2WZNA

3d structure of tet3 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
SMVDWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPPHLRIDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINKEGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 354AA LONG HYPOTHETICAL OPERON PROTEIN FRV
publication title The Structural and Biochemical Characterizations of a Novel Tet Peptidase Complex from Pyrococcus Horikoshii Reveal an Integrated Peptide Degradation System in Hyperthermophilic Archaea.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 107
structure length 338
sequence length 347
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2wznA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2wznA01
4P4JA 4MHZA 5J1QA 2C6GA 4OC2A 2PE3A 4OC0A 5ELYA 3NH5A 4PQAA 4W9YA 4NJRA 3PBBA 4ZYQA 4R7MA 5F09A 1CPXA 1XFOA 5CPAA 3SI2A 3BI1A 2G9DA 4RUHA 4DJLA 4MMOA 2ANPA 3TX8A 4NGRA 4MCPA 4PXBA 3FJUA 4ZI6A 2Q51A 2PIZA 5D29A 3D67A 2DEAA 3KR4A 2AFSA 2PJBA 1LAMA 4P4DA 3TC8A 3CPAA 2EK9A 4P4BA 2HC9A 7CPAA 4P4IA 2QVPA 4A38A 4ZX9A 3VARA 3S9MA 2IMOA 3IWWA 1VHOA 4UEEA 3NH4A 1Q7LA 3IEHA 1F2PA 2POKA 4WJBA 3H8FA 2J9AA 4MHYA 5K8MA 4F9UA 4P6YA 4MCSA 2NYQA 3CPXA 3PEIA 5DS0A 3SJFA 3VATA 4EMEA 1GYTA 2HB6A 1PYTB 2I3CA 5LRKA 3PB4X 5HVFA 4MHPA 5CBMA 5D8NA 2V8DA 2C6PA 4P45A 1ZLHA 1LFWA 2V8GA 5LYIA 4P4FA 3WT4A 3SJGA 1EE3P 4R76A 3D7FA 5JM6A 2ZEHA 4A39A 2ZEOA 2AFOA 3V38A 1FNOA 1ARMA 2C1CA 1HDQA 3SJEA 3ISXA 3D66A 3PB7X 1TKHA 2JBKA 1CG2A 1H8LA 3JRUA 1CX8A 3GLJA 4LQGA 3KHZA 3B3TA 3IC1A 4ZY2A 1Y0RA 2XEIA 1ARLA 4ZX8A 4OMEA 1YLOA 4OIDA 3SJXA 3K9TA 3RZAA 1ZG7A 5K8NA 2AFXA 4EWTA 4UEFA 2OR4A 4TWEA 4MHNA 3MRUA 3VH9A 2AFWA 1ZG8A 2GREA 1DE4C 2XEFA 4NGQA 2PJCA 3IFEA 2BO9A 2JBJA 3KL9A 3KGQA 2ZEDA 2CIJA 4MCQA 3H8EA 4R8FA 1YW6A 3V7ZA 1ZLIA 3PB6X 1Z5RA 3KASA 2GU2A 5K8OA 1FT7A 4Q7AA 2BCOA 4YWYA 1ZG9A 1VGYA 4PXEA 5LYDA 4UEZA 1QMUA 3B7IA 3FECA 3BXMA 3NFZA 3BI0A 2AFZA 3DLJA 2BOAA 3CDXA 4PXDA 2F7VA 1NSAA 2PJ5A 2XEJA 4GM5A 2V8HA 4P44A 4F8ZA 3MN8A 1ELMP 1BAVA 2QYVA 4OKOA 1XMBA 2CF4A 5LYFA 2CTCA 3CT9A 4BD9A 4WWVA 1QQ9A 4ONWA 4IAVA 3D68A 3ISZA 2C6CA 2PJAA 4NGNA 2CTBA 4OC4A 4NGTA 2ZEEA 3KI9A 4OC3A 1LCPA 3LWUA 3RBUA 1YMEA 2FVGA 2PJ2A 1TKFA 2PCUA 4FUUA 1IGBA 3N5FA 2PJ1A 2O53A 4UIAA 2IJZA 2VL1A 5HVHA 1JQGA 2EK8A 4UF4A 3D4UA 4X2TA 3NH8A 1YW4A 1TF8A 3PFOA 2PVWA 3PBEA 4IK2A 4IHMA 4R6TA 2ZOGA 2V77A 1TXRA 4OIWA 3IO1A 4OC5A 2ZEPA 1F57A 1AYEA 3KHXA 2RB7A 4JZ0A 1YSJA 3KQXA 1Y7EA 2IQ6A 3D7HA 2ZELA 2WZNA 3FX6A 1XRYA 2Q4ZA 3GB0A 2RFHA 2ZENA 2F8HA 2OOTA 3KR5A 4YU9A 1TKJA 3B2YA 3B3WA 1R43A 4ZY0A 4NGSA 1XBUA 3BHXA 5JH9A 4DYOA 4NGMA 1R3NA 3DGVA 3FEDA 1LOKA 2ZEMA 2O4HA 3L2NA 1BPMA 2PJ3A 1Y0YA 4Z65A 1DTDA 1UWYA 2PJ0A 3WC7A 4NGPA 2NSMA 4P4EA 5THWA 1TF9A 4MXUA 1VIXA 3KQZA 5I4MA 1RTQA 3B35A 1M4LA 5K8PA 4G1PA 4ZY1A 3LMSA 1BPNA 4MRIA 3D7DA 4A37A 2PJ9A 3S9LA 3IIBA 2GLFA 1VHEA 4O23A 3WABA 3PB9X 3FMCA 1CBXA 3D7GA 4JYWA 4UIBA 2PIYA 3FVLA 3PFEA 1BLLE 3FEEA 4AXVA 2GLJA 2QJ8A 3SI0A 1F2OA 3FH4A 4P10A 2PJ8A 3WC5A 3WC6A 4B6ZA 2EWBA 1Z2LA 3I1UA 1HDUA 1XJOA 1CP7A 1OBRA 3B3CA 5HXDA 3HUVA 3GUXA 1LANA 6CPAA 4FWUA 2PVVA 4FAIA 3B3VA 5LRGA 4A94A 5JGFA 2ZEFA 4X3RA 4OP4A 4CPAA 2JEWA 4K3NA 2ABZA 4X8IA 5LRJA 1LAPA 2AFMA 8CPAA 4NFRA 3S9NA 3H8GA 2V8VA 5HVGA 2XEGA 2ZOFA 3B3SA 2Q43A 4PXCA 1PCAA 4FBEA 3SI1A 4DUKA 4KSIA 3T8WA 3PRTA 1IY7A 3NA6A 4H2KA 4F9VA 4PPZA 2PRQA 1HEEA 3RAMA 2AFUA 3FF3A 3K2KA 4TNUA 5LYLA 3HLPA 1CPSA 3KZWA 2PJ4A 3IJ3A 3PB8X 1ELLP 1Z8LA 4NJQA 2PJ6A 2WYRA 1KWMA 2ZEGA 4EFDA 4MCRA 1AMPA 2PJ7A 3QNVA 1CP6A 5IB9A 4OC1A
chains in the Genus database with same CATH superfamily
4RCZA 4AC9A 1EWYA 5IX3A 2QMUA 2C6GA 4OC2A 1D8TA 2VBUA 1S3ZA 4NJRA 5C82A 1CPXA 1XFOA 3BI1A 4DJLA 4P6VF 2VBVA 2OTLB 3BH4A 3SJZA 2D4PA 2G3AA 3FJUA 2E1RA 4UWJA 4ZI6A 4XOTA 4Y9RA 1G7CA 1N0UA 2PIZA 2BL1A 3D67A 1T6YA 1GR1A 5IYRA 1EP2B 1IYKA 1NBMA 1UFHA 3PGPA 4FD7A 4X7FA 2DOGA 2CNSA 1MJBA 1CNEA 1SQHA 4ZX9A 3GVJA 5DN6A 2IMOA 3P2HA 3IWWA 4G7WA 4UEEA 4YHBA 3SXOA 2R7HA 1YK3A 3EY5A 3CMEB 3IEHA 1F2PA 3WXMA 2POKA 4WJBA 2J9AA 3WR7A 4P6YA 1YGHA 3CPXA 1PJ5A 2G0BA 4EMEA 4UZEA 5HZAA 2HB6A 1YREA 2I3CA 5HVFA 4A31A 4P45A 3Q38A 1ZLHA 2FSRA 1QSNA 3H4QA 1ZM9A 2V8GA 2ZTGA 5LYIA 4P4FA 4KSFA 2J8MA 1QX4A 2Z6BD 4UZUA 1KK2A 4FXUA 1TTTA 4FN5A 2Z3LA 2ZEOA 3EC4A 2LZJA 1QGYA 5EMIA 1EP1B 1OZPA 1EFRA 3OW2B 2X3UA 4B47A 4OP7A 1CG2A 3RYOA 3GLJA 3KHZA 4B5OA 3GKRA 3W91A 3B3TA 3CZXA 1Y0RA 2XEIA 4TT3A 2OBRA 4KOYA 5HZBA 1ZM2A 2DCUA 3FYNA 4OIDA 4UBRA 1COWA 4KOVA 1QVGB 1ZG7A 5KSWB 1E79A 4DNCA 1KK3A 4UFXA 3QB8A 3BY2A 2V31A 2RC5A 2GREA 4NGQA 3Q6RA 2I79A 3LVBA 3VR6A 2Q6KA 2BO9A 2JBJA 3KL9A 2CIJA 4HE5A 1M1DA 4R8FA 2OZGA 1R5NA 1KTVA 2D4OA 1JNYA 5K8OA 1YX2A 3BCFA 2BCOA 5G20A 4KOWA 3QFTA 2XGJA 1ZG9A 2WPDA 3LQ6A 4C2XA 1WTHD 3B7IA 2OZUA 1XMTA 3IU1A 2F4NA 1EFCA 4LBZA 3CDXA 4NXYA 2F7VA 3GQBA 4II2A 2XEJA 4F8ZA 1H8HA 2W6IA 1QSOA 2D3NA 1BAVA 1KRHA 1XMBA 3PA2A 1IOFA 5H86A 4XMYA 2Q6OA 3R6KA 1CNFA 1EP3B 4XPKA 3PUMA 3GY9A 4CYOA 3TT2A 3I9SA 1XF8A 3D68A 4G1BA 4GQNA 1Q82D 2PJAA 1V0FA 5F46A 2QMLA 4NGNA 2V7VA 4WZEA 1YJNB 4KOXA 5TV2A 4NGTA 3ZIAA 3OEHA 1KQSB 1VQ4B 2ZEEA 4GS4A 4OC3A 1NJID 1T5EA 3PP9A 1JB9A 1E1RA 4R3LA 4MFZA 3A3GA 1J9ZA 4AF6A 1PJ6A 3OKXA 2ZXHA 2ZBVA 3CP8A 3Q39A 2JEVA 4ZGYB 4DK1A 1NB0A 3ZJ0A 3MHPA 3LACA 4IUSA 1ZM4A 4I49A 3AGQA 3OWCA 4RN7A 4RPDA 3R9GA 5CNPA 2YWGA 4ZCMA 3T56B 4G7XA 2GFQA 2ZOGA 1N71A 5FVJA 1FNBA 2C27A 1AYEA 3KHXA 1WSVA 3QFCA 1IIDA 1YSJA 1PJ7A 5BWAB 2IQ6A 2CY2A 2ZELA 4DK0A 4XQFA 5F4MA 3FX6A 3W2GA 1H42A 2RFHA 2BSAA 2F8HA 2OOTA 3KR5A 4YU9A 2PRBA 2HCJB 3B2YA 2OK8A 3B3WA 4ZY0A 4NGSA 1XBUA 3BHXA 3FPKA 4DYOA 2CNTA 2CNMA 2O28A 3PENA 4KKUA 1XIXA 1R3NA 3IWGA 3FEDA 2V7UA 1U6MA 3L2NA 1QUEA 3W6SA 1Q2DA 4Z65A 1DTDA 1VQ5B 3EXNA 1VIXA 2EUIA 4UAJA 2R98A 3H9NA 2XZLA 1RTQA 3S6HA 1M4LA 3ZZIA 4B3FX 2PJ9A 3HAGA 3B78A 4PC1A 3KEWA 5IYPA 1UD4A 3SXNA 1VHEA 3BY1A 1E3XA 1GVHA 3DDYA 3AVWA 1B23P 3FB3A 3CRZA 4RI1A 4M2LA 1M1KD 1F2OA 4A2ZA 5C88A 4N3GA 4H6ZA 2B5OA 3RNZA 2XZPA 1KUVA 2BV3A 2C2WA 3JTKA 1DARA 4OLLA 2AE6A 4RS2A 1CP7A 3A9LA 4TMVA 1F20A 2YWHA 2ZZQA 3HUVA 3C26A 2X0KA 1V0EA 2FX3A 6CPAA 2CC2A 1QVFB 4FAIA 3B3VA 1RQRA 3AVUA 4FD4A 2VZYA 4JWPA 2VNIA 1XOVA 3TFYA 4K3NA 1S4MA 4KZTA 2EO8A 4X8IA 5LRJA 3D8PA 1N06A 4R9MA 4Z1MA 4NFRA 1BPLA 4LC0A 2ZOFA 4Q7JB 1FY7A 2D9RA 2HUZA 2Q6LA 2ZW7A 5FNZA 4CGLA 3SI1A 2B4BA 3PRTA 4CAXA 4KLVA 3VWDA 2WZPP 3T53B 2WR8A 2PRQA 4JXQA 3G4SB 2AFUA 1OHHA 2D74A 3WQZA 4JJXA 1QFJA 1TUIA 5LYLA 3QAYA 2QA4B 1S7LA 1E43A 1W0JA 5A27A 3IJ3A 5HKKA 2P0WA 2C78A 4NBSA 2NPFA 3CD6B 4NJQA 4RD3A 2WYRA 5F47A 4MCRA 1AMPA 3JQQA 5AG4A 1B6BA 1CP6A 5IB9A 3DR6A 2B7CA 4CGNA 4R3KA 4P4JA 4MHZA 4M4SA 4XNHC 4C7HA 4PQAA 4DNRB 4W9YA 4ZYQA 4KS9A 4R7MA 5F09A 1VLYA 5A88A 5CPAA 4MMOA 2C5HA 1P4NA 4NGRA 4FWTA 4MCPA 3MGDA 5IV0A 1VQ8B 2KCWA 2Q0YA 1WORA 2JIZA 4ORFA 4M3SA 1E1QA 4H9GA 3OFNA 3K9UA 2AFSA 3NE5B 1X10A 2Y0MA 2PJBA 4CAFA 3ONUA 4KLWA 3VMFA 4AVBA 3OZWA 4RM0A 3ASRA 3TC8A 2REFA 2HC9A 2Z11A 4OAEA 1K9MD 3S9MA 5AG5A 1NRKA 1VHOA 4MFJA 1KD1D 2GJPA 4QFMA 4WQMA 1Q7LA 4BMHA 3H8FA 3OOCA 5EC4A 5GV7A 4X07A 4F9UA 3D2PA 3PEIA 5DS0A 3SJFA 4XLHA 1BLIA 1YVKA 3CPWB 1FNCA 2PMDA 3P2FA 1TLLA 4B10A 5LRKA 3CCJB 3PB4X 4MHPA 5D8NA 4B3GA 2HLDA 2C6PA 4XNHB 3JQRA 2VNKA 1M90D 1Z8TA 4ACBA 2DPTA 1VF7A 1LFWA 1R5OA 4B5PA 4M6HA 1N07A 1GO2A 4XNFA 2FL4A 2ZEHA 4A39A 2AFOA 1FNOA 4U9YA 3F8KA 1QSRA 4PV6A 1HDQA 1YQEA 3SJEA 1S7KA 3PB7X 1E63A 1NE9A 2JBKA 1H8LA 3JRUA 3PUNA 1M44A 1X12A 4LQGA 5LMZA 5HMNA 2BPOA 2WPWA 5IB0A 1OGJA 3I56B 4NCZA 5AG6A 1YLOA 3SJXA 3K9TA 3RZAA 1IJFA 5IYNA 3OZVA 3A1PA 3AGPA 4UEFA 4MHNA 4K30A 3ZC3A 3MRUA 3VH9A 1I8DA 1G7TA 3G3SA 1S60A 1VKCA 2KVOA 4B12A 1DE4C 2RC6A 2Z0ZA 3FIXA 2ZW4A 4HNYB 4XOPA 3KGQA 2ZEDA 3JU4A 3PB6X 1EFTA 1Z5RA 2DF5A 1R57A 2GU2A 1VGYA 5LYDA 1M4DA 4C7IA 1TVCA 1NSAA 4H89A 2PJ5A 4MI4A 4HIZA 4TN1A 4P44A 2XEXA 1TIQA 4HE6A 3F0AA 2PDOA 4QVAA 2QYVA 3CESA 3PVDA 3IWEA 5TY0A 2CF4A 2VI7A 1E3ZA 4Z4ZA 4XKWA 2ARHA 2BF4A 1Q2CA 1QQ9A 1G7RA 1Z8XA 4MHDA 4IAVA 5TRDA 1VQOB 4CGOA 3SHPA 2CTBA 4FK8A 2ZBUA 4YAUA 2BM0A 2B5GB 3ZUGA 3SJPA 1UD6A 2VBTA 3LNNA 4G1VA 5A8AA 4FUUA 2PJ1A 2B5GA 4UIAA 2DXQA 2HV2A 4A32A 5I0CA 2Q7SA 4RD4A 4Z4YA 3G05A 3D2MA 3PFOA 2OK7A 4Q38A 3OEEA 2FE7A 4IHMA 5H84A 1KC8D 4OIWA 1P0HA 3CB4A 5AN9A 1WU8A 4TMXA 2ZEPA 4YELA 4Y9UA 4AB7A 4LBWA 1F57A 4B43A 3V7AA 2WSSA 2XNJA 3TOAA 3WNDA 2EBJA 1HZEA 2Q4ZA 3GB0A 2ZENA 1NSLA 1VJSA 3ZZTA 2C5BA 1R43A 3BCDA 1XE4A 2BVNA 4Z4WA 1BX0A 1NB9A 4ZGNB 4MYUA 1VQ7B 2VXKA 4G5GA 1UD3A 2R8VA 2PJ3A 3QFSA 4FD6A 1Q9SA 2ZITA 1BMFA 1GJRA 3WC7A 1GHEA 2W6JA 4XONA 4C43A 1MK4A 4P4EA 1TF9A 4MXUA 1YJ9B 4BPRA 4XR6A 1CM0A 4NEXA 4XLEA 3B35A 3AVYA 3P26A 3SKBA 2X7BA 2H5MA 4CYNA 3KKWA 2WUUA 3D7DA 4A37A 3Q6QA 2XZOA 3JUWA 3V76A 2OBTA 4MFKA 1RQPA 4PK3A 4DNTB 3PB9X 2V4DA 2DERA 1CBXA 2WJVA 2PIYA 5BSXA 1M4IA 2VJJA 3BLNA 2YNDA 1BLLE 1FRQA 1AMOA 3AVTA 3FEEA 4AXVA 3OPOA 4XKVA 1N8RD 1FDRA 1V5VA 2QJ8A 2Z3KA 3W5VA 1RXTA 4XPLA 4C2ZA 3FH4A 2GPJA 3B8HA 2PJ8A 4B6ZA 4ZV4A 1MJAA 1ZO0A 1OB5A 3LQEA 4RCYA 2BGJA 1IICA 1HDUA 4UA3A 2RC4A 1W34A 3B3CA 4CGPA 5HXDA 1CJWA 4K1XA 2GANA 4Z4TA 4FWUA 4NCNA 3P27A 1H85A 3FRMA 4A94A 2ZEFA 4E2AA 1QGAA 4CPAA 5FA6A 1S7NA 4JMQA 2ABZA 2EVNA 3LODA 4RD1A 2GE3A 3R9FA 4Y49C 2ZW6A 3H8GA 2JJ1A 4CYQA 4PXCA 2VEZA 1UD2A 2EFGA 3FNCA 3R95A 3NA6A 4XM3A 1Y9WA 4F9VA 5FL7A 4PPZA 5GCNA 3RAMA 4E0AA 4X06A 2NV4A 3QE2A 4P26A 2JDDA 4GXHA 2C77A 4B14A 3KZWA 5KNLA 3ONYA 5IYQA 3OAAA 4TMTA 3PB8X 2Z10A 3ASTA 1S7FA 4EFDA 1W35A 4NF1A 3B8GA 4YGOA 1WPCA 4OC1A 5E96A 4AVAA 2PE3A 5ELYA 2BM1A 4ZGQB 4U5YA 3T9YA 3PBBA 2G9DA 1U2RA 1B87A 4MFPA 4Y49B 4P3YA 4PXBA 4QHYA 2F1MA 5H5JA 2Q51A 3FJOA 2VNJA 5D29A 1BX1A 3R9EA 3TO6A 2JJ2A 2DEAA 3KR4A 5DWNA 4ZCLA 4Z4VA 2B4DB 5L46A 3LD2A 5EBVA 2VZLA 5B6IA 4P4DA 4P1VA 5AGEA 2EK9A 4P4BA 2B4DA 3W2FA 3G6EB 1KJZA 4UFWA 4MFLA 2CNDA 4KOSA 2OU2A 4XL9A 4MY0A 3ZZ0A 4ACAA 3NH4A 1L0CA 3SLNA 5K8MA 2JLMA 2NYQA 2Q4VA 2F5IA 2GK7A 5F4OA 5A89A 3DNSA 4PK2A 3U6KA 4KOUA 3OP1A 4QBJA 2V8DA 3PA1A 3E1YE 2X8KA 3GVKA 4OOVA 3VNVA 3WT4A 4RJLA 3SJGA 1W9XA 1IB0A 4DQLA 3D7FA 4YRHA 4YXWA 3V38A 2BSWA 1ARMA 4CQJA 1AUGA 4YAFA 2C1CA 4JLYA 2Q44A 5F4JA 3SLDA 1TKHA 1WP6A 2QTLA 1CX8A 1YJWB 5KW9A 2QIRA 4ZY2A 4ZX8A 3H94A 2CBXA 3CC4B 4ONUA 2QE7A 2C4TA 1YX0A 4PAAA 5J3OA 2AFXA 4EWTA 4TSFA 1SM4A 2OR4A 2BUEA 4TWEA 1DG1G 4AVCA 1GAQA 4RLZA 1QGZA 2I1LA 1ZG8A 3TCVA 4F0XA 2XNDA 4TKOB 2DY1A 3CCRB 2IL4A 3IFEA 4F6AA 3OJWA 2BMWA 1GAWA 1S5KA 3H8EA 3S6KA 4JD6A 3QAHA 3UY5A 1YW6A 3V7ZA 3KASA 4XN0A 4Q7AA 3CCUB 4U9ZA 2G3TA 4XPDB 1KZFA 3J81k 3FECA 3BXMA 1HVXA 2X6XA 4PXDA 2DYIA 4N3NA 2V8HA 2VBQA 3MN8A 3BC9A 5GV8A 1IYLA 1H8EA 3AVXA 2CTCA 5IK2A 2VNHA 2ZZGA 3TOBA 1S72B 4WWVA 4HNWB 4PC7A 1T6XA 4ROXA 4J3GA 2C6CA 2E1BA 5G21A 2CXAA 1J4JA 3KI9A 3GVLA 3V8IA 4NSQA 4CAWA 2CW5A 4ZCIA 3N7ZA 2VBSA 1OGIA 2GJKA 4XLFA 3JVNA 1IGBA 3N5FA 2O53A 2IJZA 2VL1A 2X6WA 4LBYA 5HVHA 1VHSA 2EK8A 1ZUNB 5FO0A 4PSXA 3IU2A 4YFJA 4UF4A 2FS5A 3D4UA 4OPOA 4PABA 1Z9UA 1YW4A 3TTHA 4R71A 1ZM3A 2PVWA 2J8NA 4IK2A 2Q7BA 2J8RA 1D2EA 1QH0A 1QUFA 4E0FA 2V77A 1TXRA 1EXMA 3IO1A 2RB7A 2GK6A 3NE7A 1Y7EA 2OB0A 1XRYA 3A8IA 3CXCB 4OPSA 1BO4A 1PU9A 4AG7A 2ZPAA 3T51B 5E6TA 2AHOA 1TKJA 5TR9A 4AF7A 2ZTNA 1IOIA 3BJ7A 3VWEA 2OTJB 2F1LA 5JH9A 5CDFA 3S6FA 4IW3B 1JWQA 2ZL7A 4M85A 1YIJB 2DPSA 4NNJA 1QSMA 1LOKA 4UCNA 2B7BA 1VLOA 1BPMA 2YNEA 1Y0YA 3GIUA 1UWYA 2QDXA 4LQ6A 4NGPA 1XB2A 2NSMA 5THWA 2ZZFA 1N0VC 4MBUA 5K8PA 5FO1A 2WJYA 2D3LA 4YEJA 2PSWA 4ZY1A 3G8WA 3CCVB 2DEUA 4MRIA 2FXFA 3S9LA 1FNDA 3OW7A 2J7KA 1QFZA 2GLFA 3R1KA 2JDIA 2R6HA 4RDKA 4O23A 1KZLA 2PQ8A 3WABA 3QFRA 2Z3OA 3FMCA 4JYWA 4UCPA 3FVLA 4XN3A 3PFEA 3DR8A 1P4MA 1YHQB 4TMZA 1K8AD 1Z8WA 3VO1A 4YAOA 3WNBA 2WSAA 3A35A 2V7XA 2XOKA 3CCLB 1QSTA 2EWBA 1Z2LA 2Q04A 4JXRA 4RD6A 4A33A 5KTDA 4A95A 1OBRA 5KTCA 3W5HA 4B4DA 4OADA 3GSIA 2PVVA 4RD2A 3BNWA 4Y7CA 4KVME 2M5SA 3ES9A 5LRGA 5FIUA 4KVXA 3A8JA 4IF5A 3CP2A 2OBSA 2VJIA 2OYNA 5HXBA 4P25A 2AFMA 1E64A 3ZZUA 4OOXA 1PUAA 5HVGA 2XEGA 2VYQA 2FCKA 4BBHA 1VQLB 5BSYA 3W2IA 3CCQB 2X85A 3CCEB 1D1NA 1IY7A 1WOOA 4L89A 4MYTA 4H2KA 2V7WA 3LO8A 4CGMA 3R6JA 1Q7YD 4YAWA 4XORA 1HEEA 4M6GA 3HLPA 1B2RA 2YWFA 4C2YA 2YGWA 4CYPA 4P3IA 1Z4EA 3CW2A 2PJ4A 2ZXVA 4PGOA 2A4NA 1F60A 3OZUA 4LBVA 5J8FA 1Q86D 1KWMA 3W5UA 1YLEA 4J0QA 4XD7A 1WK4A 3D26A 3FKSA 2PJ7A 3QNVA 2OZHA 3U6BA 4F0YA 3ZPNA 2ZZEA 5J1QA 4OC0A 1Z4RA 3NH5A 2R9VA 3CXQA 1W87A 3SI2A 4RUHA 2QN6A 3BQJA 2ANPA 3WY9A 3TX8A 3PZJA 2ZXIA 4X0CA 2CRVA 3I3GA 1SKYB 3ASQA 3B82A 1UD8A 1JJ2B 1I12A 4RD0A 4PC2A 1YITB 4C68A 2QECA 4II9A 1LAMA 1IB1E 4U9UA 2VQYA 3CPAA 7CPAA 4P4IA 2GIVA 1OB2A 2YWEA 2QVPA 2ZW5A 4A38A 1YVOA 5EMNA 3F5BA 3VNUA 3VARA 4XLCA 1K73D 2REEA 4G6IA 1PKVA 1LRZA 4CAEA 1V0CA 4MHYA 4MCSA 3VATA 3RO0A 1GYTA 3A3BA 2XNCA 1PYTB 1VQMB 5CBMA 5HH1A 3TO9A 4CAVA 1VQPB 4X7CA 4KOTA 4KUAA 1VQKB 2P3MA 5KTAA 4OPVA 1EE3P 4R76A 4M6IA 2FIWA 5JM6A 1N08A 4F7DA 1CQXA 1WOSA 4QVTA 5J35A 1NMTA 1XE1A 3ISXA 3D66A 1VQNB 4EVYA 4OOSA 3E20A 4QVJA 3CMMA 4CS0B 1YI2B 3IC1A 5JBQA 1ARLA 5A28A 4OMEA 1Q81D 1W0KA 1M4GA 1RO5A 2DETA 2CK3A 5K8NA 2DIEA 2I00A 4L8JA 4CRYB 4QV2A 1EFUA 4KORA 4B48A 2OH1A 2Z3MA 2AFWA 4HKFA 2QTZA 1MRZA 3IGRA 2XEFA 4KSAA 4KVOE 2PJCA 4PSWA 4MCQA 1A8PA 3CC2B 2BEIA 3FBUA 1ZLIA 3SEJA 5G1ZA 1DDGA 5DSZA 1FT7A 4YWYA 4ASUA 4PXEA 4UEZA 1QMUA 4UWIA 3NFZA 2F43A 1QG0A 2VZZA 2YNCC 3BI0A 2AFZA 3DLJA 1MJ9A 2BOAA 4P22A 1WDTA 3A8KA 1VQ6B 4KUBA 3U2QA 4GM5A 4FD5A 4HPSA 3AVVA 5DWMA 3E0KA 1ELMP 1JA0A 4OKOA 3FXTA 2V7TA 4WZTA 2JN9A 4QC6A 5LYFA 2QEXB 3CT9A 4BD9A 3OJXA 3NE8A 5J8CA 4ONWA 1ON0A 4PC3A 4B11A 4KKSA 1FX0A 1IU8A 3FPPA 3ISZA 4Z4SA 2ATRA 4OC4A 4TMWA 1KK0A 4ZBGA 4X5KA 3W2HA 1T6ZA 1Y9KA 2P6FA 4Q36A 2C4UA 1LCPA 1FRNA 4C0SA 3CCSB 4UFVA 3LWUA 3RBUA 2HQYA 1YMEA 2PR1A 2FVGA 2BN4A 2PJ2A 1TKFA 2PCUA 1ELOA 1JQGA 1KUXA 3CXPA 4XPDC 2B58A 4A30A 1SKQA 2PR8A 4QUSA 2ZL5A 3TE4A 3WBKA 1HA3A 3CMAB 4X2TA 1WOPA 3NH8A 1YR0A 4YALA 1E62A 4R87A 2PIAA 1TF8A 3CTAA 1BJKA 3PBEA 1QFYA 1BOBA 1R5BA 4R6TA 4CRZB 3H5ZA 4PC6A 4OC5A 4L8AA 2YNCA 3S6GA 1XQBA 5THXA 4JZ0A 4P12A 4WZLA 3KQXA 2X53S 2WPXA 3D7HA 4B44A 2WZNA 2R1IA 3DSBA 2P6EA 2Z3PA 4P2NA 2HMAA 3I1FA 1JA1A 3DDDA 3ASSA 4RDLA 1DDIA 2GQFA 4DQKA 4M1KA 3W2EA 4NGMA 5G22A 1K28D 5JQ4A 2K5TA 3CCMB 4QUZA 1KUYA 3DGVA 3VO2A 2ZEMA 1BQEA 1I21A 2O4HA 1I1DA 2QGGA 3JQPA 2PC1A 5F48A 2PJ0A 1VQ9B 2B3VA 3CXSA 1I7PA 3KQZA 5I4MA 3ZBUA 4G1PA 1A2ZA 4LUAA 2X6YA 3LMSA 1XEBA 1BPNA 4UCMA 3IIBA 4RPBA 2Q6IA 3T90A 3BJ8A 3GYAA 2HDNB 5IYWA 3D7GA 4UIBA 4Z4UA 4KKTA 1IHMA 3MCAA 4E8OA 2P6GA 2GLJA 3SI0A 1I18A 3RY8A 2GJRA 4P10A 3WC5A 3WC6A 2Q4YA 4UZFA 2FIAA 4X7DA 2V7QA 4RDJA 4LX9A 3I1UA 4H6UA 1KK1A 4AVZA 1XJOA 5F49A 1N05A 3ZBTA 4X05A 3GUXA 2EIXA 1LANA 1WWZA 1KMHA 3OE7A 1Q2YA 5JGFA 4MFQA 4EH1A 1UMKA 4X3RA 5AG7A 2NMTA 2AJ6A 1W2BB 4MJ8A 4OP4A 1OB0A 4II3A 2JEWA 5ISVA 4B5PB 4AG9A 4B13A 4M53A 1LAPA 8CPAA 5JPHA 4M0LA 1WSRA 3I55B 1K4JA 2ODFA 3S9NA 2V8VA 1AIPA 3TO7A 1UD5A 3EFAA 3B3SA 2Q43A 3MMPA 3W6XA 4Z4RA 4WZKA 1PCAA 3G71B 4FBEA 4DUKA 4X7EA 4KSIA 3T8WA 3ASPA 2JDCA 3D3SA 2FT0A 4P9SA 3EO4A 3FF3A 4R57A 2Z3NA 2ZL6A 3K2KA 4TNUA 3WNCA 3CC7B 2PLFA 5H59A 1CPSA 2BGIA 4XLAA 1IJEA 2B3UA 3R96A 3WBJA 1NDHA 1MABA 4MY3A 1ELLP 3QSYA 1Z8LA 1FNMA 4BINA 2PJ6A 3GIRA 1Y7RA 2ZEGA 3Q3AA 3WYAA 4HNXB 4QB9A 1G7SA 4B3XA 1S0UA
chains in the Genus database with same CATH topology
4P4JA 4MHZA 5J1QA 2C6GA 4OC2A 2PE3A 4OC0A 5ELYA 3NH5A 4PQAA 4W9YA 4NJRA 3PBBA 4ZYQA 4R7MA 5F09A 1CPXA 1XFOA 5CPAA 3SI2A 3BI1A 2G9DA 4RUHA 4DJLA 4MMOA 2ANPA 3TX8A 4NGRA 4MCPA 4PXBA 3FJUA 4ZI6A 2Q51A 2PIZA 5D29A 3D67A 2DEAA 3KR4A 2AFSA 2PJBA 1LAMA 4P4DA 3TC8A 3CPAA 2EK9A 4P4BA 2HC9A 7CPAA 4P4IA 2QVPA 4A38A 4ZX9A 3VARA 3S9MA 2IMOA 3IWWA 1VHOA 4UEEA 3NH4A 1Q7LA 3IEHA 1F2PA 2POKA 4WJBA 3H8FA 2J9AA 4MHYA 5K8MA 4F9UA 4P6YA 4MCSA 2NYQA 3CPXA 3PEIA 5DS0A 3SJFA 3VATA 4EMEA 1GYTA 2HB6A 1PYTB 2I3CA 5LRKA 3PB4X 5HVFA 4MHPA 5CBMA 5D8NA 2V8DA 2C6PA 4P45A 1ZLHA 1LFWA 2V8GA 5LYIA 4P4FA 3WT4A 3SJGA 1EE3P 4R76A 3D7FA 5JM6A 2ZEHA 4A39A 2ZEOA 2AFOA 3V38A 1FNOA 1ARMA 2C1CA 1HDQA 3SJEA 3ISXA 3D66A 3PB7X 1TKHA 2JBKA 1CG2A 1H8LA 3JRUA 1CX8A 3GLJA 4LQGA 3KHZA 3B3TA 3IC1A 4ZY2A 1Y0RA 2XEIA 1ARLA 4ZX8A 4OMEA 1YLOA 4OIDA 3SJXA 3K9TA 3RZAA 1ZG7A 5K8NA 2AFXA 4EWTA 4UEFA 2OR4A 4TWEA 4MHNA 3MRUA 3VH9A 2AFWA 1ZG8A 2GREA 1DE4C 2XEFA 4NGQA 2PJCA 3IFEA 2BO9A 2JBJA 3KL9A 3KGQA 2ZEDA 2CIJA 4MCQA 3H8EA 4R8FA 1YW6A 3V7ZA 1ZLIA 3PB6X 1Z5RA 3KASA 2GU2A 5K8OA 1FT7A 4Q7AA 2BCOA 4YWYA 1ZG9A 1VGYA 4PXEA 5LYDA 4UEZA 1QMUA 3B7IA 3FECA 3BXMA 3NFZA 3BI0A 2AFZA 3DLJA 2BOAA 3CDXA 4PXDA 2F7VA 1NSAA 2PJ5A 2XEJA 4GM5A 2V8HA 4P44A 4F8ZA 3MN8A 1ELMP 1BAVA 2QYVA 4OKOA 1XMBA 2CF4A 5LYFA 2CTCA 3CT9A 4BD9A 4WWVA 1QQ9A 4ONWA 4IAVA 3D68A 3ISZA 2C6CA 2PJAA 4NGNA 2CTBA 4OC4A 4NGTA 2ZEEA 3KI9A 4OC3A 1LCPA 3LWUA 3RBUA 1YMEA 2FVGA 2PJ2A 1TKFA 2PCUA 4FUUA 1IGBA 3N5FA 2PJ1A 2O53A 4UIAA 2IJZA 2VL1A 5HVHA 1JQGA 2EK8A 4UF4A 3D4UA 4X2TA 3NH8A 1YW4A 1TF8A 3PFOA 2PVWA 3PBEA 4IK2A 4IHMA 4R6TA 2ZOGA 2V77A 1TXRA 4OIWA 3IO1A 4OC5A 2ZEPA 1F57A 1AYEA 3KHXA 2RB7A 4JZ0A 1YSJA 3KQXA 1Y7EA 2IQ6A 3D7HA 2ZELA 2WZNA 3FX6A 1XRYA 2Q4ZA 3GB0A 2RFHA 2ZENA 2F8HA 2OOTA 3KR5A 4YU9A 1TKJA 3B2YA 3B3WA 1R43A 4ZY0A 4NGSA 1XBUA 3BHXA 5JH9A 4DYOA 4NGMA 1R3NA 3DGVA 3FEDA 1LOKA 2ZEMA 2O4HA 3L2NA 1BPMA 2PJ3A 1Y0YA 4Z65A 1DTDA 1UWYA 2PJ0A 3WC7A 4NGPA 2NSMA 4P4EA 5THWA 1TF9A 4MXUA 1VIXA 3KQZA 5I4MA 1RTQA 3B35A 1M4LA 5K8PA 4G1PA 4ZY1A 3LMSA 1BPNA 4MRIA 3D7DA 4A37A 2PJ9A 3S9LA 3IIBA 2GLFA 1VHEA 4O23A 3WABA 3PB9X 3FMCA 1CBXA 3D7GA 4JYWA 4UIBA 2PIYA 3FVLA 3PFEA 1BLLE 3FEEA 4AXVA 2GLJA 2QJ8A 3SI0A 1F2OA 3FH4A 4P10A 2PJ8A 3WC5A 3WC6A 4B6ZA 2EWBA 1Z2LA 3I1UA 1HDUA 1XJOA 1CP7A 1OBRA 3B3CA 5HXDA 3HUVA 3GUXA 1LANA 6CPAA 4FWUA 2PVVA 4FAIA 3B3VA 5LRGA 4A94A 5JGFA 2ZEFA 4X3RA 4OP4A 4CPAA 2JEWA 4K3NA 2ABZA 4X8IA 5LRJA 1LAPA 2AFMA 8CPAA 4NFRA 3S9NA 3H8GA 2V8VA 5HVGA 2XEGA 2ZOFA 3B3SA 2Q43A 4PXCA 1PCAA 4FBEA 3SI1A 4DUKA 4KSIA 3T8WA 3PRTA 1IY7A 3NA6A 4H2KA 4F9VA 4PPZA 2PRQA 1HEEA 3RAMA 2AFUA 3FF3A 3K2KA 4TNUA 5LYLA 3HLPA 1CPSA 3KZWA 2PJ4A 3IJ3A 3PB8X 1ELLP 1Z8LA 4NJQA 2PJ6A 2WYRA 1KWMA 2ZEGA 4EFDA 4MCRA 1AMPA 2PJ7A 3QNVA 1CP6A 5IB9A 4OC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4J A;  4MHZ A;  5J1Q A;  2C6G A;  4OC2 A;  2PE3 A;  4OC0 A;  5ELY A;  3NH5 A;  4PQA A;  4W9Y A;  4NJR A;  3PBB A;  4ZYQ A;  4R7M A;  5F09 A;  1CPX A;  1XFO A;  5CPA A;  3SI2 A;  3BI1 A;  2G9D A;  4RUH A;  4DJL A;  4MMO A;  2ANP A;  3TX8 A;  4NGR A;  4MCP A;  4PXB A;  3FJU A;  4ZI6 A;  2Q51 A;  2PIZ A;  5D29 A;  3D67 A;  2DEA A;  3KR4 A;  2AFS A;  2PJB A;  1LAM A;  4P4D A;  3TC8 A;  3CPA A;  2EK9 A;  4P4B A;  2HC9 A;  7CPA A;  4P4I A;  2QVP A;  4A38 A;  4ZX9 A;  3VAR A;  3S9M A;  2IMO A;  3IWW A;  1VHO A;  4UEE A;  3NH4 A;  1Q7L A;  3IEH A;  1F2P A;  2POK A;  4WJB A;  3H8F A;  2J9A A;  4MHY A;  5K8M A;  4F9U A;  4P6Y A;  4MCS A;  2NYQ A;  3CPX A;  3PEI A;  5DS0 A;  3SJF A;  3VAT A;  4EME A;  1GYT A;  2HB6 A;  1PYT B;  2I3C A;  5LRK A;  3PB4 X;  5HVF A;  4MHP A;  5CBM A;  5D8N A;  2V8D A;  2C6P A;  4P45 A;  1ZLH A;  1LFW A;  2V8G A;  5LYI A;  4P4F A;  3WT4 A;  3SJG A;  1EE3 P;  4R76 A;  3D7F A;  5JM6 A;  2ZEH A;  4A39 A;  2ZEO A;  2AFO A;  3V38 A;  1FNO A;  1ARM A;  2C1C A;  1HDQ A;  3SJE A;  3ISX A;  3D66 A;  3PB7 X;  1TKH A;  2JBK A;  1CG2 A;  1H8L A;  3JRU A;  1CX8 A;  3GLJ A;  4LQG A;  3KHZ A;  3B3T A;  3IC1 A;  4ZY2 A;  1Y0R A;  2XEI A;  1ARL A;  4ZX8 A;  4OME A;  1YLO A;  4OID A;  3SJX A;  3K9T A;  3RZA A;  1ZG7 A;  5K8N A;  2AFX A;  4EWT A;  4UEF A;  2OR4 A;  4TWE A;  4MHN A;  3MRU A;  3VH9 A;  2AFW A;  1ZG8 A;  2GRE A;  1DE4 C;  2XEF A;  4NGQ A;  2PJC A;  3IFE A;  2BO9 A;  2JBJ A;  3KL9 A;  3KGQ A;  2ZED A;  2CIJ A;  4MCQ A;  3H8E A;  4R8F A;  1YW6 A;  3V7Z A;  1ZLI A;  3PB6 X;  1Z5R A;  3KAS A;  2GU2 A;  5K8O A;  1FT7 A;  4Q7A A;  2BCO A;  4YWY A;  1ZG9 A;  1VGY A;  4PXE A;  5LYD A;  4UEZ A;  1QMU A;  3B7I A;  3FEC A;  3BXM A;  3NFZ A;  3BI0 A;  2AFZ A;  3DLJ A;  2BOA A;  3CDX A;  4PXD A;  2F7V A;  1NSA A;  2PJ5 A;  2XEJ A;  4GM5 A;  2V8H A;  4P44 A;  4F8Z A;  3MN8 A;  1ELM P;  1BAV A;  2QYV A;  4OKO A;  1XMB A;  2CF4 A;  5LYF A;  2CTC A;  3CT9 A;  4BD9 A;  4WWV A;  1QQ9 A;  4ONW A;  4IAV A;  3D68 A;  3ISZ A;  2C6C A;  2PJA A;  4NGN A;  2CTB A;  4OC4 A;  4NGT A;  2ZEE A;  3KI9 A;  4OC3 A;  1LCP A;  3LWU A;  3RBU A;  1YME A;  2FVG A;  2PJ2 A;  1TKF A;  2PCU A;  4FUU A;  1IGB A;  3N5F A;  2PJ1 A;  2O53 A;  4UIA A;  2IJZ A;  2VL1 A;  5HVH A;  1JQG A;  2EK8 A;  4UF4 A;  3D4U A;  4X2T A;  3NH8 A;  1YW4 A;  1TF8 A;  3PFO A;  2PVW A;  3PBE A;  4IK2 A;  4IHM A;  4R6T A;  2ZOG A;  2V77 A;  1TXR A;  4OIW A;  3IO1 A;  4OC5 A;  2ZEP A;  1F57 A;  1AYE A;  3KHX A;  2RB7 A;  4JZ0 A;  1YSJ A;  3KQX A;  1Y7E A;  2IQ6 A;  3D7H A;  2ZEL A;  2WZN A;  3FX6 A;  1XRY A;  2Q4Z A;  3GB0 A;  2RFH A;  2ZEN A;  2F8H A;  2OOT A;  3KR5 A;  4YU9 A;  1TKJ A;  3B2Y A;  3B3W A;  1R43 A;  4ZY0 A;  4NGS A;  1XBU A;  3BHX A;  5JH9 A;  4DYO A;  4NGM A;  1R3N A;  3DGV A;  3FED A;  1LOK A;  2ZEM A;  2O4H A;  3L2N A;  1BPM A;  2PJ3 A;  1Y0Y A;  4Z65 A;  1DTD A;  1UWY A;  2PJ0 A;  3WC7 A;  4NGP A;  2NSM A;  4P4E A;  5THW A;  1TF9 A;  4MXU A;  1VIX A;  3KQZ A;  5I4M A;  1RTQ A;  3B35 A;  1M4L A;  5K8P A;  4G1P A;  4ZY1 A;  3LMS A;  1BPN A;  4MRI A;  3D7D A;  4A37 A;  2PJ9 A;  3S9L A;  3IIB A;  2GLF A;  1VHE A;  4O23 A;  3WAB A;  3PB9 X;  3FMC A;  1CBX A;  3D7G A;  4JYW A;  4UIB A;  2PIY A;  3FVL A;  3PFE A;  1BLL E;  3FEE A;  4AXV A;  2GLJ A;  2QJ8 A;  3SI0 A;  1F2O A;  3FH4 A;  4P10 A;  2PJ8 A;  3WC5 A;  3WC6 A;  4B6Z A;  2EWB A;  1Z2L A;  3I1U A;  1HDU A;  1XJO A;  1CP7 A;  1OBR A;  3B3C A;  5HXD A;  3HUV A;  3GUX A;  1LAN A;  6CPA A;  4FWU A;  2PVV A;  4FAI A;  3B3V A;  5LRG A;  4A94 A;  5JGF A;  2ZEF A;  4X3R A;  4OP4 A;  4CPA A;  2JEW A;  4K3N A;  2ABZ A;  4X8I A;  5LRJ A;  1LAP A;  2AFM A;  8CPA A;  4NFR A;  3S9N A;  3H8G A;  2V8V A;  5HVG A;  2XEG A;  2ZOF A;  3B3S A;  2Q43 A;  4PXC A;  1PCA A;  4FBE A;  3SI1 A;  4DUK A;  4KSI A;  3T8W A;  3PRT A;  1IY7 A;  3NA6 A;  4H2K A;  4F9V A;  4PPZ A;  2PRQ A;  1HEE A;  3RAM A;  2AFU A;  3FF3 A;  3K2K A;  4TNU A;  5LYL A;  3HLP A;  1CPS A;  3KZW A;  2PJ4 A;  3IJ3 A;  3PB8 X;  1ELL P;  1Z8L A;  4NJQ A;  2PJ6 A;  2WYR A;  1KWM A;  2ZEG A;  4EFD A;  4MCR A;  1AMP A;  2PJ7 A;  3QNV A;  1CP6 A;  5IB9 A;  4OC1 A; 
#chains in the Genus database with same CATH topology
 4RCZ A;  4AC9 A;  1EWY A;  5IX3 A;  2QMU A;  2C6G A;  4OC2 A;  1D8T A;  2VBU A;  1S3Z A;  4NJR A;  5C82 A;  1CPX A;  1XFO A;  3BI1 A;  4DJL A;  4P6V F;  2VBV A;  2OTL B;  3BH4 A;  3SJZ A;  2D4P A;  2G3A A;  3FJU A;  2E1R A;  4UWJ A;  4ZI6 A;  4XOT A;  4Y9R A;  1G7C A;  1N0U A;  2PIZ A;  2BL1 A;  3D67 A;  1T6Y A;  1GR1 A;  5IYR A;  1EP2 B;  1IYK A;  1NBM A;  1UFH A;  3PGP A;  4FD7 A;  4X7F A;  2DOG A;  2CNS A;  1MJB A;  1CNE A;  1SQH A;  4ZX9 A;  3GVJ A;  5DN6 A;  2IMO A;  3P2H A;  3IWW A;  4G7W A;  4UEE A;  4YHB A;  3SXO A;  2R7H A;  1YK3 A;  3EY5 A;  3CME B;  3IEH A;  1F2P A;  3WXM A;  2POK A;  4WJB A;  2J9A A;  3WR7 A;  4P6Y A;  1YGH A;  3CPX A;  1PJ5 A;  2G0B A;  4EME A;  4UZE A;  5HZA A;  2HB6 A;  1YRE A;  2I3C A;  5HVF A;  4A31 A;  4P45 A;  3Q38 A;  1ZLH A;  2FSR A;  1QSN A;  3H4Q A;  1ZM9 A;  2V8G A;  2ZTG A;  5LYI A;  4P4F A;  4KSF A;  2J8M A;  1QX4 A;  2Z6B D;  4UZU A;  1KK2 A;  4FXU A;  1TTT A;  4FN5 A;  2Z3L A;  2ZEO A;  3EC4 A;  2LZJ A;  1QGY A;  5EMI A;  1EP1 B;  1OZP A;  1EFR A;  3OW2 B;  2X3U A;  4B47 A;  4OP7 A;  1CG2 A;  3RYO A;  3GLJ A;  3KHZ A;  4B5O A;  3GKR A;  3W91 A;  3B3T A;  3CZX A;  1Y0R A;  2XEI A;  4TT3 A;  2OBR A;  4KOY A;  5HZB A;  1ZM2 A;  2DCU A;  3FYN A;  4OID A;  4UBR A;  1COW A;  4KOV A;  1QVG B;  1ZG7 A;  5KSW B;  1E79 A;  4DNC A;  1KK3 A;  4UFX A;  3QB8 A;  3BY2 A;  2V31 A;  2RC5 A;  2GRE A;  4NGQ A;  3Q6R A;  2I79 A;  3LVB A;  3VR6 A;  2Q6K A;  2BO9 A;  2JBJ A;  3KL9 A;  2CIJ A;  4HE5 A;  1M1D A;  4R8F A;  2OZG A;  1R5N A;  1KTV A;  2D4O A;  1JNY A;  5K8O A;  1YX2 A;  3BCF A;  2BCO A;  5G20 A;  4KOW A;  3QFT A;  2XGJ A;  1ZG9 A;  2WPD A;  3LQ6 A;  4C2X A;  1WTH D;  3B7I A;  2OZU A;  1XMT A;  3IU1 A;  2F4N A;  1EFC A;  4LBZ A;  3CDX A;  4NXY A;  2F7V A;  3GQB A;  4II2 A;  2XEJ A;  4F8Z A;  1H8H A;  2W6I A;  1QSO A;  2D3N A;  1BAV A;  1KRH A;  1XMB A;  3PA2 A;  1IOF A;  5H86 A;  4XMY A;  2Q6O A;  3R6K A;  1CNF A;  1EP3 B;  4XPK A;  3PUM A;  3GY9 A;  4CYO A;  3TT2 A;  3I9S A;  1XF8 A;  3D68 A;  4G1B A;  4GQN A;  1Q82 D;  2PJA A;  1V0F A;  5F46 A;  2QML A;  4NGN A;  2V7V A;  4WZE A;  1YJN B;  4KOX A;  5TV2 A;  4NGT A;  3ZIA A;  3OEH A;  1KQS B;  1VQ4 B;  2ZEE A;  4GS4 A;  4OC3 A;  1NJI D;  1T5E A;  3PP9 A;  1JB9 A;  1E1R A;  4R3L A;  4MFZ A;  3A3G A;  1J9Z A;  4AF6 A;  1PJ6 A;  3OKX A;  2ZXH A;  2ZBV A;  3CP8 A;  3Q39 A;  2JEV A;  4ZGY B;  4DK1 A;  1NB0 A;  3ZJ0 A;  3MHP A;  3LAC A;  4IUS A;  1ZM4 A;  4I49 A;  3AGQ A;  3OWC A;  4RN7 A;  4RPD A;  3R9G A;  5CNP A;  2YWG A;  4ZCM A;  3T56 B;  4G7X A;  2GFQ A;  2ZOG A;  1N71 A;  5FVJ A;  1FNB A;  2C27 A;  1AYE A;  3KHX A;  1WSV A;  3QFC A;  1IID A;  1YSJ A;  1PJ7 A;  5BWA B;  2IQ6 A;  2CY2 A;  2ZEL A;  4DK0 A;  4XQF A;  5F4M A;  3FX6 A;  3W2G A;  1H42 A;  2RFH A;  2BSA A;  2F8H A;  2OOT A;  3KR5 A;  4YU9 A;  2PRB A;  2HCJ B;  3B2Y A;  2OK8 A;  3B3W A;  4ZY0 A;  4NGS A;  1XBU A;  3BHX A;  3FPK A;  4DYO A;  2CNT A;  2CNM A;  2O28 A;  3PEN A;  4KKU A;  1XIX A;  1R3N A;  3IWG A;  3FED A;  2V7U A;  1U6M A;  3L2N A;  1QUE A;  3W6S A;  1Q2D A;  4Z65 A;  1DTD A;  1VQ5 B;  3EXN A;  1VIX A;  2EUI A;  4UAJ A;  2R98 A;  3H9N A;  2XZL A;  1RTQ A;  3S6H A;  1M4L A;  3ZZI A;  4B3F X;  2PJ9 A;  3HAG A;  3B78 A;  4PC1 A;  3KEW A;  5IYP A;  1UD4 A;  3SXN A;  1VHE A;  3BY1 A;  1E3X A;  1GVH A;  3DDY A;  3AVW A;  1B23 P;  3FB3 A;  3CRZ A;  4RI1 A;  4M2L A;  1M1K D;  1F2O A;  4A2Z A;  5C88 A;  4N3G A;  4H6Z A;  2B5O A;  3RNZ A;  2XZP A;  1KUV A;  2BV3 A;  2C2W A;  3JTK A;  1DAR A;  4OLL A;  2AE6 A;  4RS2 A;  1CP7 A;  3A9L A;  4TMV A;  1F20 A;  2YWH A;  2ZZQ A;  3HUV A;  3C26 A;  2X0K A;  1V0E A;  2FX3 A;  6CPA A;  2CC2 A;  1QVF B;  4FAI A;  3B3V A;  1RQR A;  3AVU A;  4FD4 A;  2VZY A;  4JWP A;  2VNI A;  1XOV A;  3TFY A;  4K3N A;  1S4M A;  4KZT A;  2EO8 A;  4X8I A;  5LRJ A;  3D8P A;  1N06 A;  4R9M A;  4Z1M A;  4NFR A;  1BPL A;  4LC0 A;  2ZOF A;  4Q7J B;  1FY7 A;  2D9R A;  2HUZ A;  2Q6L A;  2ZW7 A;  5FNZ A;  4CGL A;  3SI1 A;  2B4B A;  3PRT A;  4CAX A;  4KLV A;  3VWD A;  2WZP P;  3T53 B;  2WR8 A;  2PRQ A;  4JXQ A;  3G4S B;  2AFU A;  1OHH A;  2D74 A;  3WQZ A;  4JJX A;  1QFJ A;  1TUI A;  5LYL A;  3QAY A;  2QA4 B;  1S7L A;  1E43 A;  1W0J A;  5A27 A;  3IJ3 A;  5HKK A;  2P0W A;  2C78 A;  4NBS A;  2NPF A;  3CD6 B;  4NJQ A;  4RD3 A;  2WYR A;  5F47 A;  4MCR A;  1AMP A;  3JQQ A;  5AG4 A;  1B6B A;  1CP6 A;  5IB9 A;  3DR6 A;  2B7C A;  4CGN A;  4R3K A;  4P4J A;  4MHZ A;  4M4S A;  4XNH C;  4C7H A;  4PQA A;  4DNR B;  4W9Y A;  4ZYQ A;  4KS9 A;  4R7M A;  5F09 A;  1VLY A;  5A88 A;  5CPA A;  4MMO A;  2C5H A;  1P4N A;  4NGR A;  4FWT A;  4MCP A;  3MGD A;  5IV0 A;  1VQ8 B;  2KCW A;  2Q0Y A;  1WOR A;  2JIZ A;  4ORF A;  4M3S A;  1E1Q A;  4H9G A;  3OFN A;  3K9U A;  2AFS A;  3NE5 B;  1X10 A;  2Y0M A;  2PJB A;  4CAF A;  3ONU A;  4KLW A;  3VMF A;  4AVB A;  3OZW A;  4RM0 A;  3ASR A;  3TC8 A;  2REF A;  2HC9 A;  2Z11 A;  4OAE A;  1K9M D;  3S9M A;  5AG5 A;  1NRK A;  1VHO A;  4MFJ A;  1KD1 D;  2GJP A;  4QFM A;  4WQM A;  1Q7L A;  4BMH A;  3H8F A;  3OOC A;  5EC4 A;  5GV7 A;  4X07 A;  4F9U A;  3D2P A;  3PEI A;  5DS0 A;  3SJF A;  4XLH A;  1BLI A;  1YVK A;  3CPW B;  1FNC A;  2PMD A;  3P2F A;  1TLL A;  4B10 A;  5LRK A;  3CCJ B;  3PB4 X;  4MHP A;  5D8N A;  4B3G A;  2HLD A;  2C6P A;  4XNH B;  3JQR A;  2VNK A;  1M90 D;  1Z8T A;  4ACB A;  2DPT A;  1VF7 A;  1LFW A;  1R5O A;  4B5P A;  4M6H A;  1N07 A;  1GO2 A;  4XNF A;  2FL4 A;  2ZEH A;  4A39 A;  2AFO A;  1FNO A;  4U9Y A;  3F8K A;  1QSR A;  4PV6 A;  1HDQ A;  1YQE A;  3SJE A;  1S7K A;  3PB7 X;  1E63 A;  1NE9 A;  2JBK A;  1H8L A;  3JRU A;  3PUN A;  1M44 A;  1X12 A;  4LQG A;  5LMZ A;  5HMN A;  2BPO A;  2WPW A;  5IB0 A;  1OGJ A;  3I56 B;  4NCZ A;  5AG6 A;  1YLO A;  3SJX A;  3K9T A;  3RZA A;  1IJF A;  5IYN A;  3OZV A;  3A1P A;  3AGP A;  4UEF A;  4MHN A;  4K30 A;  3ZC3 A;  3MRU A;  3VH9 A;  1I8D A;  1G7T A;  3G3S A;  1S60 A;  1VKC A;  2KVO A;  4B12 A;  1DE4 C;  2RC6 A;  2Z0Z A;  3FIX A;  2ZW4 A;  4HNY B;  4XOP A;  3KGQ A;  2ZED A;  3JU4 A;  3PB6 X;  1EFT A;  1Z5R A;  2DF5 A;  1R57 A;  2GU2 A;  1VGY A;  5LYD A;  1M4D A;  4C7I A;  1TVC A;  1NSA A;  4H89 A;  2PJ5 A;  4MI4 A;  4HIZ A;  4TN1 A;  4P44 A;  2XEX A;  1TIQ A;  4HE6 A;  3F0A A;  2PDO A;  4QVA A;  2QYV A;  3CES A;  3PVD A;  3IWE A;  5TY0 A;  2CF4 A;  2VI7 A;  1E3Z A;  4Z4Z A;  4XKW A;  2ARH A;  2BF4 A;  1Q2C A;  1QQ9 A;  1G7R A;  1Z8X A;  4MHD A;  4IAV A;  5TRD A;  1VQO B;  4CGO A;  3SHP A;  2CTB A;  4FK8 A;  2ZBU A;  4YAU A;  2BM0 A;  2B5G B;  3ZUG A;  3SJP A;  1UD6 A;  2VBT A;  3LNN A;  4G1V A;  5A8A A;  4FUU A;  2PJ1 A;  2B5G A;  4UIA A;  2DXQ A;  2HV2 A;  4A32 A;  5I0C A;  2Q7S A;  4RD4 A;  4Z4Y A;  3G05 A;  3D2M A;  3PFO A;  2OK7 A;  4Q38 A;  3OEE A;  2FE7 A;  4IHM A;  5H84 A;  1KC8 D;  4OIW A;  1P0H A;  3CB4 A;  5AN9 A;  1WU8 A;  4TMX A;  2ZEP A;  4YEL A;  4Y9U A;  4AB7 A;  4LBW A;  1F57 A;  4B43 A;  3V7A A;  2WSS A;  2XNJ A;  3TOA A;  3WND A;  2EBJ A;  1HZE A;  2Q4Z A;  3GB0 A;  2ZEN A;  1NSL A;  1VJS A;  3ZZT A;  2C5B A;  1R43 A;  3BCD A;  1XE4 A;  2BVN A;  4Z4W A;  1BX0 A;  1NB9 A;  4ZGN B;  4MYU A;  1VQ7 B;  2VXK A;  4G5G A;  1UD3 A;  2R8V A;  2PJ3 A;  3QFS A;  4FD6 A;  1Q9S A;  2ZIT A;  1BMF A;  1GJR A;  3WC7 A;  1GHE A;  2W6J A;  4XON A;  4C43 A;  1MK4 A;  4P4E A;  1TF9 A;  4MXU A;  1YJ9 B;  4BPR A;  4XR6 A;  1CM0 A;  4NEX A;  4XLE A;  3B35 A;  3AVY A;  3P26 A;  3SKB A;  2X7B A;  2H5M A;  4CYN A;  3KKW A;  2WUU A;  3D7D A;  4A37 A;  3Q6Q A;  2XZO A;  3JUW A;  3V76 A;  2OBT A;  4MFK A;  1RQP A;  4PK3 A;  4DNT B;  3PB9 X;  2V4D A;  2DER A;  1CBX A;  2WJV A;  2PIY A;  5BSX A;  1M4I A;  2VJJ A;  3BLN A;  2YND A;  1BLL E;  1FRQ A;  1AMO A;  3AVT A;  3FEE A;  4AXV A;  3OPO A;  4XKV A;  1N8R D;  1FDR A;  1V5V A;  2QJ8 A;  2Z3K A;  3W5V A;  1RXT A;  4XPL A;  4C2Z A;  3FH4 A;  2GPJ A;  3B8H A;  2PJ8 A;  4B6Z A;  4ZV4 A;  1MJA A;  1ZO0 A;  1OB5 A;  3LQE A;  4RCY A;  2BGJ A;  1IIC A;  1HDU A;  4UA3 A;  2RC4 A;  1W34 A;  3B3C A;  4CGP A;  5HXD A;  1CJW A;  4K1X A;  2GAN A;  4Z4T A;  4FWU A;  4NCN A;  3P27 A;  1H85 A;  3FRM A;  4A94 A;  2ZEF A;  4E2A A;  1QGA A;  4CPA A;  5FA6 A;  1S7N A;  4JMQ A;  2ABZ A;  2EVN A;  3LOD A;  4RD1 A;  2GE3 A;  3R9F A;  4Y49 C;  2ZW6 A;  3H8G A;  2JJ1 A;  4CYQ A;  4PXC A;  2VEZ A;  1UD2 A;  2EFG A;  3FNC A;  3R95 A;  3NA6 A;  4XM3 A;  1Y9W A;  4F9V A;  5FL7 A;  4PPZ A;  5GCN A;  3RAM A;  4E0A A;  4X06 A;  2NV4 A;  3QE2 A;  4P26 A;  2JDD A;  4GXH A;  2C77 A;  4B14 A;  3KZW A;  5KNL A;  3ONY A;  5IYQ A;  3OAA A;  4TMT A;  3PB8 X;  2Z10 A;  3AST A;  1S7F A;  4EFD A;  1W35 A;  4NF1 A;  3B8G A;  4YGO A;  1WPC A;  4OC1 A;  5E96 A;  4AVA A;  2PE3 A;  5ELY A;  2BM1 A;  4ZGQ B;  4U5Y A;  3T9Y A;  3PBB A;  2G9D A;  1U2R A;  1B87 A;  4MFP A;  4Y49 B;  4P3Y A;  4PXB A;  4QHY A;  2F1M A;  5H5J A;  2Q51 A;  3FJO A;  2VNJ A;  5D29 A;  1BX1 A;  3R9E A;  3TO6 A;  2JJ2 A;  2DEA A;  3KR4 A;  5DWN A;  4ZCL A;  4Z4V A;  2B4D B;  5L46 A;  3LD2 A;  5EBV A;  2VZL A;  5B6I A;  4P4D A;  4P1V A;  5AGE A;  2EK9 A;  4P4B A;  2B4D A;  3W2F A;  3G6E B;  1KJZ A;  4UFW A;  4MFL A;  2CND A;  4KOS A;  2OU2 A;  4XL9 A;  4MY0 A;  3ZZ0 A;  4ACA A;  3NH4 A;  1L0C A;  3SLN A;  5K8M A;  2JLM A;  2NYQ A;  2Q4V A;  2F5I A;  2GK7 A;  5F4O A;  5A89 A;  3DNS A;  4PK2 A;  3U6K A;  4KOU A;  3OP1 A;  4QBJ A;  2V8D A;  3PA1 A;  3E1Y E;  2X8K A;  3GVK A;  4OOV A;  3VNV A;  3WT4 A;  4RJL A;  3SJG A;  1W9X A;  1IB0 A;  4DQL A;  3D7F A;  4YRH A;  4YXW A;  3V38 A;  2BSW A;  1ARM A;  4CQJ A;  1AUG A;  4YAF A;  2C1C A;  4JLY A;  2Q44 A;  5F4J A;  3SLD A;  1TKH A;  1WP6 A;  2QTL A;  1CX8 A;  1YJW B;  5KW9 A;  2QIR A;  4ZY2 A;  4ZX8 A;  3H94 A;  2CBX A;  3CC4 B;  4ONU A;  2QE7 A;  2C4T A;  1YX0 A;  4PAA A;  5J3O A;  2AFX A;  4EWT A;  4TSF A;  1SM4 A;  2OR4 A;  2BUE A;  4TWE A;  1DG1 G;  4AVC A;  1GAQ A;  4RLZ A;  1QGZ A;  2I1L A;  1ZG8 A;  3TCV A;  4F0X A;  2XND A;  4TKO B;  2DY1 A;  3CCR B;  2IL4 A;  3IFE A;  4F6A A;  3OJW A;  2BMW A;  1GAW A;  1S5K A;  3H8E A;  3S6K A;  4JD6 A;  3QAH A;  3UY5 A;  1YW6 A;  3V7Z A;  3KAS A;  4XN0 A;  4Q7A A;  3CCU B;  4U9Z A;  2G3T A;  4XPD B;  1KZF A;  3J81 k;  3FEC A;  3BXM A;  1HVX A;  2X6X A;  4PXD A;  2DYI A;  4N3N A;  2V8H A;  2VBQ A;  3MN8 A;  3BC9 A;  5GV8 A;  1IYL A;  1H8E A;  3AVX A;  2CTC A;  5IK2 A;  2VNH A;  2ZZG A;  3TOB A;  1S72 B;  4WWV A;  4HNW B;  4PC7 A;  1T6X A;  4ROX A;  4J3G A;  2C6C A;  2E1B A;  5G21 A;  2CXA A;  1J4J A;  3KI9 A;  3GVL A;  3V8I A;  4NSQ A;  4CAW A;  2CW5 A;  4ZCI A;  3N7Z A;  2VBS A;  1OGI A;  2GJK A;  4XLF A;  3JVN A;  1IGB A;  3N5F A;  2O53 A;  2IJZ A;  2VL1 A;  2X6W A;  4LBY A;  5HVH A;  1VHS A;  2EK8 A;  1ZUN B;  5FO0 A;  4PSX A;  3IU2 A;  4YFJ A;  4UF4 A;  2FS5 A;  3D4U A;  4OPO A;  4PAB A;  1Z9U A;  1YW4 A;  3TTH A;  4R71 A;  1ZM3 A;  2PVW A;  2J8N A;  4IK2 A;  2Q7B A;  2J8R A;  1D2E A;  1QH0 A;  1QUF A;  4E0F A;  2V77 A;  1TXR A;  1EXM A;  3IO1 A;  2RB7 A;  2GK6 A;  3NE7 A;  1Y7E A;  2OB0 A;  1XRY A;  3A8I A;  3CXC B;  4OPS A;  1BO4 A;  1PU9 A;  4AG7 A;  2ZPA A;  3T51 B;  5E6T A;  2AHO A;  1TKJ A;  5TR9 A;  4AF7 A;  2ZTN A;  1IOI A;  3BJ7 A;  3VWE A;  2OTJ B;  2F1L A;  5JH9 A;  5CDF A;  3S6F A;  4IW3 B;  1JWQ A;  2ZL7 A;  4M85 A;  1YIJ B;  2DPS A;  4NNJ A;  1QSM A;  1LOK A;  4UCN A;  2B7B A;  1VLO A;  1BPM A;  2YNE A;  1Y0Y A;  3GIU A;  1UWY A;  2QDX A;  4LQ6 A;  4NGP A;  1XB2 A;  2NSM A;  5THW A;  2ZZF A;  1N0V C;  4MBU A;  5K8P A;  5FO1 A;  2WJY A;  2D3L A;  4YEJ A;  2PSW A;  4ZY1 A;  3G8W A;  3CCV B;  2DEU A;  4MRI A;  2FXF A;  3S9L A;  1FND A;  3OW7 A;  2J7K A;  1QFZ A;  2GLF A;  3R1K A;  2JDI A;  2R6H A;  4RDK A;  4O23 A;  1KZL A;  2PQ8 A;  3WAB A;  3QFR A;  2Z3O A;  3FMC A;  4JYW A;  4UCP A;  3FVL A;  4XN3 A;  3PFE A;  3DR8 A;  1P4M A;  1YHQ B;  4TMZ A;  1K8A D;  1Z8W A;  3VO1 A;  4YAO A;  3WNB A;  2WSA A;  3A35 A;  2V7X A;  2XOK A;  3CCL B;  1QST A;  2EWB A;  1Z2L A;  2Q04 A;  4JXR A;  4RD6 A;  4A33 A;  5KTD A;  4A95 A;  1OBR A;  5KTC A;  3W5H A;  4B4D A;  4OAD A;  3GSI A;  2PVV A;  4RD2 A;  3BNW A;  4Y7C A;  4KVM E;  2M5S A;  3ES9 A;  5LRG A;  5FIU A;  4KVX A;  3A8J A;  4IF5 A;  3CP2 A;  2OBS A;  2VJI A;  2OYN A;  5HXB A;  4P25 A;  2AFM A;  1E64 A;  3ZZU A;  4OOX A;  1PUA A;  5HVG A;  2XEG A;  2VYQ A;  2FCK A;  4BBH A;  1VQL B;  5BSY A;  3W2I A;  3CCQ B;  2X85 A;  3CCE B;  1D1N A;  1IY7 A;  1WOO A;  4L89 A;  4MYT A;  4H2K A;  2V7W A;  3LO8 A;  4CGM A;  3R6J A;  1Q7Y D;  4YAW A;  4XOR A;  1HEE A;  4M6G A;  3HLP A;  1B2R A;  2YWF A;  4C2Y A;  2YGW A;  4CYP A;  4P3I A;  1Z4E A;  3CW2 A;  2PJ4 A;  2ZXV A;  4PGO A;  2A4N A;  1F60 A;  3OZU A;  4LBV A;  5J8F A;  1Q86 D;  1KWM A;  3W5U A;  1YLE A;  4J0Q A;  4XD7 A;  1WK4 A;  3D26 A;  3FKS A;  2PJ7 A;  3QNV A;  2OZH A;  3U6B A;  4F0Y A;  3ZPN A;  2ZZE A;  5J1Q A;  4OC0 A;  1Z4R A;  3NH5 A;  2R9V A;  3CXQ A;  1W87 A;  3SI2 A;  4RUH A;  2QN6 A;  3BQJ A;  2ANP A;  3WY9 A;  3TX8 A;  3PZJ A;  2ZXI A;  4X0C A;  2CRV A;  3I3G A;  1SKY B;  3ASQ A;  3B82 A;  1UD8 A;  1JJ2 B;  1I12 A;  4RD0 A;  4PC2 A;  1YIT B;  4C68 A;  2QEC A;  4II9 A;  1LAM A;  1IB1 E;  4U9U A;  2VQY A;  3CPA A;  7CPA A;  4P4I A;  2GIV A;  1OB2 A;  2YWE A;  2QVP A;  2ZW5 A;  4A38 A;  1YVO A;  5EMN A;  3F5B A;  3VNU A;  3VAR A;  4XLC A;  1K73 D;  2REE A;  4G6I A;  1PKV A;  1LRZ A;  4CAE A;  1V0C A;  4MHY A;  4MCS A;  3VAT A;  3RO0 A;  1GYT A;  3A3B A;  2XNC A;  1PYT B;  1VQM B;  5CBM A;  5HH1 A;  3TO9 A;  4CAV A;  1VQP B;  4X7C A;  4KOT A;  4KUA A;  1VQK B;  2P3M A;  5KTA A;  4OPV A;  1EE3 P;  4R76 A;  4M6I A;  2FIW A;  5JM6 A;  1N08 A;  4F7D A;  1CQX A;  1WOS A;  4QVT A;  5J35 A;  1NMT A;  1XE1 A;  3ISX A;  3D66 A;  1VQN B;  4EVY A;  4OOS A;  3E20 A;  4QVJ A;  3CMM A;  4CS0 B;  1YI2 B;  3IC1 A;  5JBQ A;  1ARL A;  5A28 A;  4OME A;  1Q81 D;  1W0K A;  1M4G A;  1RO5 A;  2DET A;  2CK3 A;  5K8N A;  2DIE A;  2I00 A;  4L8J A;  4CRY B;  4QV2 A;  1EFU A;  4KOR A;  4B48 A;  2OH1 A;  2Z3M A;  2AFW A;  4HKF A;  2QTZ A;  1MRZ A;  3IGR A;  2XEF A;  4KSA A;  4KVO E;  2PJC A;  4PSW A;  4MCQ A;  1A8P A;  3CC2 B;  2BEI A;  3FBU A;  1ZLI A;  3SEJ A;  5G1Z A;  1DDG A;  5DSZ A;  1FT7 A;  4YWY A;  4ASU A;  4PXE A;  4UEZ A;  1QMU A;  4UWI A;  3NFZ A;  2F43 A;  1QG0 A;  2VZZ A;  2YNC C;  3BI0 A;  2AFZ A;  3DLJ A;  1MJ9 A;  2BOA A;  4P22 A;  1WDT A;  3A8K A;  1VQ6 B;  4KUB A;  3U2Q A;  4GM5 A;  4FD5 A;  4HPS A;  3AVV A;  5DWM A;  3E0K A;  1ELM P;  1JA0 A;  4OKO A;  3FXT A;  2V7T A;  4WZT A;  2JN9 A;  4QC6 A;  5LYF A;  2QEX B;  3CT9 A;  4BD9 A;  3OJX A;  3NE8 A;  5J8C A;  4ONW A;  1ON0 A;  4PC3 A;  4B11 A;  4KKS A;  1FX0 A;  1IU8 A;  3FPP A;  3ISZ A;  4Z4S A;  2ATR A;  4OC4 A;  4TMW A;  1KK0 A;  4ZBG A;  4X5K A;  3W2H A;  1T6Z A;  1Y9K A;  2P6F A;  4Q36 A;  2C4U A;  1LCP A;  1FRN A;  4C0S A;  3CCS B;  4UFV A;  3LWU A;  3RBU A;  2HQY A;  1YME A;  2PR1 A;  2FVG A;  2BN4 A;  2PJ2 A;  1TKF A;  2PCU A;  1ELO A;  1JQG A;  1KUX A;  3CXP A;  4XPD C;  2B58 A;  4A30 A;  1SKQ A;  2PR8 A;  4QUS A;  2ZL5 A;  3TE4 A;  3WBK A;  1HA3 A;  3CMA B;  4X2T A;  1WOP A;  3NH8 A;  1YR0 A;  4YAL A;  1E62 A;  4R87 A;  2PIA A;  1TF8 A;  3CTA A;  1BJK A;  3PBE A;  1QFY A;  1BOB A;  1R5B A;  4R6T A;  4CRZ B;  3H5Z A;  4PC6 A;  4OC5 A;  4L8A A;  2YNC A;  3S6G A;  1XQB A;  5THX A;  4JZ0 A;  4P12 A;  4WZL A;  3KQX A;  2X53 S;  2WPX A;  3D7H A;  4B44 A;  2WZN A;  2R1I A;  3DSB A;  2P6E A;  2Z3P A;  4P2N A;  2HMA A;  3I1F A;  1JA1 A;  3DDD A;  3ASS A;  4RDL A;  1DDI A;  2GQF A;  4DQK A;  4M1K A;  3W2E A;  4NGM A;  5G22 A;  1K28 D;  5JQ4 A;  2K5T A;  3CCM B;  4QUZ A;  1KUY A;  3DGV A;  3VO2 A;  2ZEM A;  1BQE A;  1I21 A;  2O4H A;  1I1D A;  2QGG A;  3JQP A;  2PC1 A;  5F48 A;  2PJ0 A;  1VQ9 B;  2B3V A;  3CXS A;  1I7P A;  3KQZ A;  5I4M A;  3ZBU A;  4G1P A;  1A2Z A;  4LUA A;  2X6Y A;  3LMS A;  1XEB A;  1BPN A;  4UCM A;  3IIB A;  4RPB A;  2Q6I A;  3T90 A;  3BJ8 A;  3GYA A;  2HDN B;  5IYW A;  3D7G A;  4UIB A;  4Z4U A;  4KKT A;  1IHM A;  3MCA A;  4E8O A;  2P6G A;  2GLJ A;  3SI0 A;  1I18 A;  3RY8 A;  2GJR A;  4P10 A;  3WC5 A;  3WC6 A;  2Q4Y A;  4UZF A;  2FIA A;  4X7D A;  2V7Q A;  4RDJ A;  4LX9 A;  3I1U A;  4H6U A;  1KK1 A;  4AVZ A;  1XJO A;  5F49 A;  1N05 A;  3ZBT A;  4X05 A;  3GUX A;  2EIX A;  1LAN A;  1WWZ A;  1KMH A;  3OE7 A;  1Q2Y A;  5JGF A;  4MFQ A;  4EH1 A;  1UMK A;  4X3R A;  5AG7 A;  2NMT A;  2AJ6 A;  1W2B B;  4MJ8 A;  4OP4 A;  1OB0 A;  4II3 A;  2JEW A;  5ISV A;  4B5P B;  4AG9 A;  4B13 A;  4M53 A;  1LAP A;  8CPA A;  5JPH A;  4M0L A;  1WSR A;  3I55 B;  1K4J A;  2ODF A;  3S9N A;  2V8V A;  1AIP A;  3TO7 A;  1UD5 A;  3EFA A;  3B3S A;  2Q43 A;  3MMP A;  3W6X A;  4Z4R A;  4WZK A;  1PCA A;  3G71 B;  4FBE A;  4DUK A;  4X7E A;  4KSI A;  3T8W A;  3ASP A;  2JDC A;  3D3S A;  2FT0 A;  4P9S A;  3EO4 A;  3FF3 A;  4R57 A;  2Z3N A;  2ZL6 A;  3K2K A;  4TNU A;  3WNC A;  3CC7 B;  2PLF A;  5H59 A;  1CPS A;  2BGI A;  4XLA A;  1IJE A;  2B3U A;  3R96 A;  3WBJ A;  1NDH A;  1MAB A;  4MY3 A;  1ELL P;  3QSY A;  1Z8L A;  1FNM A;  4BIN A;  2PJ6 A;  3GIR A;  1Y7R A;  2ZEG A;  3Q3A A;  3WYA A;  4HNX B;  4QB9 A;  1G7S A;  4B3X A;  1S0U A; 
#chains in the Genus database with same CATH homology
 4P4J A;  4MHZ A;  5J1Q A;  2C6G A;  4OC2 A;  2PE3 A;  4OC0 A;  5ELY A;  3NH5 A;  4PQA A;  4W9Y A;  4NJR A;  3PBB A;  4ZYQ A;  4R7M A;  5F09 A;  1CPX A;  1XFO A;  5CPA A;  3SI2 A;  3BI1 A;  2G9D A;  4RUH A;  4DJL A;  4MMO A;  2ANP A;  3TX8 A;  4NGR A;  4MCP A;  4PXB A;  3FJU A;  4ZI6 A;  2Q51 A;  2PIZ A;  5D29 A;  3D67 A;  2DEA A;  3KR4 A;  2AFS A;  2PJB A;  1LAM A;  4P4D A;  3TC8 A;  3CPA A;  2EK9 A;  4P4B A;  2HC9 A;  7CPA A;  4P4I A;  2QVP A;  4A38 A;  4ZX9 A;  3VAR A;  3S9M A;  2IMO A;  3IWW A;  1VHO A;  4UEE A;  3NH4 A;  1Q7L A;  3IEH A;  1F2P A;  2POK A;  4WJB A;  3H8F A;  2J9A A;  4MHY A;  5K8M A;  4F9U A;  4P6Y A;  4MCS A;  2NYQ A;  3CPX A;  3PEI A;  5DS0 A;  3SJF A;  3VAT A;  4EME A;  1GYT A;  2HB6 A;  1PYT B;  2I3C A;  5LRK A;  3PB4 X;  5HVF A;  4MHP A;  5CBM A;  5D8N A;  2V8D A;  2C6P A;  4P45 A;  1ZLH A;  1LFW A;  2V8G A;  5LYI A;  4P4F A;  3WT4 A;  3SJG A;  1EE3 P;  4R76 A;  3D7F A;  5JM6 A;  2ZEH A;  4A39 A;  2ZEO A;  2AFO A;  3V38 A;  1FNO A;  1ARM A;  2C1C A;  1HDQ A;  3SJE A;  3ISX A;  3D66 A;  3PB7 X;  1TKH A;  2JBK A;  1CG2 A;  1H8L A;  3JRU A;  1CX8 A;  3GLJ A;  4LQG A;  3KHZ A;  3B3T A;  3IC1 A;  4ZY2 A;  1Y0R A;  2XEI A;  1ARL A;  4ZX8 A;  4OME A;  1YLO A;  4OID A;  3SJX A;  3K9T A;  3RZA A;  1ZG7 A;  5K8N A;  2AFX A;  4EWT A;  4UEF A;  2OR4 A;  4TWE A;  4MHN A;  3MRU A;  3VH9 A;  2AFW A;  1ZG8 A;  2GRE A;  1DE4 C;  2XEF A;  4NGQ A;  2PJC A;  3IFE A;  2BO9 A;  2JBJ A;  3KL9 A;  3KGQ A;  2ZED A;  2CIJ A;  4MCQ A;  3H8E A;  4R8F A;  1YW6 A;  3V7Z A;  1ZLI A;  3PB6 X;  1Z5R A;  3KAS A;  2GU2 A;  5K8O A;  1FT7 A;  4Q7A A;  2BCO A;  4YWY A;  1ZG9 A;  1VGY A;  4PXE A;  5LYD A;  4UEZ A;  1QMU A;  3B7I A;  3FEC A;  3BXM A;  3NFZ A;  3BI0 A;  2AFZ A;  3DLJ A;  2BOA A;  3CDX A;  4PXD A;  2F7V A;  1NSA A;  2PJ5 A;  2XEJ A;  4GM5 A;  2V8H A;  4P44 A;  4F8Z A;  3MN8 A;  1ELM P;  1BAV A;  2QYV A;  4OKO A;  1XMB A;  2CF4 A;  5LYF A;  2CTC A;  3CT9 A;  4BD9 A;  4WWV A;  1QQ9 A;  4ONW A;  4IAV A;  3D68 A;  3ISZ A;  2C6C A;  2PJA A;  4NGN A;  2CTB A;  4OC4 A;  4NGT A;  2ZEE A;  3KI9 A;  4OC3 A;  1LCP A;  3LWU A;  3RBU A;  1YME A;  2FVG A;  2PJ2 A;  1TKF A;  2PCU A;  4FUU A;  1IGB A;  3N5F A;  2PJ1 A;  2O53 A;  4UIA A;  2IJZ A;  2VL1 A;  5HVH A;  1JQG A;  2EK8 A;  4UF4 A;  3D4U A;  4X2T A;  3NH8 A;  1YW4 A;  1TF8 A;  3PFO A;  2PVW A;  3PBE A;  4IK2 A;  4IHM A;  4R6T A;  2ZOG A;  2V77 A;  1TXR A;  4OIW A;  3IO1 A;  4OC5 A;  2ZEP A;  1F57 A;  1AYE A;  3KHX A;  2RB7 A;  4JZ0 A;  1YSJ A;  3KQX A;  1Y7E A;  2IQ6 A;  3D7H A;  2ZEL A;  2WZN A;  3FX6 A;  1XRY A;  2Q4Z A;  3GB0 A;  2RFH A;  2ZEN A;  2F8H A;  2OOT A;  3KR5 A;  4YU9 A;  1TKJ A;  3B2Y A;  3B3W A;  1R43 A;  4ZY0 A;  4NGS A;  1XBU A;  3BHX A;  5JH9 A;  4DYO A;  4NGM A;  1R3N A;  3DGV A;  3FED A;  1LOK A;  2ZEM A;  2O4H A;  3L2N A;  1BPM A;  2PJ3 A;  1Y0Y A;  4Z65 A;  1DTD A;  1UWY A;  2PJ0 A;  3WC7 A;  4NGP A;  2NSM A;  4P4E A;  5THW A;  1TF9 A;  4MXU A;  1VIX A;  3KQZ A;  5I4M A;  1RTQ A;  3B35 A;  1M4L A;  5K8P A;  4G1P A;  4ZY1 A;  3LMS A;  1BPN A;  4MRI A;  3D7D A;  4A37 A;  2PJ9 A;  3S9L A;  3IIB A;  2GLF A;  1VHE A;  4O23 A;  3WAB A;  3PB9 X;  3FMC A;  1CBX A;  3D7G A;  4JYW A;  4UIB A;  2PIY A;  3FVL A;  3PFE A;  1BLL E;  3FEE A;  4AXV A;  2GLJ A;  2QJ8 A;  3SI0 A;  1F2O A;  3FH4 A;  4P10 A;  2PJ8 A;  3WC5 A;  3WC6 A;  4B6Z A;  2EWB A;  1Z2L A;  3I1U A;  1HDU A;  1XJO A;  1CP7 A;  1OBR A;  3B3C A;  5HXD A;  3HUV A;  3GUX A;  1LAN A;  6CPA A;  4FWU A;  2PVV A;  4FAI A;  3B3V A;  5LRG A;  4A94 A;  5JGF A;  2ZEF A;  4X3R A;  4OP4 A;  4CPA A;  2JEW A;  4K3N A;  2ABZ A;  4X8I A;  5LRJ A;  1LAP A;  2AFM A;  8CPA A;  4NFR A;  3S9N A;  3H8G A;  2V8V A;  5HVG A;  2XEG A;  2ZOF A;  3B3S A;  2Q43 A;  4PXC A;  1PCA A;  4FBE A;  3SI1 A;  4DUK A;  4KSI A;  3T8W A;  3PRT A;  1IY7 A;  3NA6 A;  4H2K A;  4F9V A;  4PPZ A;  2PRQ A;  1HEE A;  3RAM A;  2AFU A;  3FF3 A;  3K2K A;  4TNU A;  5LYL A;  3HLP A;  1CPS A;  3KZW A;  2PJ4 A;  3IJ3 A;  3PB8 X;  1ELL P;  1Z8L A;  4NJQ A;  2PJ6 A;  2WYR A;  1KWM A;  2ZEG A;  4EFD A;  4MCR A;  1AMP A;  2PJ7 A;  3QNV A;  1CP6 A;  5IB9 A;  4OC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...