVNA 1D2EA 2VBUA 2P6EA 2K5TA 5G20A 4CRYB 4NGSA 2P3MA 1VF7A 2I79A 1KMHA 4CYNA 4TNUA 4XM3A 4Z1MA 1VQ5B 4Y9UA 3CC7B 4MCQA 4MFQA 3W2HA 2FIWA 3IWEA 3RBUA 2A4NA 2R7HA 4DNRB 2VL1A 4AVBA 4C2XA 2Z10A 3LNNA 1P4NA 1I8DA 2FXFA 3CCUB 4B5PA 3U6KA 3KASA 4NGTA 3GSIA 4MCPA 4ONUA 4AVZA 1FNDA 1HVXA 1W87A 4DUKA 4YELA 5THXA 1Y9WA 4XLAA 1VLOA 5IYRA 3B8GA 1V5VA 2B4BA 4A31A 3AVUA 2X6XA 1YX2A 4PC3A 2JEWA 2CNMA 1E62A 3CCQB 2IJZA 1K9MD 3Q6QA 4KOUA 1QUEA 1RQPA 2PJAA 1Z8XA 4DK1A 3BHXA 1K4JA 4H89A 2CC2A 2ZTGA 4YXWA 2BSWA 3BNWA 4C0SA 4FXUA 3P2FA 1IU8A 4MFKA 2VBVA 2CRVA 4QV2A 3FNCA 4K30A 4LBZA 4P1VA 2B5GB 4XNHB 3CW2A 1TIQA 4B11A 2P0WA 5DN6A 2EO8A 4F7DA 3I3GA 3F8KA 1N0VC 3PB9X 1ON0A 5IYPA 4FAIA 1F57A 4TMTA 4UFVA 1GO2A 1XRYA 5K8OA 2WPXA 3B7IA 2NV4A 1XE1A 3FEEA 4IAVA 1Z4EA 4Z4SA 2OH1A 3EC4A 4MFPA 4HNXB 4II9A 1KK2A 1UD3A 1G7CA 3WC5A 3CCJB 2JIZA 2QYVA 5FNZA 2Q6LA 1IJFA 3WBJA 4H2KA 3V7ZA 1Q7LA 1N71A 2XEXA 4P10A 5LRJA 1ZLIA 2B3UA 2EIXA 4DYOA 3CXPA 4PXCA 4YGOA 4TMXA 3FRMA 4XPKA 2AHOA 3TT2A 1T6ZA 3FBUA 1EWYA 4TMWA 4Z4UA 4M0LA 1E3XA 4I49A 4UA3A 4TN1A 3CRZA 3ZZ0A 3ZZUA 2BOAA 2D4PA 4N3GA 4NCNA 2Z6BD 4P4BA 2Q6KA 2PJ2A 2GK6A 2PE3A 3OW2B 1AMPA 1R5NA 2V7WA 2ZXIA 4ROXA 1W0JA 1ARMA 4II2A 1E43A 1YIJB 2POKA 4J0QA 3TO7A 3QFRA 4NNJA 2XNCA 1Z8LA 1Z8TA 4KOSA 4P4IA 2BGIA 3PVDA 3CP2A 2ZEGA 1BPMA 1U6MA 4FBEA 5F48A 5AG4A 2ZEPA 4R9MA 5AG7A 2PR1A 2ZITA 3ZC3A 2Q43A 2WUUA 4B12A 3S6HA 4MFJA 2OBTA 4LBWA 4CPAA 1YITB 3OPOA 4HPSA 2CNDA 3SXNA 4M6GA 2XEIA 2H5MA 1RQRA 3CPAA 1KZLA 3CD6B 2VBSA 4UCNA 4MJ8A 1KC8D 1NBMA 1OB0A 3LVBA 1RO5A 4JLYA 4P44A 1EP1B 1PKVA 1EFRA 1XOVA 3IGRA 2AFSA 1JA0A 3R6JA 3WNDA 3CCRB 3OJWA 1CG2A 2B4DB 1WU8A 3CMAB 3I1FA 1IICA 1ARLA 3BJ7A 4KVXA 3IWWA 2J8MA 3FXTA 4P12A 1NE9A 2IQ6A 3H5ZA 2Q51A 1ZG9A 2OK8A 1BLLE 1YMEA 3WC6A 3OP1A 4XKWA 2FCKA 4CAVA 3BH4A 3GIRA 3TOAA 2GK7A 3SI1A 3CZXA 4RD0A 4Z4VA 3ZZTA 3CP8A 2PJBA 4CAXA 2QA4B 2OZUA 1CPXA 4ZX9A 4CAEA 3SLNA 2P6GA 2B5GA 1UD6A 2R8VA 3B3TA 2B4DA 1HDQA 2ZZQA 3H8EA 4G1VA 4XLCA 2Q4ZA 2PDOA 2C2WA 1CQXA 3JUWA 1A8PA 4ZYQA 1Z2LA 4R76A 2B3VA 3OAAA 2HDNB 1WTHD 4UFWA 1IHMA 1R3NA 1CM0A 2GLJA 2DYIA 4MHPA 3KI9A 1I21A 4YEJA 3H8GA 1ZLHA 5KTAA 1NJID 2YWFA 1SKQA 4RPBA 1F2OA 4GXHA 1MJBA 1DTDA 3LQ6A 3QFSA 3A35A 1D1NA 1VQ7B 2VJJA 5IYWA 1FT7A 4II3A 4JZ0A 5IYNA 2QEXB 4LQGA 1YW4A 3G4SB 1VQLB 2ZW4A 3KR5A 4TMVA 5THWA 1Q82D 4XKVA 3WBKA 3BXMA 1GJRA 4XPDC 2EK8A 2ZL7A 4KOYA 3R9GA 5AG5A 4TSFA 3RZAA 3VO2A 3NE7A 5IV0A 4Q36A 3T9YA 3QE2A 2ZOFA 4PSWA 2Q04A 2ZEMA 4NBSA 4NGQA 4OOXA 2DEUA 5LYDA 4B5PB 3ASPA 3PP9A 5AN9A 4AG9A 3ISZA 5IB9A 3JQRA 4XLEA 2E1RA 3DR6A 3AVYA 4RUHA 2JJ1A 5F46A 3PEIA 1W34A 2X85A 1QX4A 4W9YA 3KL9A 5FA6A 1M44A 2NPFA 4OPVA 5J8FA 1VQ4B 5K8NA 5LMZA 1ZG8A 1YVKA 4AF6A 2F1LA 1LCPA 4B6ZA 1F20A 4ZGYB 2EBJA 3U6BA 4EVYA 1WK4A 2DIEA 5DS0A 1W9XA 4M85A 3SXOA 3FKSA 1S60A 3D7DA 4AVCA 3T53B 3SI0A 4ZGNB 2FE7A 1MJAA 2JJ2A 4UFXA 4DJLA 1VHSA 1E64A 1ZM4A 3OZWA 1Y0RA 4UEFA 2X6WA 4UWIA 1OHHA 3VNUA 3A8KA 4XQFA 3JRUA 4XD7A 1F60A 4PAAA 1W2BB 4R6TA 4B5OA 4BBHA 2FIAA 3WABA 3Q39A 3BLNA 1H8HA 1UD8A 3JQPA 4KZTA 2OOTA 3DLJA 4WZTA 4BPRA 1QSTA 2PQ8A 2RB7A 4RD1A 2HCJB 3TO9A 3FEDA 4P6YA 2DPTA 1IOIA 2HQYA 1QFYA 3A9LA 1DE4C 2ZXVA 4XONA 2X53S 4FWTA 4G6IA 2BV3A 4RDKA 3WT4A 4M6IA 2V7VA 2Q7BA 2G0BA 1FNBA 4MCRA 4XOPA 4EH1A 1R43A 4X3RA 1IB1E 1VJSA 2ZBVA 2PRBA 4J3GA 1BQEA 4F8ZA 4MI4A 5HH1A 1KRHA 4HNWB 1UD2A 2REEA 3V7AA 2WR8A 2XZOA 4QBJA 5EMIA 2FX3A 4P26A 3VR6A 2ZW5A 2JDIA 3WR7A 3PZJA 3ZBUA 5HKKA 1Q2DA 3RY8A 4P6VF 4A32A 4JWPA 3ZUGA 1DDGA 2Z3PA 4H6ZA 2QECA 1ZM9A 2C77A 2YNCA 4XLHA 5A27A 2R9VA 3C26A 2XNJA 3WY9A 1TF8A 3WNBA 3B82A 2OYNA 4FD5A 1M4LA 2LZJA 2C1CA 1Q86D 1Q81D 2CTBA 3A3GA 5J8CA 4AF7A 4ONWA 3FIXA 4PK3A 4AG7A 2D9RA 4KS9A 2Z3KA 3CCVB 3D66A 4P2NA 2EWBA 3HAGA 4PC2A 4OMEA 1KJZA 2JBKA 5JH9A 4RM0A 2ZTNA 4OAEA 3FVLA 4DNTB 2CIJA 4P9SA 1Q2CA 3NE5B 3A8IA 3PUMA 1OZPA 4NGNA 4RCZA 2JBJA 4Z4RA 3E0KA 4R57A 4RI1A 1CNEA 1FY7A 3OZVA 2FT0A 1KD1D 1TF9A 3T56B 3S9MA 1UMKA 3KHZA 4A33A 3B2YA 2PJ8A 4Q38A 5JM6A 1QQ9A 4XNHC 1GYTA 2ARHA 4R3LA 3K2KA 2P6FA 3KHXA 3I1UA 2Q4VA 4KVME 4M1KA 1WOOA 4C7HA 1S7FA 4CGLA 3CC4B 4KUBA 4AC9A 2OBSA 5CPAA 2V8DA 1KK0A 3SJXA 4B4DA 4E0AA 4ZI6A 2ZEDA 4FN5A 2GU2A 3T8WA 4KKUA 2ZEOA 2YWHA 1N06A 1HEEA 3RYOA 3OWCA 4XR6A 2CNTA 3VWDA 1VHOA 4FUUA 3CCSB 5H86A 4C68A 3V38A 4QVTA 4UZUA 3IIBA 3KGQA 2C5BA 4NGRA 4U9ZA 3PB6X 3PB4X 2EK9A 1L0CA 2ZW7A 4AVAA 4R87A 5HZAA 4PC1A 2F1MA 1S5KA 1XMBA 3IEHA 3GB0A 4UF4A 2QN6A 1QMUA 3VMFA 5GV7A 3H94A 1KUXA 2WPDA 4FD6A 1H8EA 1CP7A 1OBRA 5LYIA 1G7RA 4FWUA 2GLFA 1FRNA 6CPAA 4PSXA 1CPSA 2PCUA 4C7IA 4BINA 1N0UA 4HE6A 3HUVA 1E3ZA 3QAHA 2CXAA 4JYWA 1BO4A 2VZYA 4C43A 1NMTA 3NH8A 2C27A 3DGVA 4LQ6A 1JWQA 2PC1A 2QTZA 3ZIAA 1CP6A 1DG1G 3AGQA 2QDXA 3W2IA 4OKOA 5A89A 1I7PA 3W5HA 2OZGA 3D3SA 2EVNA 5TR9A 2ZZEA 1M1DA 2HLDA 4KOTA 2M5SA 2CY2A 4B3XA 4MMOA 4MHYA 3EFAA 2X3UA 3PUNA 4PV6A 2V7XA 1GHEA 3G05A 4KOWA 4WQMA 3QAYA 2ZENA 2BN4A 4CGOA 1OGIA 1CBXA 2BGJA 1RTQA 4C2ZA 4MHNA 1NB9A 2YNCC 2R6HA 3FH4A 3TTHA 4WZKA 2PLFA 2R98A 1NB0A 3EXNA 3VARA 1Z9UA 1WWZA 4ORFA 3F0AA 3PRTA 3GY9A 3AVWA 1BAVA 4LBVA 1UWYA 4KLVA 2RFHA 3W91A 1YI2B 3T51B 1UD5A 1BPNA 2PJ9A 3MCAA 1TXRA 2OZHA 3D68A 2GJPA 2QE7A 2PIZA 2JDDA 3P2HA 4WZLA 2VZLA 4A2ZA 3L2NA 4Y49B 1D8TA 1PCAA 2KCWA 4MYTA 4YAOA 1VQKB 4A38A 2VBTA 4XN0A 3V76A 2AFUA 3V8IA 4KVOE 1R5OA 2BM1A 4NXYA 1UFHA 4OP7A 2G9DA 1VKCA 2ZEEA 4Y7CA 2ATRA 2ZXHA 4FD4A 2DY1A 5J35A 1LOKA 4EFDA 2GANA 4XORA 5DSZA 1MABA 1WOSA 4F0XA 4PK2A 1NSLA 2Q7SA 2X8KA 3RAMA 3JU4A 4RLZA 5HVFA 4IW3B 2OB0A 4HNYB 3FF3A 5I0CA 1TUIA 1XIXA 2OR4A 1OGJA 5HXDA 1G7TA 1E1RA 5ELYA 4B14A 4ZCLA 2YNDA 4KUAA 2PJ4A 2CNSA 3NH4A 1Y7RA 1E79A 3N5FA 1VQ8B 5HVHA 1VQNB 1NSAA 3FX6A 2V8GA 4C2YA 4M3SA 4G7WA 5EC4A 2O4HA 4CYOA 3S6FA 3ZZIA 3R1KA 2BMWA 4E8OA 3LACA 2J8NA 2B58A 2HC9A 3DSBA 3KQZA 4L8AA 1KK1A 4DNCA 2C4TA 4NSQA 1PJ7A 2F4NA 3B3WA 1HZEA 2KVOA 2XGJA 1WDTA 1DARA 2WSSA 1YREA 4OC0A 1QFZA 1ZM2A 2Z3NA 2X0KA 2WYRA 3FJOA 3D7FA 2PJ6A 3ES9A 2V7QA 3PFOA 1Y9KA 4M2LA 1QGYA 1TKHA 1VQ9B 1XB2A 2DPSA 2O53A 5H84A 5LRGA 4OOSA 2ZBUA 5KW9A 4A95A 4M4SA 3IJ3A 4MHZA 1ELOA 2ZZGA 4MFLA 3SJZA 3LD2A 5HXBA 3DNSA 4X7EA 3OOCA 5FIUA 1W0KA 4PABA 2D74A 4WJBA 5JBQA 2ZW6A 4UEZA 1BPLA 2IMOA 4PQAA 5TV2A 3TE4A 4KSAA 3G71B 1AMOA 1F2PA 2ZOGA 4GS4A 4UEEA 2Q6OA 4QHYA 4OC1A 5CBMA 1VQMB 1B6BA 3B3VA 2YNEA 1S7NA 3SJEA 3LQEA 4G1PA 4UWJA 5KTDA 3QFTA 4L8JA 1U2RA 1EXMA 3B3CA 4XPLA 1N07A 3VATA 1GAQA 3CPWB 1KUYA 4H9GA 4R8FA 4RPDA 2C6PA 3KEWA 1Q7YD 2VNKA 2PIAA 5IX3A 3G6EB 2C78A 3MHPA 1BJKA 3GIUA 2BEIA 4OPSA 4G1BA 4MXUA 1XMTA 3ZBTA 2O28A 3CDXA 2RC4A 5KSWB 1QH0A 1XE4A 1PJ6A 5K8PA 2QMLA 1YLOA 1Z4RA 4QB9A 2E1BA 3W5UA 2I1LA 3OZUA 1VHEA 4OADA 3NH5A 4LC0A 2PJ3A 3W2GA 3F5BA 3NFZA 3FB3A 1XEBA 5FL7A 3QFCA 1ELLP 2RC5A 1T6XA 1P4MA 1CNFA 3ISXA 1CX8A 4B47A 3WC7A 4KLWA 4NCZA 4UZFA 3D8PA 4UCPA 1EP2B 4CGNA 3CXCB 1K73D 2V77A 4N3NA 2G3AA 4YHBA 4BD9A 1Q2YA 2WSAA 4U5YA 1MRZA 4U9YA 3FPPA 4Z4TA 4P4FA 3MMPA 4CYQA 4XOTA 5D8NA 1EFUA 1B87A 3W6SA 4AXVA 3ONUA 1OB2A 1SM4A 3B35A 4P25A 3CCLB 4GM5A 1QSNA 4GQNA 1XJOA 4UIBA 3E1YE 2VEZA 2HB6A 3G3SA 3VO1A 4X05A 4O23A 4NJRA 4K1XA 3LO8A 4YFJA 3CMEB 1M90D 2ZEHA 5A8AA 3R9EA 4PXDA 2B7BA 3UY5A 3SLDA 4P3YA 4RD6A 4P45A 1LAMA 1TTTA 5LYLA 3BI0A 4KOVA 1R5BA 4X5KA 3K9TA 3OEHA 4QFMA 3TCVA 2JEVA 1XQBA 3VNVA 3CXSA 4M53A 3PFEA 3W5VA 8CPAA 1QVFB 3LMSA 1FNMA 3P26A 1KTVA 4K3NA 3KR4A 1JNYA 3R6KA 4P3IA 4ZCIA 1COWA 1QFJA 2AFZA 3D67A 2ZPAA 3WNCA 1BOBA 3PENA 3W6XA 1WSRA 4NEXA 4F0YA 5EMNA 3AVXA 1V0CA 3CT9A 4DK0A 4Z65A 2J7KA 2IL4A 1K8AD 5G22A 4YWYA 1IYKA 4ZBGA 3I55B 2QVPA 1LRZA 5TRDA 2ZELA 2JDCA 1J9ZA 5C88A 2ANPA 3J81k 4RJLA 1YJ9B 1R57A 2DETA 2DXQA 3S6GA 2AFXA 1QSMA 2WPWA 2DOGA 3GQBA 4OP4A 2Q0YA 3Q3AA 4RDLA 3BI1A 4MCSA 1P0HA 5FVJA 3GVJA 4PPZA 1EE3P 2HUZA 3GLJA 3K9UA 4F9VA 4XPDB 3SKBA 3PBEA 4KORA 3ZPNA 1FX0A 3HLPA 1JJ2B 1GVHA 4JD6A 3CMMA 1YJWB 3IFEA 4Z4YA 4B13A 3S9NA 1TKFA 2G3TA 5F49A 1XBUA 4HE5A 2PRQA 4P4DA 2HMAA 1PUAA 2PVVA 4LUAA 3LWUA 5FO1A 4QUSA 1QG0A 2GREA 5EBVA 4OOVA 4OLLA 5FO0A 5KTCA 3KQXA 3OW7A 5G21A 3R95A 2PMDA 2FL4A 2F8HA 4CAWA 1E63A 2F43A 2BUEA 2HV2A 3P27A 3PA1A 3EY5A 5A88A 1KWMA 1MJ9A 1TKJA 1YR0A 1S4MA 1QVGB 3OFNA 3CTAA 4HKFA 4DQLA 5J1QA 2DERA 3KKWA 4NGPA 3FECA 1VQ6B 1B23P 2ODFA 1A2ZA 1T6YA 3B3SA 1VLYA 3SHPA 5F09A 3RO0A 3D2PA 4YU9A 4OC5A 4JXRA 2AFMA 4UCMA 2GJRA 1Q9SA 2AJ6A 2Y0MA 2WZNA 3VWEA 2B7CA 4NFRA 1NDHA 1S0UA 4IK2A 2GPJA 3D4UA 4P22A 2VI7A 3DR8A 4QUZA 4A39A 3NA6A 4EMEA 4F9UA 4TT3A 2VNHA 3OKXA 4UIAA 4R3KA 2FS5A 4X7FA 2OK7A 4UAJA 2WJVA 4FD7A 5A28A 2D4OA 3TFYA 2GQFA 2F5IA 5I4MA 4YAUA 2VNJA 4TMZA 1E1QA 4PC6A 2VZZA 3A1PA 2ZL5A 4X2TA 4X7CA 4H6UA 5CNPA 3WQZA 4MY0A 2XEJA 1HDUA 1V0EA 3B78A 2ABZA 1ZUNB 1QSRA 4RN7A 2CBXA 1QUFA 1XFOA 1S72B 5F4JA 1S7LA 1SKYB 1LAPA 2EFGA 2CF4A 3R96A 4B10A 2PJ7A 3TX8A 3S9LA 3VH9A 1RXTA 4B3GA 1TLLA 4E0FA 5CDFA 2NMTA 3I56B 1LFWA 1H85A 2DF5A 4CGMA 1S3ZA 3A3BA 4A37A 2Z11A 1FNCA 4P4EA 5E96A 1BX1A 2V4DA 1WPCA 1QGZA
chains in the Genus database with same CATH topology
4UEEA 4OC3A 4OC1A 5CBMA 7CPAA 2JEWA 2IJZA 3B3VA 3SJEA 4G1PA 3SJGA 2PJAA 2PJCA 3BHXA 3B3CA 3VATA 4TWEA 3SJFA 4R8FA 1TF8A 2C6PA 1VGYA 1M4LA 2C1CA 2ZEFA 2CTBA 2QJ8A 4KSIA 4ONWA 3D66A 2EWBA 4MRIA 2PJ0A 4MXUA 5D29A 3PB7X 4OMEA 2JBKA 5JH9A 3CDXA 2F7VA 2I3CA 3FVLA 3PB9X 2CIJA 4PXBA 5K8PA 4EWTA 4FAIA 1F57A 1YLOA 1XRYA 5K8OA 4NGNA 2JBJA 1VHEA 3B7IA 3FEEA 4IAVA 3NH5A 5LYFA 4WWVA 2PJ3A 3D7GA 1TF9A 3NFZA 1ELLP 3S9MA 3WC5A 3KHZA 2QYVA 3ISXA 1CX8A 3B2YA 2PJ8A 4H2KA 5JM6A 1QQ9A 3WC7A 3V7ZA 1FNOA 1Q7LA 1GYTA 4P10A 5LRJA 1ZLIA 3K2KA 4DYOA 3KHXA 3I1UA 4OIDA 4PXCA 4P4JA 4OC4A 2V77A 2CTCA 1ZG7A 4BD9A 4X8IA 2V8VA 5CPAA 2V8DA 5K8MA 3SJXA 4ZI6A 2ZEDA 2GU2A 2BOAA 4P4FA 3GUXA 3T8WA 2ZEOA 1HEEA 4P4BA 2PJ2A 2PE3A 1AMPA 5D8NA 3FJUA 2PJ1A 1VHOA 4AXVA 4FUUA 2AFWA 3B35A 3V38A 3IIBA 1ARMA 3KGQA 4GM5A 2POKA 4NGRA 4PXEA 1XJOA 1Z8LA 3PB6X 3PB4X 2EK9A 4UIBA 4P4IA 3MN8A 1JQGA 1XMBA 1BPMA 2HB6A 2ZEGA 3IEHA 4FBEA 3GB0A 4UF4A 1QMUA 2ZEPA 4O23A 3H8FA 2BCOA 2Q43A 2PIYA 4NJRA 5LRKA 1CP7A 4CPAA 1OBRA 3IO1A 5LYIA 2ZEHA 4FWUA 2XEGA 2GLFA 4PXDA 6CPAA 1CPSA 4ZY2A 2PCUA 2XEIA 3CPAA 1LAMA 4P45A 3HUVA 4JYWA 5LYLA 4ZX8A 3BI0A 3NH8A 4P44A 3K9TA 3DGVA 2FVGA 2AFSA 1CG2A 1CP6A 3PFEA 8CPAA 1ARLA 2PVWA 4OKOA 3IWWA 3LMSA 2XEFA 4Q7AA 2IQ6A 4K3NA 3KR4A 3PBBA 3KZWA 2Q51A 1ZG9A 1BLLE 1YMEA 1Z5RA 2AFZA 3D67A 3WC6A 2BO9A 3SI1A 4MMOA 3CT9A 4MHYA 3MRUA 4Z65A 4R7MA 1AYEA 1VIXA 2PJBA 4YWYA 4NJQA 2QVPA 1CPXA 2ZELA 4ZX9A 2ZENA 2PJ5A 2ANPA 1CBXA 3B3TA 2AFXA 1HDQA 1RTQA 4MHNA 3H8EA 2Q4ZA 4OP4A 3FH4A 3BI1A 4MCSA 4ZYQA 1Y0YA 3VARA 1Z2LA 4R76A 4PPZA 3PRTA 3CPXA 1BAVA 1UWYA 1EE3P 1R3NA 2RFHA 3FMCA 4IHMA 3GLJA 4OIWA 4F9VA 5HVGA 2GLJA 1BPNA 3PBEA 4MHPA 2PJ9A 3KI9A 1TXRA 3HLPA 3D68A 3H8GA 2PIZA 1ZLHA 3IFEA 3S9NA 1H8LA 1TKFA 3L2NA 1XBUA 2PRQA 4P4DA 1PCAA 4ZY1A 2PVVA 1F2OA 3LWUA 4A38A 1DTDA 2GREA 2AFUA 3TC8A 3KQXA 1FT7A 1YW6A 4JZ0A 2F8HA 3IC1A 4LQGA 2G9DA 1YW4A 2ZEEA 2J9AA 2AFOA 3KR5A 1LOKA 4EFDA 5JGFA 2NYQA 5THWA 1KWMA 1TKJA 4A94A 3BXMA 2EK8A 2C6CA 3RAMA 1IY7A 5J1QA 5HVFA 4OC2A 3RZAA 4NGPA 3FF3A 3FECA 2ZOFA 2NSMA 2OR4A 2ZEMA 4NGQA 5HXDA 3B3SA 5LYDA 3D7HA 1LANA 5ELYA 3ISZA 5F09A 5IB9A 3PB8X 2PJ4A 4YU9A 4OC5A 4RUHA 2AFMA 3PEIA 3NH4A 2WZNA 3N5FA 5HVHA 4NFRA 4W9YA 1NSAA 3KL9A 3FX6A 4ZY0A 2V8GA 1IGBA 2DEAA 4IK2A 5K8NA 3D4UA 1ZG8A 2O4HA 1LCPA 4B6ZA 1PYTB 4A39A 3NA6A 4EMEA 4F9UA 5DS0A 1Y7EA 2HC9A 4UIAA 3KQZA 2C6GA 3D7DA 3SI0A 4DJLA 4NGMA 5I4MA 3B3WA 3QNVA 1Y0RA 4OC0A 4UEFA 3SI2A 2WYRA 1ELMP 4X2TA 3D7FA 2PJ6A 3JRUA 2V8HA 2XEJA 3PFOA 4R6TA 1HDUA 3WABA 1TKHA 2ABZA 1YSJA 1XFOA 2OOTA 3DLJA 5LRGA 2O53A 1LAPA 4NGSA 2RB7A 2CF4A 4TNUA 3FEDA 4P6YA 2PJ7A 3IJ3A 4MHZA 3TX8A 4MCQA 3S9LA 3RBUA 3VH9A 1DE4C 1LFWA 2VL1A 4WJBA 3WT4A 4UEZA 2IMOA 4PQAA 4MCRA 4A37A 1R43A 4X3RA 3KASA 4NGTA 4MCPA 1F2PA 2ZOGA 4P4EA 4F8ZA 4DUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEE A;  4OC3 A;  4OC1 A;  5CBM A;  7CPA A;  2JEW A;  2IJZ A;  3B3V A;  3SJE A;  4G1P A;  3SJG A;  2PJA A;  2PJC A;  3BHX A;  3B3C A;  3VAT A;  4TWE A;  3SJF A;  4R8F A;  1TF8 A;  2C6P A;  1VGY A;  1M4L A;  2C1C A;  2ZEF A;  2CTB A;  2QJ8 A;  4KSI A;  4ONW A;  3D66 A;  2EWB A;  4MRI A;  2PJ0 A;  4MXU A;  5D29 A;  3PB7 X;  4OME A;  2JBK A;  5JH9 A;  3CDX A;  2F7V A;  2I3C A;  3FVL A;  3PB9 X;  2CIJ A;  4PXB A;  5K8P A;  4EWT A;  4FAI A;  1F57 A;  1YLO A;  1XRY A;  5K8O A;  4NGN A;  2JBJ A;  1VHE A;  3B7I A;  3FEE A;  4IAV A;  3NH5 A;  5LYF A;  4WWV A;  2PJ3 A;  3D7G A;  1TF9 A;  3NFZ A;  1ELL P;  3S9M A;  3WC5 A;  3KHZ A;  2QYV A;  3ISX A;  1CX8 A;  3B2Y A;  2PJ8 A;  4H2K A;  5JM6 A;  1QQ9 A;  3WC7 A;  3V7Z A;  1FNO A;  1Q7L A;  1GYT A;  4P10 A;  5LRJ A;  1ZLI A;  3K2K A;  4DYO A;  3KHX A;  3I1U A;  4OID A;  4PXC A;  4P4J A;  4OC4 A;  2V77 A;  2CTC A;  1ZG7 A;  4BD9 A;  4X8I A;  2V8V A;  5CPA A;  2V8D A;  5K8M A;  3SJX A;  4ZI6 A;  2ZED A;  2GU2 A;  2BOA A;  4P4F A;  3GUX A;  3T8W A;  2ZEO A;  1HEE A;  4P4B A;  2PJ2 A;  2PE3 A;  1AMP A;  5D8N A;  3FJU A;  2PJ1 A;  1VHO A;  4AXV A;  4FUU A;  2AFW A;  3B35 A;  3V38 A;  3IIB A;  1ARM A;  3KGQ A;  4GM5 A;  2POK A;  4NGR A;  4PXE A;  1XJO A;  1Z8L A;  3PB6 X;  3PB4 X;  2EK9 A;  4UIB A;  4P4I A;  3MN8 A;  1JQG A;  1XMB A;  1BPM A;  2HB6 A;  2ZEG A;  3IEH A;  4FBE A;  3GB0 A;  4UF4 A;  1QMU A;  2ZEP A;  4O23 A;  3H8F A;  2BCO A;  2Q43 A;  2PIY A;  4NJR A;  5LRK A;  1CP7 A;  4CPA A;  1OBR A;  3IO1 A;  5LYI A;  2ZEH A;  4FWU A;  2XEG A;  2GLF A;  4PXD A;  6CPA A;  1CPS A;  4ZY2 A;  2PCU A;  2XEI A;  3CPA A;  1LAM A;  4P45 A;  3HUV A;  4JYW A;  5LYL A;  4ZX8 A;  3BI0 A;  3NH8 A;  4P44 A;  3K9T A;  3DGV A;  2FVG A;  2AFS A;  1CG2 A;  1CP6 A;  3PFE A;  8CPA A;  1ARL A;  2PVW A;  4OKO A;  3IWW A;  3LMS A;  2XEF A;  4Q7A A;  2IQ6 A;  4K3N A;  3KR4 A;  3PBB A;  3KZW A;  2Q51 A;  1ZG9 A;  1BLL E;  1YME A;  1Z5R A;  2AFZ A;  3D67 A;  3WC6 A;  2BO9 A;  3SI1 A;  4MMO A;  3CT9 A;  4MHY A;  3MRU A;  4Z65 A;  4R7M A;  1AYE A;  1VIX A;  2PJB A;  4YWY A;  4NJQ A;  2QVP A;  1CPX A;  2ZEL A;  4ZX9 A;  2ZEN A;  2PJ5 A;  2ANP A;  1CBX A;  3B3T A;  2AFX A;  1HDQ A;  1RTQ A;  4MHN A;  3H8E A;  2Q4Z A;  4OP4 A;  3FH4 A;  3BI1 A;  4MCS A;  4ZYQ A;  1Y0Y A;  3VAR A;  1Z2L A;  4R76 A;  4PPZ A;  3PRT A;  3CPX A;  1BAV A;  1UWY A;  1EE3 P;  1R3N A;  2RFH A;  3FMC A;  4IHM A;  3GLJ A;  4OIW A;  4F9V A;  5HVG A;  2GLJ A;  1BPN A;  3PBE A;  4MHP A;  2PJ9 A;  3KI9 A;  1TXR A;  3HLP A;  3D68 A;  3H8G A;  2PIZ A;  1ZLH A;  3IFE A;  3S9N A;  1H8L A;  1TKF A;  3L2N A;  1XBU A;  2PRQ A;  4P4D A;  1PCA A;  4ZY1 A;  2PVV A;  1F2O A;  3LWU A;  4A38 A;  1DTD A;  2GRE A;  2AFU A;  3TC8 A;  3KQX A;  1FT7 A;  1YW6 A;  4JZ0 A;  2F8H A;  3IC1 A;  4LQG A;  2G9D A;  1YW4 A;  2ZEE A;  2J9A A;  2AFO A;  3KR5 A;  1LOK A;  4EFD A;  5JGF A;  2NYQ A;  5THW A;  1KWM A;  1TKJ A;  4A94 A;  3BXM A;  2EK8 A;  2C6C A;  3RAM A;  1IY7 A;  5J1Q A;  5HVF A;  4OC2 A;  3RZA A;  4NGP A;  3FF3 A;  3FEC A;  2ZOF A;  2NSM A;  2OR4 A;  2ZEM A;  4NGQ A;  5HXD A;  3B3S A;  5LYD A;  3D7H A;  1LAN A;  5ELY A;  3ISZ A;  5F09 A;  5IB9 A;  3PB8 X;  2PJ4 A;  4YU9 A;  4OC5 A;  4RUH A;  2AFM A;  3PEI A;  3NH4 A;  2WZN A;  3N5F A;  5HVH A;  4NFR A;  4W9Y A;  1NSA A;  3KL9 A;  3FX6 A;  4ZY0 A;  2V8G A;  1IGB A;  2DEA A;  4IK2 A;  5K8N A;  3D4U A;  1ZG8 A;  2O4H A;  1LCP A;  4B6Z A;  1PYT B;  4A39 A;  3NA6 A;  4EME A;  4F9U A;  5DS0 A;  1Y7E A;  2HC9 A;  4UIA A;  3KQZ A;  2C6G A;  3D7D A;  3SI0 A;  4DJL A;  4NGM A;  5I4M A;  3B3W A;  3QNV A;  1Y0R A;  4OC0 A;  4UEF A;  3SI2 A;  2WYR A;  1ELM P;  4X2T A;  3D7F A;  2PJ6 A;  3JRU A;  2V8H A;  2XEJ A;  3PFO A;  4R6T A;  1HDU A;  3WAB A;  1TKH A;  2ABZ A;  1YSJ A;  1XFO A;  2OOT A;  3DLJ A;  5LRG A;  2O53 A;  1LAP A;  4NGS A;  2RB7 A;  2CF4 A;  4TNU A;  3FED A;  4P6Y A;  2PJ7 A;  3IJ3 A;  4MHZ A;  3TX8 A;  4MCQ A;  3S9L A;  3RBU A;  3VH9 A;  1DE4 C;  1LFW A;  2VL1 A;  4WJB A;  3WT4 A;  4UEZ A;  2IMO A;  4PQA A;  4MCR A;  4A37 A;  1R43 A;  4X3R A;  3KAS A;  4NGT A;  4MCP A;  1F2P A;  2ZOG A;  4P4E A;  4F8Z A;  4DUK A; 
#chains in the Genus database with same CATH topology
 2C4U A;  1W35 A;  1WOR A;  4OC3 A;  5DWN A;  3N7Z A;  2D3L A;  7CPA A;  5JPH A;  2J8R A;  2OTJ B;  2OU2 A;  2JN9 A;  1I18 A;  1JB9 A;  4XMY A;  1N08 A;  2BPO A;  2ZZF A;  1YHQ B;  4B43 A;  3SJG A;  4CS0 B;  2PJC A;  1YVO A;  3IU2 A;  4ASU A;  4TWE A;  1HA3 A;  3SJF A;  4B3F X;  1I1D A;  3D26 A;  3AVV A;  4CRZ B;  1J4J A;  2PR8 A;  2D3N A;  1VGY A;  4XL9 A;  1QSO A;  2CW5 A;  2ZEF A;  1YGH A;  2QJ8 A;  2VQY A;  1FDR A;  4KSI A;  2PSW A;  2YGW A;  3DDD A;  3U2Q A;  3T90 A;  3CCE B;  4RCY A;  4MRI A;  2PJ0 A;  1VQP B;  5D29 A;  2YWE A;  2C5H A;  3PB7 X;  4E2A A;  2OTL B;  2GJK A;  2F7V A;  4CGP A;  2I3C A;  2BL1 A;  1ZO0 A;  3PGP A;  4KOX A;  3R9F A;  4PXB A;  1WP6 A;  1T5E A;  4EWT A;  4RDJ A;  1KQS B;  3G8W A;  2FSR A;  2ZL6 A;  3BJ8 A;  1YX0 A;  4RD3 A;  1BMF A;  5LYF A;  4WWV A;  3ZJ0 A;  3ONY A;  3D7G A;  3ASS A;  2YWG A;  4XNF A;  4G5G A;  3ASR A;  2WZP P;  3PA2 A;  1CJW A;  4A30 A;  1B2R A;  2OBR A;  5AG6 A;  1K28 D;  1FNO A;  4HIZ A;  2X7B A;  3BY1 A;  3BQJ A;  4R71 A;  4JXQ A;  4L89 A;  4OID A;  3CES A;  4P4J A;  4OC4 A;  2CTC A;  1M4G A;  4U9U A;  3GVK A;  1ZG7 A;  2VYQ A;  3S6K A;  1WSV A;  4X8I A;  2V8V A;  5F4O A;  3Q6R A;  1EFT A;  3BCF A;  5K8M A;  3GUX A;  5HZB A;  4X06 A;  2GFQ A;  4B44 A;  5GV8 A;  4MY3 A;  3FJU A;  3JTK A;  4WZE A;  2PJ1 A;  4ZGQ B;  4YRH A;  2AFW A;  3OJX A;  4DQK A;  2VJI A;  5GCN A;  2Z3O A;  4PXE A;  5C82 A;  2XND A;  4RD4 A;  2QGG A;  5IB0 A;  3OE7 A;  2CK3 A;  3MN8 A;  1JQG A;  1UD4 A;  2Z3L A;  4QVA A;  2DCU A;  1KUV A;  3NE8 A;  4X0C A;  2BSA A;  2V7T A;  3H8F A;  1N8R D;  4MBU A;  2BCO A;  1EP3 B;  2PIY A;  2REF A;  5B6I A;  3WYA A;  5LRK A;  3IO1 A;  3AVT A;  4PGO A;  2XZL A;  2XEG A;  2BF4 A;  4ZY2 A;  4YAL A;  1AUG A;  4BMH A;  3D2M A;  1IID A;  4QVJ A;  4MYU A;  1YLE A;  4ZX8 A;  3IU1 A;  3GVL A;  4IF5 A;  1IB0 A;  4NF1 A;  1NRK A;  4Y9R A;  2FVG A;  4JMQ A;  5L46 A;  1S7K A;  2JLM A;  2Z0Z A;  1XF8 A;  4F6A A;  4M6H A;  2RC6 A;  3JQQ A;  2GIV A;  1JA1 A;  2PVW A;  2XEF A;  4Q7A A;  4CYP A;  1H42 A;  3PBB A;  3KZW A;  5BWA B;  2Q6I A;  5F47 A;  1Z5R A;  1M4I A;  5AGE A;  4Z4Z A;  4G7X A;  1MK4 A;  3TOB A;  3CCM B;  2QIR A;  2BM0 A;  2BO9 A;  1PU9 A;  1IYL A;  3MRU A;  4R7M A;  5F4M A;  5KNL A;  5BSX A;  1AYE A;  1VIX A;  4NJQ A;  5H59 A;  2XOK A;  1YJN B;  1PJ5 A;  2PJ5 A;  1N05 A;  2V7U A;  1G7S A;  4KKS A;  1FRQ A;  2V31 A;  3BCD A;  5DWM A;  1Y0Y A;  4LX9 A;  2QTL A;  4JJX A;  4X7D A;  4Z4W A;  3CPX A;  1YK3 A;  3FMC A;  3AGP A;  2VNI A;  4IHM A;  1X12 A;  4OIW A;  5HVG A;  4MFZ A;  2VXK A;  1IOF A;  5G1Z A;  3RNZ A;  2I00 A;  1Z8W A;  3AST A;  3B8H A;  3WXM A;  3BC9 A;  1H8L A;  1X10 A;  3CXQ A;  5H5J A;  1AIP A;  4ZY1 A;  2QMU A;  2WJY A;  2XZP A;  3SEJ A;  3OEE A;  2VBQ A;  1VQO B;  4ACB A;  3FYN A;  4Q7J B;  4Y49 C;  2AE6 A;  1IJE A;  4ACA A;  3TC8 A;  2W6J A;  1YW6 A;  3SJP A;  3IWG A;  3IC1 A;  4PC7 A;  3FPK A;  1M1K D;  2J9A A;  2AFO A;  1QGA A;  5JGF A;  2NYQ A;  4A94 A;  3E20 A;  5E6T A;  1GAW A;  2C6C A;  1IY7 A;  4OC2 A;  3BY2 A;  4X07 A;  2Q4Y A;  4CQJ A;  1BLI A;  2NSM A;  4AB7 A;  3JVN A;  4LBY A;  2X6Y A;  4XN3 A;  4UBR A;  5ISV A;  1BX0 A;  3D7H A;  3CB4 A;  1LAN A;  2B5O A;  3PB8 X;  4ZCM A;  1KZF A;  3TO6 A;  1GR1 A;  1KK3 A;  3GKR A;  2GE3 A;  4ZY0 A;  3GYA A;  4MHD A;  4B48 A;  2R1I A;  1IGB A;  2DEA A;  1EFC A;  4KKT A;  3Q38 A;  4QC6 A;  3QSY A;  5BSY A;  1PYT B;  4OPO A;  1I12 A;  4YAF A;  3EO4 A;  4UZE A;  2EUI A;  1Y7E A;  5TY0 A;  2W6I A;  2Z3M A;  5IYQ A;  3CC2 B;  5J3O A;  1SQH A;  2C6G A;  1ZM3 A;  4XLF A;  1OB5 A;  4KSF A;  4IUS A;  1DDI A;  1M4D A;  3H4Q A;  1YQE A;  4NGM A;  3A8J A;  3QNV A;  3DDY A;  4CAF A;  5HMN A;  4YAW A;  3H9N A;  3I9S A;  3ASQ A;  3SI2 A;  3QB8 A;  1WOP A;  5JQ4 A;  1ELM P;  3LOD A;  2Q44 A;  4ZV4 A;  4RS2 A;  5IK2 A;  4TKO B;  2V8H A;  4RD2 A;  4FK8 A;  3W2F A;  1TVC A;  3W2E A;  1V0F A;  3MGD A;  1YSJ A;  2BVN A;  1D2E A;  2VBU A;  2P6E A;  2K5T A;  5G20 A;  4CRY B;  4NGS A;  2P3M A;  1VF7 A;  2I79 A;  1KMH A;  4CYN A;  4TNU A;  4XM3 A;  4Z1M A;  1VQ5 B;  4Y9U A;  3CC7 B;  4MCQ A;  4MFQ A;  3W2H A;  2FIW A;  3IWE A;  3RBU A;  2A4N A;  2R7H A;  4DNR B;  2VL1 A;  4AVB A;  4C2X A;  2Z10 A;  3LNN A;  1P4N A;  1I8D A;  2FXF A;  3CCU B;  4B5P A;  3U6K A;  3KAS A;  4NGT A;  3GSI A;  4MCP A;  4ONU A;  4AVZ A;  1FND A;  1HVX A;  1W87 A;  4DUK A;  4YEL A;  5THX A;  1Y9W A;  4XLA A;  1VLO A;  5IYR A;  3B8G A;  1V5V A;  2B4B A;  4A31 A;  3AVU A;  2X6X A;  1YX2 A;  4PC3 A;  2JEW A;  2CNM A;  1E62 A;  3CCQ B;  2IJZ A;  1K9M D;  3Q6Q A;  4KOU A;  1QUE A;  1RQP A;  2PJA A;  1Z8X A;  4DK1 A;  3BHX A;  1K4J A;  4H89 A;  2CC2 A;  2ZTG A;  4YXW A;  2BSW A;  3BNW A;  4C0S A;  4FXU A;  3P2F A;  1IU8 A;  4MFK A;  2VBV A;  2CRV A;  4QV2 A;  3FNC A;  4K30 A;  4LBZ A;  4P1V A;  2B5G B;  4XNH B;  3CW2 A;  1TIQ A;  4B11 A;  2P0W A;  5DN6 A;  2EO8 A;  4F7D A;  3I3G A;  3F8K A;  1N0V C;  3PB9 X;  1ON0 A;  5IYP A;  4FAI A;  1F57 A;  4TMT A;  4UFV A;  1GO2 A;  1XRY A;  5K8O A;  2WPX A;  3B7I A;  2NV4 A;  1XE1 A;  3FEE A;  4IAV A;  1Z4E A;  4Z4S A;  2OH1 A;  3EC4 A;  4MFP A;  4HNX B;  4II9 A;  1KK2 A;  1UD3 A;  1G7C A;  3WC5 A;  3CCJ B;  2JIZ A;  2QYV A;  5FNZ A;  2Q6L A;  1IJF A;  3WBJ A;  4H2K A;  3V7Z A;  1Q7L A;  1N71 A;  2XEX A;  4P10 A;  5LRJ A;  1ZLI A;  2B3U A;  2EIX A;  4DYO A;  3CXP A;  4PXC A;  4YGO A;  4TMX A;  3FRM A;  4XPK A;  2AHO A;  3TT2 A;  1T6Z A;  3FBU A;  1EWY A;  4TMW A;  4Z4U A;  4M0L A;  1E3X A;  4I49 A;  4UA3 A;  4TN1 A;  3CRZ A;  3ZZ0 A;  3ZZU A;  2BOA A;  2D4P A;  4N3G A;  4NCN A;  2Z6B D;  4P4B A;  2Q6K A;  2PJ2 A;  2GK6 A;  2PE3 A;  3OW2 B;  1AMP A;  1R5N A;  2V7W A;  2ZXI A;  4ROX A;  1W0J A;  1ARM A;  4II2 A;  1E43 A;  1YIJ B;  2POK A;  4J0Q A;  3TO7 A;  3QFR A;  4NNJ A;  2XNC A;  1Z8L A;  1Z8T A;  4KOS A;  4P4I A;  2BGI A;  3PVD A;  3CP2 A;  2ZEG A;  1BPM A;  1U6M A;  4FBE A;  5F48 A;  5AG4 A;  2ZEP A;  4R9M A;  5AG7 A;  2PR1 A;  2ZIT A;  3ZC3 A;  2Q43 A;  2WUU A;  4B12 A;  3S6H A;  4MFJ A;  2OBT A;  4LBW A;  4CPA A;  1YIT B;  3OPO A;  4HPS A;  2CND A;  3SXN A;  4M6G A;  2XEI A;  2H5M A;  1RQR A;  3CPA A;  1KZL A;  3CD6 B;  2VBS A;  4UCN A;  4MJ8 A;  1KC8 D;  1NBM A;  1OB0 A;  3LVB A;  1RO5 A;  4JLY A;  4P44 A;  1EP1 B;  1PKV A;  1EFR A;  1XOV A;  3IGR A;  2AFS A;  1JA0 A;  3R6J A;  3WND A;  3CCR B;  3OJW A;  1CG2 A;  2B4D B;  1WU8 A;  3CMA B;  3I1F A;  1IIC A;  1ARL A;  3BJ7 A;  4KVX A;  3IWW A;  2J8M A;  3FXT A;  4P12 A;  1NE9 A;  2IQ6 A;  3H5Z A;  2Q51 A;  1ZG9 A;  2OK8 A;  1BLL E;  1YME A;  3WC6 A;  3OP1 A;  4XKW A;  2FCK A;  4CAV A;  3BH4 A;  3GIR A;  3TOA A;  2GK7 A;  3SI1 A;  3CZX A;  4RD0 A;  4Z4V A;  3ZZT A;  3CP8 A;  2PJB A;  4CAX A;  2QA4 B;  2OZU A;  1CPX A;  4ZX9 A;  4CAE A;  3SLN A;  2P6G A;  2B5G A;  1UD6 A;  2R8V A;  3B3T A;  2B4D A;  1HDQ A;  2ZZQ A;  3H8E A;  4G1V A;  4XLC A;  2Q4Z A;  2PDO A;  2C2W A;  1CQX A;  3JUW A;  1A8P A;  4ZYQ A;  1Z2L A;  4R76 A;  2B3V A;  3OAA A;  2HDN B;  1WTH D;  4UFW A;  1IHM A;  1R3N A;  1CM0 A;  2GLJ A;  2DYI A;  4MHP A;  3KI9 A;  1I21 A;  4YEJ A;  3H8G A;  1ZLH A;  5KTA A;  1NJI D;  2YWF A;  1SKQ A;  4RPB A;  1F2O A;  4GXH A;  1MJB A;  1DTD A;  3LQ6 A;  3QFS A;  3A35 A;  1D1N A;  1VQ7 B;  2VJJ A;  5IYW A;  1FT7 A;  4II3 A;  4JZ0 A;  5IYN A;  2QEX B;  4LQG A;  1YW4 A;  3G4S B;  1VQL B;  2ZW4 A;  3KR5 A;  4TMV A;  5THW A;  1Q82 D;  4XKV A;  3WBK A;  3BXM A;  1GJR A;  4XPD C;  2EK8 A;  2ZL7 A;  4KOY A;  3R9G A;  5AG5 A;  4TSF A;  3RZA A;  3VO2 A;  3NE7 A;  5IV0 A;  4Q36 A;  3T9Y A;  3QE2 A;  2ZOF A;  4PSW A;  2Q04 A;  2ZEM A;  4NBS A;  4NGQ A;  4OOX A;  2DEU A;  5LYD A;  4B5P B;  3ASP A;  3PP9 A;  5AN9 A;  4AG9 A;  3ISZ A;  5IB9 A;  3JQR A;  4XLE A;  2E1R A;  3DR6 A;  3AVY A;  4RUH A;  2JJ1 A;  5F46 A;  3PEI A;  1W34 A;  2X85 A;  1QX4 A;  4W9Y A;  3KL9 A;  5FA6 A;  1M44 A;  2NPF A;  4OPV A;  5J8F A;  1VQ4 B;  5K8N A;  5LMZ A;  1ZG8 A;  1YVK A;  4AF6 A;  2F1L A;  1LCP A;  4B6Z A;  1F20 A;  4ZGY B;  2EBJ A;  3U6B A;  4EVY A;  1WK4 A;  2DIE A;  5DS0 A;  1W9X A;  4M85 A;  3SXO A;  3FKS A;  1S60 A;  3D7D A;  4AVC A;  3T53 B;  3SI0 A;  4ZGN B;  2FE7 A;  1MJA A;  2JJ2 A;  4UFX A;  4DJL A;  1VHS A;  1E64 A;  1ZM4 A;  3OZW A;  1Y0R A;  4UEF A;  2X6W A;  4UWI A;  1OHH A;  3VNU A;  3A8K A;  4XQF A;  3JRU A;  4XD7 A;  1F60 A;  4PAA A;  1W2B B;  4R6T A;  4B5O A;  4BBH A;  2FIA A;  3WAB A;  3Q39 A;  3BLN A;  1H8H A;  1UD8 A;  3JQP A;  4KZT A;  2OOT A;  3DLJ A;  4WZT A;  4BPR A;  1QST A;  2PQ8 A;  2RB7 A;  4RD1 A;  2HCJ B;  3TO9 A;  3FED A;  4P6Y A;  2DPT A;  1IOI A;  2HQY A;  1QFY A;  3A9L A;  1DE4 C;  2ZXV A;  4XON A;  2X53 S;  4FWT A;  4G6I A;  2BV3 A;  4RDK A;  3WT4 A;  4M6I A;  2V7V A;  2Q7B A;  2G0B A;  1FNB A;  4MCR A;  4XOP A;  4EH1 A;  1R43 A;  4X3R A;  1IB1 E;  1VJS A;  2ZBV A;  2PRB A;  4J3G A;  1BQE A;  4F8Z A;  4MI4 A;  5HH1 A;  1KRH A;  4HNW B;  1UD2 A;  2REE A;  3V7A A;  2WR8 A;  2XZO A;  4QBJ A;  5EMI A;  2FX3 A;  4P26 A;  3VR6 A;  2ZW5 A;  2JDI A;  3WR7 A;  3PZJ A;  3ZBU A;  5HKK A;  1Q2D A;  3RY8 A;  4P6V F;  4A32 A;  4JWP A;  3ZUG A;  1DDG A;  2Z3P A;  4H6Z A;  2QEC A;  1ZM9 A;  2C77 A;  2YNC A;  4XLH A;  5A27 A;  2R9V A;  3C26 A;  2XNJ A;  3WY9 A;  1TF8 A;  3WNB A;  3B82 A;  2OYN A;  4FD5 A;  1M4L A;  2LZJ A;  2C1C A;  1Q86 D;  1Q81 D;  2CTB A;  3A3G A;  5J8C A;  4AF7 A;  4ONW A;  3FIX A;  4PK3 A;  4AG7 A;  2D9R A;  4KS9 A;  2Z3K A;  3CCV B;  3D66 A;  4P2N A;  2EWB A;  3HAG A;  4PC2 A;  4OME A;  1KJZ A;  2JBK A;  5JH9 A;  4RM0 A;  2ZTN A;  4OAE A;  3FVL A;  4DNT B;  2CIJ A;  4P9S A;  1Q2C A;  3NE5 B;  3A8I A;  3PUM A;  1OZP A;  4NGN A;  4RCZ A;  2JBJ A;  4Z4R A;  3E0K A;  4R57 A;  4RI1 A;  1CNE A;  1FY7 A;  3OZV A;  2FT0 A;  1KD1 D;  1TF9 A;  3T56 B;  3S9M A;  1UMK A;  3KHZ A;  4A33 A;  3B2Y A;  2PJ8 A;  4Q38 A;  5JM6 A;  1QQ9 A;  4XNH C;  1GYT A;  2ARH A;  4R3L A;  3K2K A;  2P6F A;  3KHX A;  3I1U A;  2Q4V A;  4KVM E;  4M1K A;  1WOO A;  4C7H A;  1S7F A;  4CGL A;  3CC4 B;  4KUB A;  4AC9 A;  2OBS A;  5CPA A;  2V8D A;  1KK0 A;  3SJX A;  4B4D A;  4E0A A;  4ZI6 A;  2ZED A;  4FN5 A;  2GU2 A;  3T8W A;  4KKU A;  2ZEO A;  2YWH A;  1N06 A;  1HEE A;  3RYO A;  3OWC A;  4XR6 A;  2CNT A;  3VWD A;  1VHO A;  4FUU A;  3CCS B;  5H86 A;  4C68 A;  3V38 A;  4QVT A;  4UZU A;  3IIB A;  3KGQ A;  2C5B A;  4NGR A;  4U9Z A;  3PB6 X;  3PB4 X;  2EK9 A;  1L0C A;  2ZW7 A;  4AVA A;  4R87 A;  5HZA A;  4PC1 A;  2F1M A;  1S5K A;  1XMB A;  3IEH A;  3GB0 A;  4UF4 A;  2QN6 A;  1QMU A;  3VMF A;  5GV7 A;  3H94 A;  1KUX A;  2WPD A;  4FD6 A;  1H8E A;  1CP7 A;  1OBR A;  5LYI A;  1G7R A;  4FWU A;  2GLF A;  1FRN A;  6CPA A;  4PSX A;  1CPS A;  2PCU A;  4C7I A;  4BIN A;  1N0U A;  4HE6 A;  3HUV A;  1E3Z A;  3QAH A;  2CXA A;  4JYW A;  1BO4 A;  2VZY A;  4C43 A;  1NMT A;  3NH8 A;  2C27 A;  3DGV A;  4LQ6 A;  1JWQ A;  2PC1 A;  2QTZ A;  3ZIA A;  1CP6 A;  1DG1 G;  3AGQ A;  2QDX A;  3W2I A;  4OKO A;  5A89 A;  1I7P A;  3W5H A;  2OZG A;  3D3S A;  2EVN A;  5TR9 A;  2ZZE A;  1M1D A;  2HLD A;  4KOT A;  2M5S A;  2CY2 A;  4B3X A;  4MMO A;  4MHY A;  3EFA A;  2X3U A;  3PUN A;  4PV6 A;  2V7X A;  1GHE A;  3G05 A;  4KOW A;  4WQM A;  3QAY A;  2ZEN A;  2BN4 A;  4CGO A;  1OGI A;  1CBX A;  2BGJ A;  1RTQ A;  4C2Z A;  4MHN A;  1NB9 A;  2YNC C;  2R6H A;  3FH4 A;  3TTH A;  4WZK A;  2PLF A;  2R98 A;  1NB0 A;  3EXN A;  3VAR A;  1Z9U A;  1WWZ A;  4ORF A;  3F0A A;  3PRT A;  3GY9 A;  3AVW A;  1BAV A;  4LBV A;  1UWY A;  4KLV A;  2RFH A;  3W91 A;  1YI2 B;  3T51 B;  1UD5 A;  1BPN A;  2PJ9 A;  3MCA A;  1TXR A;  2OZH A;  3D68 A;  2GJP A;  2QE7 A;  2PIZ A;  2JDD A;  3P2H A;  4WZL A;  2VZL A;  4A2Z A;  3L2N A;  4Y49 B;  1D8T A;  1PCA A;  2KCW A;  4MYT A;  4YAO A;  1VQK B;  4A38 A;  2VBT A;  4XN0 A;  3V76 A;  2AFU A;  3V8I A;  4KVO E;  1R5O A;  2BM1 A;  4NXY A;  1UFH A;  4OP7 A;  2G9D A;  1VKC A;  2ZEE A;  4Y7C A;  2ATR A;  2ZXH A;  4FD4 A;  2DY1 A;  5J35 A;  1LOK A;  4EFD A;  2GAN A;  4XOR A;  5DSZ A;  1MAB A;  1WOS A;  4F0X A;  4PK2 A;  1NSL A;  2Q7S A;  2X8K A;  3RAM A;  3JU4 A;  4RLZ A;  5HVF A;  4IW3 B;  2OB0 A;  4HNY B;  3FF3 A;  5I0C A;  1TUI A;  1XIX A;  2OR4 A;  1OGJ A;  5HXD A;  1G7T A;  1E1R A;  5ELY A;  4B14 A;  4ZCL A;  2YND A;  4KUA A;  2PJ4 A;  2CNS A;  3NH4 A;  1Y7R A;  1E79 A;  3N5F A;  1VQ8 B;  5HVH A;  1VQN B;  1NSA A;  3FX6 A;  2V8G A;  4C2Y A;  4M3S A;  4G7W A;  5EC4 A;  2O4H A;  4CYO A;  3S6F A;  3ZZI A;  3R1K A;  2BMW A;  4E8O A;  3LAC A;  2J8N A;  2B58 A;  2HC9 A;  3DSB A;  3KQZ A;  4L8A A;  1KK1 A;  4DNC A;  2C4T A;  4NSQ A;  1PJ7 A;  2F4N A;  3B3W A;  1HZE A;  2KVO A;  2XGJ A;  1WDT A;  1DAR A;  2WSS A;  1YRE A;  4OC0 A;  1QFZ A;  1ZM2 A;  2Z3N A;  2X0K A;  2WYR A;  3FJO A;  3D7F A;  2PJ6 A;  3ES9 A;  2V7Q A;  3PFO A;  1Y9K A;  4M2L A;  1QGY A;  1TKH A;  1VQ9 B;  1XB2 A;  2DPS A;  2O53 A;  5H84 A;  5LRG A;  4OOS A;  2ZBU A;  5KW9 A;  4A95 A;  4M4S A;  3IJ3 A;  4MHZ A;  1ELO A;  2ZZG A;  4MFL A;  3SJZ A;  3LD2 A;  5HXB A;  3DNS A;  4X7E A;  3OOC A;  5FIU A;  1W0K A;  4PAB A;  2D74 A;  4WJB A;  5JBQ A;  2ZW6 A;  4UEZ A;  1BPL A;  2IMO A;  4PQA A;  5TV2 A;  3TE4 A;  4KSA A;  3G71 B;  1AMO A;  1F2P A;  2ZOG A;  4GS4 A;  4UEE A;  2Q6O A;  4QHY A;  4OC1 A;  5CBM A;  1VQM B;  1B6B A;  3B3V A;  2YNE A;  1S7N A;  3SJE A;  3LQE A;  4G1P A;  4UWJ A;  5KTD A;  3QFT A;  4L8J A;  1U2R A;  1EXM A;  3B3C A;  4XPL A;  1N07 A;  3VAT A;  1GAQ A;  3CPW B;  1KUY A;  4H9G A;  4R8F A;  4RPD A;  2C6P A;  3KEW A;  1Q7Y D;  2VNK A;  2PIA A;  5IX3 A;  3G6E B;  2C78 A;  3MHP A;  1BJK A;  3GIU A;  2BEI A;  4OPS A;  4G1B A;  4MXU A;  1XMT A;  3ZBT A;  2O28 A;  3CDX A;  2RC4 A;  5KSW B;  1QH0 A;  1XE4 A;  1PJ6 A;  5K8P A;  2QML A;  1YLO A;  1Z4R A;  4QB9 A;  2E1B A;  3W5U A;  2I1L A;  3OZU A;  1VHE A;  4OAD A;  3NH5 A;  4LC0 A;  2PJ3 A;  3W2G A;  3F5B A;  3NFZ A;  3FB3 A;  1XEB A;  5FL7 A;  3QFC A;  1ELL P;  2RC5 A;  1T6X A;  1P4M A;  1CNF A;  3ISX A;  1CX8 A;  4B47 A;  3WC7 A;  4KLW A;  4NCZ A;  4UZF A;  3D8P A;  4UCP A;  1EP2 B;  4CGN A;  3CXC B;  1K73 D;  2V77 A;  4N3N A;  2G3A A;  4YHB A;  4BD9 A;  1Q2Y A;  2WSA A;  4U5Y A;  1MRZ A;  4U9Y A;  3FPP A;  4Z4T A;  4P4F A;  3MMP A;  4CYQ A;  4XOT A;  5D8N A;  1EFU A;  1B87 A;  3W6S A;  4AXV A;  3ONU A;  1OB2 A;  1SM4 A;  3B35 A;  4P25 A;  3CCL B;  4GM5 A;  1QSN A;  4GQN A;  1XJO A;  4UIB A;  3E1Y E;  2VEZ A;  2HB6 A;  3G3S A;  3VO1 A;  4X05 A;  4O23 A;  4NJR A;  4K1X A;  3LO8 A;  4YFJ A;  3CME B;  1M90 D;  2ZEH A;  5A8A A;  3R9E A;  4PXD A;  2B7B A;  3UY5 A;  3SLD A;  4P3Y A;  4RD6 A;  4P45 A;  1LAM A;  1TTT A;  5LYL A;  3BI0 A;  4KOV A;  1R5B A;  4X5K A;  3K9T A;  3OEH A;  4QFM A;  3TCV A;  2JEV A;  1XQB A;  3VNV A;  3CXS A;  4M53 A;  3PFE A;  3W5V A;  8CPA A;  1QVF B;  3LMS A;  1FNM A;  3P26 A;  1KTV A;  4K3N A;  3KR4 A;  1JNY A;  3R6K A;  4P3I A;  4ZCI A;  1COW A;  1QFJ A;  2AFZ A;  3D67 A;  2ZPA A;  3WNC A;  1BOB A;  3PEN A;  3W6X A;  1WSR A;  4NEX A;  4F0Y A;  5EMN A;  3AVX A;  1V0C A;  3CT9 A;  4DK0 A;  4Z65 A;  2J7K A;  2IL4 A;  1K8A D;  5G22 A;  4YWY A;  1IYK A;  4ZBG A;  3I55 B;  2QVP A;  1LRZ A;  5TRD A;  2ZEL A;  2JDC A;  1J9Z A;  5C88 A;  2ANP A;  3J81 k;  4RJL A;  1YJ9 B;  1R57 A;  2DET A;  2DXQ A;  3S6G A;  2AFX A;  1QSM A;  2WPW A;  2DOG A;  3GQB A;  4OP4 A;  2Q0Y A;  3Q3A A;  4RDL A;  3BI1 A;  4MCS A;  1P0H A;  5FVJ A;  3GVJ A;  4PPZ A;  1EE3 P;  2HUZ A;  3GLJ A;  3K9U A;  4F9V A;  4XPD B;  3SKB A;  3PBE A;  4KOR A;  3ZPN A;  1FX0 A;  3HLP A;  1JJ2 B;  1GVH A;  4JD6 A;  3CMM A;  1YJW B;  3IFE A;  4Z4Y A;  4B13 A;  3S9N A;  1TKF A;  2G3T A;  5F49 A;  1XBU A;  4HE5 A;  2PRQ A;  4P4D A;  2HMA A;  1PUA A;  2PVV A;  4LUA A;  3LWU A;  5FO1 A;  4QUS A;  1QG0 A;  2GRE A;  5EBV A;  4OOV A;  4OLL A;  5FO0 A;  5KTC A;  3KQX A;  3OW7 A;  5G21 A;  3R95 A;  2PMD A;  2FL4 A;  2F8H A;  4CAW A;  1E63 A;  2F43 A;  2BUE A;  2HV2 A;  3P27 A;  3PA1 A;  3EY5 A;  5A88 A;  1KWM A;  1MJ9 A;  1TKJ A;  1YR0 A;  1S4M A;  1QVG B;  3OFN A;  3CTA A;  4HKF A;  4DQL A;  5J1Q A;  2DER A;  3KKW A;  4NGP A;  3FEC A;  1VQ6 B;  1B23 P;  2ODF A;  1A2Z A;  1T6Y A;  3B3S A;  1VLY A;  3SHP A;  5F09 A;  3RO0 A;  3D2P A;  4YU9 A;  4OC5 A;  4JXR A;  2AFM A;  4UCM A;  2GJR A;  1Q9S A;  2AJ6 A;  2Y0M A;  2WZN A;  3VWE A;  2B7C A;  4NFR A;  1NDH A;  1S0U A;  4IK2 A;  2GPJ A;  3D4U A;  4P22 A;  2VI7 A;  3DR8 A;  4QUZ A;  4A39 A;  3NA6 A;  4EME A;  4F9U A;  4TT3 A;  2VNH A;  3OKX A;  4UIA A;  4R3K A;  2FS5 A;  4X7F A;  2OK7 A;  4UAJ A;  2WJV A;  4FD7 A;  5A28 A;  2D4O A;  3TFY A;  2GQF A;  2F5I A;  5I4M A;  4YAU A;  2VNJ A;  4TMZ A;  1E1Q A;  4PC6 A;  2VZZ A;  3A1P A;  2ZL5 A;  4X2T A;  4X7C A;  4H6U A;  5CNP A;  3WQZ A;  4MY0 A;  2XEJ A;  1HDU A;  1V0E A;  3B78 A;  2ABZ A;  1ZUN B;  1QSR A;  4RN7 A;  2CBX A;  1QUF A;  1XFO A;  1S72 B;  5F4J A;  1S7L A;  1SKY B;  1LAP A;  2EFG A;  2CF4 A;  3R96 A;  4B10 A;  2PJ7 A;  3TX8 A;  3S9L A;  3VH9 A;  1RXT A;  4B3G A;  1TLL A;  4E0F A;  5CDF A;  2NMT A;  3I56 B;  1LFW A;  1H85 A;  2DF5 A;  4CGM A;  1S3Z A;  3A3B A;  4A37 A;  2Z11 A;  1FNC A;  4P4E A;  5E96 A;  1BX1 A;  2V4D A;  1WPC A;  1QGZ A; 
#chains in the Genus database with same CATH homology
 4UEE A;  4OC3 A;  4OC1 A;  5CBM A;  7CPA A;  2JEW A;  2IJZ A;  3B3V A;  3SJE A;  4G1P A;  3SJG A;  2PJA A;  2PJC A;  3BHX A;  3B3C A;  3VAT A;  4TWE A;  3SJF A;  4R8F A;  1TF8 A;  2C6P A;  1VGY A;  1M4L A;  2C1C A;  2ZEF A;  2CTB A;  2QJ8 A;  4KSI A;  4ONW A;  3D66 A;  2EWB A;  4MRI A;  2PJ0 A;  4MXU A;  5D29 A;  3PB7 X;  4OME A;  2JBK A;  5JH9 A;  3CDX A;  2F7V A;  2I3C A;  3FVL A;  3PB9 X;  2CIJ A;  4PXB A;  5K8P A;  4EWT A;  4FAI A;  1F57 A;  1YLO A;  1XRY A;  5K8O A;  4NGN A;  2JBJ A;  1VHE A;  3B7I A;  3FEE A;  4IAV A;  3NH5 A;  5LYF A;  4WWV A;  2PJ3 A;  3D7G A;  1TF9 A;  3NFZ A;  1ELL P;  3S9M A;  3WC5 A;  3KHZ A;  2QYV A;  3ISX A;  1CX8 A;  3B2Y A;  2PJ8 A;  4H2K A;  5JM6 A;  1QQ9 A;  3WC7 A;  3V7Z A;  1FNO A;  1Q7L A;  1GYT A;  4P10 A;  5LRJ A;  1ZLI A;  3K2K A;  4DYO A;  3KHX A;  3I1U A;  4OID A;  4PXC A;  4P4J A;  4OC4 A;  2V77 A;  2CTC A;  1ZG7 A;  4BD9 A;  4X8I A;  2V8V A;  5CPA A;  2V8D A;  5K8M A;  3SJX A;  4ZI6 A;  2ZED A;  2GU2 A;  2BOA A;  4P4F A;  3GUX A;  3T8W A;  2ZEO A;  1HEE A;  4P4B A;  2PJ2 A;  2PE3 A;  1AMP A;  5D8N A;  3FJU A;  2PJ1 A;  1VHO A;  4AXV A;  4FUU A;  2AFW A;  3B35 A;  3V38 A;  3IIB A;  1ARM A;  3KGQ A;  4GM5 A;  2POK A;  4NGR A;  4PXE A;  1XJO A;  1Z8L A;  3PB6 X;  3PB4 X;  2EK9 A;  4UIB A;  4P4I A;  3MN8 A;  1JQG A;  1XMB A;  1BPM A;  2HB6 A;  2ZEG A;  3IEH A;  4FBE A;  3GB0 A;  4UF4 A;  1QMU A;  2ZEP A;  4O23 A;  3H8F A;  2BCO A;  2Q43 A;  2PIY A;  4NJR A;  5LRK A;  1CP7 A;  4CPA A;  1OBR A;  3IO1 A;  5LYI A;  2ZEH A;  4FWU A;  2XEG A;  2GLF A;  4PXD A;  6CPA A;  1CPS A;  4ZY2 A;  2PCU A;  2XEI A;  3CPA A;  1LAM A;  4P45 A;  3HUV A;  4JYW A;  5LYL A;  4ZX8 A;  3BI0 A;  3NH8 A;  4P44 A;  3K9T A;  3DGV A;  2FVG A;  2AFS A;  1CG2 A;  1CP6 A;  3PFE A;  8CPA A;  1ARL A;  2PVW A;  4OKO A;  3IWW A;  3LMS A;  2XEF A;  4Q7A A;  2IQ6 A;  4K3N A;  3KR4 A;  3PBB A;  3KZW A;  2Q51 A;  1ZG9 A;  1BLL E;  1YME A;  1Z5R A;  2AFZ A;  3D67 A;  3WC6 A;  2BO9 A;  3SI1 A;  4MMO A;  3CT9 A;  4MHY A;  3MRU A;  4Z65 A;  4R7M A;  1AYE A;  1VIX A;  2PJB A;  4YWY A;  4NJQ A;  2QVP A;  1CPX A;  2ZEL A;  4ZX9 A;  2ZEN A;  2PJ5 A;  2ANP A;  1CBX A;  3B3T A;  2AFX A;  1HDQ A;  1RTQ A;  4MHN A;  3H8E A;  2Q4Z A;  4OP4 A;  3FH4 A;  3BI1 A;  4MCS A;  4ZYQ A;  1Y0Y A;  3VAR A;  1Z2L A;  4R76 A;  4PPZ A;  3PRT A;  3CPX A;  1BAV A;  1UWY A;  1EE3 P;  1R3N A;  2RFH A;  3FMC A;  4IHM A;  3GLJ A;  4OIW A;  4F9V A;  5HVG A;  2GLJ A;  1BPN A;  3PBE A;  4MHP A;  2PJ9 A;  3KI9 A;  1TXR A;  3HLP A;  3D68 A;  3H8G A;  2PIZ A;  1ZLH A;  3IFE A;  3S9N A;  1H8L A;  1TKF A;  3L2N A;  1XBU A;  2PRQ A;  4P4D A;  1PCA A;  4ZY1 A;  2PVV A;  1F2O A;  3LWU A;  4A38 A;  1DTD A;  2GRE A;  2AFU A;  3TC8 A;  3KQX A;  1FT7 A;  1YW6 A;  4JZ0 A;  2F8H A;  3IC1 A;  4LQG A;  2G9D A;  1YW4 A;  2ZEE A;  2J9A A;  2AFO A;  3KR5 A;  1LOK A;  4EFD A;  5JGF A;  2NYQ A;  5THW A;  1KWM A;  1TKJ A;  4A94 A;  3BXM A;  2EK8 A;  2C6C A;  3RAM A;  1IY7 A;  5J1Q A;  5HVF A;  4OC2 A;  3RZA A;  4NGP A;  3FF3 A;  3FEC A;  2ZOF A;  2NSM A;  2OR4 A;  2ZEM A;  4NGQ A;  5HXD A;  3B3S A;  5LYD A;  3D7H A;  1LAN A;  5ELY A;  3ISZ A;  5F09 A;  5IB9 A;  3PB8 X;  2PJ4 A;  4YU9 A;  4OC5 A;  4RUH A;  2AFM A;  3PEI A;  3NH4 A;  2WZN A;  3N5F A;  5HVH A;  4NFR A;  4W9Y A;  1NSA A;  3KL9 A;  3FX6 A;  4ZY0 A;  2V8G A;  1IGB A;  2DEA A;  4IK2 A;  5K8N A;  3D4U A;  1ZG8 A;  2O4H A;  1LCP A;  4B6Z A;  1PYT B;  4A39 A;  3NA6 A;  4EME A;  4F9U A;  5DS0 A;  1Y7E A;  2HC9 A;  4UIA A;  3KQZ A;  2C6G A;  3D7D A;  3SI0 A;  4DJL A;  4NGM A;  5I4M A;  3B3W A;  3QNV A;  1Y0R A;  4OC0 A;  4UEF A;  3SI2 A;  2WYR A;  1ELM P;  4X2T A;  3D7F A;  2PJ6 A;  3JRU A;  2V8H A;  2XEJ A;  3PFO A;  4R6T A;  1HDU A;  3WAB A;  1TKH A;  2ABZ A;  1YSJ A;  1XFO A;  2OOT A;  3DLJ A;  5LRG A;  2O53 A;  1LAP A;  4NGS A;  2RB7 A;  2CF4 A;  4TNU A;  3FED A;  4P6Y A;  2PJ7 A;  3IJ3 A;  4MHZ A;  3TX8 A;  4MCQ A;  3S9L A;  3RBU A;  3VH9 A;  1DE4 C;  1LFW A;  2VL1 A;  4WJB A;  3WT4 A;  4UEZ A;  2IMO A;  4PQA A;  4MCR A;  4A37 A;  1R43 A;  4X3R A;  3KAS A;  4NGT A;  4MCP A;  1F2P A;  2ZOG A;  4P4E A;  4F8Z A;  4DUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...