2WZNA

3d structure of tet3 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
SMVDWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPPHLRIDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINKEGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 354AA LONG HYPOTHETICAL OPERON PROTEIN FRV
publication title The Structural and Biochemical Characterizations of a Novel Tet Peptidase Complex from Pyrococcus Horikoshii Reveal an Integrated Peptide Degradation System in Hyperthermophilic Archaea.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 107
structure length 338
sequence length 347
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2wznA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2wznA01
2Q4ZA 3JRUA 3WT4A 3LWUA 3B7IA 2ZEPA 2PJ1A 3RZAA 2PJ0A 4UIAA 1BPNA 4TWEA 2HC9A 2JBKA 2V8GA 3IC1A 3IEHA 3FEEA 1CPSA 5IB9A 2AFXA 5K8NA 3KL9A 2V8DA 2AFMA 1Z8LA 2V8HA 2J9AA 3PB9X 1UWYA 2POKA 1KWMA 2ZEGA 2EK8A 3B35A 4IK2A 3WC7A 3VH9A 2PJ6A 5JGFA 1FNOA 2PJ2A 3IIBA 2AFZA 2PIZA 3D67A 2ZENA 5HXDA 1CBXA 1HDUA 2PJCA 4R7MA 1VHOA 3H8EA 4WWVA 4MCQA 4H2KA 4MRIA 4ZYQA 3PBEA 1AMPA 1R3NA 4MHZA 3D7GA 4R8FA 3CPXA 2XEIA 4NJQA 3KR5A 4P10A 2WYRA 2G9DA 3SJGA 4RUHA 4P4FA 3PB7X 2GLJA 3DGVA 3D7HA 2XEJA 4NGTA 2I3CA 4EMEA 4O23A 4YWYA 3SI0A 2IQ6A 2C1CA 2OR4A 3WC5A 2AFSA 3BHXA 3WC6A 4X8IA 4PXBA 2QJ8A 1OBRA 1XFOA 1XJOA 2PRQA 1FT7A 3PB8X 1ARLA 5K8MA 4EFDA 1TKJA 3H8GA 1Y0RA 5F09A 2PJ5A 4A38A 2ZOGA 1Y0YA 4NGPA 1F57A 1AYEA 5LYIA 1ZG8A 3DLJA 3B3CA 1YW6A 5LRKA 2F8HA 4PXCA 1CG2A 1DTDA 4OC3A 3D7DA 1TF9A 1H8LA 3CT9A 3KZWA 4F9VA 1HEEA 1ZG9A 4TNUA 4NJRA 2CIJA 4OC5A 2DEAA 5THWA 4UEZA 4PQAA 3NH5A 3D66A 2ZELA 7CPAA 1IY7A 3IO1A 2BOAA 2BO9A 3VATA 3VARA 4YU9A 5CPAA 5ELYA 8CPAA 4A39A 3PFOA 4MMOA 3B3SA 3GB0A 3PBBA 3D68A 1LFWA 3FEDA 2RB7A 4OIWA 4DUKA 4UEFA 1Y7EA 3FVLA 3GUXA 4R76A 1R43A 3NH4A 2JBJA 3FMCA 4W9YA 4X2TA 5HVGA 2NYQA 3TX8A 2HB6A 1VGYA 3GLJA 1ZLHA 2ZEEA 4IAVA 3IFEA 4PXEA 4DYOA 4LQGA 3I1UA 1Z2LA 1ZG7A 2PJ3A 2PVWA 3PRTA 5D8NA 2OOTA 1CPXA 1F2OA 2O4HA 4NGRA 1IGBA 1TF8A 4CPAA 3BI1A 1YLOA 4OC1A 1YMEA 2CTCA 3NA6A 4P4BA 4WJBA 1YSJA 1GYTA 4NGMA 5HVFA 2C6PA 1LAMA 4JYWA 4Q7AA 3HLPA 4ZY0A 5DS0A 3V7ZA 4PPZA 5K8OA 4MCSA 3S9NA 2ZEDA 1PCAA 3KR4A 1LAPA 2PE3A 1LOKA 1EE3P 1ZLIA 2QVPA 3NH8A 3D4UA 3ISXA 1Z5RA 3SI1A 4P45A 4OC2A 4F8ZA 3K9TA 5K8PA 1LCPA 3S9LA 2ANPA 4MHYA 3WABA 4ZI6A 4P4IA 2V77A 2IMOA 1BAVA 1ELLP 4P4JA 1CP7A 2Q43A 5LRJA 2PIYA 3NFZA 1XRYA 4A94A 3TC8A 1HDQA 3RBUA 5LYLA 4UIBA 6CPAA 2ZEFA 3FJUA 1Q7LA 3QNVA 4NGQA 1LANA 2QYVA 1BPMA 2PJBA 3IJ3A 3B2YA 3CPAA 4OKOA 2EWBA 3CDXA 2CF4A 1NSAA 4GM5A 2GLFA 5J1QA 4A37A 2ABZA 5LYDA 3KQZA 1XMBA 3MRUA 3PB4X 4IHMA 2O53A 3L2NA 1TXRA 3PFEA 1XBUA 2XEGA 3S9MA 4NGNA 5CBMA 1JQGA 3K2KA 2VL1A 2RFHA 5JM6A 3SI2A 2V8VA 5HVHA 4P4EA 4B6ZA 1TKFA 5LRGA 2EK9A 3IWWA 4ZX9A 3T8WA 1VIXA 1M4LA 3B3WA 1RTQA 2F7VA 3H8FA 5D29A 3KI9A 2ZEOA 2ZEMA 4DJLA 2PJ7A 2ZOFA 4ZY1A 4MHPA 4NFRA 4F9UA 4OIDA 2AFOA 2WZNA 2PJ9A 4G1PA 3SJXA 4UEEA 4FUUA 4BD9A 4P4DA 2CTBA 3V38A 2JEWA 3HUVA 1TKHA 3KHZA 3KASA 4FBEA 4P44A 1VHEA 1QQ9A 4AXVA 2PJAA 3PB6X 5LYFA 3BI0A 4FAIA 4X3RA 3PEIA 2Q51A 3SJFA 3FECA 5JH9A 2PCUA 4ONWA 1ARMA 1YW4A 4ZX8A 1BLLE 4MCRA 4OMEA 3LMSA 2C6CA 2BCOA 2PVVA 4MHNA 3MN8A 4OC0A 3SJEA 1CX8A 3KQXA 2XEFA 2IJZA 2AFUA 2PJ8A 3FF3A 3KGQA 3FH4A 4Z65A 2FVGA 2NSMA 4FWUA 5I4MA 3FX6A 3D7FA 1PYTB 4PXDA 4OC4A 1ELMP 2C6GA 4UF4A 4JZ0A 3N5FA 3BXMA 2AFWA 2GREA 4R6TA 4MXUA 1QMUA 3ISZA 4K3NA 2ZEHA 4EWTA 2PJ4A 4NGSA 2GU2A 3B3TA 3KHXA 1DE4C 4P6YA 1F2PA 4MCPA 3RAMA 1CP6A 4KSIA 3B3VA 4ZY2A 4OP4A
chains in the Genus database with same CATH superfamily
4C7HA 3LWUA 2EIXA 3CCLB 4UFWA 1E3XA 1BPNA 4TWEA 1NJID 4QVTA 1V0CA 3IC1A 2PSWA 1WP6A 1CPSA 5IB9A 4CRYB 4XPDC 2R9VA 4G1VA 2IL4A 2V8DA 3ZBTA 1I7PA 3F8KA 4IW3B 2J8RA 4G6IA 3G4SB 1M90D 3H94A 3Q6RA 3ZIAA 4PK2A 1S7NA 1VQ5B 4MY0A 1QH0A 5HH1A 2DCUA 5IYRA 4C2XA 5H84A 1CM0A 4KVME 4ZV4A 3D67A 4Y49B 5HXDA 1HDUA 5IYNA 2PJCA 3IGRA 4G7WA 4WWVA 4YEJA 2QTZA 4NNJA 4P6VF 4JXQA 2B5OA 2OYNA 3PP9A 4KOSA 5AG4A 4ZGQB 4MHZA 4DQKA 2Q44A 4Q7JB 3CPXA 4UAJA 3RY8A 1UD6A 4YXWA 2VNHA 1XEBA 2WYRA 3SJGA 4RUHA 1FX0A 1XE1A 2XNCA 2X85A 2GLJA 3DGVA 2WUUA 5AG5A 2OTLB 1Z4EA 4EMEA 3JQQA 2Z3NA 2B5GB 4MI4A 2QJ8A 3D2MA 4H89A 1H8EA 1JB9A 1I12A 2G0BA 3P26A 2WSSA 2BM1A 2GQFA 3E1YE 4A38A 2A4NA 2QMUA 4YAFA 3T53B 1SM4A 3JQPA 2P6FA 1OB0A 2OBTA 1DDIA 5BSYA 1ZG8A 1K28D 1YW6A 3IU2A 2F8HA 1CG2A 1E3ZA 3JVNA 4OC3A 3D7DA 3N7ZA 3CT9A 3R6KA 2BV3A 4F9VA 1ZG9A 4X7EA 2CIJA 4IF5A 2EBJA 2X3UA 3Q3AA 3FB3A 4PQAA 1JJ2B 2QA4B 2X7BA 1HVXA 2QEXB 2FX3A 4M2LA 1HA3A 1NDHA 2F1MA 2BOAA 2JJ1A 3S6GA 2B5GA 3VARA 3LD2A 4YU9A 4DK0A 1ZM9A 4YAUA 2F43A 2E1BA 1ON0A 3ZPNA 4P26A 4MMOA 1W2BB 3B3SA 2QGGA 3GB0A 3PBBA 3FXTA 1VQ9B 4RM0A 4QVAA 4MFQA 1G7RA 2BL1A 4KKTA 1X12A 3CC2B 2VNJA 1UMKA 1WTHD 1R43A 1R5NA 5IX3A 3FYNA 3FMCA 4M6GA 2DXQA 2NYQA 2HB6A 1ZM2A 1VGYA 3GLJA 1ZLHA 4PXEA 4NCNA 1E1RA 2V7VA 4HE5A 1ZG7A 2DEUA 3UY5A 4C2YA 3MMPA 4B3XA 1K73D 4K1XA 5CNPA 5D8NA 1VQ7B 2WPXA 4YGOA 2ZBUA 1F2OA 2O4HA 5C88A 4II3A 1TF8A 4TSFA 4LX9A 4BINA 3NA6A 2CTCA 4LQ6A 4OADA 3BJ8A 4U9ZA 5GV7A 3G3SA 3W2EA 2ATRA 5AN9A 3AVWA 1LAMA 2C6PA 1SQHA 4ZY0A 4PPZA 4XMYA 5K8OA 4Y49C 2ZEDA 3NE7A 1UD3A 2GK6A 2QVPA 2G3TA 3D4UA 3LQEA 5I0CA 5H86A 3FKSA 1D8TA 2BSWA 4OC2A 4JMQA 1B6BA 3IWEA 4GXHA 3K9TA 5F49A 3S9LA 4MHYA 5KSWB 3WABA 4ORFA 1WPCA 4P4IA 2V77A 3CXQA 1ELLP 2LZJA 4P3IA 4C0SA 1CP7A 3T90A 5J8FA 2VYQA 4UCNA 4TT3A 5LRJA 1HDQA 3RBUA 2W6JA 1WDTA 1A2ZA 4KOXA 1IOIA 4NCZA 5LYLA 1PJ5A 4AG9A 2B7BA 4UIBA 1YR0A 2OU2A 6CPAA 2ZEFA 3AGPA 1Q7LA 2I79A 1S7KA 4NGQA 1LANA 2X8KA 4PC2A 2PJBA 4X7FA 3P27A 4FXUA 3VWDA 3PA2A 2J8NA 1V0FA 2FIWA 1XF8A 4RS2A 1AMOA 5FIUA 4KS9A 4GM5A 5J1QA 5G22A 2ABZA 3A35A 4DNRB 1FY7A 3KQZA 2F5IA 5LYDA 1Q7YD 1JWQA 3SKBA 3L2NA 5E6TA 3QFSA 4UFVA 3LODA 3ONYA 1OB2A 3S9MA 4M0LA 2VL1A 4TMXA 5KTAA 3BY1A 4UCPA 3IWWA 4KLVA 3WBJA 3T8WA 1VQLB 4N3GA 1CQXA 3H8FA 3BH4A 3F5BA 3VWEA 2ZEOA 3PZJA 2QE7A 2OB0A 3G8WA 4P9SA 1EFUA 4PGOA 2OZHA 2QDXA 4M53A 4TMTA 4E0AA 2GANA 4BD9A 3H9NA 4AF7A 3CCUB 3EFAA 1S0UA 2CTBA 3V38A 3BY2A 3KASA 3QB8A 1BX0A 3TO9A 4P25A 1QQ9A 3VO1A 2B7CA 1VQ6B 4AVBA 2Z3LA 4CAFA 4ACAA 2JEVA 3FECA 4MHDA 3W6SA 3G05A 4ONWA 2PDOA 3SEJA 2YWHA 1BLLE 4MCRA 3W2IA 2ZW4A 4MHNA 3GSIA 1ZM3A 2P0WA 2X53S 1CX8A 1GAWA 1OGIA 3VNUA 4J0QA 2AFUA 4Z65A 1Z8XA 2NSMA 2C2WA 4RLZA 4PABA 4FWUA 3ASSA 3FX6A 1IHMA 3LNNA 2REFA 1E64A 2Q7SA 2WR8A 4Z4ZA 2C6GA 4JZ0A 4B5PB 1TIQA 2JDIA 2X6WA 4KKUA 4MXUA 3ISZA 1RQPA 4X07A 3B3TA 3CCQB 3GVKA 2ZL6A 3RAMA 4Z4WA 1CP6A 1YREA 4HIZA 3B3VA 4MY3A 3SLNA 2PR8A 4OP4A 2EVNA 2ZZFA 1MJBA 2FE7A 2CK3A 2GJKA 2WZPP 2PJ1A 3R1KA 3RZAA 2PJ0A 4UIAA 2V7WA 4P12A 2HC9A 1EP2B 2JBKA 3BCFA 5ISVA 1K9MD 2VQYA 4CGLA 3KL9A 3PA1A 1UD4A 2V8HA 4KOYA 3Q38A 5FA6A 2DETA 3WBKA 2J9AA 4B5PA 3OAAA 4ZCIA 1UWYA 3U2QA 2VJJA 2POKA 4KZTA 4XOTA 1FNCA 2PJ6A 4RD3A 3TO6A 2PIZA 2ZENA 3A3BA 4CGMA 1M1KD 4XLCA 3H8EA 3W5HA 4MCQA 2W6IA 4QV2A 2OH1A 1H85A 2ZW6A 3IU1A 4AVAA 1WSVA 3PGPA 4R8FA 2XEIA 3KEWA 2OZUA 2XGJA 1OB5A 4P10A 2ZTNA 3W2HA 4P4FA 4OPVA 5HMNA 2H5MA 3WNCA 2DERA 4PC6A 2PC1A 1QVGB 4YWYA 2IQ6A 5KTDA 3WC5A 2NPFA 1EFTA 1XFOA 1XJOA 2PRQA 4B47A 2G3AA 4Z4RA 1ARLA 4EFDA 1V5VA 3DSBA 2HUZA 1G7TA 2J8MA 4X06A 4ZCLA 2PJ5A 4RCZA 2ZOGA 4C2ZA 2VBTA 3ZC3A 4CGNA 5KW9A 1Y0YA 4NGPA 3S6FA 4RCYA 3GIRA 1YHQB 5LYIA 1Z8TA 3B3CA 3FJOA 1Q81D 4HKFA 1W35A 1DTDA 3FIXA 2AHOA 3SLDA 4B3FX 4TNUA 2X6XA 1M4IA 4YRHA 4LBWA 1KUYA 2C78A 2P3MA 2AJ6A 2WSAA 3I3GA 4CAEA 3QE2A 3PUNA 2BO9A 3EY5A 4YALA 5ELYA 2XOKA 5CPAA 1VQ8B 8CPAA 4F6AA 3PFOA 2KVOA 4KSFA 1F20A 2ZPAA 2KCWA 4Z4VA 2HCJB 3D2PA 1LFWA 3FEDA 4OIWA 1Y7EA 1KRHA 4QC6A 3FPKA 2EFGA 2BPOA 2Q6OA 4LBYA 3NH4A 4MFKA 4R76A 2C27A 3OEEA 3ZJ0A 3JUWA 3VMFA 4X2TA 4G7XA 2EUIA 4JXRA 4MYTA 1RO5A 2Q7BA 2PLFA 3W2GA 2ZEEA 3CCSB 4QVJA 3IFEA 1A8PA 4FD5A 4LQGA 4UZFA 4B10A 4C7IA 1YVOA 3CC4B 2F4NA 3I1UA 1NB9A 1HZEA 4KOVA 1R5OA 2GPJA 3OW7A 2PVWA 3PRTA 5L46A 1QFJA 2ZL5A 1YJ9B 1IGBA 2CNDA 3WXMA 1YLOA 2Q4YA 4OC1A 4EH1A 1YITB 4L8JA 2FL4A 1N08A 5A28A 3AVTA 1WK4A 4Z4YA 4FD4A 4JYWA 1U6MA 1IB0A 2JN9A 4Q7AA 1YI2B 5DS0A 3LACA 3FPPA 1BMFA 1NE9A 1T5EA 1LAPA 1VLYA 1LOKA 1ZLIA 5EMIA 2CC2A 1OZPA 2M5SA 3ZZ0A 3GY9A 2OBSA 2D3LA 1WOSA 3OJXA 3SI1A 1M1DA 2GIVA 4RD4A 4M3SA 4P45A 4ROXA 4E8OA 3EXNA 3F0AA 5B6IA 1TLLA 1M44A 4Z4TA 5IYWA 1WORA 4Y9UA 3OP1A 3Q39A 4XONA 4UCMA 2VEZA 3CPWB 3PENA 2CRVA 2PIYA 3NFZA 3TC8A 1L0CA 3ASRA 5JQ4A 5F4OA 4K30A 2ZXVA 1D2EA 2FIAA 4R87A 1I1DA 2OZGA 1PUAA 1YQEA 4OKOA 2YNCC 3S6KA 4CAWA 1NSAA 4NXYA 2ZITA 4A37A 3RYOA 1BPLA 3MRUA 3PB4X 2RC4A 2O53A 1TXRA 3FBUA 3OW2B 4B13A 1F60A 2OK8A 1IB1E 1FRQA 2Z6BD 4HE6A 1JQGA 3K2KA 3Q6QA 3VR6A 5JM6A 5HVHA 1E1QA 1TKFA 2EK9A 4ZX9A 4OOVA 4PAAA 2BUEA 2BM0A 1ZUNB 3ZZUA 5D29A 1S4MA 2C5BA 1XIXA 1CNFA 2PJ7A 1S72B 1Z4RA 5FO1A 3E0KA 4CYQA 4TMWA 4U5YA 5J8CA 3K9UA 3OZVA 2OK7A 2PJ9A 1GJRA 4XNFA 4XLFA 5AG7A 5F46A 3KKWA 5J3OA 1H42A 1Z9UA 5GCNA 3SJXA 4UEEA 4CYOA 4B12A 3HUVA 1QGAA 4FBEA 4P44A 4A30A 4CAVA 2WJVA 4PK3A 1QVFB 3PEIA 2Q51A 3MCAA 2X6YA 4X7DA 3MGDA 3LMSA 4RD6A 2C6CA 1BX1A 3VO2A 2PVVA 4QFMA 2V4DA 1KZFA 3T56B 1KJZA 2C5HA 4DK1A 5IB0A 3FF3A 3KGQA 3OFNA 1W34A 1EWYA 1UD5A 3CW2A 2HMAA 5H5JA 1DG1G 2DOGA 1W87A 1SKYB 3N5FA 1WSRA 2FSRA 3BXMA 2BN4A 2Q6KA 2Z3OA 1E43A 3MHPA 2AFWA 2XNJA 2BEIA 1QUEA 5H59A 2ZEHA 4EWTA 3WR7A 2WPWA 2B3UA 1N0UA 2GU2A 3CC7B 1S7LA 3A9LA 3KHXA 1DE4C 1DARA 4Q38A 2I1LA 5EBVA 2HDNB 2Q6IA 1N0VC 2VXKA 4PSXA 1P4MA 1ZM4A 3VNVA 1TUIA 3W91A 1G7CA 2Q04A 3JRUA 3WT4A 4PSWA 2CNMA 4UWJA 3DR8A 2ZEPA 3RO0A 2V8GA 5GV8A 5JPHA 2AFXA 3EO4A 5K8NA 1CNEA 1Z8LA 2AFMA 3R9EA 1IICA 1WWZA 5F47A 1COWA 4XLEA 3PB9X 1NSLA 3NE8A 4FN5A 4F0YA 1KWMA 2XZLA 2ZEGA 1T6ZA 2EK8A 3CCRB 3WC7A 4LC0A 4B11A 3I56B 2PJ2A 3IIBA 1B87A 4P3YA 4NF1A 2WJYA 3OPOA 1J4JA 4DQLA 1VQPB 1RXTA 1QG0A 2R6HA 4H9GA 1WOOA 4MRIA 1Y7RA 3TCVA 1R3NA 3D7GA 2BGIA 3TTHA 4UZEA 2R98A 4NJQA 2CW5A 1Q2DA 3OKXA 3PB7X 3LVBA 4XPLA 5F48A 2QECA 2R8VA 1VKCA 3CESA 3ASPA 3D7HA 1S60A 1KUXA 1VQ4B 3DR6A 2XEJA 1IYLA 4JD6A 4PC3A 3HAGA 4O23A 4A33A 3SI0A 1QSNA 2VZZA 1IIDA 3BHXA 4X8IA 5LMZA 1OBRA 4TKOB 4UFXA 1FT7A 3PB8X 1M4DA 4ONUA 1TKJA 2RC6A 1Y0RA 4QHYA 5F09A 1Q2CA 2XNDA 4FD6A 2FCKA 5G1ZA 1E63A 1GR1A 4OAEA 3R6JA 1VLOA 4LBZA 4M1KA 1EP3B 4P22A 3S6HA 3DLJA 5LRKA 4OPSA 3FRMA 4AVCA 4ACBA 4R71A 1TF9A 1H8LA 3KZWA 3B82A 2CXAA 1N71A 4WZKA 3FNCA 4NJRA 2B3VA 1DDGA 1BQEA 4YHBA 3P2FA 3TT2A 5THWA 3WNDA 3NH5A 1K4JA 1P4NA 7CPAA 1JA0A 3CCMB 2ZW7A 1FNMA 1VQNB 2D74A 3BCDA 4A31A 3VATA 3ZBUA 3P2HA 2Z3PA 1Q2YA 2PIAA 3D8PA 2ODFA 4A39A 3CZXA 4I49A 1E79A 3OEHA 4L89A 4KORA 3CB4A 3OWCA 4Y9RA 4OLLA 3QFTA 4DUKA 2B4BA 3FVLA 1BJKA 2GK7A 1NMTA 3TX8A 4B14A 4XM3A 2XZOA 3BLNA 3WQZA 2P6EA 3B78A 1VF7A 3I1FA 4IAVA 4DYOA 2JIZA 3A8JA 3U6BA 5KTCA 3W6XA 3TE4A 4AVZA 2QN6A 4R9MA 5A88A 4CPAA 3BI1A 1P0HA 3GYAA 1GHEA 1YSJA 2C4UA 1GYTA 2ZZGA 4X05A 2VJIA 2PMDA 1QSTA 2Z3KA 2VBVA 4LBVA 4MJ8A 3E20A 5IV0A 1TVCA 4WZEA 1KK1A 1UD8A 4Z1MA 4R57A 2AE6A 4MCSA 5TRDA 5EC4A 1N05A 4B5OA 1KC8D 4FD7A 3KR4A 1N07A 2PE3A 4ZGNB 4PC1A 5DWNA 3D26A 4KUBA 4BBHA 2VNKA 4ASUA 2HLDA 1Z5RA 5BSXA 4F8ZA 2PRBA 1VQMB 1FNBA 3CXSA 4P2NA 2V7QA 1G7SA 5K8PA 3OOCA 2C77A 4WQMA 4XORA 4XKWA 1BAVA 4P4JA 1N8RD 2Q4VA 2FXFA 1XRYA 4A94A 4MYUA 2VZYA 4H6ZA 4X0CA 4C43A 5JBQA 5E96A 2CNTA 3FJUA 3QNVA 1WOPA 3CP2A 4WZLA 2QYVA 5A8AA 2BVNA 4OOXA 4RPDA 2J7KA 3IJ3A 3B2YA 3CPAA 2CF4A 1B23P 2GLFA 3TOBA 1XB2A 5HZAA 1MJAA 1QSRA 4XN0A 1XMBA 4IHMA 4R3KA 2YNCA 3LQ6A 2ZZEA 1Q9SA 2I00A 1T6YA 4NGNA 1YJNB 1IJEA 5BWAB 3CXCB 1GVHA 2V8VA 5G20A 4B6ZA 5LRGA 4KOUA 1FNDA 1VIXA 2DPTA 4M4SA 3B3WA 3KI9A 2VI7A 4TMZA 2ZEMA 3AVYA 4MHPA 3WYAA 4MFJA 4RJLA 2AFOA 2YNDA 2WZNA 4E2AA 4M6HA 4AC9A 3GIUA 3CCVB 3JU4A 4FUUA 4P4DA 1TTTA 5KNLA 2JEWA 2Z10A 1T6XA 2Q6LA 3DNSA 1VHEA 4AXVA 2CY2A 5FO0A 4B43A 3PB6X 5LYFA 2E1RA 1K8AD 3V76A 4XOPA 5A89A 3BI0A 4DNCA 4FAIA 4X3RA 4NEXA 4C68A 3SJFA 4QBJA 3ZZIA 1AUGA 4KOWA 2PCUA 5F4MA 2PQ8A 3ASQA 2OBRA 1VQKB 4ZX8A 4KKSA 4OPOA 4QUSA 3GVJA 1EFRA 4EVYA 2FS5A 3MN8A 4OC0A 1KK3A 3SJEA 1KD1D 4YELA 1LRZA 1NBMA 4F0XA 1VQOB 4CRZB 4RDKA 2PJ8A 4CQJA 2FVGA 1Y9KA 4FK8A 3V7AA 3ASTA 3W5VA 1PYTB 3CXPA 1ELMP 4UF4A 3D3SA 4DNTB 1OHHA 4M6IA 4A2ZA 3EC4A 4GS4A 4A32A 1B2RA 5F4JA 1S7FA 1GO2A 2Q0YA 1QMUA 2DPSA 1CJWA 4RN7A 3SHPA 1BOBA 4B4DA 4UWIA 5HZBA 1F2PA 1KMHA 4P1VA 4MCPA 4YFJA 3JQRA 4KSIA 4ZY2A 4B44A 4XNHB 3JTKA 4RD0A 1S5KA 2JDCA 2Q4ZA 1RQRA 1Q86D 3B7IA 1KQSB 4XL9A 3T51B 3G6EB 3IEHA 5THXA 3FEEA 4RDJA 2V7TA 1QSOA 4CGPA 3QSYA 1Q82D 5HXBA 1D1NA 4X5KA 4XLHA 4UZUA 1I21A 5DSZA 1PU9A 5IYQA 2BGJA 3H4QA 5A27A 3B35A 2RC5A 4IK2A 3GVLA 2D4PA 3VH9A 5JGFA 1FNOA 1WU8A 1ZO0A 2CNSA 3ZZTA 2AFZA 3BJ7A 4XQFA 1EFCA 1CBXA 1KZLA 3CMMA 1NB0A 4CS0B 5J35A 4R7MA 1VHOA 1MK4A 1XE4A 3SXNA 3W5UA 2BF4A 3CCEB 4XKVA 4H2KA 1N06A 4ZYQA 3PBEA 2ZXIA 1AMPA 5IYPA 1BLIA 3ONUA 1QGZA 3CCJB 1Z8WA 3KR5A 4E0FA 2G9DA 2ZBVA 1M4GA 2DYIA 1IOFA 1OGJA 3W2FA 2HV2A 1PJ7A 1MJ9A 3WNBA 4NGTA 2I3CA 2JDDA 2C1CA 3H5ZA 2OR4A 2AFSA 3WC6A 4H6UA 2DY1A 4PXBA 1FDRA 1U2RA 1QGYA 4FWTA 2QTLA 3R9FA 1XQBA 1SKQA 5K8MA 3CD6B 4OP7A 3H8GA 4TMVA 2DIEA 1JNYA 5AGEA 4NSQA 5FNZA 3A1PA 2ZW5A 1VHSA 4KVXA 1F57A 1AYEA 2Z3MA 1YGHA 4A95A 2C4TA 1W9XA 1PJ6A 1R57A 4PXCA 4XPKA 4UA3A 5C82A 4OOSA 2ZTGA 4Q36A 1E62A 2OTJB 1MRZA 4Z4SA 1HEEA 4OC5A 1KUVA 4ZGYB 2DEAA 4UEZA 4B3GA 3D66A 3SJZA 2ZXHA 2ZELA 2CBXA 1IY7A 1W0KA 2D9RA 1IJFA 1EXMA 3IO1A 4KOTA 3B8HA 3U6KA 3BQJA 3AVVA 4JJXA 3R9GA 3D68A 1QSMA 2RB7A 2YWFA 4UEFA 5IK2A 4N3NA 3GUXA 3PUMA 2JBJA 4W9YA 5HVGA 4G1BA 3BNWA 3IWGA 4QUZA 4XNHC 4HNXB 2Z0ZA 4X7CA 2Z11A 3J81k 4KVOE 1Z2LA 1YIJB 2WPDA 4XLAA 2PJ3A 1S3ZA 4LUAA 2XEXA 2OOTA 4BMHA 1CPXA 3ZUGA 2VBQA 4BPRA 1YLEA 3A3GA 2ARHA 4II9A 4NGRA 1QUFA 2BMWA 1AIPA 1V0EA 1YMEA 4II2A 3CTAA 4P4BA 4U9YA 4WJBA 2B4DB 3DDDA 2DF5A 4NGMA 1QFYA 2ZL7A 5HVFA 3CRZA 2GE3A 4GQNA 3GQBA 3HLPA 2V7UA 4XN3A 2V7XA 4YAOA 3R96A 3V7ZA 1EP1B 3S9NA 1PCAA 2VBSA 1QFZA 1UD2A 1EE3P 2GJPA 3NH8A 2ZZQA 2B58A 3ISXA 3AGQA 5G21A 1YX2A 4B48A 2YGWA 4M85A 5DN6A 1Y9WA 2VBUA 5FVJA 2YNEA 3QAHA 5AG6A 1IU8A 3QFRA 4HNYB 1LCPA 3CMAB 1I18A 3WY9A 2ANPA 4Z4UA 4ZI6A 1KK2A 5DWMA 2YWEA 1YJWB 2IMOA 5HKKA 1X10A 3CMEB 4ZBGA 2Q43A 2QIRA 1I8DA 2FT0A 5FL7A 2B4DA 1XOVA 1YX0A 4XPDB 2VZLA 2X0KA 4XD7A 3I55B 4G5GA 1MABA 2YWGA 1BO4A 4MFZA 3A8IA 4MFPA 3SJPA 3RNZA 4AF6A 4RPBA 4KUAA 1BPMA 2Y0MA 3B8GA 1PKVA 5TV2A 4JWPA 3A8KA 2EWBA 3CDXA 4UBRA 3QFCA 2D3NA 4JLYA 4YAWA 3TOAA 4R3LA 3BC9A 4NBSA 1W0JA 4CYNA 4MBUA 3PFEA 1XBUA 2NMTA 2XEGA 5CBMA 2RFHA 4AG7A 3SI2A 1GAQA 1KTVA 4P4EA 4RI1A 3CP8A 3AVUA 1YVKA 4IUSA 2VNIA 1M4LA 4J3GA 4WZTA 1RTQA 3NE5B 2F7VA 2V31A 4CGOA 1YK3A 3SXOA 4DJLA 4AB7A 3OJWA 2ZOFA 4ZY1A 3DDYA 4NFRA 4F9UA 4CYPA 4OIDA 3QAYA 1JA1A 1J9ZA 2HQYA 3I9SA 4L8AA 3TO7A 2QMLA 4XR6A 4G1PA 1QX4A 4Y7CA 1H8HA 1FRNA 4RD2A 2REEA 3OE7A 1XMTA 2BSAA 2EO8A 2R7HA 3ES9A 1TKHA 3KHZA 4U9UA 2NV4A 3GKRA 2XZPA 2PJAA 2P6GA 1R5BA 4KSAA 2JLMA 3LO8A 5JH9A 2K5TA 4RD1A 1ARMA 1YW4A 4HNWB 4OMEA 2GJRA 2BCOA 4RDLA 1UFHA 4HPSA 1KK0A 4TN1A 3AVXA 3OZWA 4QB9A 3PVDA 3KQXA 2XEFA 1ELOA 2IJZA 2O28A 2R1IA 3FH4A 5I4MA 1VJSA 3G71B 5EMNA 1IYKA 4PC7A 3D7FA 4MFLA 4PXDA 4OC4A 4CAXA 3C26A 4ZCMA 2GFQA 5TR9A 2GREA 1NRKA 3OZUA 4R6TA 2F1LA 3R95A 4K3NA 2PJ4A 4NGSA 4F7DA 3T9YA 2PR1A 4P6YA 5TY0A 3TFYA 5CDFA 3V8IA 2D4OA 2JJ2A 4KLWA 4PV6A
chains in the Genus database with same CATH topology
2Q4ZA 3JRUA 3WT4A 3LWUA 3B7IA 2ZEPA 2PJ1A 3RZAA 2PJ0A 4UIAA 1BPNA 4TWEA 2HC9A 2JBKA 2V8GA 3IC1A 3IEHA 3FEEA 1CPSA 5IB9A 2AFXA 5K8NA 3KL9A 2V8DA 2AFMA 1Z8LA 2V8HA 2J9AA 3PB9X 1UWYA 2POKA 1KWMA 2ZEGA 2EK8A 3B35A 4IK2A 3WC7A 3VH9A 2PJ6A 5JGFA 1FNOA 2PJ2A 3IIBA 2AFZA 2PIZA 3D67A 2ZENA 5HXDA 1CBXA 1HDUA 2PJCA 4R7MA 1VHOA 3H8EA 4WWVA 4MCQA 4H2KA 4MRIA 4ZYQA 3PBEA 1AMPA 1R3NA 4MHZA 3D7GA 4R8FA 3CPXA 2XEIA 4NJQA 3KR5A 4P10A 2WYRA 2G9DA 3SJGA 4RUHA 4P4FA 3PB7X 2GLJA 3DGVA 3D7HA 2XEJA 4NGTA 2I3CA 4EMEA 4O23A 4YWYA 3SI0A 2IQ6A 2C1CA 2OR4A 3WC5A 2AFSA 3BHXA 3WC6A 4X8IA 4PXBA 2QJ8A 1OBRA 1XFOA 1XJOA 2PRQA 1FT7A 3PB8X 1ARLA 5K8MA 4EFDA 1TKJA 3H8GA 1Y0RA 5F09A 2PJ5A 4A38A 2ZOGA 1Y0YA 4NGPA 1F57A 1AYEA 5LYIA 1ZG8A 3DLJA 3B3CA 1YW6A 5LRKA 2F8HA 4PXCA 1CG2A 1DTDA 4OC3A 3D7DA 1TF9A 1H8LA 3CT9A 3KZWA 4F9VA 1HEEA 1ZG9A 4TNUA 4NJRA 2CIJA 4OC5A 2DEAA 5THWA 4UEZA 4PQAA 3NH5A 3D66A 2ZELA 7CPAA 1IY7A 3IO1A 2BOAA 2BO9A 3VATA 3VARA 4YU9A 5CPAA 5ELYA 8CPAA 4A39A 3PFOA 4MMOA 3B3SA 3GB0A 3PBBA 3D68A 1LFWA 3FEDA 2RB7A 4OIWA 4DUKA 4UEFA 1Y7EA 3FVLA 3GUXA 4R76A 1R43A 3NH4A 2JBJA 3FMCA 4W9YA 4X2TA 5HVGA 2NYQA 3TX8A 2HB6A 1VGYA 3GLJA 1ZLHA 2ZEEA 4IAVA 3IFEA 4PXEA 4DYOA 4LQGA 3I1UA 1Z2LA 1ZG7A 2PJ3A 2PVWA 3PRTA 5D8NA 2OOTA 1CPXA 1F2OA 2O4HA 4NGRA 1IGBA 1TF8A 4CPAA 3BI1A 1YLOA 4OC1A 1YMEA 2CTCA 3NA6A 4P4BA 4WJBA 1YSJA 1GYTA 4NGMA 5HVFA 2C6PA 1LAMA 4JYWA 4Q7AA 3HLPA 4ZY0A 5DS0A 3V7ZA 4PPZA 5K8OA 4MCSA 3S9NA 2ZEDA 1PCAA 3KR4A 1LAPA 2PE3A 1LOKA 1EE3P 1ZLIA 2QVPA 3NH8A 3D4UA 3ISXA 1Z5RA 3SI1A 4P45A 4OC2A 4F8ZA 3K9TA 5K8PA 1LCPA 3S9LA 2ANPA 4MHYA 3WABA 4ZI6A 4P4IA 2V77A 2IMOA 1BAVA 1ELLP 4P4JA 1CP7A 2Q43A 5LRJA 2PIYA 3NFZA 1XRYA 4A94A 3TC8A 1HDQA 3RBUA 5LYLA 4UIBA 6CPAA 2ZEFA 3FJUA 1Q7LA 3QNVA 4NGQA 1LANA 2QYVA 1BPMA 2PJBA 3IJ3A 3B2YA 3CPAA 4OKOA 2EWBA 3CDXA 2CF4A 1NSAA 4GM5A 2GLFA 5J1QA 4A37A 2ABZA 5LYDA 3KQZA 1XMBA 3MRUA 3PB4X 4IHMA 2O53A 3L2NA 1TXRA 3PFEA 1XBUA 2XEGA 3S9MA 4NGNA 5CBMA 1JQGA 3K2KA 2VL1A 2RFHA 5JM6A 3SI2A 2V8VA 5HVHA 4P4EA 4B6ZA 1TKFA 5LRGA 2EK9A 3IWWA 4ZX9A 3T8WA 1VIXA 1M4LA 3B3WA 1RTQA 2F7VA 3H8FA 5D29A 3KI9A 2ZEOA 2ZEMA 4DJLA 2PJ7A 2ZOFA 4ZY1A 4MHPA 4NFRA 4F9UA 4OIDA 2AFOA 2WZNA 2PJ9A 4G1PA 3SJXA 4UEEA 4FUUA 4BD9A 4P4DA 2CTBA 3V38A 2JEWA 3HUVA 1TKHA 3KHZA 3KASA 4FBEA 4P44A 1VHEA 1QQ9A 4AXVA 2PJAA 3PB6X 5LYFA 3BI0A 4FAIA 4X3RA 3PEIA 2Q51A 3SJFA 3FECA 5JH9A 2PCUA 4ONWA 1ARMA 1YW4A 4ZX8A 1BLLE 4MCRA 4OMEA 3LMSA 2C6CA 2BCOA 2PVVA 4MHNA 3MN8A 4OC0A 3SJEA 1CX8A 3KQXA 2XEFA 2IJZA 2AFUA 2PJ8A 3FF3A 3KGQA 3FH4A 4Z65A 2FVGA 2NSMA 4FWUA 5I4MA 3FX6A 3D7FA 1PYTB 4PXDA 4OC4A 1ELMP 2C6GA 4UF4A 4JZ0A 3N5FA 3BXMA 2AFWA 2GREA 4R6TA 4MXUA 1QMUA 3ISZA 4K3NA 2ZEHA 4EWTA 2PJ4A 4NGSA 2GU2A 3B3TA 3KHXA 1DE4C 4P6YA 1F2PA 4MCPA 3RAMA 1CP6A 4KSIA 3B3VA 4ZY2A 4OP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4Z A;  3JRU A;  3WT4 A;  3LWU A;  3B7I A;  2ZEP A;  2PJ1 A;  3RZA A;  2PJ0 A;  4UIA A;  1BPN A;  4TWE A;  2HC9 A;  2JBK A;  2V8G A;  3IC1 A;  3IEH A;  3FEE A;  1CPS A;  5IB9 A;  2AFX A;  5K8N A;  3KL9 A;  2V8D A;  2AFM A;  1Z8L A;  2V8H A;  2J9A A;  3PB9 X;  1UWY A;  2POK A;  1KWM A;  2ZEG A;  2EK8 A;  3B35 A;  4IK2 A;  3WC7 A;  3VH9 A;  2PJ6 A;  5JGF A;  1FNO A;  2PJ2 A;  3IIB A;  2AFZ A;  2PIZ A;  3D67 A;  2ZEN A;  5HXD A;  1CBX A;  1HDU A;  2PJC A;  4R7M A;  1VHO A;  3H8E A;  4WWV A;  4MCQ A;  4H2K A;  4MRI A;  4ZYQ A;  3PBE A;  1AMP A;  1R3N A;  4MHZ A;  3D7G A;  4R8F A;  3CPX A;  2XEI A;  4NJQ A;  3KR5 A;  4P10 A;  2WYR A;  2G9D A;  3SJG A;  4RUH A;  4P4F A;  3PB7 X;  2GLJ A;  3DGV A;  3D7H A;  2XEJ A;  4NGT A;  2I3C A;  4EME A;  4O23 A;  4YWY A;  3SI0 A;  2IQ6 A;  2C1C A;  2OR4 A;  3WC5 A;  2AFS A;  3BHX A;  3WC6 A;  4X8I A;  4PXB A;  2QJ8 A;  1OBR A;  1XFO A;  1XJO A;  2PRQ A;  1FT7 A;  3PB8 X;  1ARL A;  5K8M A;  4EFD A;  1TKJ A;  3H8G A;  1Y0R A;  5F09 A;  2PJ5 A;  4A38 A;  2ZOG A;  1Y0Y A;  4NGP A;  1F57 A;  1AYE A;  5LYI A;  1ZG8 A;  3DLJ A;  3B3C A;  1YW6 A;  5LRK A;  2F8H A;  4PXC A;  1CG2 A;  1DTD A;  4OC3 A;  3D7D A;  1TF9 A;  1H8L A;  3CT9 A;  3KZW A;  4F9V A;  1HEE A;  1ZG9 A;  4TNU A;  4NJR A;  2CIJ A;  4OC5 A;  2DEA A;  5THW A;  4UEZ A;  4PQA A;  3NH5 A;  3D66 A;  2ZEL A;  7CPA A;  1IY7 A;  3IO1 A;  2BOA A;  2BO9 A;  3VAT A;  3VAR A;  4YU9 A;  5CPA A;  5ELY A;  8CPA A;  4A39 A;  3PFO A;  4MMO A;  3B3S A;  3GB0 A;  3PBB A;  3D68 A;  1LFW A;  3FED A;  2RB7 A;  4OIW A;  4DUK A;  4UEF A;  1Y7E A;  3FVL A;  3GUX A;  4R76 A;  1R43 A;  3NH4 A;  2JBJ A;  3FMC A;  4W9Y A;  4X2T A;  5HVG A;  2NYQ A;  3TX8 A;  2HB6 A;  1VGY A;  3GLJ A;  1ZLH A;  2ZEE A;  4IAV A;  3IFE A;  4PXE A;  4DYO A;  4LQG A;  3I1U A;  1Z2L A;  1ZG7 A;  2PJ3 A;  2PVW A;  3PRT A;  5D8N A;  2OOT A;  1CPX A;  1F2O A;  2O4H A;  4NGR A;  1IGB A;  1TF8 A;  4CPA A;  3BI1 A;  1YLO A;  4OC1 A;  1YME A;  2CTC A;  3NA6 A;  4P4B A;  4WJB A;  1YSJ A;  1GYT A;  4NGM A;  5HVF A;  2C6P A;  1LAM A;  4JYW A;  4Q7A A;  3HLP A;  4ZY0 A;  5DS0 A;  3V7Z A;  4PPZ A;  5K8O A;  4MCS A;  3S9N A;  2ZED A;  1PCA A;  3KR4 A;  1LAP A;  2PE3 A;  1LOK A;  1EE3 P;  1ZLI A;  2QVP A;  3NH8 A;  3D4U A;  3ISX A;  1Z5R A;  3SI1 A;  4P45 A;  4OC2 A;  4F8Z A;  3K9T A;  5K8P A;  1LCP A;  3S9L A;  2ANP A;  4MHY A;  3WAB A;  4ZI6 A;  4P4I A;  2V77 A;  2IMO A;  1BAV A;  1ELL P;  4P4J A;  1CP7 A;  2Q43 A;  5LRJ A;  2PIY A;  3NFZ A;  1XRY A;  4A94 A;  3TC8 A;  1HDQ A;  3RBU A;  5LYL A;  4UIB A;  6CPA A;  2ZEF A;  3FJU A;  1Q7L A;  3QNV A;  4NGQ A;  1LAN A;  2QYV A;  1BPM A;  2PJB A;  3IJ3 A;  3B2Y A;  3CPA A;  4OKO A;  2EWB A;  3CDX A;  2CF4 A;  1NSA A;  4GM5 A;  2GLF A;  5J1Q A;  4A37 A;  2ABZ A;  5LYD A;  3KQZ A;  1XMB A;  3MRU A;  3PB4 X;  4IHM A;  2O53 A;  3L2N A;  1TXR A;  3PFE A;  1XBU A;  2XEG A;  3S9M A;  4NGN A;  5CBM A;  1JQG A;  3K2K A;  2VL1 A;  2RFH A;  5JM6 A;  3SI2 A;  2V8V A;  5HVH A;  4P4E A;  4B6Z A;  1TKF A;  5LRG A;  2EK9 A;  3IWW A;  4ZX9 A;  3T8W A;  1VIX A;  1M4L A;  3B3W A;  1RTQ A;  2F7V A;  3H8F A;  5D29 A;  3KI9 A;  2ZEO A;  2ZEM A;  4DJL A;  2PJ7 A;  2ZOF A;  4ZY1 A;  4MHP A;  4NFR A;  4F9U A;  4OID A;  2AFO A;  2WZN A;  2PJ9 A;  4G1P A;  3SJX A;  4UEE A;  4FUU A;  4BD9 A;  4P4D A;  2CTB A;  3V38 A;  2JEW A;  3HUV A;  1TKH A;  3KHZ A;  3KAS A;  4FBE A;  4P44 A;  1VHE A;  1QQ9 A;  4AXV A;  2PJA A;  3PB6 X;  5LYF A;  3BI0 A;  4FAI A;  4X3R A;  3PEI A;  2Q51 A;  3SJF A;  3FEC A;  5JH9 A;  2PCU A;  4ONW A;  1ARM A;  1YW4 A;  4ZX8 A;  1BLL E;  4MCR A;  4OME A;  3LMS A;  2C6C A;  2BCO A;  2PVV A;  4MHN A;  3MN8 A;  4OC0 A;  3SJE A;  1CX8 A;  3KQX A;  2XEF A;  2IJZ A;  2AFU A;  2PJ8 A;  3FF3 A;  3KGQ A;  3FH4 A;  4Z65 A;  2FVG A;  2NSM A;  4FWU A;  5I4M A;  3FX6 A;  3D7F A;  1PYT B;  4PXD A;  4OC4 A;  1ELM P;  2C6G A;  4UF4 A;  4JZ0 A;  3N5F A;  3BXM A;  2AFW A;  2GRE A;  4R6T A;  4MXU A;  1QMU A;  3ISZ A;  4K3N A;  2ZEH A;  4EWT A;  2PJ4 A;  4NGS A;  2GU2 A;  3B3T A;  3KHX A;  1DE4 C;  4P6Y A;  1F2P A;  4MCP A;  3RAM A;  1CP6 A;  4KSI A;  3B3V A;  4ZY2 A;  4OP4 A; 
#chains in the Genus database with same CATH topology
 4C7H A;  3LWU A;  2EIX A;  3CCL B;  4UFW A;  1E3X A;  1BPN A;  4TWE A;  1NJI D;  4QVT A;  1V0C A;  3IC1 A;  2PSW A;  1WP6 A;  1CPS A;  5IB9 A;  4CRY B;  4XPD C;  2R9V A;  4G1V A;  2IL4 A;  2V8D A;  3ZBT A;  1I7P A;  3F8K A;  4IW3 B;  2J8R A;  4G6I A;  3G4S B;  1M90 D;  3H94 A;  3Q6R A;  3ZIA A;  4PK2 A;  1S7N A;  1VQ5 B;  4MY0 A;  1QH0 A;  5HH1 A;  2DCU A;  5IYR A;  4C2X A;  5H84 A;  1CM0 A;  4KVM E;  4ZV4 A;  3D67 A;  4Y49 B;  5HXD A;  1HDU A;  5IYN A;  2PJC A;  3IGR A;  4G7W A;  4WWV A;  4YEJ A;  2QTZ A;  4NNJ A;  4P6V F;  4JXQ A;  2B5O A;  2OYN A;  3PP9 A;  4KOS A;  5AG4 A;  4ZGQ B;  4MHZ A;  4DQK A;  2Q44 A;  4Q7J B;  3CPX A;  4UAJ A;  3RY8 A;  1UD6 A;  4YXW A;  2VNH A;  1XEB A;  2WYR A;  3SJG A;  4RUH A;  1FX0 A;  1XE1 A;  2XNC A;  2X85 A;  2GLJ A;  3DGV A;  2WUU A;  5AG5 A;  2OTL B;  1Z4E A;  4EME A;  3JQQ A;  2Z3N A;  2B5G B;  4MI4 A;  2QJ8 A;  3D2M A;  4H89 A;  1H8E A;  1JB9 A;  1I12 A;  2G0B A;  3P26 A;  2WSS A;  2BM1 A;  2GQF A;  3E1Y E;  4A38 A;  2A4N A;  2QMU A;  4YAF A;  3T53 B;  1SM4 A;  3JQP A;  2P6F A;  1OB0 A;  2OBT A;  1DDI A;  5BSY A;  1ZG8 A;  1K28 D;  1YW6 A;  3IU2 A;  2F8H A;  1CG2 A;  1E3Z A;  3JVN A;  4OC3 A;  3D7D A;  3N7Z A;  3CT9 A;  3R6K A;  2BV3 A;  4F9V A;  1ZG9 A;  4X7E A;  2CIJ A;  4IF5 A;  2EBJ A;  2X3U A;  3Q3A A;  3FB3 A;  4PQA A;  1JJ2 B;  2QA4 B;  2X7B A;  1HVX A;  2QEX B;  2FX3 A;  4M2L A;  1HA3 A;  1NDH A;  2F1M A;  2BOA A;  2JJ1 A;  3S6G A;  2B5G A;  3VAR A;  3LD2 A;  4YU9 A;  4DK0 A;  1ZM9 A;  4YAU A;  2F43 A;  2E1B A;  1ON0 A;  3ZPN A;  4P26 A;  4MMO A;  1W2B B;  3B3S A;  2QGG A;  3GB0 A;  3PBB A;  3FXT A;  1VQ9 B;  4RM0 A;  4QVA A;  4MFQ A;  1G7R A;  2BL1 A;  4KKT A;  1X12 A;  3CC2 B;  2VNJ A;  1UMK A;  1WTH D;  1R43 A;  1R5N A;  5IX3 A;  3FYN A;  3FMC A;  4M6G A;  2DXQ A;  2NYQ A;  2HB6 A;  1ZM2 A;  1VGY A;  3GLJ A;  1ZLH A;  4PXE A;  4NCN A;  1E1R A;  2V7V A;  4HE5 A;  1ZG7 A;  2DEU A;  3UY5 A;  4C2Y A;  3MMP A;  4B3X A;  1K73 D;  4K1X A;  5CNP A;  5D8N A;  1VQ7 B;  2WPX A;  4YGO A;  2ZBU A;  1F2O A;  2O4H A;  5C88 A;  4II3 A;  1TF8 A;  4TSF A;  4LX9 A;  4BIN A;  3NA6 A;  2CTC A;  4LQ6 A;  4OAD A;  3BJ8 A;  4U9Z A;  5GV7 A;  3G3S A;  3W2E A;  2ATR A;  5AN9 A;  3AVW A;  1LAM A;  2C6P A;  1SQH A;  4ZY0 A;  4PPZ A;  4XMY A;  5K8O A;  4Y49 C;  2ZED A;  3NE7 A;  1UD3 A;  2GK6 A;  2QVP A;  2G3T A;  3D4U A;  3LQE A;  5I0C A;  5H86 A;  3FKS A;  1D8T A;  2BSW A;  4OC2 A;  4JMQ A;  1B6B A;  3IWE A;  4GXH A;  3K9T A;  5F49 A;  3S9L A;  4MHY A;  5KSW B;  3WAB A;  4ORF A;  1WPC A;  4P4I A;  2V77 A;  3CXQ A;  1ELL P;  2LZJ A;  4P3I A;  4C0S A;  1CP7 A;  3T90 A;  5J8F A;  2VYQ A;  4UCN A;  4TT3 A;  5LRJ A;  1HDQ A;  3RBU A;  2W6J A;  1WDT A;  1A2Z A;  4KOX A;  1IOI A;  4NCZ A;  5LYL A;  1PJ5 A;  4AG9 A;  2B7B A;  4UIB A;  1YR0 A;  2OU2 A;  6CPA A;  2ZEF A;  3AGP A;  1Q7L A;  2I79 A;  1S7K A;  4NGQ A;  1LAN A;  2X8K A;  4PC2 A;  2PJB A;  4X7F A;  3P27 A;  4FXU A;  3VWD A;  3PA2 A;  2J8N A;  1V0F A;  2FIW A;  1XF8 A;  4RS2 A;  1AMO A;  5FIU A;  4KS9 A;  4GM5 A;  5J1Q A;  5G22 A;  2ABZ A;  3A35 A;  4DNR B;  1FY7 A;  3KQZ A;  2F5I A;  5LYD A;  1Q7Y D;  1JWQ A;  3SKB A;  3L2N A;  5E6T A;  3QFS A;  4UFV A;  3LOD A;  3ONY A;  1OB2 A;  3S9M A;  4M0L A;  2VL1 A;  4TMX A;  5KTA A;  3BY1 A;  4UCP A;  3IWW A;  4KLV A;  3WBJ A;  3T8W A;  1VQL B;  4N3G A;  1CQX A;  3H8F A;  3BH4 A;  3F5B A;  3VWE A;  2ZEO A;  3PZJ A;  2QE7 A;  2OB0 A;  3G8W A;  4P9S A;  1EFU A;  4PGO A;  2OZH A;  2QDX A;  4M53 A;  4TMT A;  4E0A A;  2GAN A;  4BD9 A;  3H9N A;  4AF7 A;  3CCU B;  3EFA A;  1S0U A;  2CTB A;  3V38 A;  3BY2 A;  3KAS A;  3QB8 A;  1BX0 A;  3TO9 A;  4P25 A;  1QQ9 A;  3VO1 A;  2B7C A;  1VQ6 B;  4AVB A;  2Z3L A;  4CAF A;  4ACA A;  2JEV A;  3FEC A;  4MHD A;  3W6S A;  3G05 A;  4ONW A;  2PDO A;  3SEJ A;  2YWH A;  1BLL E;  4MCR A;  3W2I A;  2ZW4 A;  4MHN A;  3GSI A;  1ZM3 A;  2P0W A;  2X53 S;  1CX8 A;  1GAW A;  1OGI A;  3VNU A;  4J0Q A;  2AFU A;  4Z65 A;  1Z8X A;  2NSM A;  2C2W A;  4RLZ A;  4PAB A;  4FWU A;  3ASS A;  3FX6 A;  1IHM A;  3LNN A;  2REF A;  1E64 A;  2Q7S A;  2WR8 A;  4Z4Z A;  2C6G A;  4JZ0 A;  4B5P B;  1TIQ A;  2JDI A;  2X6W A;  4KKU A;  4MXU A;  3ISZ A;  1RQP A;  4X07 A;  3B3T A;  3CCQ B;  3GVK A;  2ZL6 A;  3RAM A;  4Z4W A;  1CP6 A;  1YRE A;  4HIZ A;  3B3V A;  4MY3 A;  3SLN A;  2PR8 A;  4OP4 A;  2EVN A;  2ZZF A;  1MJB A;  2FE7 A;  2CK3 A;  2GJK A;  2WZP P;  2PJ1 A;  3R1K A;  3RZA A;  2PJ0 A;  4UIA A;  2V7W A;  4P12 A;  2HC9 A;  1EP2 B;  2JBK A;  3BCF A;  5ISV A;  1K9M D;  2VQY A;  4CGL A;  3KL9 A;  3PA1 A;  1UD4 A;  2V8H A;  4KOY A;  3Q38 A;  5FA6 A;  2DET A;  3WBK A;  2J9A A;  4B5P A;  3OAA A;  4ZCI A;  1UWY A;  3U2Q A;  2VJJ A;  2POK A;  4KZT A;  4XOT A;  1FNC A;  2PJ6 A;  4RD3 A;  3TO6 A;  2PIZ A;  2ZEN A;  3A3B A;  4CGM A;  1M1K D;  4XLC A;  3H8E A;  3W5H A;  4MCQ A;  2W6I A;  4QV2 A;  2OH1 A;  1H85 A;  2ZW6 A;  3IU1 A;  4AVA A;  1WSV A;  3PGP A;  4R8F A;  2XEI A;  3KEW A;  2OZU A;  2XGJ A;  1OB5 A;  4P10 A;  2ZTN A;  3W2H A;  4P4F A;  4OPV A;  5HMN A;  2H5M A;  3WNC A;  2DER A;  4PC6 A;  2PC1 A;  1QVG B;  4YWY A;  2IQ6 A;  5KTD A;  3WC5 A;  2NPF A;  1EFT A;  1XFO A;  1XJO A;  2PRQ A;  4B47 A;  2G3A A;  4Z4R A;  1ARL A;  4EFD A;  1V5V A;  3DSB A;  2HUZ A;  1G7T A;  2J8M A;  4X06 A;  4ZCL A;  2PJ5 A;  4RCZ A;  2ZOG A;  4C2Z A;  2VBT A;  3ZC3 A;  4CGN A;  5KW9 A;  1Y0Y A;  4NGP A;  3S6F A;  4RCY A;  3GIR A;  1YHQ B;  5LYI A;  1Z8T A;  3B3C A;  3FJO A;  1Q81 D;  4HKF A;  1W35 A;  1DTD A;  3FIX A;  2AHO A;  3SLD A;  4B3F X;  4TNU A;  2X6X A;  1M4I A;  4YRH A;  4LBW A;  1KUY A;  2C78 A;  2P3M A;  2AJ6 A;  2WSA A;  3I3G A;  4CAE A;  3QE2 A;  3PUN A;  2BO9 A;  3EY5 A;  4YAL A;  5ELY A;  2XOK A;  5CPA A;  1VQ8 B;  8CPA A;  4F6A A;  3PFO A;  2KVO A;  4KSF A;  1F20 A;  2ZPA A;  2KCW A;  4Z4V A;  2HCJ B;  3D2P A;  1LFW A;  3FED A;  4OIW A;  1Y7E A;  1KRH A;  4QC6 A;  3FPK A;  2EFG A;  2BPO A;  2Q6O A;  4LBY A;  3NH4 A;  4MFK A;  4R76 A;  2C27 A;  3OEE A;  3ZJ0 A;  3JUW A;  3VMF A;  4X2T A;  4G7X A;  2EUI A;  4JXR A;  4MYT A;  1RO5 A;  2Q7B A;  2PLF A;  3W2G A;  2ZEE A;  3CCS B;  4QVJ A;  3IFE A;  1A8P A;  4FD5 A;  4LQG A;  4UZF A;  4B10 A;  4C7I A;  1YVO A;  3CC4 B;  2F4N A;  3I1U A;  1NB9 A;  1HZE A;  4KOV A;  1R5O A;  2GPJ A;  3OW7 A;  2PVW A;  3PRT A;  5L46 A;  1QFJ A;  2ZL5 A;  1YJ9 B;  1IGB A;  2CND A;  3WXM A;  1YLO A;  2Q4Y A;  4OC1 A;  4EH1 A;  1YIT B;  4L8J A;  2FL4 A;  1N08 A;  5A28 A;  3AVT A;  1WK4 A;  4Z4Y A;  4FD4 A;  4JYW A;  1U6M A;  1IB0 A;  2JN9 A;  4Q7A A;  1YI2 B;  5DS0 A;  3LAC A;  3FPP A;  1BMF A;  1NE9 A;  1T5E A;  1LAP A;  1VLY A;  1LOK A;  1ZLI A;  5EMI A;  2CC2 A;  1OZP A;  2M5S A;  3ZZ0 A;  3GY9 A;  2OBS A;  2D3L A;  1WOS A;  3OJX A;  3SI1 A;  1M1D A;  2GIV A;  4RD4 A;  4M3S A;  4P45 A;  4ROX A;  4E8O A;  3EXN A;  3F0A A;  5B6I A;  1TLL A;  1M44 A;  4Z4T A;  5IYW A;  1WOR A;  4Y9U A;  3OP1 A;  3Q39 A;  4XON A;  4UCM A;  2VEZ A;  3CPW B;  3PEN A;  2CRV A;  2PIY A;  3NFZ A;  3TC8 A;  1L0C A;  3ASR A;  5JQ4 A;  5F4O A;  4K30 A;  2ZXV A;  1D2E A;  2FIA A;  4R87 A;  1I1D A;  2OZG A;  1PUA A;  1YQE A;  4OKO A;  2YNC C;  3S6K A;  4CAW A;  1NSA A;  4NXY A;  2ZIT A;  4A37 A;  3RYO A;  1BPL A;  3MRU A;  3PB4 X;  2RC4 A;  2O53 A;  1TXR A;  3FBU A;  3OW2 B;  4B13 A;  1F60 A;  2OK8 A;  1IB1 E;  1FRQ A;  2Z6B D;  4HE6 A;  1JQG A;  3K2K A;  3Q6Q A;  3VR6 A;  5JM6 A;  5HVH A;  1E1Q A;  1TKF A;  2EK9 A;  4ZX9 A;  4OOV A;  4PAA A;  2BUE A;  2BM0 A;  1ZUN B;  3ZZU A;  5D29 A;  1S4M A;  2C5B A;  1XIX A;  1CNF A;  2PJ7 A;  1S72 B;  1Z4R A;  5FO1 A;  3E0K A;  4CYQ A;  4TMW A;  4U5Y A;  5J8C A;  3K9U A;  3OZV A;  2OK7 A;  2PJ9 A;  1GJR A;  4XNF A;  4XLF A;  5AG7 A;  5F46 A;  3KKW A;  5J3O A;  1H42 A;  1Z9U A;  5GCN A;  3SJX A;  4UEE A;  4CYO A;  4B12 A;  3HUV A;  1QGA A;  4FBE A;  4P44 A;  4A30 A;  4CAV A;  2WJV A;  4PK3 A;  1QVF B;  3PEI A;  2Q51 A;  3MCA A;  2X6Y A;  4X7D A;  3MGD A;  3LMS A;  4RD6 A;  2C6C A;  1BX1 A;  3VO2 A;  2PVV A;  4QFM A;  2V4D A;  1KZF A;  3T56 B;  1KJZ A;  2C5H A;  4DK1 A;  5IB0 A;  3FF3 A;  3KGQ A;  3OFN A;  1W34 A;  1EWY A;  1UD5 A;  3CW2 A;  2HMA A;  5H5J A;  1DG1 G;  2DOG A;  1W87 A;  1SKY B;  3N5F A;  1WSR A;  2FSR A;  3BXM A;  2BN4 A;  2Q6K A;  2Z3O A;  1E43 A;  3MHP A;  2AFW A;  2XNJ A;  2BEI A;  1QUE A;  5H59 A;  2ZEH A;  4EWT A;  3WR7 A;  2WPW A;  2B3U A;  1N0U A;  2GU2 A;  3CC7 B;  1S7L A;  3A9L A;  3KHX A;  1DE4 C;  1DAR A;  4Q38 A;  2I1L A;  5EBV A;  2HDN B;  2Q6I A;  1N0V C;  2VXK A;  4PSX A;  1P4M A;  1ZM4 A;  3VNV A;  1TUI A;  3W91 A;  1G7C A;  2Q04 A;  3JRU A;  3WT4 A;  4PSW A;  2CNM A;  4UWJ A;  3DR8 A;  2ZEP A;  3RO0 A;  2V8G A;  5GV8 A;  5JPH A;  2AFX A;  3EO4 A;  5K8N A;  1CNE A;  1Z8L A;  2AFM A;  3R9E A;  1IIC A;  1WWZ A;  5F47 A;  1COW A;  4XLE A;  3PB9 X;  1NSL A;  3NE8 A;  4FN5 A;  4F0Y A;  1KWM A;  2XZL A;  2ZEG A;  1T6Z A;  2EK8 A;  3CCR B;  3WC7 A;  4LC0 A;  4B11 A;  3I56 B;  2PJ2 A;  3IIB A;  1B87 A;  4P3Y A;  4NF1 A;  2WJY A;  3OPO A;  1J4J A;  4DQL A;  1VQP B;  1RXT A;  1QG0 A;  2R6H A;  4H9G A;  1WOO A;  4MRI A;  1Y7R A;  3TCV A;  1R3N A;  3D7G A;  2BGI A;  3TTH A;  4UZE A;  2R98 A;  4NJQ A;  2CW5 A;  1Q2D A;  3OKX A;  3PB7 X;  3LVB A;  4XPL A;  5F48 A;  2QEC A;  2R8V A;  1VKC A;  3CES A;  3ASP A;  3D7H A;  1S60 A;  1KUX A;  1VQ4 B;  3DR6 A;  2XEJ A;  1IYL A;  4JD6 A;  4PC3 A;  3HAG A;  4O23 A;  4A33 A;  3SI0 A;  1QSN A;  2VZZ A;  1IID A;  3BHX A;  4X8I A;  5LMZ A;  1OBR A;  4TKO B;  4UFX A;  1FT7 A;  3PB8 X;  1M4D A;  4ONU A;  1TKJ A;  2RC6 A;  1Y0R A;  4QHY A;  5F09 A;  1Q2C A;  2XND A;  4FD6 A;  2FCK A;  5G1Z A;  1E63 A;  1GR1 A;  4OAE A;  3R6J A;  1VLO A;  4LBZ A;  4M1K A;  1EP3 B;  4P22 A;  3S6H A;  3DLJ A;  5LRK A;  4OPS A;  3FRM A;  4AVC A;  4ACB A;  4R71 A;  1TF9 A;  1H8L A;  3KZW A;  3B82 A;  2CXA A;  1N71 A;  4WZK A;  3FNC A;  4NJR A;  2B3V A;  1DDG A;  1BQE A;  4YHB A;  3P2F A;  3TT2 A;  5THW A;  3WND A;  3NH5 A;  1K4J A;  1P4N A;  7CPA A;  1JA0 A;  3CCM B;  2ZW7 A;  1FNM A;  1VQN B;  2D74 A;  3BCD A;  4A31 A;  3VAT A;  3ZBU A;  3P2H A;  2Z3P A;  1Q2Y A;  2PIA A;  3D8P A;  2ODF A;  4A39 A;  3CZX A;  4I49 A;  1E79 A;  3OEH A;  4L89 A;  4KOR A;  3CB4 A;  3OWC A;  4Y9R A;  4OLL A;  3QFT A;  4DUK A;  2B4B A;  3FVL A;  1BJK A;  2GK7 A;  1NMT A;  3TX8 A;  4B14 A;  4XM3 A;  2XZO A;  3BLN A;  3WQZ A;  2P6E A;  3B78 A;  1VF7 A;  3I1F A;  4IAV A;  4DYO A;  2JIZ A;  3A8J A;  3U6B A;  5KTC A;  3W6X A;  3TE4 A;  4AVZ A;  2QN6 A;  4R9M A;  5A88 A;  4CPA A;  3BI1 A;  1P0H A;  3GYA A;  1GHE A;  1YSJ A;  2C4U A;  1GYT A;  2ZZG A;  4X05 A;  2VJI A;  2PMD A;  1QST A;  2Z3K A;  2VBV A;  4LBV A;  4MJ8 A;  3E20 A;  5IV0 A;  1TVC A;  4WZE A;  1KK1 A;  1UD8 A;  4Z1M A;  4R57 A;  2AE6 A;  4MCS A;  5TRD A;  5EC4 A;  1N05 A;  4B5O A;  1KC8 D;  4FD7 A;  3KR4 A;  1N07 A;  2PE3 A;  4ZGN B;  4PC1 A;  5DWN A;  3D26 A;  4KUB A;  4BBH A;  2VNK A;  4ASU A;  2HLD A;  1Z5R A;  5BSX A;  4F8Z A;  2PRB A;  1VQM B;  1FNB A;  3CXS A;  4P2N A;  2V7Q A;  1G7S A;  5K8P A;  3OOC A;  2C77 A;  4WQM A;  4XOR A;  4XKW A;  1BAV A;  4P4J A;  1N8R D;  2Q4V A;  2FXF A;  1XRY A;  4A94 A;  4MYU A;  2VZY A;  4H6Z A;  4X0C A;  4C43 A;  5JBQ A;  5E96 A;  2CNT A;  3FJU A;  3QNV A;  1WOP A;  3CP2 A;  4WZL A;  2QYV A;  5A8A A;  2BVN A;  4OOX A;  4RPD A;  2J7K A;  3IJ3 A;  3B2Y A;  3CPA A;  2CF4 A;  1B23 P;  2GLF A;  3TOB A;  1XB2 A;  5HZA A;  1MJA A;  1QSR A;  4XN0 A;  1XMB A;  4IHM A;  4R3K A;  2YNC A;  3LQ6 A;  2ZZE A;  1Q9S A;  2I00 A;  1T6Y A;  4NGN A;  1YJN B;  1IJE A;  5BWA B;  3CXC B;  1GVH A;  2V8V A;  5G20 A;  4B6Z A;  5LRG A;  4KOU A;  1FND A;  1VIX A;  2DPT A;  4M4S A;  3B3W A;  3KI9 A;  2VI7 A;  4TMZ A;  2ZEM A;  3AVY A;  4MHP A;  3WYA A;  4MFJ A;  4RJL A;  2AFO A;  2YND A;  2WZN A;  4E2A A;  4M6H A;  4AC9 A;  3GIU A;  3CCV B;  3JU4 A;  4FUU A;  4P4D A;  1TTT A;  5KNL A;  2JEW A;  2Z10 A;  1T6X A;  2Q6L A;  3DNS A;  1VHE A;  4AXV A;  2CY2 A;  5FO0 A;  4B43 A;  3PB6 X;  5LYF A;  2E1R A;  1K8A D;  3V76 A;  4XOP A;  5A89 A;  3BI0 A;  4DNC A;  4FAI A;  4X3R A;  4NEX A;  4C68 A;  3SJF A;  4QBJ A;  3ZZI A;  1AUG A;  4KOW A;  2PCU A;  5F4M A;  2PQ8 A;  3ASQ A;  2OBR A;  1VQK B;  4ZX8 A;  4KKS A;  4OPO A;  4QUS A;  3GVJ A;  1EFR A;  4EVY A;  2FS5 A;  3MN8 A;  4OC0 A;  1KK3 A;  3SJE A;  1KD1 D;  4YEL A;  1LRZ A;  1NBM A;  4F0X A;  1VQO B;  4CRZ B;  4RDK A;  2PJ8 A;  4CQJ A;  2FVG A;  1Y9K A;  4FK8 A;  3V7A A;  3AST A;  3W5V A;  1PYT B;  3CXP A;  1ELM P;  4UF4 A;  3D3S A;  4DNT B;  1OHH A;  4M6I A;  4A2Z A;  3EC4 A;  4GS4 A;  4A32 A;  1B2R A;  5F4J A;  1S7F A;  1GO2 A;  2Q0Y A;  1QMU A;  2DPS A;  1CJW A;  4RN7 A;  3SHP A;  1BOB A;  4B4D A;  4UWI A;  5HZB A;  1F2P A;  1KMH A;  4P1V A;  4MCP A;  4YFJ A;  3JQR A;  4KSI A;  4ZY2 A;  4B44 A;  4XNH B;  3JTK A;  4RD0 A;  1S5K A;  2JDC A;  2Q4Z A;  1RQR A;  1Q86 D;  3B7I A;  1KQS B;  4XL9 A;  3T51 B;  3G6E B;  3IEH A;  5THX A;  3FEE A;  4RDJ A;  2V7T A;  1QSO A;  4CGP A;  3QSY A;  1Q82 D;  5HXB A;  1D1N A;  4X5K A;  4XLH A;  4UZU A;  1I21 A;  5DSZ A;  1PU9 A;  5IYQ A;  2BGJ A;  3H4Q A;  5A27 A;  3B35 A;  2RC5 A;  4IK2 A;  3GVL A;  2D4P A;  3VH9 A;  5JGF A;  1FNO A;  1WU8 A;  1ZO0 A;  2CNS A;  3ZZT A;  2AFZ A;  3BJ7 A;  4XQF A;  1EFC A;  1CBX A;  1KZL A;  3CMM A;  1NB0 A;  4CS0 B;  5J35 A;  4R7M A;  1VHO A;  1MK4 A;  1XE4 A;  3SXN A;  3W5U A;  2BF4 A;  3CCE B;  4XKV A;  4H2K A;  1N06 A;  4ZYQ A;  3PBE A;  2ZXI A;  1AMP A;  5IYP A;  1BLI A;  3ONU A;  1QGZ A;  3CCJ B;  1Z8W A;  3KR5 A;  4E0F A;  2G9D A;  2ZBV A;  1M4G A;  2DYI A;  1IOF A;  1OGJ A;  3W2F A;  2HV2 A;  1PJ7 A;  1MJ9 A;  3WNB A;  4NGT A;  2I3C A;  2JDD A;  2C1C A;  3H5Z A;  2OR4 A;  2AFS A;  3WC6 A;  4H6U A;  2DY1 A;  4PXB A;  1FDR A;  1U2R A;  1QGY A;  4FWT A;  2QTL A;  3R9F A;  1XQB A;  1SKQ A;  5K8M A;  3CD6 B;  4OP7 A;  3H8G A;  4TMV A;  2DIE A;  1JNY A;  5AGE A;  4NSQ A;  5FNZ A;  3A1P A;  2ZW5 A;  1VHS A;  4KVX A;  1F57 A;  1AYE A;  2Z3M A;  1YGH A;  4A95 A;  2C4T A;  1W9X A;  1PJ6 A;  1R57 A;  4PXC A;  4XPK A;  4UA3 A;  5C82 A;  4OOS A;  2ZTG A;  4Q36 A;  1E62 A;  2OTJ B;  1MRZ A;  4Z4S A;  1HEE A;  4OC5 A;  1KUV A;  4ZGY B;  2DEA A;  4UEZ A;  4B3G A;  3D66 A;  3SJZ A;  2ZXH A;  2ZEL A;  2CBX A;  1IY7 A;  1W0K A;  2D9R A;  1IJF A;  1EXM A;  3IO1 A;  4KOT A;  3B8H A;  3U6K A;  3BQJ A;  3AVV A;  4JJX A;  3R9G A;  3D68 A;  1QSM A;  2RB7 A;  2YWF A;  4UEF A;  5IK2 A;  4N3N A;  3GUX A;  3PUM A;  2JBJ A;  4W9Y A;  5HVG A;  4G1B A;  3BNW A;  3IWG A;  4QUZ A;  4XNH C;  4HNX B;  2Z0Z A;  4X7C A;  2Z11 A;  3J81 k;  4KVO E;  1Z2L A;  1YIJ B;  2WPD A;  4XLA A;  2PJ3 A;  1S3Z A;  4LUA A;  2XEX A;  2OOT A;  4BMH A;  1CPX A;  3ZUG A;  2VBQ A;  4BPR A;  1YLE A;  3A3G A;  2ARH A;  4II9 A;  4NGR A;  1QUF A;  2BMW A;  1AIP A;  1V0E A;  1YME A;  4II2 A;  3CTA A;  4P4B A;  4U9Y A;  4WJB A;  2B4D B;  3DDD A;  2DF5 A;  4NGM A;  1QFY A;  2ZL7 A;  5HVF A;  3CRZ A;  2GE3 A;  4GQN A;  3GQB A;  3HLP A;  2V7U A;  4XN3 A;  2V7X A;  4YAO A;  3R96 A;  3V7Z A;  1EP1 B;  3S9N A;  1PCA A;  2VBS A;  1QFZ A;  1UD2 A;  1EE3 P;  2GJP A;  3NH8 A;  2ZZQ A;  2B58 A;  3ISX A;  3AGQ A;  5G21 A;  1YX2 A;  4B48 A;  2YGW A;  4M85 A;  5DN6 A;  1Y9W A;  2VBU A;  5FVJ A;  2YNE A;  3QAH A;  5AG6 A;  1IU8 A;  3QFR A;  4HNY B;  1LCP A;  3CMA B;  1I18 A;  3WY9 A;  2ANP A;  4Z4U A;  4ZI6 A;  1KK2 A;  5DWM A;  2YWE A;  1YJW B;  2IMO A;  5HKK A;  1X10 A;  3CME B;  4ZBG A;  2Q43 A;  2QIR A;  1I8D A;  2FT0 A;  5FL7 A;  2B4D A;  1XOV A;  1YX0 A;  4XPD B;  2VZL A;  2X0K A;  4XD7 A;  3I55 B;  4G5G A;  1MAB A;  2YWG A;  1BO4 A;  4MFZ A;  3A8I A;  4MFP A;  3SJP A;  3RNZ A;  4AF6 A;  4RPB A;  4KUA A;  1BPM A;  2Y0M A;  3B8G A;  1PKV A;  5TV2 A;  4JWP A;  3A8K A;  2EWB A;  3CDX A;  4UBR A;  3QFC A;  2D3N A;  4JLY A;  4YAW A;  3TOA A;  4R3L A;  3BC9 A;  4NBS A;  1W0J A;  4CYN A;  4MBU A;  3PFE A;  1XBU A;  2NMT A;  2XEG A;  5CBM A;  2RFH A;  4AG7 A;  3SI2 A;  1GAQ A;  1KTV A;  4P4E A;  4RI1 A;  3CP8 A;  3AVU A;  1YVK A;  4IUS A;  2VNI A;  1M4L A;  4J3G A;  4WZT A;  1RTQ A;  3NE5 B;  2F7V A;  2V31 A;  4CGO A;  1YK3 A;  3SXO A;  4DJL A;  4AB7 A;  3OJW A;  2ZOF A;  4ZY1 A;  3DDY A;  4NFR A;  4F9U A;  4CYP A;  4OID A;  3QAY A;  1JA1 A;  1J9Z A;  2HQY A;  3I9S A;  4L8A A;  3TO7 A;  2QML A;  4XR6 A;  4G1P A;  1QX4 A;  4Y7C A;  1H8H A;  1FRN A;  4RD2 A;  2REE A;  3OE7 A;  1XMT A;  2BSA A;  2EO8 A;  2R7H A;  3ES9 A;  1TKH A;  3KHZ A;  4U9U A;  2NV4 A;  3GKR A;  2XZP A;  2PJA A;  2P6G A;  1R5B A;  4KSA A;  2JLM A;  3LO8 A;  5JH9 A;  2K5T A;  4RD1 A;  1ARM A;  1YW4 A;  4HNW B;  4OME A;  2GJR A;  2BCO A;  4RDL A;  1UFH A;  4HPS A;  1KK0 A;  4TN1 A;  3AVX A;  3OZW A;  4QB9 A;  3PVD A;  3KQX A;  2XEF A;  1ELO A;  2IJZ A;  2O28 A;  2R1I A;  3FH4 A;  5I4M A;  1VJS A;  3G71 B;  5EMN A;  1IYK A;  4PC7 A;  3D7F A;  4MFL A;  4PXD A;  4OC4 A;  4CAX A;  3C26 A;  4ZCM A;  2GFQ A;  5TR9 A;  2GRE A;  1NRK A;  3OZU A;  4R6T A;  2F1L A;  3R95 A;  4K3N A;  2PJ4 A;  4NGS A;  4F7D A;  3T9Y A;  2PR1 A;  4P6Y A;  5TY0 A;  3TFY A;  5CDF A;  3V8I A;  2D4O A;  2JJ2 A;  4KLW A;  4PV6 A; 
#chains in the Genus database with same CATH homology
 2Q4Z A;  3JRU A;  3WT4 A;  3LWU A;  3B7I A;  2ZEP A;  2PJ1 A;  3RZA A;  2PJ0 A;  4UIA A;  1BPN A;  4TWE A;  2HC9 A;  2JBK A;  2V8G A;  3IC1 A;  3IEH A;  3FEE A;  1CPS A;  5IB9 A;  2AFX A;  5K8N A;  3KL9 A;  2V8D A;  2AFM A;  1Z8L A;  2V8H A;  2J9A A;  3PB9 X;  1UWY A;  2POK A;  1KWM A;  2ZEG A;  2EK8 A;  3B35 A;  4IK2 A;  3WC7 A;  3VH9 A;  2PJ6 A;  5JGF A;  1FNO A;  2PJ2 A;  3IIB A;  2AFZ A;  2PIZ A;  3D67 A;  2ZEN A;  5HXD A;  1CBX A;  1HDU A;  2PJC A;  4R7M A;  1VHO A;  3H8E A;  4WWV A;  4MCQ A;  4H2K A;  4MRI A;  4ZYQ A;  3PBE A;  1AMP A;  1R3N A;  4MHZ A;  3D7G A;  4R8F A;  3CPX A;  2XEI A;  4NJQ A;  3KR5 A;  4P10 A;  2WYR A;  2G9D A;  3SJG A;  4RUH A;  4P4F A;  3PB7 X;  2GLJ A;  3DGV A;  3D7H A;  2XEJ A;  4NGT A;  2I3C A;  4EME A;  4O23 A;  4YWY A;  3SI0 A;  2IQ6 A;  2C1C A;  2OR4 A;  3WC5 A;  2AFS A;  3BHX A;  3WC6 A;  4X8I A;  4PXB A;  2QJ8 A;  1OBR A;  1XFO A;  1XJO A;  2PRQ A;  1FT7 A;  3PB8 X;  1ARL A;  5K8M A;  4EFD A;  1TKJ A;  3H8G A;  1Y0R A;  5F09 A;  2PJ5 A;  4A38 A;  2ZOG A;  1Y0Y A;  4NGP A;  1F57 A;  1AYE A;  5LYI A;  1ZG8 A;  3DLJ A;  3B3C A;  1YW6 A;  5LRK A;  2F8H A;  4PXC A;  1CG2 A;  1DTD A;  4OC3 A;  3D7D A;  1TF9 A;  1H8L A;  3CT9 A;  3KZW A;  4F9V A;  1HEE A;  1ZG9 A;  4TNU A;  4NJR A;  2CIJ A;  4OC5 A;  2DEA A;  5THW A;  4UEZ A;  4PQA A;  3NH5 A;  3D66 A;  2ZEL A;  7CPA A;  1IY7 A;  3IO1 A;  2BOA A;  2BO9 A;  3VAT A;  3VAR A;  4YU9 A;  5CPA A;  5ELY A;  8CPA A;  4A39 A;  3PFO A;  4MMO A;  3B3S A;  3GB0 A;  3PBB A;  3D68 A;  1LFW A;  3FED A;  2RB7 A;  4OIW A;  4DUK A;  4UEF A;  1Y7E A;  3FVL A;  3GUX A;  4R76 A;  1R43 A;  3NH4 A;  2JBJ A;  3FMC A;  4W9Y A;  4X2T A;  5HVG A;  2NYQ A;  3TX8 A;  2HB6 A;  1VGY A;  3GLJ A;  1ZLH A;  2ZEE A;  4IAV A;  3IFE A;  4PXE A;  4DYO A;  4LQG A;  3I1U A;  1Z2L A;  1ZG7 A;  2PJ3 A;  2PVW A;  3PRT A;  5D8N A;  2OOT A;  1CPX A;  1F2O A;  2O4H A;  4NGR A;  1IGB A;  1TF8 A;  4CPA A;  3BI1 A;  1YLO A;  4OC1 A;  1YME A;  2CTC A;  3NA6 A;  4P4B A;  4WJB A;  1YSJ A;  1GYT A;  4NGM A;  5HVF A;  2C6P A;  1LAM A;  4JYW A;  4Q7A A;  3HLP A;  4ZY0 A;  5DS0 A;  3V7Z A;  4PPZ A;  5K8O A;  4MCS A;  3S9N A;  2ZED A;  1PCA A;  3KR4 A;  1LAP A;  2PE3 A;  1LOK A;  1EE3 P;  1ZLI A;  2QVP A;  3NH8 A;  3D4U A;  3ISX A;  1Z5R A;  3SI1 A;  4P45 A;  4OC2 A;  4F8Z A;  3K9T A;  5K8P A;  1LCP A;  3S9L A;  2ANP A;  4MHY A;  3WAB A;  4ZI6 A;  4P4I A;  2V77 A;  2IMO A;  1BAV A;  1ELL P;  4P4J A;  1CP7 A;  2Q43 A;  5LRJ A;  2PIY A;  3NFZ A;  1XRY A;  4A94 A;  3TC8 A;  1HDQ A;  3RBU A;  5LYL A;  4UIB A;  6CPA A;  2ZEF A;  3FJU A;  1Q7L A;  3QNV A;  4NGQ A;  1LAN A;  2QYV A;  1BPM A;  2PJB A;  3IJ3 A;  3B2Y A;  3CPA A;  4OKO A;  2EWB A;  3CDX A;  2CF4 A;  1NSA A;  4GM5 A;  2GLF A;  5J1Q A;  4A37 A;  2ABZ A;  5LYD A;  3KQZ A;  1XMB A;  3MRU A;  3PB4 X;  4IHM A;  2O53 A;  3L2N A;  1TXR A;  3PFE A;  1XBU A;  2XEG A;  3S9M A;  4NGN A;  5CBM A;  1JQG A;  3K2K A;  2VL1 A;  2RFH A;  5JM6 A;  3SI2 A;  2V8V A;  5HVH A;  4P4E A;  4B6Z A;  1TKF A;  5LRG A;  2EK9 A;  3IWW A;  4ZX9 A;  3T8W A;  1VIX A;  1M4L A;  3B3W A;  1RTQ A;  2F7V A;  3H8F A;  5D29 A;  3KI9 A;  2ZEO A;  2ZEM A;  4DJL A;  2PJ7 A;  2ZOF A;  4ZY1 A;  4MHP A;  4NFR A;  4F9U A;  4OID A;  2AFO A;  2WZN A;  2PJ9 A;  4G1P A;  3SJX A;  4UEE A;  4FUU A;  4BD9 A;  4P4D A;  2CTB A;  3V38 A;  2JEW A;  3HUV A;  1TKH A;  3KHZ A;  3KAS A;  4FBE A;  4P44 A;  1VHE A;  1QQ9 A;  4AXV A;  2PJA A;  3PB6 X;  5LYF A;  3BI0 A;  4FAI A;  4X3R A;  3PEI A;  2Q51 A;  3SJF A;  3FEC A;  5JH9 A;  2PCU A;  4ONW A;  1ARM A;  1YW4 A;  4ZX8 A;  1BLL E;  4MCR A;  4OME A;  3LMS A;  2C6C A;  2BCO A;  2PVV A;  4MHN A;  3MN8 A;  4OC0 A;  3SJE A;  1CX8 A;  3KQX A;  2XEF A;  2IJZ A;  2AFU A;  2PJ8 A;  3FF3 A;  3KGQ A;  3FH4 A;  4Z65 A;  2FVG A;  2NSM A;  4FWU A;  5I4M A;  3FX6 A;  3D7F A;  1PYT B;  4PXD A;  4OC4 A;  1ELM P;  2C6G A;  4UF4 A;  4JZ0 A;  3N5F A;  3BXM A;  2AFW A;  2GRE A;  4R6T A;  4MXU A;  1QMU A;  3ISZ A;  4K3N A;  2ZEH A;  4EWT A;  2PJ4 A;  4NGS A;  2GU2 A;  3B3T A;  3KHX A;  1DE4 C;  4P6Y A;  1F2P A;  4MCP A;  3RAM A;  1CP6 A;  4KSI A;  3B3V A;  4ZY2 A;  4OP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...