2WZNA

3d structure of tet3 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
SMVDWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPPHLRIDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINKEGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural and Biochemical Characterizations of a Novel Tet Peptidase Complex from Pyrococcus Horikoshii Reveal an Integrated Peptide Degradation System in Hyperthermophilic Archaea.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords 354AA LONG HYPOTHETICAL OPERON PROTEIN FRV
total genus 107
structure length 338
sequence length 347
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2wznA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2wznA01
1BLLE 3KGQA 2GU2A 2V8HA 4ZI6A 1DE4C 4PQAA 3B3WA 4FUUA 2CTCA 4P45A 2C6GA 3IFEA 4UIAA 5IB9A 3RAMA 1BPNA 3V38A 3KI9A 4NGMA 1F2OA 4ZX8A 2F8HA 4OC0A 3NH4A 2I3CA 2CTBA 3H8GA 4PXDA 1TKHA 1CP7A 3VH9A 2NYQA 4P4JA 3FJUA 3RZAA 3PEIA 4ZY0A 3S9LA 2FVGA 5HVFA 2ZEEA 2CF4A 2PJ0A 4B6ZA 3SI0A 4IHMA 4UEEA 4JZ0A 4MHPA 5ELYA 3KQXA 4ZY2A 3MRUA 2XEGA 4F9VA 4P44A 4FBEA 2PVWA 4O23A 3PRTA 3L2NA 4MCRA 3DLJA 3TC8A 1EE3P 1YLOA 3IO1A 4PXCA 4R6TA 3WC6A 2ZENA 5LYFA 2EK8A 1TXRA 2HB6A 3B35A 3WABA 3FEDA 2Q43A 3PBBA 1LFWA 3IWWA 4P10A 3SJXA 4X8IA 3K9TA 3BHXA 4P4EA 3B7IA 2GLFA 2ZOFA 5D29A 1CP6A 4R7MA 4P4FA 3D7HA 3ISXA 3TX8A 2PCUA 2QJ8A 4GM5A 4PXBA 3PB8X 3SI1A 1LAMA 1AMPA 5HVGA 1ZLHA 1YSJA 3ISZA 1TF9A 1HEEA 3SJFA 3WT4A 2HC9A 3JRUA 1F57A 2IMOA 4KSIA 4EFDA 1JQGA 2ZEDA 1ELMP 2PJ6A 2V77A 3B3SA 4LQGA 3N5FA 4A38A 3RBUA 3KHZA 1ELLP 2F7VA 3PFOA 1VHEA 2XEJA 3LMSA 4NFRA 4ZY1A 2BOAA 3BXMA 4A37A 4UEFA 2C1CA 2WZNA 4FWUA 3KASA 1R43A 3LWUA 4NJRA 5DS0A 4X2TA 4RUHA 4X3RA 3D4UA 4OC4A 5JM6A 3KHXA 5CPAA 5D8NA 2PJ3A 4IK2A 1R3NA 1ZG9A 2AFXA 4WJBA 5LRGA 4Z65A 1LANA 6CPAA 3CT9A 2VL1A 2ZEHA 4DJLA 5K8MA 2QYVA 1OBRA 5LRKA 3IC1A 2ZEFA 4NGQA 3KL9A 2RFHA 1BAVA 1IY7A 8CPAA 3SJEA 3QNVA 1M4LA 2C6CA 2QVPA 3BI1A 4DYOA 2GLJA 1HDQA 2PJ9A 5K8OA 4MHNA 1AYEA 2ANPA 3D66A 1TF8A 1CPSA 4MXUA 1BPMA 1CPXA 2BO9A 3S9NA 1TKFA 1FNOA 3H8EA 4NGRA 4CPAA 4NGNA 4F8ZA 4MRIA 1PYTB 2PJ4A 3B3TA 2AFUA 2PJCA 3IEHA 5F09A 3FX6A 1ZG8A 2AFOA 4OKOA 4OMEA 3V7ZA 4Q7AA 4ZYQA 2EK9A 1IGBA 2V8DA 5JGFA 4P4IA 3B3CA 2V8GA 1Y7EA 4IAVA 5LYLA 1YW6A 3KZWA 5THWA 3I1UA 2AFWA 2PIZA 2DEAA 4PXEA 2NSMA 3D67A 2EWBA 2AFMA 1YMEA 2PVVA 3IIBA 2PJ8A 4W9YA 4ONWA 4UIBA 1ZLIA 4F9UA 3D7FA 2OOTA 3S9MA 3CDXA 3CPXA 2JBJA 1KWMA 3VATA 1H8LA 4OC5A 1F2PA 4OIWA 3FEEA 1QQ9A 4G1PA 4UF4A 4FAIA 3KR5A 3PB4X 1CG2A 2OR4A 3K2KA 3T8WA 2Q4ZA 5J1QA 2IJZA 3CPAA 3GLJA 4MMOA 2PJ7A 2IQ6A 4TNUA 3VARA 1TKJA 4MHZA 4EMEA 2ZEOA 4WWVA 3BI0A 2JEWA 2PJ1A 3D7GA 3IJ3A 4EWTA 1HDUA 1VGYA 3DGVA 4OP4A 2AFSA 1Z2LA 2PE3A 2ZEMA 5K8NA 2BCOA 3PB7X 2C6PA 2XEFA 1LOKA 3KR4A 4MCSA 4MCPA 4OC3A 5LYDA 4UEZA 3FVLA 4OIDA 1RTQA 1Y0YA 1YW4A 3SJGA 1FT7A 2PJ2A 2JBKA 2WYRA 4PPZA 4OC1A 4A39A 4ZX9A 3PB6X 2RB7A 1LAPA 1XBUA 1XMBA 3B2YA 3MN8A 4NGSA 2J9AA 4YU9A 1Z5RA 5LRJA 5I4MA 4P4BA 2AFZA 1ARLA 3NH8A 3HLPA 1PCAA 5HVHA 4MCQA 1Y0RA 2ABZA 3FH4A 1XRYA 3NH5A 3D7DA 3H8FA 4A94A 1Q7LA 1DTDA 5LYIA 7CPAA 1GYTA 2Q51A 4DUKA 4AXVA 2XEIA 4NGPA 3SI2A 3WC7A 2PIYA 4R76A 3B3VA 2O4HA 4H2KA 5CBMA 4JYWA 4P6YA 1VHOA 1CBXA 3PB9X 2ZELA 4R8FA 4TWEA 4YWYA 2PJ5A 3FMCA 1XFOA 2ZEPA 4NJQA 2O53A 5HXDA 1ARMA 2CIJA 5K8PA 2GREA 3D68A 1NSAA 4BD9A 2PRQA 1ZG7A 1QMUA 1UWYA 1Z8LA 4MHYA 3FF3A 2PJBA 3HUVA 5JH9A 3NA6A 3WC5A 4NGTA 3KQZA 4K3NA 2POKA 4OC2A 1CX8A 3PFEA 1VIXA 3GB0A 3PBEA 3GUXA 3NFZA 2ZOGA 3FECA 2V8VA 1XJOA 2ZEGA 2PJAA 2G9DA 1LCPA 4P4DA
chains in the Genus database with same CATH superfamily
3I1FA 3D2MA 3KGQA 1XE4A 1M1KD 5IB9A 4H6UA 3RAMA 3AVUA 3WBKA 1B23P 3BJ7A 1VQ4B 3PZJA 4HNXB 4FD7A 2BVNA 3MMPA 2BGIA 3A8JA 4ZX8A 1N05A 4FD6A 3CCRB 4N3NA 4RDJA 5IV0A 2D3LA 4CGNA 4P3YA 3EY5A 1TKHA 2K5TA 1XQBA 3BY1A 4UCMA 4B48A 5J35A 1EXMA 3CXPA 3CD6B 1HA3A 3I55B 1YVOA 1Z4EA 1YQEA 2BL1A 1V5VA 2B4DA 3TO7A 4R57A 2FVGA 4AG9A 1ELOA 3R1KA 4Y49C 2VJJA 2OU2A 2BGJA 1EWYA 4UEEA 4KOTA 3QFCA 1JA0A 2V7TA 1NDHA 5ELYA 1QUEA 1I7PA 2ZBUA 2JJ1A 3MRUA 1H8EA 4NCNA 4NNJA 3SXOA 4B14A 4P22A 3PRTA 3OZWA 4X0CA 4M53A 4QB9A 3EFAA 4PAAA 4B44A 3TC8A 3AVXA 4R6TA 3WC6A 1QVFB 1G7TA 4Q7JB 1OGJA 2E1RA 2Q43A 1H42A 2W6IA 1LFWA 1GAQA 4QVTA 2WR8A 2GK6A 4X8IA 2QECA 1Q7YD 4KSAA 4QVJA 2JIZA 4P4EA 1I12A 1Q86D 4R7MA 4FD4A 4U9UA 2VBSA 2RC5A 3CMEB 4R71A 1IOFA 2QJ8A 1KC8D 1EFRA 1KMHA 3SI1A 1YSJA 1RQRA 2HC9A 2ZTNA 3IWGA 2EBJA 2Q0YA 4XLAA 2X0KA 2Q6IA 1YR0A 2P6GA 1ELMP 3LQ6A 3B3SA 1IHMA 2BN4A 5HXBA 2DOGA 1VQ8B 1ELLP 3ZZUA 1VHEA 4XQFA 5F4OA 3W6XA 4ZY1A 2YNCC 3DDYA 2C1CA 3PUMA 3LWUA 4RUHA 3D4UA 1K4JA 5JM6A 4II9A 4MY0A 5D8NA 4XL9A 3BCFA 4B5PA 1R3NA 1YITB 1KZLA 4R9MA 2AFXA 5H84A 2BV3A 4WJBA 3SLDA 5LRGA 4MYUA 1LANA 4JJXA 5ISVA 3W5UA 3CT9A 5KSWB 2JDDA 2ZEHA 4RD0A 3SKBA 2ARHA 2OTJB 4M3SA 1YX2A 3B8HA 1XIXA 1IY7A 1IYLA 8CPAA 2NPFA 1N0UA 2C6CA 2QTZA 3SXNA 4AC9A 4OOSA 4YELA 4XKVA 4Q36A 1VLOA 4CYNA 5THXA 1AYEA 2ANPA 2X6WA 1CPSA 4MXUA 1BPMA 1CPXA 1KUYA 2BO9A 2Q7SA 1TKFA 2XNDA 2EVNA 1VQNB 2VJIA 4QUZA 4XKWA 2WJYA 2CK3A 3CCQB 4AF6A 3B3TA 2PJCA 4B5PB 2OTLB 5F09A 1ZG8A 4X5KA 1S3ZA 3CC7B 4OMEA 3QFRA 4Q7AA 2FS5A 2I1LA 1YIJB 1P4MA 5JGFA 4IAVA 1BLIA 5LYLA 4RD2A 2XZLA 3KZWA 2R8VA 5AG4A 4H89A 2AJ6A 3I1UA 5DWNA 2AFWA 5J8CA 4FN5A 1N71A 2NSMA 3D67A 1E63A 3A35A 2A4NA 1YMEA 1FX0A 1PU9A 2YWFA 2QTLA 1LRZA 1W34A 5EBVA 2REFA 4AVZA 2BPOA 3CC2B 3TOBA 1GHEA 5FA6A 3SLNA 3S9MA 2HUZA 3G4SB 1N0VC 4PK3A 3C26A 1VHSA 3R9GA 4OIWA 4MY3A 4ACAA 4KLVA 2ZZQA 2BEIA 4G1PA 5BWAB 4CAEA 3JQQA 1D1NA 2Q4ZA 5AGEA 5J1QA 3CPAA 3GLJA 2OZUA 3ES9A 4IW3B 2C78A 2AE6A 2PJ7A 5EC4A 4TNUA 3CTAA 4GQNA 4UBRA 3JUWA 1FDRA 5DWMA 4U9YA 1OHHA 3IU2A 1PUAA 4OLLA 2V31A 1RO5A 3V76A 4F0YA 4B3XA 5EMNA 3D7GA 4XPDC 2OBSA 4EWTA 1HDUA 1AMOA 3ZZIA 4MBUA 1Z2LA 1MRZA 3DR6A 2PE3A 5K8NA 5HZBA 4LBZA 1LOKA 4BINA 3W2HA 1VLYA 2GPJA 4RM0A 4MCPA 4MFJA 2CRVA 4KOVA 2FIAA 3ZZ0A 4OIDA 1RTQA 2VZYA 5L46A 3QB8A 2V7QA 2R9VA 4CRZB 4ASUA 1BO4A 4DQKA 1LAPA 1XBUA 1WU8A 3MN8A 4XPKA 3RYOA 4XR6A 1PKVA 1GVHA 2G3TA 4OADA 1NSLA 1Y7RA 1ZUNB 1M4GA 4MCQA 4GS4A 1CNEA 3NE5B 3NH5A 5TY0A 3AVTA 3BC9A 3QE2A 2V7XA 2ZZEA 4FK8A 2DPSA 1IOIA 4YAOA 4QHYA 4CS0B 1KK1A 3B3VA 4RN7A 5LMZA 3CCUB 3FPPA 3F0AA 3WBJA 3RY8A 2Z3PA 2HCJB 1NMTA 1YJWB 5HH1A 5F49A 4FWTA 3VMFA 4NJQA 5HXDA 3A1PA 5K8PA 3WNBA 3D68A 4BD9A 4RCYA 2PRQA 5IYPA 3HUVA 3WC5A 4NGTA 2X7BA 1XOVA 1E3ZA 4OC2A 2ZZFA 1CX8A 1RXTA 1VIXA 3GB0A 2B7CA 5A28A 4XOTA 1QGZA 4I49A 2D9RA 5TR9A 4P4DA 3Q39A 1BLLE 3FRMA 2GU2A 1DE4C 3UY5A 1VQ7B 2OBTA 3Q6QA 2X53S 1WDTA 2CTCA 2C6GA 2WUUA 3B82A 2ZL5A 4OOXA 2FIWA 3V38A 2PC1A 1WP6A 2ZW7A 4B43A 2D4PA 1UD3A 1QUFA 2F8HA 1YVKA 4F0XA 4AVAA 3NH4A 2EFGA 4NCZA 4II3A 2DIEA 1HZEA 4KLWA 1DDIA 3S6HA 3OW2B 3S6KA 2WJVA 1KD1D 1T5EA 1T6YA 3AGPA 3ZBUA 3CESA 4LC0A 3ZC3A 2DEUA 4ZY0A 1EP3B 2ODFA 1YLEA 3S9LA 1BMFA 2P3MA 4B6ZA 4XNFA 4MJ8A 1UMKA 4CQJA 3MHPA 3G05A 4XOPA 3E0KA 4MHPA 4KKSA 2Q44A 4TMWA 5BSXA 2V7WA 1WTHD 4F9VA 4DNTB 4MCRA 4TKOB 4UZFA 1EE3P 3IO1A 3OPOA 5BSYA 5G21A 3G71B 2VBTA 4IF5A 2EK8A 5EMIA 5GCNA 3B35A 3GY9A 2D3NA 3U2QA 4P1VA 3IWWA 4Z4YA 2NV4A 3EC4A 2YNEA 4X07A 3R96A 1GO2A 2QE7A 2Z11A 4QUSA 2ZOFA 4EH1A 2BMWA 4TMXA 5A88A 4MHDA 4P4FA 3IWEA 3D7HA 3TX8A 3TO9A 4MYTA 4JXRA 4GM5A 4PSXA 3Q3AA 3PB8X 1P4NA 4UWIA 1TF9A 3SJFA 2IL4A 2EIXA 4HNYB 4KKUA 3JRUA 1A8PA 4RPDA 4X7FA 4X7EA 4KSIA 1GR1A 2R98A 4HNWB 4LQGA 1FNDA 3N5FA 3KHZA 1BOBA 4B3FX 1ZM2A 3PFOA 3KEWA 2WPWA 3W2EA 4Z4UA 1MABA 4YAFA 1QVGB 3I3GA 1CJWA 4XPLA 3LMSA 4NSQA 2BOAA 1QGAA 5FO0A 4UEFA 2Q7BA 4AB7A 4FWUA 4X05A 3CCJB 3R6JA 1WSRA 3W5HA 4DK0A 3OW7A 4NJRA 1U6MA 1RQPA 4X3RA 5J3OA 1GJRA 3KHXA 4IK2A 1ZG9A 4NEXA 3D2PA 1R5NA 5A89A 4XLEA 6CPAA 4YFJA 2OYNA 1E62A 4HE5A 5K8MA 2E1BA 3WY9A 1OBRA 5LRKA 3IC1A 2ZEFA 3KL9A 4ZV4A 1SM4A 3TTHA 5GV7A 3SJEA 3A3GA 3QNVA 2Z3LA 2QVPA 3BI1A 2VI7A 4KVME 1OB0A 4UA3A 1H85A 2X6XA 2GLJA 2WZPP 2REEA 3OEHA 1TF8A 4ZCIA 3CCEB 4UWJA 2VEZA 1NB9A 3D8PA 2AHOA 3K9UA 2HQYA 4NGRA 4XD7A 4PC1A 4PK2A 5FIUA 1K28D 4CPAA 2GQFA 4RDLA 1PYTB 4OPOA 3OOCA 1NJID 4G1VA 4UZUA 3SJPA 2AFOA 4L8JA 2W6JA 2CW5A 2OK7A 2DCUA 2EK9A 2Q4VA 2ZW6A 1IJFA 4UFWA 2OK8A 4B13A 3JVNA 1OZPA 5THWA 2WSAA 1KQSB 2PIZA 2GANA 2RC4A 2H5MA 4CGOA 1AUGA 2NMTA 2YNDA 2DEAA 2GIVA 4PXEA 1COWA 2AFMA 5HZAA 1Q82D 1E1RA 1G7RA 3W5VA 1BX1A 4F9UA 3CDXA 2JBJA 1KWMA 1P0HA 1H8LA 3MGDA 1UD5A 1F2PA 4UAJA 3GYAA 1KK0A 4FAIA 4KOUA 3KR5A 3EXNA 5AG5A 2JLMA 3ZJ0A 4H6ZA 3JTKA 2Q6OA 4QBJA 4XORA 3OZUA 4RPBA 3Q6RA 1S72B 4JMQA 1QGYA 2P6EA 2R1IA 1TKJA 3QAYA 2OB0A 4EMEA 2C27A 2XOKA 1CNFA 3BI0A 4DK1A 4LBYA 2JEWA 3SHPA 1KK2A 2HMAA 5KTDA 3IJ3A 3DGVA 1VGYA 3ZPNA 4C68A 4OP4A 2Q6LA 1KJZA 2V4DA 3N7ZA 2JJ2A 4MCSA 4XNHC 4KUAA 4Z4VA 3PA2A 1K8AD 3BLNA 3ONUA 1FT7A 4PV6A 2VQYA 5F4MA 1ZM4A 2ZL7A 1I21A 3PB6X 3P27A 4KZTA 1R5OA 2FL4A 1DG1G 1Y9WA 1XMBA 5F48A 5IK2A 5JPHA 4CRYB 4Z1MA 5I4MA 2AFZA 3T51B 3OFNA 3PGPA 2Z3KA 3A3BA 5HVHA 1E3XA 4M1KA 2DERA 1XRYA 4WZKA 2FSRA 4G7XA 4RD3A 3D7DA 3T53B 1Q7LA 5IB0A 4Y7CA 2XZPA 3W91A 4DUKA 2EUIA 4ORFA 3LNNA 1V0CA 4NGPA 3WC7A 2PIYA 4YHBA 2Q4YA 2P0WA 3QSYA 2XZOA 3BY2A 4H2KA 4Z4SA 5CBMA 1JWQA 4P6YA 1VHOA 3PB9X 1YGHA 4U5YA 3ZUGA 2CXAA 5G20A 3TCVA 4A2ZA 2PJ5A 1GAWA 3FMCA 2OZHA 4IUSA 3W2FA 2DF5A 4RS2A 4ZBGA 1J9ZA 2O53A 3VNVA 1TVCA 1ARMA 2Z3NA 4YAUA 4MFPA 1QMUA 4MHYA 1WOPA 2PR1A 3FF3A 2OH1A 5B6IA 2Z0ZA 2POKA 2PIAA 2Z6BD 1MK4A 1E64A 5CDFA 1M1DA 2WPXA 3JU4A 5IX3A 1B2RA 3CXQA 4ZI6A 4JWPA 1BX0A 4PQAA 1K73D 4KOSA 4M6HA 4JXQA 4KOWA 4OPSA 3G8WA 4P45A 2VZLA 3GVKA 2X85A 4JLYA 4BPRA 4OP7A 3KI9A 1NRKA 1E79A 2C4TA 1F2OA 1JA1A 3A9LA 3NE7A 4PSWA 3AGQA 4OC0A 1D2EA 5TRDA 2PLFA 5FVJA 5FO1A 3I56B 4WQMA 2I3CA 2CTBA 4UFXA 3V8IA 3H8GA 2ZITA 3U6BA 3TO6A 1MJ9A 2YWEA 3E1YE 1YJ9B 2ATRA 3ASRA 2Q6KA 4KVXA 2ZPAA 4P4JA 3RZAA 3VO2A 2ZEEA 1EP2B 1K9MD 3BCDA 3SI0A 1ON0A 5F46A 1G7SA 2JDIA 4JZ0A 2V7UA 4RJLA 4ZY2A 1FNBA 2ZTGA 2CC2A 2XEGA 4FBEA 2PVWA 4O23A 3FB3A 1S4MA 4M6IA 1X12A 4C2XA 1YLOA 3FNCA 4PXCA 2DY1A 4B11A 2ZENA 2VNKA 4B47A 5LYFA 2WSSA 1Z4RA 5AG6A 1TXRA 2HB6A 3SJZA 1IJEA 3WABA 4XLCA 3FEDA 1KZFA 2O28A 3ASQA 3PBBA 2QDXA 4P3IA 4P10A 1VJSA 1M44A 3SJXA 5CNPA 3K9TA 1YX0A 1EP1B 3BHXA 5A8AA 3B7IA 2I79A 1CP6A 3GSIA 2BSWA 2BUEA 2PCUA 3CRZA 3I9SA 4C7IA 1JB9A 1LAMA 5HVGA 1NE9A 1Q2DA 3ZBTA 4DNRB 1HEEA 3WT4A 5JBQA 3P2FA 2B3VA 4EFDA 1JQGA 1N06A 4PC6A 4OOVA 4R3LA 2V77A 4U9ZA 4A38A 3OJXA 1W9XA 2YWHA 3F5BA 1F60A 3KASA 1AIPA 1R43A 1MJAA 1WK4A 3BQJA 4B12A 4BMHA 1ZM9A 4OC4A 2FCKA 4QC6A 5CPAA 4YGOA 4L8AA 4WZLA 1UD8A 4RDKA 1TTTA 3KKWA 3BNWA 3PENA 4C2YA 4CYPA 2Y0MA 2F1MA 5F4JA 4RCZA 4BBHA 4Z4ZA 3R6KA 4YEJA 3BH4A 4YAWA 2VL1A 1EFCA 4ZGYB 3R9EA 4DJLA 2VNHA 1UD2A 1B87A 1IYKA 1WPCA 4P9SA 5IYWA 2X6YA 4HIZA 2ZXVA 1U2RA 1BAVA 1TIQA 4UZEA 1M4LA 3WNDA 1YK3A 4R87A 4DYOA 2BM0A 2PJ9A 1TLLA 1HDQA 4Z4WA 3WQZA 1XF8A 4ONUA 3GKRA 4CGLA 3FJOA 4KORA 1QG0A 4X06A 4MI4A 3B8GA 1QFYA 2QA4B 3H8EA 4XNHB 1H8HA 2C5HA 2PR8A 2JN9A 2YGWA 1QSMA 4F8ZA 4X7DA 4MRIA 4QFMA 2FE7A 3DDDA 3IEHA 3FX6A 4AVCA 4OPVA 3V7ZA 5DN6A 3GIRA 2V8DA 3BJ8A 3T9YA 4P4IA 3B3CA 2X3UA 1QFJA 2J7KA 3OWCA 3W6SA 1YW6A 4H9GA 3JQPA 4G5GA 3W2IA 1W35A 4PABA 2G0BA 1S7FA 3ASPA 1YREA 2PVVA 5A27A 3OE7A 4XM3A 2WPDA 3IIBA 4W9YA 1B6BA 4ONWA 4UIBA 3GIUA 3CPXA 1QSOA 4TSFA 3TE4A 1QQ9A 4TT3A 4UF4A 2I00A 1V0FA 4RD6A 3PB4X 1CG2A 3CCLB 2OR4A 3K2KA 4KUBA 3T8WA 1IB1E 4Y9UA 2V7VA 4CAFA 3VO1A 1E1QA 2IQ6A 5IYQA 1KK3A 1N07A 4RD1A 3VARA 4UCNA 4MHZA 4XPDB 2VZZA 2R7HA 5AG7A 4WZTA 4G6IA 1VQLB 3WXMA 5KTAA 3CW2A 2JDCA 4KKTA 2B4BA 1QX4A 3GQBA 5C82A 2AFSA 1JJ2B 1SQHA 1I1DA 3H4QA 3PB7X 4LQ6A 4JD6A 4QVAA 4UCPA 3CC4B 5LYDA 2F5IA 4UEZA 3CXCB 2Q04A 2F1LA 3FBUA 1W0KA 2VBVA 2PJ2A 1CQXA 5FL7A 2JBKA 2WYRA 2HLDA 2PMDA 1VQPB 1E43A 3JQRA 3QFSA 4HPSA 4PPZA 3WR7A 1M4DA 4OC1A 4A39A 4ZX9A 1YJNB 3CP2A 4WZEA 3HAGA 4NGSA 3DSBA 4YU9A 4A33A 1BQEA 1DDGA 3S6GA 4P4BA 4AG7A 3HLPA 3OP1A 1PCAA 2C5BA 3TOAA 5H86A 4LBVA 1BPLA 2P6FA 1QH0A 2B5OA 5LYIA 1DTDA 1ZO0A 5IYNA 1Z8XA 1S7KA 4HKFA 1M4IA 4KVOE 4AXVA 2VBUA 4CGMA 4XLFA 3SI2A 3CZXA 4R76A 2PDOA 4TN1A 3TT2A 5I0CA 3G3SA 4CAXA 1MJBA 4R8FA 4TWEA 1QFZA 1KUVA 2VNJA 1VQOB 1XFOA 3P2HA 2ZEPA 3TFYA 1VF7A 1Z8TA 3A8IA 4XN0A 2CIJA 4C43A 4Y49B 3R95A 4ZCMA 1ZG7A 1UWYA 1Z8LA 1OB5A 1T6ZA 5JH9A 3NA6A 1KTVA 4LUAA 4K3NA 1G7CA 3S6FA 2F43A 4J0QA 1J4JA 3PFEA 3AVYA 2QMUA 4M85A 3PBEA 3RNZA 3GUXA 3NFZA 2HV2A 3FECA 2CBXA 2ZEGA 1XJOA 2V8VA 4XN3A 2PJAA 3EO4A 2G9DA 1XMTA 4M2LA 1Z9UA 2V8HA 3V7AA 3H5ZA 2VYQA 4PGOA 3B3WA 3VNUA 3T90A 4FUUA 4P26A 4P6VF 3IFEA 4UIAA 5TV2A 4XLHA 3CXSA 1BPNA 5J8FA 4C0SA 1HVXA 2GK7A 4LBWA 4B5OA 4NGMA 4K1XA 3LO8A 3GVJA 4YRHA 2CNTA 3DNSA 3D26A 3QAHA 4PXDA 3G6EB 3CCVB 5KW9A 1PJ7A 1CP7A 4CAVA 4NXYA 2RC6A 1A2ZA 3WNCA 3VH9A 4FD5A 3CB4A 3IGRA 3P26A 2PQ8A 2QEXB 1V0EA 1X10A 2NYQA 3FJUA 1QSNA 3PEIA 2Z3MA 3GVLA 3PUNA 5HVFA 2CF4A 2PJ0A 3W2GA 1F20A 1R5BA 4IHMA 1VQKB 2KCWA 3VWEA 2C77A 3PVDA 2J8MA 3CP8A 3AVVA 3FXTA 3KQXA 5JQ4A 3U6KA 1XEBA 4P44A 4A95A 3FYNA 1YHQB 3IU1A 3L2NA 3DLJA 1WOSA 1JNYA 4PC2A 4PC3A 2GJRA 1S7LA 1IU8A 1VQMB 3VR6A 1FNMA 1BJKA 4FXUA 1D8TA 2ZL6A 4E0FA 1QSTA 2GLFA 2CNMA 5HKKA 5D29A 5AN9A 2J8RA 5KTCA 3ISXA 4E2AA 2DXQA 4PXBA 4GXHA 1AMPA 4ZCLA 1ZLHA 4Q38A 4II2A 3ISZA 4HE6A 2PSWA 1F57A 2IMOA 1VQ9B 4N3GA 2ZEDA 1N08A 1W87A 2PJ6A 3LQEA 3R9FA 3LACA 1S7NA 3RBUA 1VQ6B 3SEJA 1CM0A 2CY2A 2BSAA 2F7VA 1M90D 2XEJA 2B5GB 4NFRA 3BXMA 4A37A 4PC7A 5F47A 2WZNA 1WORA 1EFUA 2GFQA 2OZGA 5DS0A 4X2TA 4NBSA 2FX3A 3ASSA 1Q2YA 1SKYB 2PJ3A 4RI1A 2DETA 1Q9SA 4RLZA 2QGGA 1IIDA 4P12A 2CNDA 4QV2A 1W0JA 3MCAA 3OAAA 4M0LA 5FNZA 4Z65A 1IICA 1IB0A 3ASTA 2QYVA 2F4NA 2G3AA 4Z4TA 4A32A 2ZXIA 2FXFA 4NGQA 3FPKA 2RFHA 3CMAB 4ZGQB 2BM1A 3LD2A 1S5KA 4J3GA 4CYQA 5K8OA 4MHNA 1FRNA 3D66A 3PP9A 1TUIA 2D74A 3S9NA 1Q81D 2B5GA 3QFTA 4E8OA 1WWZA 2DYIA 4ACBA 1FNOA 3H9NA 1S0UA 1OB2A 2B3UA 2EO8A 2GJKA 2VXKA 4NGNA 1EFTA 1PJ5A 1Y9KA 2PRBA 2PJ4A 4XMYA 3CCMB 2CNSA 2AFUA 2FT0A 1FRQA 1WOOA 2QN6A 2ZZGA 1W2BB 2QMLA 4Y9RA 3DR8A 1FY7A 4OKOA 1XE1A 3OJWA 4ZYQA 2LZJA 1IGBA 2ZBVA 4P25A 2V8GA 1Y7EA 2D4OA 4DNCA 2JEVA 2Z10A 1KUXA 1YI2B 1PJ6A 2XNJA 1Z8WA 2EWBA 4G1BA 4AVBA 2KVOA 2PJ8A 3B78A 4KSFA 4CAWA 1NB0A 4XONA 1ZLIA 2J8NA 5KNLA 3AVWA 3D7FA 2OOTA 1QSRA 2B4DB 4E0AA 4OAEA 3VATA 4OC5A 3FEEA 3LVBA 5H5JA 4A31A 1ZM3A 3FKSA 3ZZTA 2IJZA 2C2WA 1I8DA 4NF1A 2VNIA 2B58A 4TMZA 4MMOA 4KOYA 1Q2CA 1UFHA 1S60A 2X8KA 1FNCA 4UFVA 1SKQA 3D3SA 4A30A 4B10A 2ZEOA 4WWVA 3CPWB 3J81k 3OZVA 2PJ1A 2OBRA 4M6GA 4C2ZA 4AF7A 2ZW5A 4Z4RA 4B3GA 1T6XA 4EVYA 2M5SA 2ZEMA 5HMNA 1UD6A 2BCOA 2C6PA 5E96A 2XEFA 4X7CA 3KR4A 2ZW4A 3PA1A 4B4DA 4OC3A 3Q38A 3ZIAA 3FVLA 1Y0YA 1YW4A 3SJGA 2B7BA 1VQ5B 2C4UA 2RB7A 1NBMA 4CYOA 4F7DA 4MFKA 3B2YA 2GJPA 2J9AA 1Z5RA 5IYRA 4LX9A 5LRJA 2HDNB 5C88A 1I18A 1ARLA 3NH8A 4L89A 4MFZA 1Y0RA 2ABZA 2DPTA 3FH4A 4KS9A 3E20A 4TMVA 4ROXA 2YNCA 3F8KA 4RD4A 3H8FA 4A94A 4P2NA 5E6TA 7CPAA 1GYTA 1L0CA 1DARA 2QIRA 5G22A 2Q51A 4MFLA 2XEIA 1XB2A 4G7WA 2BF4A 1OGIA 4M4SA 2XEXA 2GE3A 1UD4A 3NE8A 4CGPA 2O4HA 4JYWA 1CBXA 5H59A 4DQLA 2ZELA 3FIXA 4YWYA 2XGJA 2XNCA 4YXWA 3T56B 4ZGNB 4YALA 4K30A 1N8RD 1WSVA 2VBQA 1R57A 2YWGA 3RO0A 3VWDA 1VKCA 1KRHA 2R6HA 2GREA 4MFQA 1NSAA 3A8KA 3H94A 4F6AA 5DSZA 3ONYA 2PJBA 5GV8A 5G1ZA 3KQZA 4R3KA 3CCSB 4C7HA 4TMTA 2Z3OA 3LODA 4KOXA 2ZOGA 3OEEA 2ZXHA 3WYAA 1LCPA 3CMMA 3OKXA
chains in the Genus database with same CATH topology
1BLLE 3KGQA 2GU2A 2V8HA 4ZI6A 1DE4C 4PQAA 3B3WA 4FUUA 2CTCA 4P45A 2C6GA 3IFEA 4UIAA 5IB9A 3RAMA 1BPNA 3V38A 3KI9A 4NGMA 1F2OA 4ZX8A 2F8HA 4OC0A 3NH4A 2I3CA 2CTBA 3H8GA 4PXDA 1TKHA 1CP7A 3VH9A 2NYQA 4P4JA 3FJUA 3RZAA 3PEIA 4ZY0A 3S9LA 2FVGA 5HVFA 2ZEEA 2CF4A 2PJ0A 4B6ZA 3SI0A 4IHMA 4UEEA 4JZ0A 4MHPA 5ELYA 3KQXA 4ZY2A 3MRUA 2XEGA 4F9VA 4P44A 4FBEA 2PVWA 4O23A 3PRTA 3L2NA 4MCRA 3DLJA 3TC8A 1EE3P 1YLOA 3IO1A 4PXCA 4R6TA 3WC6A 2ZENA 5LYFA 2EK8A 1TXRA 2HB6A 3B35A 3WABA 3FEDA 2Q43A 3PBBA 1LFWA 3IWWA 4P10A 3SJXA 4X8IA 3K9TA 3BHXA 4P4EA 3B7IA 2GLFA 2ZOFA 5D29A 1CP6A 4R7MA 4P4FA 3D7HA 3ISXA 3TX8A 2PCUA 2QJ8A 4GM5A 4PXBA 3PB8X 3SI1A 1LAMA 1AMPA 5HVGA 1ZLHA 1YSJA 3ISZA 1TF9A 1HEEA 3SJFA 3WT4A 2HC9A 3JRUA 1F57A 2IMOA 4KSIA 4EFDA 1JQGA 2ZEDA 1ELMP 2PJ6A 2V77A 3B3SA 4LQGA 3N5FA 4A38A 3RBUA 3KHZA 1ELLP 2F7VA 3PFOA 1VHEA 2XEJA 3LMSA 4NFRA 4ZY1A 2BOAA 3BXMA 4A37A 4UEFA 2C1CA 2WZNA 4FWUA 3KASA 1R43A 3LWUA 4NJRA 5DS0A 4X2TA 4RUHA 4X3RA 3D4UA 4OC4A 5JM6A 3KHXA 5CPAA 5D8NA 2PJ3A 4IK2A 1R3NA 1ZG9A 2AFXA 4WJBA 5LRGA 4Z65A 1LANA 6CPAA 3CT9A 2VL1A 2ZEHA 4DJLA 5K8MA 2QYVA 1OBRA 5LRKA 3IC1A 2ZEFA 4NGQA 3KL9A 2RFHA 1BAVA 1IY7A 8CPAA 3SJEA 3QNVA 1M4LA 2C6CA 2QVPA 3BI1A 4DYOA 2GLJA 1HDQA 2PJ9A 5K8OA 4MHNA 1AYEA 2ANPA 3D66A 1TF8A 1CPSA 4MXUA 1BPMA 1CPXA 2BO9A 3S9NA 1TKFA 1FNOA 3H8EA 4NGRA 4CPAA 4NGNA 4F8ZA 4MRIA 1PYTB 2PJ4A 3B3TA 2AFUA 2PJCA 3IEHA 5F09A 3FX6A 1ZG8A 2AFOA 4OKOA 4OMEA 3V7ZA 4Q7AA 4ZYQA 2EK9A 1IGBA 2V8DA 5JGFA 4P4IA 3B3CA 2V8GA 1Y7EA 4IAVA 5LYLA 1YW6A 3KZWA 5THWA 3I1UA 2AFWA 2PIZA 2DEAA 4PXEA 2NSMA 3D67A 2EWBA 2AFMA 1YMEA 2PVVA 3IIBA 2PJ8A 4W9YA 4ONWA 4UIBA 1ZLIA 4F9UA 3D7FA 2OOTA 3S9MA 3CDXA 3CPXA 2JBJA 1KWMA 3VATA 1H8LA 4OC5A 1F2PA 4OIWA 3FEEA 1QQ9A 4G1PA 4UF4A 4FAIA 3KR5A 3PB4X 1CG2A 2OR4A 3K2KA 3T8WA 2Q4ZA 5J1QA 2IJZA 3CPAA 3GLJA 4MMOA 2PJ7A 2IQ6A 4TNUA 3VARA 1TKJA 4MHZA 4EMEA 2ZEOA 4WWVA 3BI0A 2JEWA 2PJ1A 3D7GA 3IJ3A 4EWTA 1HDUA 1VGYA 3DGVA 4OP4A 2AFSA 1Z2LA 2PE3A 2ZEMA 5K8NA 2BCOA 3PB7X 2C6PA 2XEFA 1LOKA 3KR4A 4MCSA 4MCPA 4OC3A 5LYDA 4UEZA 3FVLA 4OIDA 1RTQA 1Y0YA 1YW4A 3SJGA 1FT7A 2PJ2A 2JBKA 2WYRA 4PPZA 4OC1A 4A39A 4ZX9A 3PB6X 2RB7A 1LAPA 1XBUA 1XMBA 3B2YA 3MN8A 4NGSA 2J9AA 4YU9A 1Z5RA 5LRJA 5I4MA 4P4BA 2AFZA 1ARLA 3NH8A 3HLPA 1PCAA 5HVHA 4MCQA 1Y0RA 2ABZA 3FH4A 1XRYA 3NH5A 3D7DA 3H8FA 4A94A 1Q7LA 1DTDA 5LYIA 7CPAA 1GYTA 2Q51A 4DUKA 4AXVA 2XEIA 4NGPA 3SI2A 3WC7A 2PIYA 4R76A 3B3VA 2O4HA 4H2KA 5CBMA 4JYWA 4P6YA 1VHOA 1CBXA 3PB9X 2ZELA 4R8FA 4TWEA 4YWYA 2PJ5A 3FMCA 1XFOA 2ZEPA 4NJQA 2O53A 5HXDA 1ARMA 2CIJA 5K8PA 2GREA 3D68A 1NSAA 4BD9A 2PRQA 1ZG7A 1QMUA 1UWYA 1Z8LA 4MHYA 3FF3A 2PJBA 3HUVA 5JH9A 3NA6A 3WC5A 4NGTA 3KQZA 4K3NA 2POKA 4OC2A 1CX8A 3PFEA 1VIXA 3GB0A 3PBEA 3GUXA 3NFZA 2ZOGA 3FECA 2V8VA 1XJOA 2ZEGA 2PJAA 2G9DA 1LCPA 4P4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLL E;  3KGQ A;  2GU2 A;  2V8H A;  4ZI6 A;  1DE4 C;  4PQA A;  3B3W A;  4FUU A;  2CTC A;  4P45 A;  2C6G A;  3IFE A;  4UIA A;  5IB9 A;  3RAM A;  1BPN A;  3V38 A;  3KI9 A;  4NGM A;  1F2O A;  4ZX8 A;  2F8H A;  4OC0 A;  3NH4 A;  2I3C A;  2CTB A;  3H8G A;  4PXD A;  1TKH A;  1CP7 A;  3VH9 A;  2NYQ A;  4P4J A;  3FJU A;  3RZA A;  3PEI A;  4ZY0 A;  3S9L A;  2FVG A;  5HVF A;  2ZEE A;  2CF4 A;  2PJ0 A;  4B6Z A;  3SI0 A;  4IHM A;  4UEE A;  4JZ0 A;  4MHP A;  5ELY A;  3KQX A;  4ZY2 A;  3MRU A;  2XEG A;  4F9V A;  4P44 A;  4FBE A;  2PVW A;  4O23 A;  3PRT A;  3L2N A;  4MCR A;  3DLJ A;  3TC8 A;  1EE3 P;  1YLO A;  3IO1 A;  4PXC A;  4R6T A;  3WC6 A;  2ZEN A;  5LYF A;  2EK8 A;  1TXR A;  2HB6 A;  3B35 A;  3WAB A;  3FED A;  2Q43 A;  3PBB A;  1LFW A;  3IWW A;  4P10 A;  3SJX A;  4X8I A;  3K9T A;  3BHX A;  4P4E A;  3B7I A;  2GLF A;  2ZOF A;  5D29 A;  1CP6 A;  4R7M A;  4P4F A;  3D7H A;  3ISX A;  3TX8 A;  2PCU A;  2QJ8 A;  4GM5 A;  4PXB A;  3PB8 X;  3SI1 A;  1LAM A;  1AMP A;  5HVG A;  1ZLH A;  1YSJ A;  3ISZ A;  1TF9 A;  1HEE A;  3SJF A;  3WT4 A;  2HC9 A;  3JRU A;  1F57 A;  2IMO A;  4KSI A;  4EFD A;  1JQG A;  2ZED A;  1ELM P;  2PJ6 A;  2V77 A;  3B3S A;  4LQG A;  3N5F A;  4A38 A;  3RBU A;  3KHZ A;  1ELL P;  2F7V A;  3PFO A;  1VHE A;  2XEJ A;  3LMS A;  4NFR A;  4ZY1 A;  2BOA A;  3BXM A;  4A37 A;  4UEF A;  2C1C A;  2WZN A;  4FWU A;  3KAS A;  1R43 A;  3LWU A;  4NJR A;  5DS0 A;  4X2T A;  4RUH A;  4X3R A;  3D4U A;  4OC4 A;  5JM6 A;  3KHX A;  5CPA A;  5D8N A;  2PJ3 A;  4IK2 A;  1R3N A;  1ZG9 A;  2AFX A;  4WJB A;  5LRG A;  4Z65 A;  1LAN A;  6CPA A;  3CT9 A;  2VL1 A;  2ZEH A;  4DJL A;  5K8M A;  2QYV A;  1OBR A;  5LRK A;  3IC1 A;  2ZEF A;  4NGQ A;  3KL9 A;  2RFH A;  1BAV A;  1IY7 A;  8CPA A;  3SJE A;  3QNV A;  1M4L A;  2C6C A;  2QVP A;  3BI1 A;  4DYO A;  2GLJ A;  1HDQ A;  2PJ9 A;  5K8O A;  4MHN A;  1AYE A;  2ANP A;  3D66 A;  1TF8 A;  1CPS A;  4MXU A;  1BPM A;  1CPX A;  2BO9 A;  3S9N A;  1TKF A;  1FNO A;  3H8E A;  4NGR A;  4CPA A;  4NGN A;  4F8Z A;  4MRI A;  1PYT B;  2PJ4 A;  3B3T A;  2AFU A;  2PJC A;  3IEH A;  5F09 A;  3FX6 A;  1ZG8 A;  2AFO A;  4OKO A;  4OME A;  3V7Z A;  4Q7A A;  4ZYQ A;  2EK9 A;  1IGB A;  2V8D A;  5JGF A;  4P4I A;  3B3C A;  2V8G A;  1Y7E A;  4IAV A;  5LYL A;  1YW6 A;  3KZW A;  5THW A;  3I1U A;  2AFW A;  2PIZ A;  2DEA A;  4PXE A;  2NSM A;  3D67 A;  2EWB A;  2AFM A;  1YME A;  2PVV A;  3IIB A;  2PJ8 A;  4W9Y A;  4ONW A;  4UIB A;  1ZLI A;  4F9U A;  3D7F A;  2OOT A;  3S9M A;  3CDX A;  3CPX A;  2JBJ A;  1KWM A;  3VAT A;  1H8L A;  4OC5 A;  1F2P A;  4OIW A;  3FEE A;  1QQ9 A;  4G1P A;  4UF4 A;  4FAI A;  3KR5 A;  3PB4 X;  1CG2 A;  2OR4 A;  3K2K A;  3T8W A;  2Q4Z A;  5J1Q A;  2IJZ A;  3CPA A;  3GLJ A;  4MMO A;  2PJ7 A;  2IQ6 A;  4TNU A;  3VAR A;  1TKJ A;  4MHZ A;  4EME A;  2ZEO A;  4WWV A;  3BI0 A;  2JEW A;  2PJ1 A;  3D7G A;  3IJ3 A;  4EWT A;  1HDU A;  1VGY A;  3DGV A;  4OP4 A;  2AFS A;  1Z2L A;  2PE3 A;  2ZEM A;  5K8N A;  2BCO A;  3PB7 X;  2C6P A;  2XEF A;  1LOK A;  3KR4 A;  4MCS A;  4MCP A;  4OC3 A;  5LYD A;  4UEZ A;  3FVL A;  4OID A;  1RTQ A;  1Y0Y A;  1YW4 A;  3SJG A;  1FT7 A;  2PJ2 A;  2JBK A;  2WYR A;  4PPZ A;  4OC1 A;  4A39 A;  4ZX9 A;  3PB6 X;  2RB7 A;  1LAP A;  1XBU A;  1XMB A;  3B2Y A;  3MN8 A;  4NGS A;  2J9A A;  4YU9 A;  1Z5R A;  5LRJ A;  5I4M A;  4P4B A;  2AFZ A;  1ARL A;  3NH8 A;  3HLP A;  1PCA A;  5HVH A;  4MCQ A;  1Y0R A;  2ABZ A;  3FH4 A;  1XRY A;  3NH5 A;  3D7D A;  3H8F A;  4A94 A;  1Q7L A;  1DTD A;  5LYI A;  7CPA A;  1GYT A;  2Q51 A;  4DUK A;  4AXV A;  2XEI A;  4NGP A;  3SI2 A;  3WC7 A;  2PIY A;  4R76 A;  3B3V A;  2O4H A;  4H2K A;  5CBM A;  4JYW A;  4P6Y A;  1VHO A;  1CBX A;  3PB9 X;  2ZEL A;  4R8F A;  4TWE A;  4YWY A;  2PJ5 A;  3FMC A;  1XFO A;  2ZEP A;  4NJQ A;  2O53 A;  5HXD A;  1ARM A;  2CIJ A;  5K8P A;  2GRE A;  3D68 A;  1NSA A;  4BD9 A;  2PRQ A;  1ZG7 A;  1QMU A;  1UWY A;  1Z8L A;  4MHY A;  3FF3 A;  2PJB A;  3HUV A;  5JH9 A;  3NA6 A;  3WC5 A;  4NGT A;  3KQZ A;  4K3N A;  2POK A;  4OC2 A;  1CX8 A;  3PFE A;  1VIX A;  3GB0 A;  3PBE A;  3GUX A;  3NFZ A;  2ZOG A;  3FEC A;  2V8V A;  1XJO A;  2ZEG A;  2PJA A;  2G9D A;  1LCP A;  4P4D A; 
#chains in the Genus database with same CATH topology
 3I1F A;  3D2M A;  3KGQ A;  1XE4 A;  1M1K D;  5IB9 A;  4H6U A;  3RAM A;  3AVU A;  3WBK A;  1B23 P;  3BJ7 A;  1VQ4 B;  3PZJ A;  4HNX B;  4FD7 A;  2BVN A;  3MMP A;  2BGI A;  3A8J A;  4ZX8 A;  1N05 A;  4FD6 A;  3CCR B;  4N3N A;  4RDJ A;  5IV0 A;  2D3L A;  4CGN A;  4P3Y A;  3EY5 A;  1TKH A;  2K5T A;  1XQB A;  3BY1 A;  4UCM A;  4B48 A;  5J35 A;  1EXM A;  3CXP A;  3CD6 B;  1HA3 A;  3I55 B;  1YVO A;  1Z4E A;  1YQE A;  2BL1 A;  1V5V A;  2B4D A;  3TO7 A;  4R57 A;  2FVG A;  4AG9 A;  1ELO A;  3R1K A;  4Y49 C;  2VJJ A;  2OU2 A;  2BGJ A;  1EWY A;  4UEE A;  4KOT A;  3QFC A;  1JA0 A;  2V7T A;  1NDH A;  5ELY A;  1QUE A;  1I7P A;  2ZBU A;  2JJ1 A;  3MRU A;  1H8E A;  4NCN A;  4NNJ A;  3SXO A;  4B14 A;  4P22 A;  3PRT A;  3OZW A;  4X0C A;  4M53 A;  4QB9 A;  3EFA A;  4PAA A;  4B44 A;  3TC8 A;  3AVX A;  4R6T A;  3WC6 A;  1QVF B;  1G7T A;  4Q7J B;  1OGJ A;  2E1R A;  2Q43 A;  1H42 A;  2W6I A;  1LFW A;  1GAQ A;  4QVT A;  2WR8 A;  2GK6 A;  4X8I A;  2QEC A;  1Q7Y D;  4KSA A;  4QVJ A;  2JIZ A;  4P4E A;  1I12 A;  1Q86 D;  4R7M A;  4FD4 A;  4U9U A;  2VBS A;  2RC5 A;  3CME B;  4R71 A;  1IOF A;  2QJ8 A;  1KC8 D;  1EFR A;  1KMH A;  3SI1 A;  1YSJ A;  1RQR A;  2HC9 A;  2ZTN A;  3IWG A;  2EBJ A;  2Q0Y A;  4XLA A;  2X0K A;  2Q6I A;  1YR0 A;  2P6G A;  1ELM P;  3LQ6 A;  3B3S A;  1IHM A;  2BN4 A;  5HXB A;  2DOG A;  1VQ8 B;  1ELL P;  3ZZU A;  1VHE A;  4XQF A;  5F4O A;  3W6X A;  4ZY1 A;  2YNC C;  3DDY A;  2C1C A;  3PUM A;  3LWU A;  4RUH A;  3D4U A;  1K4J A;  5JM6 A;  4II9 A;  4MY0 A;  5D8N A;  4XL9 A;  3BCF A;  4B5P A;  1R3N A;  1YIT B;  1KZL A;  4R9M A;  2AFX A;  5H84 A;  2BV3 A;  4WJB A;  3SLD A;  5LRG A;  4MYU A;  1LAN A;  4JJX A;  5ISV A;  3W5U A;  3CT9 A;  5KSW B;  2JDD A;  2ZEH A;  4RD0 A;  3SKB A;  2ARH A;  2OTJ B;  4M3S A;  1YX2 A;  3B8H A;  1XIX A;  1IY7 A;  1IYL A;  8CPA A;  2NPF A;  1N0U A;  2C6C A;  2QTZ A;  3SXN A;  4AC9 A;  4OOS A;  4YEL A;  4XKV A;  4Q36 A;  1VLO A;  4CYN A;  5THX A;  1AYE A;  2ANP A;  2X6W A;  1CPS A;  4MXU A;  1BPM A;  1CPX A;  1KUY A;  2BO9 A;  2Q7S A;  1TKF A;  2XND A;  2EVN A;  1VQN B;  2VJI A;  4QUZ A;  4XKW A;  2WJY A;  2CK3 A;  3CCQ B;  4AF6 A;  3B3T A;  2PJC A;  4B5P B;  2OTL B;  5F09 A;  1ZG8 A;  4X5K A;  1S3Z A;  3CC7 B;  4OME A;  3QFR A;  4Q7A A;  2FS5 A;  2I1L A;  1YIJ B;  1P4M A;  5JGF A;  4IAV A;  1BLI A;  5LYL A;  4RD2 A;  2XZL A;  3KZW A;  2R8V A;  5AG4 A;  4H89 A;  2AJ6 A;  3I1U A;  5DWN A;  2AFW A;  5J8C A;  4FN5 A;  1N71 A;  2NSM A;  3D67 A;  1E63 A;  3A35 A;  2A4N A;  1YME A;  1FX0 A;  1PU9 A;  2YWF A;  2QTL A;  1LRZ A;  1W34 A;  5EBV A;  2REF A;  4AVZ A;  2BPO A;  3CC2 B;  3TOB A;  1GHE A;  5FA6 A;  3SLN A;  3S9M A;  2HUZ A;  3G4S B;  1N0V C;  4PK3 A;  3C26 A;  1VHS A;  3R9G A;  4OIW A;  4MY3 A;  4ACA A;  4KLV A;  2ZZQ A;  2BEI A;  4G1P A;  5BWA B;  4CAE A;  3JQQ A;  1D1N A;  2Q4Z A;  5AGE A;  5J1Q A;  3CPA A;  3GLJ A;  2OZU A;  3ES9 A;  4IW3 B;  2C78 A;  2AE6 A;  2PJ7 A;  5EC4 A;  4TNU A;  3CTA A;  4GQN A;  4UBR A;  3JUW A;  1FDR A;  5DWM A;  4U9Y A;  1OHH A;  3IU2 A;  1PUA A;  4OLL A;  2V31 A;  1RO5 A;  3V76 A;  4F0Y A;  4B3X A;  5EMN A;  3D7G A;  4XPD C;  2OBS A;  4EWT A;  1HDU A;  1AMO A;  3ZZI A;  4MBU A;  1Z2L A;  1MRZ A;  3DR6 A;  2PE3 A;  5K8N A;  5HZB A;  4LBZ A;  1LOK A;  4BIN A;  3W2H A;  1VLY A;  2GPJ A;  4RM0 A;  4MCP A;  4MFJ A;  2CRV A;  4KOV A;  2FIA A;  3ZZ0 A;  4OID A;  1RTQ A;  2VZY A;  5L46 A;  3QB8 A;  2V7Q A;  2R9V A;  4CRZ B;  4ASU A;  1BO4 A;  4DQK A;  1LAP A;  1XBU A;  1WU8 A;  3MN8 A;  4XPK A;  3RYO A;  4XR6 A;  1PKV A;  1GVH A;  2G3T A;  4OAD A;  1NSL A;  1Y7R A;  1ZUN B;  1M4G A;  4MCQ A;  4GS4 A;  1CNE A;  3NE5 B;  3NH5 A;  5TY0 A;  3AVT A;  3BC9 A;  3QE2 A;  2V7X A;  2ZZE A;  4FK8 A;  2DPS A;  1IOI A;  4YAO A;  4QHY A;  4CS0 B;  1KK1 A;  3B3V A;  4RN7 A;  5LMZ A;  3CCU B;  3FPP A;  3F0A A;  3WBJ A;  3RY8 A;  2Z3P A;  2HCJ B;  1NMT A;  1YJW B;  5HH1 A;  5F49 A;  4FWT A;  3VMF A;  4NJQ A;  5HXD A;  3A1P A;  5K8P A;  3WNB A;  3D68 A;  4BD9 A;  4RCY A;  2PRQ A;  5IYP A;  3HUV A;  3WC5 A;  4NGT A;  2X7B A;  1XOV A;  1E3Z A;  4OC2 A;  2ZZF A;  1CX8 A;  1RXT A;  1VIX A;  3GB0 A;  2B7C A;  5A28 A;  4XOT A;  1QGZ A;  4I49 A;  2D9R A;  5TR9 A;  4P4D A;  3Q39 A;  1BLL E;  3FRM A;  2GU2 A;  1DE4 C;  3UY5 A;  1VQ7 B;  2OBT A;  3Q6Q A;  2X53 S;  1WDT A;  2CTC A;  2C6G A;  2WUU A;  3B82 A;  2ZL5 A;  4OOX A;  2FIW A;  3V38 A;  2PC1 A;  1WP6 A;  2ZW7 A;  4B43 A;  2D4P A;  1UD3 A;  1QUF A;  2F8H A;  1YVK A;  4F0X A;  4AVA A;  3NH4 A;  2EFG A;  4NCZ A;  4II3 A;  2DIE A;  1HZE A;  4KLW A;  1DDI A;  3S6H A;  3OW2 B;  3S6K A;  2WJV A;  1KD1 D;  1T5E A;  1T6Y A;  3AGP A;  3ZBU A;  3CES A;  4LC0 A;  3ZC3 A;  2DEU A;  4ZY0 A;  1EP3 B;  2ODF A;  1YLE A;  3S9L A;  1BMF A;  2P3M A;  4B6Z A;  4XNF A;  4MJ8 A;  1UMK A;  4CQJ A;  3MHP A;  3G05 A;  4XOP A;  3E0K A;  4MHP A;  4KKS A;  2Q44 A;  4TMW A;  5BSX A;  2V7W A;  1WTH D;  4F9V A;  4DNT B;  4MCR A;  4TKO B;  4UZF A;  1EE3 P;  3IO1 A;  3OPO A;  5BSY A;  5G21 A;  3G71 B;  2VBT A;  4IF5 A;  2EK8 A;  5EMI A;  5GCN A;  3B35 A;  3GY9 A;  2D3N A;  3U2Q A;  4P1V A;  3IWW A;  4Z4Y A;  2NV4 A;  3EC4 A;  2YNE A;  4X07 A;  3R96 A;  1GO2 A;  2QE7 A;  2Z11 A;  4QUS A;  2ZOF A;  4EH1 A;  2BMW A;  4TMX A;  5A88 A;  4MHD A;  4P4F A;  3IWE A;  3D7H A;  3TX8 A;  3TO9 A;  4MYT A;  4JXR A;  4GM5 A;  4PSX A;  3Q3A A;  3PB8 X;  1P4N A;  4UWI A;  1TF9 A;  3SJF A;  2IL4 A;  2EIX A;  4HNY B;  4KKU A;  3JRU A;  1A8P A;  4RPD A;  4X7F A;  4X7E A;  4KSI A;  1GR1 A;  2R98 A;  4HNW B;  4LQG A;  1FND A;  3N5F A;  3KHZ A;  1BOB A;  4B3F X;  1ZM2 A;  3PFO A;  3KEW A;  2WPW A;  3W2E A;  4Z4U A;  1MAB A;  4YAF A;  1QVG B;  3I3G A;  1CJW A;  4XPL A;  3LMS A;  4NSQ A;  2BOA A;  1QGA A;  5FO0 A;  4UEF A;  2Q7B A;  4AB7 A;  4FWU A;  4X05 A;  3CCJ B;  3R6J A;  1WSR A;  3W5H A;  4DK0 A;  3OW7 A;  4NJR A;  1U6M A;  1RQP A;  4X3R A;  5J3O A;  1GJR A;  3KHX A;  4IK2 A;  1ZG9 A;  4NEX A;  3D2P A;  1R5N A;  5A89 A;  4XLE A;  6CPA A;  4YFJ A;  2OYN A;  1E62 A;  4HE5 A;  5K8M A;  2E1B A;  3WY9 A;  1OBR A;  5LRK A;  3IC1 A;  2ZEF A;  3KL9 A;  4ZV4 A;  1SM4 A;  3TTH A;  5GV7 A;  3SJE A;  3A3G A;  3QNV A;  2Z3L A;  2QVP A;  3BI1 A;  2VI7 A;  4KVM E;  1OB0 A;  4UA3 A;  1H85 A;  2X6X A;  2GLJ A;  2WZP P;  2REE A;  3OEH A;  1TF8 A;  4ZCI A;  3CCE B;  4UWJ A;  2VEZ A;  1NB9 A;  3D8P A;  2AHO A;  3K9U A;  2HQY A;  4NGR A;  4XD7 A;  4PC1 A;  4PK2 A;  5FIU A;  1K28 D;  4CPA A;  2GQF A;  4RDL A;  1PYT B;  4OPO A;  3OOC A;  1NJI D;  4G1V A;  4UZU A;  3SJP A;  2AFO A;  4L8J A;  2W6J A;  2CW5 A;  2OK7 A;  2DCU A;  2EK9 A;  2Q4V A;  2ZW6 A;  1IJF A;  4UFW A;  2OK8 A;  4B13 A;  3JVN A;  1OZP A;  5THW A;  2WSA A;  1KQS B;  2PIZ A;  2GAN A;  2RC4 A;  2H5M A;  4CGO A;  1AUG A;  2NMT A;  2YND A;  2DEA A;  2GIV A;  4PXE A;  1COW A;  2AFM A;  5HZA A;  1Q82 D;  1E1R A;  1G7R A;  3W5V A;  1BX1 A;  4F9U A;  3CDX A;  2JBJ A;  1KWM A;  1P0H A;  1H8L A;  3MGD A;  1UD5 A;  1F2P A;  4UAJ A;  3GYA A;  1KK0 A;  4FAI A;  4KOU A;  3KR5 A;  3EXN A;  5AG5 A;  2JLM A;  3ZJ0 A;  4H6Z A;  3JTK A;  2Q6O A;  4QBJ A;  4XOR A;  3OZU A;  4RPB A;  3Q6R A;  1S72 B;  4JMQ A;  1QGY A;  2P6E A;  2R1I A;  1TKJ A;  3QAY A;  2OB0 A;  4EME A;  2C27 A;  2XOK A;  1CNF A;  3BI0 A;  4DK1 A;  4LBY A;  2JEW A;  3SHP A;  1KK2 A;  2HMA A;  5KTD A;  3IJ3 A;  3DGV A;  1VGY A;  3ZPN A;  4C68 A;  4OP4 A;  2Q6L A;  1KJZ A;  2V4D A;  3N7Z A;  2JJ2 A;  4MCS A;  4XNH C;  4KUA A;  4Z4V A;  3PA2 A;  1K8A D;  3BLN A;  3ONU A;  1FT7 A;  4PV6 A;  2VQY A;  5F4M A;  1ZM4 A;  2ZL7 A;  1I21 A;  3PB6 X;  3P27 A;  4KZT A;  1R5O A;  2FL4 A;  1DG1 G;  1Y9W A;  1XMB A;  5F48 A;  5IK2 A;  5JPH A;  4CRY B;  4Z1M A;  5I4M A;  2AFZ A;  3T51 B;  3OFN A;  3PGP A;  2Z3K A;  3A3B A;  5HVH A;  1E3X A;  4M1K A;  2DER A;  1XRY A;  4WZK A;  2FSR A;  4G7X A;  4RD3 A;  3D7D A;  3T53 B;  1Q7L A;  5IB0 A;  4Y7C A;  2XZP A;  3W91 A;  4DUK A;  2EUI A;  4ORF A;  3LNN A;  1V0C A;  4NGP A;  3WC7 A;  2PIY A;  4YHB A;  2Q4Y A;  2P0W A;  3QSY A;  2XZO A;  3BY2 A;  4H2K A;  4Z4S A;  5CBM A;  1JWQ A;  4P6Y A;  1VHO A;  3PB9 X;  1YGH A;  4U5Y A;  3ZUG A;  2CXA A;  5G20 A;  3TCV A;  4A2Z A;  2PJ5 A;  1GAW A;  3FMC A;  2OZH A;  4IUS A;  3W2F A;  2DF5 A;  4RS2 A;  4ZBG A;  1J9Z A;  2O53 A;  3VNV A;  1TVC A;  1ARM A;  2Z3N A;  4YAU A;  4MFP A;  1QMU A;  4MHY A;  1WOP A;  2PR1 A;  3FF3 A;  2OH1 A;  5B6I A;  2Z0Z A;  2POK A;  2PIA A;  2Z6B D;  1MK4 A;  1E64 A;  5CDF A;  1M1D A;  2WPX A;  3JU4 A;  5IX3 A;  1B2R A;  3CXQ A;  4ZI6 A;  4JWP A;  1BX0 A;  4PQA A;  1K73 D;  4KOS A;  4M6H A;  4JXQ A;  4KOW A;  4OPS A;  3G8W A;  4P45 A;  2VZL A;  3GVK A;  2X85 A;  4JLY A;  4BPR A;  4OP7 A;  3KI9 A;  1NRK A;  1E79 A;  2C4T A;  1F2O A;  1JA1 A;  3A9L A;  3NE7 A;  4PSW A;  3AGQ A;  4OC0 A;  1D2E A;  5TRD A;  2PLF A;  5FVJ A;  5FO1 A;  3I56 B;  4WQM A;  2I3C A;  2CTB A;  4UFX A;  3V8I A;  3H8G A;  2ZIT A;  3U6B A;  3TO6 A;  1MJ9 A;  2YWE A;  3E1Y E;  1YJ9 B;  2ATR A;  3ASR A;  2Q6K A;  4KVX A;  2ZPA A;  4P4J A;  3RZA A;  3VO2 A;  2ZEE A;  1EP2 B;  1K9M D;  3BCD A;  3SI0 A;  1ON0 A;  5F46 A;  1G7S A;  2JDI A;  4JZ0 A;  2V7U A;  4RJL A;  4ZY2 A;  1FNB A;  2ZTG A;  2CC2 A;  2XEG A;  4FBE A;  2PVW A;  4O23 A;  3FB3 A;  1S4M A;  4M6I A;  1X12 A;  4C2X A;  1YLO A;  3FNC A;  4PXC A;  2DY1 A;  4B11 A;  2ZEN A;  2VNK A;  4B47 A;  5LYF A;  2WSS A;  1Z4R A;  5AG6 A;  1TXR A;  2HB6 A;  3SJZ A;  1IJE A;  3WAB A;  4XLC A;  3FED A;  1KZF A;  2O28 A;  3ASQ A;  3PBB A;  2QDX A;  4P3I A;  4P10 A;  1VJS A;  1M44 A;  3SJX A;  5CNP A;  3K9T A;  1YX0 A;  1EP1 B;  3BHX A;  5A8A A;  3B7I A;  2I79 A;  1CP6 A;  3GSI A;  2BSW A;  2BUE A;  2PCU A;  3CRZ A;  3I9S A;  4C7I A;  1JB9 A;  1LAM A;  5HVG A;  1NE9 A;  1Q2D A;  3ZBT A;  4DNR B;  1HEE A;  3WT4 A;  5JBQ A;  3P2F A;  2B3V A;  4EFD A;  1JQG A;  1N06 A;  4PC6 A;  4OOV A;  4R3L A;  2V77 A;  4U9Z A;  4A38 A;  3OJX A;  1W9X A;  2YWH A;  3F5B A;  1F60 A;  3KAS A;  1AIP A;  1R43 A;  1MJA A;  1WK4 A;  3BQJ A;  4B12 A;  4BMH A;  1ZM9 A;  4OC4 A;  2FCK A;  4QC6 A;  5CPA A;  4YGO A;  4L8A A;  4WZL A;  1UD8 A;  4RDK A;  1TTT A;  3KKW A;  3BNW A;  3PEN A;  4C2Y A;  4CYP A;  2Y0M A;  2F1M A;  5F4J A;  4RCZ A;  4BBH A;  4Z4Z A;  3R6K A;  4YEJ A;  3BH4 A;  4YAW A;  2VL1 A;  1EFC A;  4ZGY B;  3R9E A;  4DJL A;  2VNH A;  1UD2 A;  1B87 A;  1IYK A;  1WPC A;  4P9S A;  5IYW A;  2X6Y A;  4HIZ A;  2ZXV A;  1U2R A;  1BAV A;  1TIQ A;  4UZE A;  1M4L A;  3WND A;  1YK3 A;  4R87 A;  4DYO A;  2BM0 A;  2PJ9 A;  1TLL A;  1HDQ A;  4Z4W A;  3WQZ A;  1XF8 A;  4ONU A;  3GKR A;  4CGL A;  3FJO A;  4KOR A;  1QG0 A;  4X06 A;  4MI4 A;  3B8G A;  1QFY A;  2QA4 B;  3H8E A;  4XNH B;  1H8H A;  2C5H A;  2PR8 A;  2JN9 A;  2YGW A;  1QSM A;  4F8Z A;  4X7D A;  4MRI A;  4QFM A;  2FE7 A;  3DDD A;  3IEH A;  3FX6 A;  4AVC A;  4OPV A;  3V7Z A;  5DN6 A;  3GIR A;  2V8D A;  3BJ8 A;  3T9Y A;  4P4I A;  3B3C A;  2X3U A;  1QFJ A;  2J7K A;  3OWC A;  3W6S A;  1YW6 A;  4H9G A;  3JQP A;  4G5G A;  3W2I A;  1W35 A;  4PAB A;  2G0B A;  1S7F A;  3ASP A;  1YRE A;  2PVV A;  5A27 A;  3OE7 A;  4XM3 A;  2WPD A;  3IIB A;  4W9Y A;  1B6B A;  4ONW A;  4UIB A;  3GIU A;  3CPX A;  1QSO A;  4TSF A;  3TE4 A;  1QQ9 A;  4TT3 A;  4UF4 A;  2I00 A;  1V0F A;  4RD6 A;  3PB4 X;  1CG2 A;  3CCL B;  2OR4 A;  3K2K A;  4KUB A;  3T8W A;  1IB1 E;  4Y9U A;  2V7V A;  4CAF A;  3VO1 A;  1E1Q A;  2IQ6 A;  5IYQ A;  1KK3 A;  1N07 A;  4RD1 A;  3VAR A;  4UCN A;  4MHZ A;  4XPD B;  2VZZ A;  2R7H A;  5AG7 A;  4WZT A;  4G6I A;  1VQL B;  3WXM A;  5KTA A;  3CW2 A;  2JDC A;  4KKT A;  2B4B A;  1QX4 A;  3GQB A;  5C82 A;  2AFS A;  1JJ2 B;  1SQH A;  1I1D A;  3H4Q A;  3PB7 X;  4LQ6 A;  4JD6 A;  4QVA A;  4UCP A;  3CC4 B;  5LYD A;  2F5I A;  4UEZ A;  3CXC B;  2Q04 A;  2F1L A;  3FBU A;  1W0K A;  2VBV A;  2PJ2 A;  1CQX A;  5FL7 A;  2JBK A;  2WYR A;  2HLD A;  2PMD A;  1VQP B;  1E43 A;  3JQR A;  3QFS A;  4HPS A;  4PPZ A;  3WR7 A;  1M4D A;  4OC1 A;  4A39 A;  4ZX9 A;  1YJN B;  3CP2 A;  4WZE A;  3HAG A;  4NGS A;  3DSB A;  4YU9 A;  4A33 A;  1BQE A;  1DDG A;  3S6G A;  4P4B A;  4AG7 A;  3HLP A;  3OP1 A;  1PCA A;  2C5B A;  3TOA A;  5H86 A;  4LBV A;  1BPL A;  2P6F A;  1QH0 A;  2B5O A;  5LYI A;  1DTD A;  1ZO0 A;  5IYN A;  1Z8X A;  1S7K A;  4HKF A;  1M4I A;  4KVO E;  4AXV A;  2VBU A;  4CGM A;  4XLF A;  3SI2 A;  3CZX A;  4R76 A;  2PDO A;  4TN1 A;  3TT2 A;  5I0C A;  3G3S A;  4CAX A;  1MJB A;  4R8F A;  4TWE A;  1QFZ A;  1KUV A;  2VNJ A;  1VQO B;  1XFO A;  3P2H A;  2ZEP A;  3TFY A;  1VF7 A;  1Z8T A;  3A8I A;  4XN0 A;  2CIJ A;  4C43 A;  4Y49 B;  3R95 A;  4ZCM A;  1ZG7 A;  1UWY A;  1Z8L A;  1OB5 A;  1T6Z A;  5JH9 A;  3NA6 A;  1KTV A;  4LUA A;  4K3N A;  1G7C A;  3S6F A;  2F43 A;  4J0Q A;  1J4J A;  3PFE A;  3AVY A;  2QMU A;  4M85 A;  3PBE A;  3RNZ A;  3GUX A;  3NFZ A;  2HV2 A;  3FEC A;  2CBX A;  2ZEG A;  1XJO A;  2V8V A;  4XN3 A;  2PJA A;  3EO4 A;  2G9D A;  1XMT A;  4M2L A;  1Z9U A;  2V8H A;  3V7A A;  3H5Z A;  2VYQ A;  4PGO A;  3B3W A;  3VNU A;  3T90 A;  4FUU A;  4P26 A;  4P6V F;  3IFE A;  4UIA A;  5TV2 A;  4XLH A;  3CXS A;  1BPN A;  5J8F A;  4C0S A;  1HVX A;  2GK7 A;  4LBW A;  4B5O A;  4NGM A;  4K1X A;  3LO8 A;  3GVJ A;  4YRH A;  2CNT A;  3DNS A;  3D26 A;  3QAH A;  4PXD A;  3G6E B;  3CCV B;  5KW9 A;  1PJ7 A;  1CP7 A;  4CAV A;  4NXY A;  2RC6 A;  1A2Z A;  3WNC A;  3VH9 A;  4FD5 A;  3CB4 A;  3IGR A;  3P26 A;  2PQ8 A;  2QEX B;  1V0E A;  1X10 A;  2NYQ A;  3FJU A;  1QSN A;  3PEI A;  2Z3M A;  3GVL A;  3PUN A;  5HVF A;  2CF4 A;  2PJ0 A;  3W2G A;  1F20 A;  1R5B A;  4IHM A;  1VQK B;  2KCW A;  3VWE A;  2C77 A;  3PVD A;  2J8M A;  3CP8 A;  3AVV A;  3FXT A;  3KQX A;  5JQ4 A;  3U6K A;  1XEB A;  4P44 A;  4A95 A;  3FYN A;  1YHQ B;  3IU1 A;  3L2N A;  3DLJ A;  1WOS A;  1JNY A;  4PC2 A;  4PC3 A;  2GJR A;  1S7L A;  1IU8 A;  1VQM B;  3VR6 A;  1FNM A;  1BJK A;  4FXU A;  1D8T A;  2ZL6 A;  4E0F A;  1QST A;  2GLF A;  2CNM A;  5HKK A;  5D29 A;  5AN9 A;  2J8R A;  5KTC A;  3ISX A;  4E2A A;  2DXQ A;  4PXB A;  4GXH A;  1AMP A;  4ZCL A;  1ZLH A;  4Q38 A;  4II2 A;  3ISZ A;  4HE6 A;  2PSW A;  1F57 A;  2IMO A;  1VQ9 B;  4N3G A;  2ZED A;  1N08 A;  1W87 A;  2PJ6 A;  3LQE A;  3R9F A;  3LAC A;  1S7N A;  3RBU A;  1VQ6 B;  3SEJ A;  1CM0 A;  2CY2 A;  2BSA A;  2F7V A;  1M90 D;  2XEJ A;  2B5G B;  4NFR A;  3BXM A;  4A37 A;  4PC7 A;  5F47 A;  2WZN A;  1WOR A;  1EFU A;  2GFQ A;  2OZG A;  5DS0 A;  4X2T A;  4NBS A;  2FX3 A;  3ASS A;  1Q2Y A;  1SKY B;  2PJ3 A;  4RI1 A;  2DET A;  1Q9S A;  4RLZ A;  2QGG A;  1IID A;  4P12 A;  2CND A;  4QV2 A;  1W0J A;  3MCA A;  3OAA A;  4M0L A;  5FNZ A;  4Z65 A;  1IIC A;  1IB0 A;  3AST A;  2QYV A;  2F4N A;  2G3A A;  4Z4T A;  4A32 A;  2ZXI A;  2FXF A;  4NGQ A;  3FPK A;  2RFH A;  3CMA B;  4ZGQ B;  2BM1 A;  3LD2 A;  1S5K A;  4J3G A;  4CYQ A;  5K8O A;  4MHN A;  1FRN A;  3D66 A;  3PP9 A;  1TUI A;  2D74 A;  3S9N A;  1Q81 D;  2B5G A;  3QFT A;  4E8O A;  1WWZ A;  2DYI A;  4ACB A;  1FNO A;  3H9N A;  1S0U A;  1OB2 A;  2B3U A;  2EO8 A;  2GJK A;  2VXK A;  4NGN A;  1EFT A;  1PJ5 A;  1Y9K A;  2PRB A;  2PJ4 A;  4XMY A;  3CCM B;  2CNS A;  2AFU A;  2FT0 A;  1FRQ A;  1WOO A;  2QN6 A;  2ZZG A;  1W2B B;  2QML A;  4Y9R A;  3DR8 A;  1FY7 A;  4OKO A;  1XE1 A;  3OJW A;  4ZYQ A;  2LZJ A;  1IGB A;  2ZBV A;  4P25 A;  2V8G A;  1Y7E A;  2D4O A;  4DNC A;  2JEV A;  2Z10 A;  1KUX A;  1YI2 B;  1PJ6 A;  2XNJ A;  1Z8W A;  2EWB A;  4G1B A;  4AVB A;  2KVO A;  2PJ8 A;  3B78 A;  4KSF A;  4CAW A;  1NB0 A;  4XON A;  1ZLI A;  2J8N A;  5KNL A;  3AVW A;  3D7F A;  2OOT A;  1QSR A;  2B4D B;  4E0A A;  4OAE A;  3VAT A;  4OC5 A;  3FEE A;  3LVB A;  5H5J A;  4A31 A;  1ZM3 A;  3FKS A;  3ZZT A;  2IJZ A;  2C2W A;  1I8D A;  4NF1 A;  2VNI A;  2B58 A;  4TMZ A;  4MMO A;  4KOY A;  1Q2C A;  1UFH A;  1S60 A;  2X8K A;  1FNC A;  4UFV A;  1SKQ A;  3D3S A;  4A30 A;  4B10 A;  2ZEO A;  4WWV A;  3CPW B;  3J81 k;  3OZV A;  2PJ1 A;  2OBR A;  4M6G A;  4C2Z A;  4AF7 A;  2ZW5 A;  4Z4R A;  4B3G A;  1T6X A;  4EVY A;  2M5S A;  2ZEM A;  5HMN A;  1UD6 A;  2BCO A;  2C6P A;  5E96 A;  2XEF A;  4X7C A;  3KR4 A;  2ZW4 A;  3PA1 A;  4B4D A;  4OC3 A;  3Q38 A;  3ZIA A;  3FVL A;  1Y0Y A;  1YW4 A;  3SJG A;  2B7B A;  1VQ5 B;  2C4U A;  2RB7 A;  1NBM A;  4CYO A;  4F7D A;  4MFK A;  3B2Y A;  2GJP A;  2J9A A;  1Z5R A;  5IYR A;  4LX9 A;  5LRJ A;  2HDN B;  5C88 A;  1I18 A;  1ARL A;  3NH8 A;  4L89 A;  4MFZ A;  1Y0R A;  2ABZ A;  2DPT A;  3FH4 A;  4KS9 A;  3E20 A;  4TMV A;  4ROX A;  2YNC A;  3F8K A;  4RD4 A;  3H8F A;  4A94 A;  4P2N A;  5E6T A;  7CPA A;  1GYT A;  1L0C A;  1DAR A;  2QIR A;  5G22 A;  2Q51 A;  4MFL A;  2XEI A;  1XB2 A;  4G7W A;  2BF4 A;  1OGI A;  4M4S A;  2XEX A;  2GE3 A;  1UD4 A;  3NE8 A;  4CGP A;  2O4H A;  4JYW A;  1CBX A;  5H59 A;  4DQL A;  2ZEL A;  3FIX A;  4YWY A;  2XGJ A;  2XNC A;  4YXW A;  3T56 B;  4ZGN B;  4YAL A;  4K30 A;  1N8R D;  1WSV A;  2VBQ A;  1R57 A;  2YWG A;  3RO0 A;  3VWD A;  1VKC A;  1KRH A;  2R6H A;  2GRE A;  4MFQ A;  1NSA A;  3A8K A;  3H94 A;  4F6A A;  5DSZ A;  3ONY A;  2PJB A;  5GV8 A;  5G1Z A;  3KQZ A;  4R3K A;  3CCS B;  4C7H A;  4TMT A;  2Z3O A;  3LOD A;  4KOX A;  2ZOG A;  3OEE A;  2ZXH A;  3WYA A;  1LCP A;  3CMM A;  3OKX A; 
#chains in the Genus database with same CATH homology
 1BLL E;  3KGQ A;  2GU2 A;  2V8H A;  4ZI6 A;  1DE4 C;  4PQA A;  3B3W A;  4FUU A;  2CTC A;  4P45 A;  2C6G A;  3IFE A;  4UIA A;  5IB9 A;  3RAM A;  1BPN A;  3V38 A;  3KI9 A;  4NGM A;  1F2O A;  4ZX8 A;  2F8H A;  4OC0 A;  3NH4 A;  2I3C A;  2CTB A;  3H8G A;  4PXD A;  1TKH A;  1CP7 A;  3VH9 A;  2NYQ A;  4P4J A;  3FJU A;  3RZA A;  3PEI A;  4ZY0 A;  3S9L A;  2FVG A;  5HVF A;  2ZEE A;  2CF4 A;  2PJ0 A;  4B6Z A;  3SI0 A;  4IHM A;  4UEE A;  4JZ0 A;  4MHP A;  5ELY A;  3KQX A;  4ZY2 A;  3MRU A;  2XEG A;  4F9V A;  4P44 A;  4FBE A;  2PVW A;  4O23 A;  3PRT A;  3L2N A;  4MCR A;  3DLJ A;  3TC8 A;  1EE3 P;  1YLO A;  3IO1 A;  4PXC A;  4R6T A;  3WC6 A;  2ZEN A;  5LYF A;  2EK8 A;  1TXR A;  2HB6 A;  3B35 A;  3WAB A;  3FED A;  2Q43 A;  3PBB A;  1LFW A;  3IWW A;  4P10 A;  3SJX A;  4X8I A;  3K9T A;  3BHX A;  4P4E A;  3B7I A;  2GLF A;  2ZOF A;  5D29 A;  1CP6 A;  4R7M A;  4P4F A;  3D7H A;  3ISX A;  3TX8 A;  2PCU A;  2QJ8 A;  4GM5 A;  4PXB A;  3PB8 X;  3SI1 A;  1LAM A;  1AMP A;  5HVG A;  1ZLH A;  1YSJ A;  3ISZ A;  1TF9 A;  1HEE A;  3SJF A;  3WT4 A;  2HC9 A;  3JRU A;  1F57 A;  2IMO A;  4KSI A;  4EFD A;  1JQG A;  2ZED A;  1ELM P;  2PJ6 A;  2V77 A;  3B3S A;  4LQG A;  3N5F A;  4A38 A;  3RBU A;  3KHZ A;  1ELL P;  2F7V A;  3PFO A;  1VHE A;  2XEJ A;  3LMS A;  4NFR A;  4ZY1 A;  2BOA A;  3BXM A;  4A37 A;  4UEF A;  2C1C A;  2WZN A;  4FWU A;  3KAS A;  1R43 A;  3LWU A;  4NJR A;  5DS0 A;  4X2T A;  4RUH A;  4X3R A;  3D4U A;  4OC4 A;  5JM6 A;  3KHX A;  5CPA A;  5D8N A;  2PJ3 A;  4IK2 A;  1R3N A;  1ZG9 A;  2AFX A;  4WJB A;  5LRG A;  4Z65 A;  1LAN A;  6CPA A;  3CT9 A;  2VL1 A;  2ZEH A;  4DJL A;  5K8M A;  2QYV A;  1OBR A;  5LRK A;  3IC1 A;  2ZEF A;  4NGQ A;  3KL9 A;  2RFH A;  1BAV A;  1IY7 A;  8CPA A;  3SJE A;  3QNV A;  1M4L A;  2C6C A;  2QVP A;  3BI1 A;  4DYO A;  2GLJ A;  1HDQ A;  2PJ9 A;  5K8O A;  4MHN A;  1AYE A;  2ANP A;  3D66 A;  1TF8 A;  1CPS A;  4MXU A;  1BPM A;  1CPX A;  2BO9 A;  3S9N A;  1TKF A;  1FNO A;  3H8E A;  4NGR A;  4CPA A;  4NGN A;  4F8Z A;  4MRI A;  1PYT B;  2PJ4 A;  3B3T A;  2AFU A;  2PJC A;  3IEH A;  5F09 A;  3FX6 A;  1ZG8 A;  2AFO A;  4OKO A;  4OME A;  3V7Z A;  4Q7A A;  4ZYQ A;  2EK9 A;  1IGB A;  2V8D A;  5JGF A;  4P4I A;  3B3C A;  2V8G A;  1Y7E A;  4IAV A;  5LYL A;  1YW6 A;  3KZW A;  5THW A;  3I1U A;  2AFW A;  2PIZ A;  2DEA A;  4PXE A;  2NSM A;  3D67 A;  2EWB A;  2AFM A;  1YME A;  2PVV A;  3IIB A;  2PJ8 A;  4W9Y A;  4ONW A;  4UIB A;  1ZLI A;  4F9U A;  3D7F A;  2OOT A;  3S9M A;  3CDX A;  3CPX A;  2JBJ A;  1KWM A;  3VAT A;  1H8L A;  4OC5 A;  1F2P A;  4OIW A;  3FEE A;  1QQ9 A;  4G1P A;  4UF4 A;  4FAI A;  3KR5 A;  3PB4 X;  1CG2 A;  2OR4 A;  3K2K A;  3T8W A;  2Q4Z A;  5J1Q A;  2IJZ A;  3CPA A;  3GLJ A;  4MMO A;  2PJ7 A;  2IQ6 A;  4TNU A;  3VAR A;  1TKJ A;  4MHZ A;  4EME A;  2ZEO A;  4WWV A;  3BI0 A;  2JEW A;  2PJ1 A;  3D7G A;  3IJ3 A;  4EWT A;  1HDU A;  1VGY A;  3DGV A;  4OP4 A;  2AFS A;  1Z2L A;  2PE3 A;  2ZEM A;  5K8N A;  2BCO A;  3PB7 X;  2C6P A;  2XEF A;  1LOK A;  3KR4 A;  4MCS A;  4MCP A;  4OC3 A;  5LYD A;  4UEZ A;  3FVL A;  4OID A;  1RTQ A;  1Y0Y A;  1YW4 A;  3SJG A;  1FT7 A;  2PJ2 A;  2JBK A;  2WYR A;  4PPZ A;  4OC1 A;  4A39 A;  4ZX9 A;  3PB6 X;  2RB7 A;  1LAP A;  1XBU A;  1XMB A;  3B2Y A;  3MN8 A;  4NGS A;  2J9A A;  4YU9 A;  1Z5R A;  5LRJ A;  5I4M A;  4P4B A;  2AFZ A;  1ARL A;  3NH8 A;  3HLP A;  1PCA A;  5HVH A;  4MCQ A;  1Y0R A;  2ABZ A;  3FH4 A;  1XRY A;  3NH5 A;  3D7D A;  3H8F A;  4A94 A;  1Q7L A;  1DTD A;  5LYI A;  7CPA A;  1GYT A;  2Q51 A;  4DUK A;  4AXV A;  2XEI A;  4NGP A;  3SI2 A;  3WC7 A;  2PIY A;  4R76 A;  3B3V A;  2O4H A;  4H2K A;  5CBM A;  4JYW A;  4P6Y A;  1VHO A;  1CBX A;  3PB9 X;  2ZEL A;  4R8F A;  4TWE A;  4YWY A;  2PJ5 A;  3FMC A;  1XFO A;  2ZEP A;  4NJQ A;  2O53 A;  5HXD A;  1ARM A;  2CIJ A;  5K8P A;  2GRE A;  3D68 A;  1NSA A;  4BD9 A;  2PRQ A;  1ZG7 A;  1QMU A;  1UWY A;  1Z8L A;  4MHY A;  3FF3 A;  2PJB A;  3HUV A;  5JH9 A;  3NA6 A;  3WC5 A;  4NGT A;  3KQZ A;  4K3N A;  2POK A;  4OC2 A;  1CX8 A;  3PFE A;  1VIX A;  3GB0 A;  3PBE A;  3GUX A;  3NFZ A;  2ZOG A;  3FEC A;  2V8V A;  1XJO A;  2ZEG A;  2PJA A;  2G9D A;  1LCP A;  4P4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...