2WZNA

3d structure of tet3 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
SMVDWKLMQEIIEAPGVSGYEHLGIRDIVVDVLKEVADEVKVDKLGNVIAHFKGSSPRIMVAAHMDKIGVMVNHIDKDGYLHIVPIGGVLPETLVAQRIRFFTEKGERYGVVGVLPPHLRIDWDQIVVDVGASSKEEAEEMGFRVGTVGEFAPNFTRLNEHRFATPYLDDRICLYAMIEAARQLGDHEADIYIVGSVQEEVGLRGARVASYAINPEVGIAMDVTFAKQPHDKGKIVPELGKGPVMDVGPNINPKLRAFADEVAKKYEIPLQVEPSPRPTGTDANVMQINKEGVATAVLSIPIRYMHSQVELADARDVDNTIKLAKALLEELKPMDFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural and Biochemical Characterizations of a Novel Tet Peptidase Complex from Pyrococcus Horikoshii Reveal an Integrated Peptide Degradation System in Hyperthermophilic Archaea.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords 354AA LONG HYPOTHETICAL OPERON PROTEIN FRV
total genus 107
structure length 338
sequence length 347
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05343 Peptidase_M42 M42 glutamyl aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.40 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Peptidase M42, domain 2 2wznA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2wznA01
3RAMA 1HEEA 3NH4A 4NGPA 4FBEA 1NSAA 3H8EA 3WC6A 3BI0A 2PJ5A 1CP6A 3WC7A 4X8IA 3D66A 4NGTA 1QMUA 3BXMA 4IHMA 2G9DA 3VARA 3FMCA 2PRQA 3CT9A 1VHEA 2ZEFA 1OBRA 3RBUA 4NGRA 4TWEA 3K9TA 4F9VA 3I1UA 2ZOFA 4Z65A 3PBBA 3KQZA 3IWWA 1BPNA 3D7GA 2O53A 2PE3A 1FT7A 2PJ1A 2POKA 3PFEA 5HVFA 4H2KA 4R7MA 3KQXA 2WYRA 4F8ZA 2BCOA 4OIDA 4NFRA 2V8DA 3KASA 3FVLA 3H8GA 3KZWA 8CPAA 3IIBA 1Z8LA 4MCQA 2RB7A 3WT4A 1XMBA 2ZELA 3N5FA 1YSJA 4K3NA 1VIXA 2EK8A 4AXVA 4O23A 1TF9A 4P4BA 1VGYA 5LYIA 4A94A 3T8WA 1XJOA 4WWVA 5IB9A 2BO9A 2CTBA 3IFEA 2PJ7A 5J1QA 4R8FA 2PJ8A 2XEFA 2F7VA 4P44A 2DEAA 3NH8A 2IQ6A 3RZAA 3D7DA 4OC4A 1IGBA 4OC1A 4JZ0A 3B2YA 3CPXA 1ZLHA 5ELYA 2PJ9A 2GREA 1HDQA 1ELLP 2HB6A 4MHNA 1DTDA 4EWTA 4OP4A 5K8PA 3S9LA 2ZOGA 2PJ0A 4ZX8A 3BHXA 4X2TA 5JM6A 4ZYQA 2RFHA 1F2PA 3PFOA 5THWA 1AMPA 4DYOA 2CIJA 4KSIA 1ARMA 1Y0RA 4P4EA 1FNOA 3PEIA 2JBKA 1BPMA 3KR4A 4MCPA 3ISXA 2OR4A 1CG2A 3KR5A 5CPAA 4MHPA 1BAVA 4ZY1A 5D8NA 4A39A 1VHOA 4NGSA 4DUKA 4P4JA 3BI1A 3VATA 4ZY2A 4X3RA 3TX8A 4JYWA 3FEDA 3V7ZA 3TC8A 4OC5A 1YW4A 2XEIA 4UEZA 4R76A 2AFUA 1LAMA 3D7FA 2J9AA 2ZEDA 3DLJA 1GYTA 2GU2A 4MHYA 2CF4A 3S9MA 2O4HA 3CPAA 4ZI6A 4PXBA 4MMOA 5CBMA 7CPAA 4OC3A 2AFOA 3LMSA 3K2KA 2VL1A 1PYTB 4R6TA 1YLOA 4P6YA 1DE4C 2PJBA 1JQGA 1CBXA 4NJRA 5LYLA 2EK9A 4RUHA 4ZX9A 4UEFA 2AFMA 1CX8A 2WZNA 2PJCA 4PXCA 4EFDA 4OC2A 1LFWA 4FWUA 4TNUA 5LRJA 1ZLIA 2I3CA 3L2NA 3GLJA 1LANA 5LYFA 2ZENA 3GB0A 3SI1A 3SJGA 4OC0A 3NA6A 4UIBA 1TF8A 3V38A 5K8OA 5HVGA 6CPAA 2PVWA 5DS0A 3B35A 2Q4ZA 2JEWA 2FVGA 1ARLA 4MXUA 2QYVA 4IAVA 3D68A 4UIAA 1LCPA 1RTQA 3B3CA 1ZG7A 3VH9A 2NSMA 1F57A 1F2OA 1LOKA 2EWBA 3D4UA 1ELMP 4PXEA 5JH9A 5LYDA 2V77A 4Q7AA 3PB4X 2JBJA 1BLLE 1TXRA 1XBUA 2C6PA 4YU9A 3MN8A 3WC5A 4CPAA 1UWYA 1TKJA 3HUVA 4IK2A 4YWYA 3S9NA 2PVVA 3KHZA 4MRIA 3IO1A 2AFZA 3D67A 1YMEA 2AFSA 4MHZA 2C1CA 5I4MA 4PPZA 3SI2A 4ONWA 2HC9A 2XEJA 2PIZA 3IEHA 4P4FA 2Q51A 3PBEA 3B3SA 4OKOA 1AYEA 2NYQA 1Q7LA 3D7HA 5K8NA 1PCAA 2IJZA 1CPSA 1M4LA 2ZEOA 4P4IA 4BD9A 2PIYA 3SJFA 3B7IA 4PQAA 2V8HA 4NGNA 4NGMA 4LQGA 5HXDA 2QJ8A 5F09A 3NH5A 2C6CA 1TKFA 1R43A 1HDUA 3PB6X 1XRYA 2PJ3A 5D29A 2PJ4A 2PJAA 2ZEPA 2QVPA 3FX6A 3PRTA 4A37A 4FUUA 1ZG8A 3HLPA 1ZG9A 4B6ZA 2V8VA 1QQ9A 3DGVA 5LRGA 3SJEA 4GM5A 4W9YA 3FEEA 1IY7A 2AFXA 1TKHA 1Y7EA 3KHXA 2PJ6A 3B3TA 1KWMA 3CDXA 5K8MA 3SI0A 3IJ3A 3KGQA 4P10A 4UF4A 3FJUA 4NJQA 3B3VA 4EMEA 3SJXA 5JGFA 4NGQA 2V8GA 3JRUA 3LWUA 1Z5RA 3QNVA 3PB8X 2ANPA 2BOAA 4P4DA 2OOTA 3PB9X 4ZY0A 4A38A 3GUXA 4MCSA 1CPXA 4F9UA 2ZEMA 3ISZA 2C6GA 2PJ2A 4G1PA 1Z2LA 3FECA 3FF3A 3NFZA 1XFOA 4FAIA 2IMOA 3MRUA 3FH4A 4DJLA 3H8FA 5HVHA 2PCUA 2ZEEA 2GLJA 3B3WA 4WJBA 3WABA 1LAPA 2F8HA 4OMEA 4MCRA 2ABZA 4PXDA 2Q43A 5LRKA 1EE3P 1H8LA 1Y0YA 3KL9A 2CTCA 2ZEGA 1R3NA 4OIWA 4UEEA 2ZEHA 1YW6A 3IC1A 2AFWA 2XEGA 2GLFA 3PB7X 3KI9A 1CP7A 4P45A
chains in the Genus database with same CATH superfamily
4AVZA 3RAMA 1BX0A 2Q6KA 4NGPA 3LODA 4FBEA 1ZM3A 5DSZA 3WC6A 3BI0A 5F47A 4TMZA 2ODFA 4NGTA 3GIRA 1YQEA 1QG0A 3BXMA 4Z4TA 1Q86D 3FMCA 4B5OA 4M85A 1OBRA 1A8PA 4DK0A 4HNXB 2CNSA 3I1UA 2ZOFA 3OJWA 1Q7YD 2PE3A 2PJ1A 2JJ2A 1EWYA 2WYRA 3BLNA 2BCOA 2V8DA 3CXPA 2C5BA 3T9YA 1KUYA 4GXHA 8CPAA 1E62A 1WORA 3IIBA 4NXYA 1XQBA 4UZFA 4XPLA 4CGPA 1EP1B 2R6HA 2V7WA 5AG6A 5I0CA 2ZZQA 2RC6A 5IYRA 2X8KA 4O23A 4P4BA 1S7FA 1VGYA 3CCMB 4PGOA 4WWVA 1V5VA 2PDOA 2BO9A 5CNPA 2CTBA 3DNSA 2P6FA 5AG4A 1QX4A 3G6EB 4R8FA 2PLFA 2PJ8A 2XEFA 2JJ1A 1BJKA 4P44A 2DEAA 3PP9A 5AG5A 4WQMA 2IQ6A 4R9MA 4AVCA 3F5BA 3CD6B 4UWJA 1IICA 4H6UA 4Y49C 4JZ0A 4TMWA 2AHOA 3A8IA 2W6IA 4OPOA 5ELYA 3ASPA 2JDIA 3N7ZA 1HDQA 2HB6A 4C0SA 2ZXHA 4EWTA 1UD6A 2FL4A 3LO8A 2B7BA 4KUAA 3T90A 4YRHA 1FNDA 3OP1A 1H85A 1P4NA 3G8WA 5THWA 2QGGA 3BQJA 3I55B 3CCEB 3PFOA 4ACAA 3F8KA 1S0UA 4XL9A 2CIJA 3TE4A 3W5HA 1T5EA 3LQ6A 1Y0RA 2XZOA 3CP2A 3OE7A 3ZC3A 4KKSA 3OWCA 2Q7SA 3KR4A 4AVBA 1H42A 1QH0A 1CG2A 4QVAA 4UZEA 4CQJA 2Q44A 1E1QA 2JDDA 3AVVA 2B3VA 3U6KA 4P4JA 2X0KA 5GCNA 2V7TA 4XONA 3CPWB 2Z11A 1YLEA 4JMQA 4X3RA 3RYOA 4XPKA 1OB0A 3FEDA 1WOPA 1VLYA 1R5NA 3V7ZA 2R98A 1QSMA 4OC5A 1GO2A 4UEZA 4KOXA 4BPRA 2P6EA 3CMAB 3GVKA 4P25A 4GQNA 3DLJA 2ZBUA 2GU2A 2P0WA 4Y49B 3D26A 3ZZUA 3CPAA 4ZI6A 4PXBA 1XE1A 3LMSA 4OADA 3K2KA 4DQLA 4MJ8A 1W0JA 2HDNB 4CAEA 2ZL5A 1JQGA 4CAWA 2VBSA 1S3ZA 1CBXA 4NJRA 3R6JA 5LYLA 3OAAA 4RUHA 4N3GA 2H5MA 3BCFA 2AFMA 2PJCA 4B12A 4QV2A 3PA1A 3R9GA 1GJRA 2EFGA 1LFWA 5BWAB 1KD1D 5J3OA 1Z8WA 2REEA 2BVNA 4PV6A 2GJKA 2NMTA 4RCZA 2ARHA 4KKUA 5LYFA 1QSTA 4XQFA 3I9SA 3WNCA 2D3NA 3NA6A 4OPVA 3LNNA 1WPCA 2GIVA 3AVUA 2AE6A 1H8HA 3PZJA 2QYVA 4Z4VA 3DR8A 1LCPA 4II3A 4MFPA 2YNDA 4NF1A 4ASUA 1F57A 2EVNA 1LOKA 3VO1A 4WZTA 1KK2A 5JH9A 5LYDA 3PB4X 5GV8A 3S6FA 2Q04A 4AC9A 1TXRA 2BN4A 3DR6A 1AUGA 1UWYA 3TTHA 1ZM2A 3KHZA 2B5OA 3D2MA 1YMEA 2Q6LA 3W5UA 1FNBA 1PJ6A 3QFCA 5I4MA 4XR6A 2OZHA 4A2ZA 2HC9A 3IEHA 3WNBA 2JDCA 3PBEA 4CYQA 3OEEA 2NYQA 1Q7LA 4YAOA 1PCAA 1Q9SA 1KC8D 3VR6A 1CPSA 3IWEA 4BD9A 2PIYA 2QN6A 3B8GA 2V8HA 1YX0A 2B4DB 4CYNA 4NNJA 1X10A 2Q6IA 1WWZA 5BSXA 3BY1A 2C6CA 2XGJA 2X6WA 1M44A 1E3ZA 3AVWA 4XM3A 3P2HA 3SLDA 2X7BA 4XN0A 1XF8A 1HA3A 4JXRA 2PIAA 3PRTA 2ZTNA 1VQNB 1YIJB 1M4IA 4A37A 3AVTA 4KLWA 4UBRA 1P0HA 1ZG8A 4C43A 2ZXVA 4B6ZA 2HCJB 1QQ9A 2G0BA 1K28D 4MFLA 3FEEA 2AFXA 1EP2B 1OB2A 2CNTA 2PJ6A 2ATRA 1KWMA 4X07A 4ZV4A 3IJ3A 2HUZA 4QBJA 1EP3B 3FJUA 2D9RA 4L89A 4NJQA 1M90D 5JBQA 4K1XA 5IV0A 1JWQA 1VLOA 4XLCA 3CC2B 5H84A 1Z5RA 2OU2A 4KZTA 2ANPA 4P4DA 2XEXA 1PUAA 2OOTA 4X06A 4XPDB 4RD1A 4B3FX 4TKOB 1Z8TA 4F9UA 1TVCA 4ORFA 2ZXIA 3CC4B 3A9LA 4G1VA 2BGJA 3CXQA 2F43A 3T56B 1UD4A 1QSNA 4MY3A 1OB5A 3FB3A 2GLJA 3B3WA 4HPSA 2PSWA 4WJBA 4WZKA 1LAPA 3QAYA 4MCRA 4PXDA 4LUAA 5LRKA 3KL9A 2ZEGA 2WPXA 1R3NA 3MMPA 4OIWA 3D8PA 5TRDA 1YX2A 3ZPNA 1KMHA 5EMIA 2QE7A 5IYQA 1ON0A 2GLFA 2OBRA 3EY5A 1HEEA 2HV2A 4H6ZA 3H8EA 1QUFA 4JLYA 4UA3A 1Y7RA 4OOXA 1N05A 1R5BA 2R9VA 4MFKA 3SKBA 3CT9A 5KNLA 1N08A 4KVXA 3BC9A 4NGRA 3K9TA 1QFYA 3PBBA 1BPNA 4MY0A 5A89A 4CGMA 1FT7A 1SKQA 5B6IA 1T6ZA 1Q81D 4R7MA 3KQXA 3IU1A 3ZIAA 1VJSA 3IU2A 2XZLA 4OIDA 2C78A 3H8GA 1Y9WA 1H8EA 1YHQB 1NBMA 4HIZA 2GQFA 1Z8LA 4TT3A 4NCZA 1V0EA 1YJNB 2DPTA 2QTLA 1YSJA 3I3GA 2EUIA 1TF9A 3OPOA 1DDIA 5LYIA 3JQPA 1Q2DA 1VQPB 1N0UA 1ZO0A 1K9MD 4RPDA 5L46A 3IFEA 3CB4A 4MFJA 1BX1A 2JN9A 2R7HA 1T6XA 1SM4A 1YI2B 4FWTA 3CCUB 2BUEA 3W6SA 5F48A 4IW3B 3RZAA 3JVNA 4OC4A 4ZCMA 4X0CA 1IGBA 4M6IA 3B2YA 3CPXA 1ZLHA 4DNTB 3Q6QA 4P3YA 1XMTA 4UFXA 4CS0B 2PJ9A 4M6GA 1CNFA 2GREA 2V31A 1N71A 4II9A 4MHNA 4AF6A 2YGWA 2B3UA 1LRZA 2YWHA 3S9LA 4PK3A 4LC0A 1TIQA 3LACA 4OOSA 3GSIA 1FY7A 2VNJA 4JXQA 4A31A 2FE7A 4ZYQA 2GJPA 5FIUA 4JJXA 2J7KA 3GKRA 2G3AA 4RD0A 4R57A 2O28A 4KSIA 5TY0A 3W2EA 4YAFA 3PEIA 1BPMA 4RD4A 1IIDA 3E0KA 2OR4A 3PENA 5D8NA 3FJOA 2WJYA 1Q2CA 5BSYA 1BO4A 1J4JA 3CCRB 4CGOA 4Q38A 2VNIA 5E6TA 2I1LA 5FO1A 2QMLA 5H59A 4HE5A 3TC8A 4CRZB 2XEIA 2GANA 4Y9RA 3NE8A 1BPLA 2J9AA 3CCJB 4IUSA 1GYTA 4MHYA 4UFWA 3I1FA 3G3SA 4C2YA 4MYUA 2VBTA 3S9MA 2O4HA 1JB9A 4QC6A 4MMOA 5CBMA 2Z3LA 2BSWA 1PYTB 1L0CA 4G7WA 4R6TA 4P6YA 1QGZA 4A95A 4B3GA 1MABA 3TO6A 5HMNA 2D4PA 4H9GA 2OZUA 3CXSA 4R3KA 4GS4A 4ZX9A 2D4OA 1F20A 1NSLA 3WNDA 3Q3AA 4LBYA 3G4SB 4KS9A 4TNUA 4KVOE 5HXBA 4R87A 4CAXA 4M53A 3LD2A 4R71A 1OGJA 2CY2A 2DCUA 3TOAA 5FVJA 3SJGA 1JA0A 1CQXA 1YREA 3R9EA 2Q6OA 3V38A 2R1IA 3SHPA 1B6BA 2WPDA 1X12A 2PVWA 3EC4A 2Q4ZA 5A27A 1ARLA 2X53S 3D68A 4UIAA 3LVBA 4B3XA 1RTQA 5F49A 4X7EA 2PR1A 1RQPA 1ZG7A 4UFVA 4P12A 4HNWB 2NSMA 5TR9A 3CCVB 2ZZFA 1ELMP 3E20A 4A30A 3CP8A 2V77A 4L8AA 2WJVA 1AIPA 2V7QA 4RN7A 4RM0A 3W2HA 4B43A 1RQRA 3MN8A 4CPAA 2DOGA 1VQLB 1TKJA 4IK2A 5G1ZA 2JIZA 3Q6RA 3TO7A 2PVVA 4MRIA 1OGIA 2P3MA 5ISVA 5A88A 3D67A 4CYOA 2AFSA 4MHZA 2C1CA 1WOSA 2I79A 4HNYB 2VNKA 4PPZA 4RD6A 4ONWA 2Z0ZA 4UZUA 4P9SA 4RLZA 2XEJA 3SXNA 1EXMA 1PJ5A 4YXWA 1W9XA 4PABA 4P4FA 4OKOA 2V4DA 2Q0YA 3W2FA 3FRMA 1YVKA 2ZEOA 3SJFA 2EIXA 4PQAA 1IJEA 4NGNA 4NGMA 4Z4YA 5DN6A 3TOBA 4EVYA 4B10A 2YWEA 4ZCLA 1EFUA 1T6YA 5F09A 3NH5A 2F1LA 1EFCA 1WU8A 3CC7B 1HDUA 1EFTA 1XB2A 1I1DA 4JWPA 4KOVA 2DEUA 1GVHA 2VNHA 2PJ4A 4YGOA 1QVFB 4F0YA 2QTZA 3WR7A 2I00A 1IYKA 4I49A 1MJAA 1DDGA 4KLVA 3PA2A 1FNMA 4TMXA 2B4DA 1IHMA 5FL7A 3R95A 3FNCA 3SI0A 2C4TA 4R3LA 1G7CA 3W2IA 4FD4A 4P10A 4YAUA 1Z4EA 2ZITA 2V7XA 4Z4ZA 1D2EA 4MBUA 2DIEA 2Z10A 2V8GA 3FPKA 2Y0MA 2GK7A 5FO0A 2OYNA 3JUWA 1FRNA 3PB9X 4ZY0A 3GUXA 2P6GA 1CPXA 2ZEMA 3SJPA 3ISZA 4B11A 2GE3A 4KOWA 2V7UA 4M2LA 5F4MA 4NEXA 1JNYA 3FPPA 1IOIA 4PC2A 4YEJA 3VWEA 4OOVA 2ZEEA 5EMNA 1YITB 2KVOA 2Q43A 1Y0YA 2J8RA 1QFZA 1PU9A 2A4NA 1NDHA 2ZEHA 2QA4B 1B2RA 4MHDA 3D3SA 4Z4RA 2AFWA 2NV4A 2XEGA 1NRKA 3PB7X 3KI9A 4RPBA 1JA1A 3IWGA 1WSVA 1MRZA 2BMWA 1CP6A 1Z9UA 3RNZA 3B78A 3D66A 4XNHC 1PJ7A 1QMUA 4B14A 5TV2A 2PRQA 4IF5A 4TWEA 2QECA 4F9VA 4Z65A 3R1KA 2JEVA 2POKA 5KTCA 4PC7A 4H2KA 4AB7A 1YR0A 2C5HA 1XE4A 5C82A 1S72B 4LBVA 1COWA 1DARA 4II2A 5J35A 3FVLA 1NJID 3MHPA 1YJ9B 3HAGA 4X7CA 3KZWA 3S6KA 5F46A 1K73D 4BMHA 3GYAA 1R5OA 3ZZIA 2DETA 4MCQA 3VNUA 2VZZA 1S5KA 2F4NA 3PVDA 2RB7A 3WT4A 3N5FA 1KK3A 1VIXA 2C4UA 3ZZ0A 4A94A 1XJOA 3P26A 5IB9A 1UD2A 4A32A 4CYPA 5IK2A 5J1QA 2FT0A 4KOSA 2F7VA 2BEIA 1S4MA 1Y9KA 5C88A 3D7DA 2ZBVA 4AVAA 4OC1A 2OZGA 5H86A 3QB8A 2WUUA 4G5GA 3H9NA 2Z3NA 4RCYA 1DTDA 4OP4A 5H5JA 1VQ5B 5K8PA 3FBUA 2ZW7A 2D74A 1VQ7B 3VO2A 1RO5A 4YAWA 3IGRA 3BHXA 4X2TA 4LBZA 4XKWA 1VHSA 3JTKA 5JM6A 2FSRA 1YVOA 1AMPA 2QIRA 4DYOA 1JJ2B 1QFJA 3SXOA 2V7VA 1ARMA 1OHHA 1KK0A 4A33A 1TTTA 3ISXA 5DWMA 1D8TA 3KR5A 4KOUA 1BAVA 4Q36A 4ZY1A 1Q82D 2OK7A 1XIXA 1S7KA 3D2PA 4NGSA 3K9UA 2BL1A 3CZXA 5A8AA 3BI1A 3VATA 4ZY2A 3W91A 4CAFA 4YHBA 4KUBA 3TX8A 4P1VA 3DSBA 4PSWA 5F4OA 1YW4A 2NPFA 4FXUA 2QMUA 2AFUA 2ZPAA 4P6VF 3VWDA 3D7FA 3GY9A 2CF4A 1M4GA 4Z4SA 3OKXA 2XNCA 4B44A 4FD7A 7CPAA 2AFOA 2VL1A 3WY9A 2ZZGA 1MJ9A 1VKCA 5IX3A 3EO4A 1K4JA 2HMAA 3PGPA 3BH4A 3A35A 2PJBA 3FKSA 1I8DA 4OLLA 2RC4A 4QUSA 3NE5B 3OZWA 4QUZA 5E96A 3FXTA 2EK9A 4KOYA 3CTAA 4J0QA 4P22A 1M1DA 3SLNA 4EFDA 3BNWA 3OW7A 4OC2A 3QFTA 5LRJA 1ELOA 1ZLIA 2BM0A 4PC6A 4RI1A 3W2GA 3GB0A 2GFQA 3CCQB 1TF8A 1UD8A 3ASTA 5G20A 5DWNA 5DS0A 1FRQA 2C27A 2X85A 2FVGA 1PKVA 3S6GA 4MXUA 2OTLB 3KKWA 1VQMB 2BPOA 3WYAA 1VQKB 3AVYA 1UD3A 2VJJA 3T53B 1WSRA 4MI4A 2JLMA 1CJWA 2LZJA 4AG9A 3BCDA 2FIAA 2PR8A 4CAVA 2EWBA 3CCLB 4PXEA 2YNEA 5EC4A 4Q7AA 1E3XA 4XLFA 3WQZA 2JBJA 1GHEA 4K30A 3U6BA 3A8KA 4QVJA 3OEHA 1N07A 2C6PA 1W2BB 4RS2A 3WC5A 1E1RA 1WDTA 1GR1A 3HUVA 4YWYA 4C68A 3S9NA 4PC3A 3JU4A 3BJ7A 4X05A 4TMVA 2VZYA 4MFQA 2GJRA 1E79A 3ONUA 1R57A 2KCWA 3EXNA 3SI2A 4DQKA 2YNCC 3VMFA 4AG7A 2PIZA 2FCKA 1MK4A 1NMTA 1MJBA 2VJIA 1WTHD 3B3SA 1NB9A 3R6KA 4B5PB 2GPJA 4N3NA 4OAEA 1AYEA 5IYNA 3D7HA 2Z3PA 1M4LA 3DDDA 2CBXA 3B82A 1E64A 1VQ8B 4LQGA 5HXDA 5FA6A 4ZBGA 1W0KA 3ZJ0A 4AF7A 2QJ8A 3G71B 2J8MA 2XNDA 4B4DA 1TKFA 2Z3KA 2BF4A 1R43A 3FIXA 3ES9A 4PK2A 4ZGNB 3PB6X 1XRYA 1AMOA 5D29A 3I56B 2QVPA 2ZEPA 4WZEA 3OZVA 3WBJA 4QVTA 1V0CA 3J81k 4FK8A 4FUUA 3OJXA 2OB0A 3H4QA 1I12A 1Z4RA 4XMYA 2V8VA 3DGVA 2WR8A 4GM5A 1IY7A 1E43A 1HVXA 4HKFA 3KHXA 4C7IA 1QGAA 5K8MA 3Q39A 3BY2A 3KGQA 4XOTA 3P2FA 1G7TA 4X7DA 1P4MA 3A3GA 1M4DA 3SJXA 4KOTA 5JGFA 3UY5A 1A2ZA 5JPHA 1BQEA 3SJZA 5AN9A 4YELA 4E0AA 3AGQA 3QNVA 4XORA 4JD6A 2BOAA 4KVME 2VI7A 4ZGQB 4A38A 2XZPA 2CW5A 1KK1A 4C7HA 3T51B 4RJLA 1Z2LA 1Q2YA 2B58A 3B8HA 3FECA 1KZLA 4RD3A 3FF3A 3NFZA 4B13A 1S7LA 3A3BA 3MRUA 3FH4A 4CRYB 3H8FA 5HVHA 3WABA 2F8HA 4P26A 4OMEA 2ABZA 3TT2A 1QVGB 1EE3P 1H8LA 2CTCA 2OK8A 3V8IA 4UEEA 4EH1A 1N8RD 1YW6A 3IC1A 1D1NA 4LX9A 2Q7BA 4E0FA 2VXKA 5FNZA 3FYNA 3NH4A 4RDJA 1NSAA 4G1BA 3CMMA 2PJ5A 4E8OA 2AJ6A 3WC7A 4X8IA 3W6XA 4B47A 5JQ4A 3AVXA 2W6JA 2ZTGA 4IHMA 2G9DA 3VARA 4XOPA 4KSFA 1KRHA 1VHEA 2ZEFA 5GV7A 4G6IA 3RBUA 4G7XA 4UCPA 3KQZA 3IWWA 2C77A 2QEXB 3D7GA 2O53A 1W87A 4U9ZA 1KZFA 4M6HA 3RO0A 3PFEA 5HVFA 4YALA 5HZBA 5THXA 3ASRA 1S7NA 4F8ZA 4UCNA 2BSAA 1K8AD 4NFRA 3KASA 3QE2A 1KQSB 1GAWA 1I7PA 2E1RA 3ZZTA 1IU8A 2WSAA 4XN3A 1QUEA 2B5GB 4UCMA 3A1PA 4P2NA 3CESA 1N06A 4WZLA 3U2QA 4M3SA 1XMBA 2ZELA 4QFMA 4TMTA 2VBQA 4K3NA 2EK8A 4AXVA 3CW2A 3OZUA 4RDKA 3H94A 3T8WA 1BLIA 4Z4UA 1SQHA 1RXTA 2ZW6A 2QDXA 1IJFA 1U6MA 1B23P 2PJ7A 4Q7JB 2M5SA 1ZUNB 1QSRA 3TO9A 2FS5A 3GQBA 3NH8A 1VQ9B 4X5KA 2CK3A 4M0LA 2C2WA 5HZAA 4FD6A 4M1KA 4PC1A 4U9UA 3G05A 2DERA 1ELLP 2R8VA 4ZCIA 3GVLA 3ASQA 4HE6A 1ZM4A 3RY8A 4DNCA 2CRVA 2ZOGA 1U2RA 2PJ0A 2ZW5A 1I21A 4BINA 1NE9A 4ZX8A 3AGPA 1B87A 2RFHA 4B48A 1F2PA 4UAJA 3JQRA 2FIWA 5CDFA 1N0VC 2DYIA 1FX0A 3F0AA 4P4EA 1FNOA 1QGYA 4Z1MA 4MYTA 2JBKA 4KKTA 4MCPA 3ONYA 4Y9UA 1IOFA 5CPAA 5KTAA 4MHPA 1E63A 4CGLA 4A39A 2CNDA 4F7DA 3NE7A 1VHOA 1S60A 5HH1A 1XOVA 1KTVA 4DUKA 3Q38A 4JYWA 4KSAA 1HZEA 3CMEB 4DNRB 2VYQA 2REFA 4R76A 1WOOA 3OFNA 2YNCA 2WZPP 4F0XA 2VBUA 1LAMA 2VQYA 4XKVA 2Q4VA 4L8JA 2ZEDA 4Z4WA 2PQ8A 1KUXA 5KSWB 3WBKA 2BM1A 4H89A 1G7SA 2VZLA 3QAHA 1W35A 2B5GA 2XOKA 4QB9A 3R96A 4OC3A 1BMFA 1QSOA 1DG1G 2F1MA 2FXFA 4OP7A 1YLOA 3ZBUA 1DE4C 5AGEA 3SEJA 4ACBA 2GK6A 4XLAA 3MCAA 2B7CA 2HQYA 3MGDA 4B5PA 3VNVA 4PSXA 1KUVA 1IYLA 4UEFA 1CX8A 2WZNA 4LQ6A 4PXCA 3H5ZA 3ZUGA 2IL4A 2Q4YA 4FWUA 5HKKA 2FX3A 2Z6BD 2I3CA 3L2NA 1BOBA 3GLJA 2PRBA 1LANA 3ZBTA 1YJWB 1VQ4B 4XNHB 3R9FA 2ZENA 2X6XA 3SI1A 2G3TA 4OC0A 4UIBA 4DK1A 4UWIA 2PMDA 5K8OA 5HVGA 2HLDA 6CPAA 2Z3MA 3B35A 4M4SA 1TUIA 2JEWA 4C2XA 2E1BA 2J8NA 3P27A 2OH1A 5LMZA 4IAVA 1IB1E 2WPWA 2DPSA 3B3CA 2WSSA 4TN1A 3QFSA 3KEWA 2CXAA 2DXQA 3VH9A 3GIUA 1F2OA 2EBJA 4MFZA 3D4UA 3WXMA 1BLLE 3GVJA 4FD5A 4XNFA 1XBUA 4CGNA 4YU9A 3V7AA 4U5YA 1VQ6B 1FDRA 2BV3A 4RD2A 3OW2B 3ASSA 4NSQA 4OPSA 4XD7A 1UMKA 3PUNA 3A8JA 3IO1A 4BBHA 2AFZA 4TSFA 1G7RA 1IB0A 4P3IA 3CXCB 1YGHA 3C26A 1ZM9A 2VEZA 4XLHA 1KJZA 5IYWA 3CCSB 2Q51A 2ZZEA 2VBVA 5K8NA 2ZL6A 2IJZA 2DF5A 4P4IA 2X6YA 5F4JA 2B4BA 3B7IA 2DY1A 2OTJB 1VQOB 2F5IA 2OBSA 3W5VA 2PJ3A 2K5TA 5EBVA 2PJAA 3OOCA 4J3GA 3FX6A 2CC2A 2PC1A 2OBTA 3V76A 4PAAA 2EO8A 1CNEA 2Z3OA 3HLPA 1FNCA 1ZG9A 3LQEA 3JQQA 2YWGA 4LBWA 5LRGA 3SJEA 4F6AA 3TCVA 1F60A 4W9YA 3S6HA 1TKHA 1Y7EA 5AG7A 3B3TA 4X7FA 3CDXA 1V0FA 1OZPA 5G22A 3DDYA 3E1YE 4FN5A 4XLEA 4UF4A 3PUMA 3B3VA 4EMEA 5KTDA 5J8CA 2CNMA 1UD5A 1I18A 1YK3A 4NGQA 1WP6A 2X3UA 3JRUA 3LWUA 5KW9A 5G21A 1EFRA 4KORA 4ROXA 3PB8X 3QFRA 3CRZA 2ZL7A 1NB0A 3TFYA 1TLLA 1M1KD 4YFJA 4MCSA 1XEBA 4NBSA 2C6GA 2PJ2A 1J9ZA 4G1PA 4Y7CA 2RC5A 4E2AA 1UFHA 1WK4A 1XFOA 4FAIA 2D3LA 1W34A 2IMOA 4DJLA 5IB0A 2BGIA 2XNJA 4XPDC 3BJ8A 2ZW4A 2PCUA 5J8FA 4RDLA 3QSYA 4C2ZA 5A28A 1VF7A 2YWFA 4NCNA 4ZGYB 1GAQA 3EFAA 1SKYB 1Z8XA 5IYPA 1CM0A 4ONUA 4QHYA 4U9YA 1CP7A 4P45A
chains in the Genus database with same CATH topology
3RAMA 1HEEA 3NH4A 4NGPA 4FBEA 1NSAA 3H8EA 3WC6A 3BI0A 2PJ5A 1CP6A 3WC7A 4X8IA 3D66A 4NGTA 1QMUA 3BXMA 4IHMA 2G9DA 3VARA 3FMCA 2PRQA 3CT9A 1VHEA 2ZEFA 1OBRA 3RBUA 4NGRA 4TWEA 3K9TA 4F9VA 3I1UA 2ZOFA 4Z65A 3PBBA 3KQZA 3IWWA 1BPNA 3D7GA 2O53A 2PE3A 1FT7A 2PJ1A 2POKA 3PFEA 5HVFA 4H2KA 4R7MA 3KQXA 2WYRA 4F8ZA 2BCOA 4OIDA 4NFRA 2V8DA 3KASA 3FVLA 3H8GA 3KZWA 8CPAA 3IIBA 1Z8LA 4MCQA 2RB7A 3WT4A 1XMBA 2ZELA 3N5FA 1YSJA 4K3NA 1VIXA 2EK8A 4AXVA 4O23A 1TF9A 4P4BA 1VGYA 5LYIA 4A94A 3T8WA 1XJOA 4WWVA 5IB9A 2BO9A 2CTBA 3IFEA 2PJ7A 5J1QA 4R8FA 2PJ8A 2XEFA 2F7VA 4P44A 2DEAA 3NH8A 2IQ6A 3RZAA 3D7DA 4OC4A 1IGBA 4OC1A 4JZ0A 3B2YA 3CPXA 1ZLHA 5ELYA 2PJ9A 2GREA 1HDQA 1ELLP 2HB6A 4MHNA 1DTDA 4EWTA 4OP4A 5K8PA 3S9LA 2ZOGA 2PJ0A 4ZX8A 3BHXA 4X2TA 5JM6A 4ZYQA 2RFHA 1F2PA 3PFOA 5THWA 1AMPA 4DYOA 2CIJA 4KSIA 1ARMA 1Y0RA 4P4EA 1FNOA 3PEIA 2JBKA 1BPMA 3KR4A 4MCPA 3ISXA 2OR4A 1CG2A 3KR5A 5CPAA 4MHPA 1BAVA 4ZY1A 5D8NA 4A39A 1VHOA 4NGSA 4DUKA 4P4JA 3BI1A 3VATA 4ZY2A 4X3RA 3TX8A 4JYWA 3FEDA 3V7ZA 3TC8A 4OC5A 1YW4A 2XEIA 4UEZA 4R76A 2AFUA 1LAMA 3D7FA 2J9AA 2ZEDA 3DLJA 1GYTA 2GU2A 4MHYA 2CF4A 3S9MA 2O4HA 3CPAA 4ZI6A 4PXBA 4MMOA 5CBMA 7CPAA 4OC3A 2AFOA 3LMSA 3K2KA 2VL1A 1PYTB 4R6TA 1YLOA 4P6YA 1DE4C 2PJBA 1JQGA 1CBXA 4NJRA 5LYLA 2EK9A 4RUHA 4ZX9A 4UEFA 2AFMA 1CX8A 2WZNA 2PJCA 4PXCA 4EFDA 4OC2A 1LFWA 4FWUA 4TNUA 5LRJA 1ZLIA 2I3CA 3L2NA 3GLJA 1LANA 5LYFA 2ZENA 3GB0A 3SI1A 3SJGA 4OC0A 3NA6A 4UIBA 1TF8A 3V38A 5K8OA 5HVGA 6CPAA 2PVWA 5DS0A 3B35A 2Q4ZA 2JEWA 2FVGA 1ARLA 4MXUA 2QYVA 4IAVA 3D68A 4UIAA 1LCPA 1RTQA 3B3CA 1ZG7A 3VH9A 2NSMA 1F57A 1F2OA 1LOKA 2EWBA 3D4UA 1ELMP 4PXEA 5JH9A 5LYDA 2V77A 4Q7AA 3PB4X 2JBJA 1BLLE 1TXRA 1XBUA 2C6PA 4YU9A 3MN8A 3WC5A 4CPAA 1UWYA 1TKJA 3HUVA 4IK2A 4YWYA 3S9NA 2PVVA 3KHZA 4MRIA 3IO1A 2AFZA 3D67A 1YMEA 2AFSA 4MHZA 2C1CA 5I4MA 4PPZA 3SI2A 4ONWA 2HC9A 2XEJA 2PIZA 3IEHA 4P4FA 2Q51A 3PBEA 3B3SA 4OKOA 1AYEA 2NYQA 1Q7LA 3D7HA 5K8NA 1PCAA 2IJZA 1CPSA 1M4LA 2ZEOA 4P4IA 4BD9A 2PIYA 3SJFA 3B7IA 4PQAA 2V8HA 4NGNA 4NGMA 4LQGA 5HXDA 2QJ8A 5F09A 3NH5A 2C6CA 1TKFA 1R43A 1HDUA 3PB6X 1XRYA 2PJ3A 5D29A 2PJ4A 2PJAA 2ZEPA 2QVPA 3FX6A 3PRTA 4A37A 4FUUA 1ZG8A 3HLPA 1ZG9A 4B6ZA 2V8VA 1QQ9A 3DGVA 5LRGA 3SJEA 4GM5A 4W9YA 3FEEA 1IY7A 2AFXA 1TKHA 1Y7EA 3KHXA 2PJ6A 3B3TA 1KWMA 3CDXA 5K8MA 3SI0A 3IJ3A 3KGQA 4P10A 4UF4A 3FJUA 4NJQA 3B3VA 4EMEA 3SJXA 5JGFA 4NGQA 2V8GA 3JRUA 3LWUA 1Z5RA 3QNVA 3PB8X 2ANPA 2BOAA 4P4DA 2OOTA 3PB9X 4ZY0A 4A38A 3GUXA 4MCSA 1CPXA 4F9UA 2ZEMA 3ISZA 2C6GA 2PJ2A 4G1PA 1Z2LA 3FECA 3FF3A 3NFZA 1XFOA 4FAIA 2IMOA 3MRUA 3FH4A 4DJLA 3H8FA 5HVHA 2PCUA 2ZEEA 2GLJA 3B3WA 4WJBA 3WABA 1LAPA 2F8HA 4OMEA 4MCRA 2ABZA 4PXDA 2Q43A 5LRKA 1EE3P 1H8LA 1Y0YA 3KL9A 2CTCA 2ZEGA 1R3NA 4OIWA 4UEEA 2ZEHA 1YW6A 3IC1A 2AFWA 2XEGA 2GLFA 3PB7X 3KI9A 1CP7A 4P45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAM A;  1HEE A;  3NH4 A;  4NGP A;  4FBE A;  1NSA A;  3H8E A;  3WC6 A;  3BI0 A;  2PJ5 A;  1CP6 A;  3WC7 A;  4X8I A;  3D66 A;  4NGT A;  1QMU A;  3BXM A;  4IHM A;  2G9D A;  3VAR A;  3FMC A;  2PRQ A;  3CT9 A;  1VHE A;  2ZEF A;  1OBR A;  3RBU A;  4NGR A;  4TWE A;  3K9T A;  4F9V A;  3I1U A;  2ZOF A;  4Z65 A;  3PBB A;  3KQZ A;  3IWW A;  1BPN A;  3D7G A;  2O53 A;  2PE3 A;  1FT7 A;  2PJ1 A;  2POK A;  3PFE A;  5HVF A;  4H2K A;  4R7M A;  3KQX A;  2WYR A;  4F8Z A;  2BCO A;  4OID A;  4NFR A;  2V8D A;  3KAS A;  3FVL A;  3H8G A;  3KZW A;  8CPA A;  3IIB A;  1Z8L A;  4MCQ A;  2RB7 A;  3WT4 A;  1XMB A;  2ZEL A;  3N5F A;  1YSJ A;  4K3N A;  1VIX A;  2EK8 A;  4AXV A;  4O23 A;  1TF9 A;  4P4B A;  1VGY A;  5LYI A;  4A94 A;  3T8W A;  1XJO A;  4WWV A;  5IB9 A;  2BO9 A;  2CTB A;  3IFE A;  2PJ7 A;  5J1Q A;  4R8F A;  2PJ8 A;  2XEF A;  2F7V A;  4P44 A;  2DEA A;  3NH8 A;  2IQ6 A;  3RZA A;  3D7D A;  4OC4 A;  1IGB A;  4OC1 A;  4JZ0 A;  3B2Y A;  3CPX A;  1ZLH A;  5ELY A;  2PJ9 A;  2GRE A;  1HDQ A;  1ELL P;  2HB6 A;  4MHN A;  1DTD A;  4EWT A;  4OP4 A;  5K8P A;  3S9L A;  2ZOG A;  2PJ0 A;  4ZX8 A;  3BHX A;  4X2T A;  5JM6 A;  4ZYQ A;  2RFH A;  1F2P A;  3PFO A;  5THW A;  1AMP A;  4DYO A;  2CIJ A;  4KSI A;  1ARM A;  1Y0R A;  4P4E A;  1FNO A;  3PEI A;  2JBK A;  1BPM A;  3KR4 A;  4MCP A;  3ISX A;  2OR4 A;  1CG2 A;  3KR5 A;  5CPA A;  4MHP A;  1BAV A;  4ZY1 A;  5D8N A;  4A39 A;  1VHO A;  4NGS A;  4DUK A;  4P4J A;  3BI1 A;  3VAT A;  4ZY2 A;  4X3R A;  3TX8 A;  4JYW A;  3FED A;  3V7Z A;  3TC8 A;  4OC5 A;  1YW4 A;  2XEI A;  4UEZ A;  4R76 A;  2AFU A;  1LAM A;  3D7F A;  2J9A A;  2ZED A;  3DLJ A;  1GYT A;  2GU2 A;  4MHY A;  2CF4 A;  3S9M A;  2O4H A;  3CPA A;  4ZI6 A;  4PXB A;  4MMO A;  5CBM A;  7CPA A;  4OC3 A;  2AFO A;  3LMS A;  3K2K A;  2VL1 A;  1PYT B;  4R6T A;  1YLO A;  4P6Y A;  1DE4 C;  2PJB A;  1JQG A;  1CBX A;  4NJR A;  5LYL A;  2EK9 A;  4RUH A;  4ZX9 A;  4UEF A;  2AFM A;  1CX8 A;  2WZN A;  2PJC A;  4PXC A;  4EFD A;  4OC2 A;  1LFW A;  4FWU A;  4TNU A;  5LRJ A;  1ZLI A;  2I3C A;  3L2N A;  3GLJ A;  1LAN A;  5LYF A;  2ZEN A;  3GB0 A;  3SI1 A;  3SJG A;  4OC0 A;  3NA6 A;  4UIB A;  1TF8 A;  3V38 A;  5K8O A;  5HVG A;  6CPA A;  2PVW A;  5DS0 A;  3B35 A;  2Q4Z A;  2JEW A;  2FVG A;  1ARL A;  4MXU A;  2QYV A;  4IAV A;  3D68 A;  4UIA A;  1LCP A;  1RTQ A;  3B3C A;  1ZG7 A;  3VH9 A;  2NSM A;  1F57 A;  1F2O A;  1LOK A;  2EWB A;  3D4U A;  1ELM P;  4PXE A;  5JH9 A;  5LYD A;  2V77 A;  4Q7A A;  3PB4 X;  2JBJ A;  1BLL E;  1TXR A;  1XBU A;  2C6P A;  4YU9 A;  3MN8 A;  3WC5 A;  4CPA A;  1UWY A;  1TKJ A;  3HUV A;  4IK2 A;  4YWY A;  3S9N A;  2PVV A;  3KHZ A;  4MRI A;  3IO1 A;  2AFZ A;  3D67 A;  1YME A;  2AFS A;  4MHZ A;  2C1C A;  5I4M A;  4PPZ A;  3SI2 A;  4ONW A;  2HC9 A;  2XEJ A;  2PIZ A;  3IEH A;  4P4F A;  2Q51 A;  3PBE A;  3B3S A;  4OKO A;  1AYE A;  2NYQ A;  1Q7L A;  3D7H A;  5K8N A;  1PCA A;  2IJZ A;  1CPS A;  1M4L A;  2ZEO A;  4P4I A;  4BD9 A;  2PIY A;  3SJF A;  3B7I A;  4PQA A;  2V8H A;  4NGN A;  4NGM A;  4LQG A;  5HXD A;  2QJ8 A;  5F09 A;  3NH5 A;  2C6C A;  1TKF A;  1R43 A;  1HDU A;  3PB6 X;  1XRY A;  2PJ3 A;  5D29 A;  2PJ4 A;  2PJA A;  2ZEP A;  2QVP A;  3FX6 A;  3PRT A;  4A37 A;  4FUU A;  1ZG8 A;  3HLP A;  1ZG9 A;  4B6Z A;  2V8V A;  1QQ9 A;  3DGV A;  5LRG A;  3SJE A;  4GM5 A;  4W9Y A;  3FEE A;  1IY7 A;  2AFX A;  1TKH A;  1Y7E A;  3KHX A;  2PJ6 A;  3B3T A;  1KWM A;  3CDX A;  5K8M A;  3SI0 A;  3IJ3 A;  3KGQ A;  4P10 A;  4UF4 A;  3FJU A;  4NJQ A;  3B3V A;  4EME A;  3SJX A;  5JGF A;  4NGQ A;  2V8G A;  3JRU A;  3LWU A;  1Z5R A;  3QNV A;  3PB8 X;  2ANP A;  2BOA A;  4P4D A;  2OOT A;  3PB9 X;  4ZY0 A;  4A38 A;  3GUX A;  4MCS A;  1CPX A;  4F9U A;  2ZEM A;  3ISZ A;  2C6G A;  2PJ2 A;  4G1P A;  1Z2L A;  3FEC A;  3FF3 A;  3NFZ A;  1XFO A;  4FAI A;  2IMO A;  3MRU A;  3FH4 A;  4DJL A;  3H8F A;  5HVH A;  2PCU A;  2ZEE A;  2GLJ A;  3B3W A;  4WJB A;  3WAB A;  1LAP A;  2F8H A;  4OME A;  4MCR A;  2ABZ A;  4PXD A;  2Q43 A;  5LRK A;  1EE3 P;  1H8L A;  1Y0Y A;  3KL9 A;  2CTC A;  2ZEG A;  1R3N A;  4OIW A;  4UEE A;  2ZEH A;  1YW6 A;  3IC1 A;  2AFW A;  2XEG A;  2GLF A;  3PB7 X;  3KI9 A;  1CP7 A;  4P45 A; 
#chains in the Genus database with same CATH topology
 4AVZ A;  3RAM A;  1BX0 A;  2Q6K A;  4NGP A;  3LOD A;  4FBE A;  1ZM3 A;  5DSZ A;  3WC6 A;  3BI0 A;  5F47 A;  4TMZ A;  2ODF A;  4NGT A;  3GIR A;  1YQE A;  1QG0 A;  3BXM A;  4Z4T A;  1Q86 D;  3FMC A;  4B5O A;  4M85 A;  1OBR A;  1A8P A;  4DK0 A;  4HNX B;  2CNS A;  3I1U A;  2ZOF A;  3OJW A;  1Q7Y D;  2PE3 A;  2PJ1 A;  2JJ2 A;  1EWY A;  2WYR A;  3BLN A;  2BCO A;  2V8D A;  3CXP A;  2C5B A;  3T9Y A;  1KUY A;  4GXH A;  8CPA A;  1E62 A;  1WOR A;  3IIB A;  4NXY A;  1XQB A;  4UZF A;  4XPL A;  4CGP A;  1EP1 B;  2R6H A;  2V7W A;  5AG6 A;  5I0C A;  2ZZQ A;  2RC6 A;  5IYR A;  2X8K A;  4O23 A;  4P4B A;  1S7F A;  1VGY A;  3CCM B;  4PGO A;  4WWV A;  1V5V A;  2PDO A;  2BO9 A;  5CNP A;  2CTB A;  3DNS A;  2P6F A;  5AG4 A;  1QX4 A;  3G6E B;  4R8F A;  2PLF A;  2PJ8 A;  2XEF A;  2JJ1 A;  1BJK A;  4P44 A;  2DEA A;  3PP9 A;  5AG5 A;  4WQM A;  2IQ6 A;  4R9M A;  4AVC A;  3F5B A;  3CD6 B;  4UWJ A;  1IIC A;  4H6U A;  4Y49 C;  4JZ0 A;  4TMW A;  2AHO A;  3A8I A;  2W6I A;  4OPO A;  5ELY A;  3ASP A;  2JDI A;  3N7Z A;  1HDQ A;  2HB6 A;  4C0S A;  2ZXH A;  4EWT A;  1UD6 A;  2FL4 A;  3LO8 A;  2B7B A;  4KUA A;  3T90 A;  4YRH A;  1FND A;  3OP1 A;  1H85 A;  1P4N A;  3G8W A;  5THW A;  2QGG A;  3BQJ A;  3I55 B;  3CCE B;  3PFO A;  4ACA A;  3F8K A;  1S0U A;  4XL9 A;  2CIJ A;  3TE4 A;  3W5H A;  1T5E A;  3LQ6 A;  1Y0R A;  2XZO A;  3CP2 A;  3OE7 A;  3ZC3 A;  4KKS A;  3OWC A;  2Q7S A;  3KR4 A;  4AVB A;  1H42 A;  1QH0 A;  1CG2 A;  4QVA A;  4UZE A;  4CQJ A;  2Q44 A;  1E1Q A;  2JDD A;  3AVV A;  2B3V A;  3U6K A;  4P4J A;  2X0K A;  5GCN A;  2V7T A;  4XON A;  3CPW B;  2Z11 A;  1YLE A;  4JMQ A;  4X3R A;  3RYO A;  4XPK A;  1OB0 A;  3FED A;  1WOP A;  1VLY A;  1R5N A;  3V7Z A;  2R98 A;  1QSM A;  4OC5 A;  1GO2 A;  4UEZ A;  4KOX A;  4BPR A;  2P6E A;  3CMA B;  3GVK A;  4P25 A;  4GQN A;  3DLJ A;  2ZBU A;  2GU2 A;  2P0W A;  4Y49 B;  3D26 A;  3ZZU A;  3CPA A;  4ZI6 A;  4PXB A;  1XE1 A;  3LMS A;  4OAD A;  3K2K A;  4DQL A;  4MJ8 A;  1W0J A;  2HDN B;  4CAE A;  2ZL5 A;  1JQG A;  4CAW A;  2VBS A;  1S3Z A;  1CBX A;  4NJR A;  3R6J A;  5LYL A;  3OAA A;  4RUH A;  4N3G A;  2H5M A;  3BCF A;  2AFM A;  2PJC A;  4B12 A;  4QV2 A;  3PA1 A;  3R9G A;  1GJR A;  2EFG A;  1LFW A;  5BWA B;  1KD1 D;  5J3O A;  1Z8W A;  2REE A;  2BVN A;  4PV6 A;  2GJK A;  2NMT A;  4RCZ A;  2ARH A;  4KKU A;  5LYF A;  1QST A;  4XQF A;  3I9S A;  3WNC A;  2D3N A;  3NA6 A;  4OPV A;  3LNN A;  1WPC A;  2GIV A;  3AVU A;  2AE6 A;  1H8H A;  3PZJ A;  2QYV A;  4Z4V A;  3DR8 A;  1LCP A;  4II3 A;  4MFP A;  2YND A;  4NF1 A;  4ASU A;  1F57 A;  2EVN A;  1LOK A;  3VO1 A;  4WZT A;  1KK2 A;  5JH9 A;  5LYD A;  3PB4 X;  5GV8 A;  3S6F A;  2Q04 A;  4AC9 A;  1TXR A;  2BN4 A;  3DR6 A;  1AUG A;  1UWY A;  3TTH A;  1ZM2 A;  3KHZ A;  2B5O A;  3D2M A;  1YME A;  2Q6L A;  3W5U A;  1FNB A;  1PJ6 A;  3QFC A;  5I4M A;  4XR6 A;  2OZH A;  4A2Z A;  2HC9 A;  3IEH A;  3WNB A;  2JDC A;  3PBE A;  4CYQ A;  3OEE A;  2NYQ A;  1Q7L A;  4YAO A;  1PCA A;  1Q9S A;  1KC8 D;  3VR6 A;  1CPS A;  3IWE A;  4BD9 A;  2PIY A;  2QN6 A;  3B8G A;  2V8H A;  1YX0 A;  2B4D B;  4CYN A;  4NNJ A;  1X10 A;  2Q6I A;  1WWZ A;  5BSX A;  3BY1 A;  2C6C A;  2XGJ A;  2X6W A;  1M44 A;  1E3Z A;  3AVW A;  4XM3 A;  3P2H A;  3SLD A;  2X7B A;  4XN0 A;  1XF8 A;  1HA3 A;  4JXR A;  2PIA A;  3PRT A;  2ZTN A;  1VQN B;  1YIJ B;  1M4I A;  4A37 A;  3AVT A;  4KLW A;  4UBR A;  1P0H A;  1ZG8 A;  4C43 A;  2ZXV A;  4B6Z A;  2HCJ B;  1QQ9 A;  2G0B A;  1K28 D;  4MFL A;  3FEE A;  2AFX A;  1EP2 B;  1OB2 A;  2CNT A;  2PJ6 A;  2ATR A;  1KWM A;  4X07 A;  4ZV4 A;  3IJ3 A;  2HUZ A;  4QBJ A;  1EP3 B;  3FJU A;  2D9R A;  4L89 A;  4NJQ A;  1M90 D;  5JBQ A;  4K1X A;  5IV0 A;  1JWQ A;  1VLO A;  4XLC A;  3CC2 B;  5H84 A;  1Z5R A;  2OU2 A;  4KZT A;  2ANP A;  4P4D A;  2XEX A;  1PUA A;  2OOT A;  4X06 A;  4XPD B;  4RD1 A;  4B3F X;  4TKO B;  1Z8T A;  4F9U A;  1TVC A;  4ORF A;  2ZXI A;  3CC4 B;  3A9L A;  4G1V A;  2BGJ A;  3CXQ A;  2F43 A;  3T56 B;  1UD4 A;  1QSN A;  4MY3 A;  1OB5 A;  3FB3 A;  2GLJ A;  3B3W A;  4HPS A;  2PSW A;  4WJB A;  4WZK A;  1LAP A;  3QAY A;  4MCR A;  4PXD A;  4LUA A;  5LRK A;  3KL9 A;  2ZEG A;  2WPX A;  1R3N A;  3MMP A;  4OIW A;  3D8P A;  5TRD A;  1YX2 A;  3ZPN A;  1KMH A;  5EMI A;  2QE7 A;  5IYQ A;  1ON0 A;  2GLF A;  2OBR A;  3EY5 A;  1HEE A;  2HV2 A;  4H6Z A;  3H8E A;  1QUF A;  4JLY A;  4UA3 A;  1Y7R A;  4OOX A;  1N05 A;  1R5B A;  2R9V A;  4MFK A;  3SKB A;  3CT9 A;  5KNL A;  1N08 A;  4KVX A;  3BC9 A;  4NGR A;  3K9T A;  1QFY A;  3PBB A;  1BPN A;  4MY0 A;  5A89 A;  4CGM A;  1FT7 A;  1SKQ A;  5B6I A;  1T6Z A;  1Q81 D;  4R7M A;  3KQX A;  3IU1 A;  3ZIA A;  1VJS A;  3IU2 A;  2XZL A;  4OID A;  2C78 A;  3H8G A;  1Y9W A;  1H8E A;  1YHQ B;  1NBM A;  4HIZ A;  2GQF A;  1Z8L A;  4TT3 A;  4NCZ A;  1V0E A;  1YJN B;  2DPT A;  2QTL A;  1YSJ A;  3I3G A;  2EUI A;  1TF9 A;  3OPO A;  1DDI A;  5LYI A;  3JQP A;  1Q2D A;  1VQP B;  1N0U A;  1ZO0 A;  1K9M D;  4RPD A;  5L46 A;  3IFE A;  3CB4 A;  4MFJ A;  1BX1 A;  2JN9 A;  2R7H A;  1T6X A;  1SM4 A;  1YI2 B;  4FWT A;  3CCU B;  2BUE A;  3W6S A;  5F48 A;  4IW3 B;  3RZA A;  3JVN A;  4OC4 A;  4ZCM A;  4X0C A;  1IGB A;  4M6I A;  3B2Y A;  3CPX A;  1ZLH A;  4DNT B;  3Q6Q A;  4P3Y A;  1XMT A;  4UFX A;  4CS0 B;  2PJ9 A;  4M6G A;  1CNF A;  2GRE A;  2V31 A;  1N71 A;  4II9 A;  4MHN A;  4AF6 A;  2YGW A;  2B3U A;  1LRZ A;  2YWH A;  3S9L A;  4PK3 A;  4LC0 A;  1TIQ A;  3LAC A;  4OOS A;  3GSI A;  1FY7 A;  2VNJ A;  4JXQ A;  4A31 A;  2FE7 A;  4ZYQ A;  2GJP A;  5FIU A;  4JJX A;  2J7K A;  3GKR A;  2G3A A;  4RD0 A;  4R57 A;  2O28 A;  4KSI A;  5TY0 A;  3W2E A;  4YAF A;  3PEI A;  1BPM A;  4RD4 A;  1IID A;  3E0K A;  2OR4 A;  3PEN A;  5D8N A;  3FJO A;  2WJY A;  1Q2C A;  5BSY A;  1BO4 A;  1J4J A;  3CCR B;  4CGO A;  4Q38 A;  2VNI A;  5E6T A;  2I1L A;  5FO1 A;  2QML A;  5H59 A;  4HE5 A;  3TC8 A;  4CRZ B;  2XEI A;  2GAN A;  4Y9R A;  3NE8 A;  1BPL A;  2J9A A;  3CCJ B;  4IUS A;  1GYT A;  4MHY A;  4UFW A;  3I1F A;  3G3S A;  4C2Y A;  4MYU A;  2VBT A;  3S9M A;  2O4H A;  1JB9 A;  4QC6 A;  4MMO A;  5CBM A;  2Z3L A;  2BSW A;  1PYT B;  1L0C A;  4G7W A;  4R6T A;  4P6Y A;  1QGZ A;  4A95 A;  4B3G A;  1MAB A;  3TO6 A;  5HMN A;  2D4P A;  4H9G A;  2OZU A;  3CXS A;  4R3K A;  4GS4 A;  4ZX9 A;  2D4O A;  1F20 A;  1NSL A;  3WND A;  3Q3A A;  4LBY A;  3G4S B;  4KS9 A;  4TNU A;  4KVO E;  5HXB A;  4R87 A;  4CAX A;  4M53 A;  3LD2 A;  4R71 A;  1OGJ A;  2CY2 A;  2DCU A;  3TOA A;  5FVJ A;  3SJG A;  1JA0 A;  1CQX A;  1YRE A;  3R9E A;  2Q6O A;  3V38 A;  2R1I A;  3SHP A;  1B6B A;  2WPD A;  1X12 A;  2PVW A;  3EC4 A;  2Q4Z A;  5A27 A;  1ARL A;  2X53 S;  3D68 A;  4UIA A;  3LVB A;  4B3X A;  1RTQ A;  5F49 A;  4X7E A;  2PR1 A;  1RQP A;  1ZG7 A;  4UFV A;  4P12 A;  4HNW B;  2NSM A;  5TR9 A;  3CCV B;  2ZZF A;  1ELM P;  3E20 A;  4A30 A;  3CP8 A;  2V77 A;  4L8A A;  2WJV A;  1AIP A;  2V7Q A;  4RN7 A;  4RM0 A;  3W2H A;  4B43 A;  1RQR A;  3MN8 A;  4CPA A;  2DOG A;  1VQL B;  1TKJ A;  4IK2 A;  5G1Z A;  2JIZ A;  3Q6R A;  3TO7 A;  2PVV A;  4MRI A;  1OGI A;  2P3M A;  5ISV A;  5A88 A;  3D67 A;  4CYO A;  2AFS A;  4MHZ A;  2C1C A;  1WOS A;  2I79 A;  4HNY B;  2VNK A;  4PPZ A;  4RD6 A;  4ONW A;  2Z0Z A;  4UZU A;  4P9S A;  4RLZ A;  2XEJ A;  3SXN A;  1EXM A;  1PJ5 A;  4YXW A;  1W9X A;  4PAB A;  4P4F A;  4OKO A;  2V4D A;  2Q0Y A;  3W2F A;  3FRM A;  1YVK A;  2ZEO A;  3SJF A;  2EIX A;  4PQA A;  1IJE A;  4NGN A;  4NGM A;  4Z4Y A;  5DN6 A;  3TOB A;  4EVY A;  4B10 A;  2YWE A;  4ZCL A;  1EFU A;  1T6Y A;  5F09 A;  3NH5 A;  2F1L A;  1EFC A;  1WU8 A;  3CC7 B;  1HDU A;  1EFT A;  1XB2 A;  1I1D A;  4JWP A;  4KOV A;  2DEU A;  1GVH A;  2VNH A;  2PJ4 A;  4YGO A;  1QVF B;  4F0Y A;  2QTZ A;  3WR7 A;  2I00 A;  1IYK A;  4I49 A;  1MJA A;  1DDG A;  4KLV A;  3PA2 A;  1FNM A;  4TMX A;  2B4D A;  1IHM A;  5FL7 A;  3R95 A;  3FNC A;  3SI0 A;  2C4T A;  4R3L A;  1G7C A;  3W2I A;  4FD4 A;  4P10 A;  4YAU A;  1Z4E A;  2ZIT A;  2V7X A;  4Z4Z A;  1D2E A;  4MBU A;  2DIE A;  2Z10 A;  2V8G A;  3FPK A;  2Y0M A;  2GK7 A;  5FO0 A;  2OYN A;  3JUW A;  1FRN A;  3PB9 X;  4ZY0 A;  3GUX A;  2P6G A;  1CPX A;  2ZEM A;  3SJP A;  3ISZ A;  4B11 A;  2GE3 A;  4KOW A;  2V7U A;  4M2L A;  5F4M A;  4NEX A;  1JNY A;  3FPP A;  1IOI A;  4PC2 A;  4YEJ A;  3VWE A;  4OOV A;  2ZEE A;  5EMN A;  1YIT B;  2KVO A;  2Q43 A;  1Y0Y A;  2J8R A;  1QFZ A;  1PU9 A;  2A4N A;  1NDH A;  2ZEH A;  2QA4 B;  1B2R A;  4MHD A;  3D3S A;  4Z4R A;  2AFW A;  2NV4 A;  2XEG A;  1NRK A;  3PB7 X;  3KI9 A;  4RPB A;  1JA1 A;  3IWG A;  1WSV A;  1MRZ A;  2BMW A;  1CP6 A;  1Z9U A;  3RNZ A;  3B78 A;  3D66 A;  4XNH C;  1PJ7 A;  1QMU A;  4B14 A;  5TV2 A;  2PRQ A;  4IF5 A;  4TWE A;  2QEC A;  4F9V A;  4Z65 A;  3R1K A;  2JEV A;  2POK A;  5KTC A;  4PC7 A;  4H2K A;  4AB7 A;  1YR0 A;  2C5H A;  1XE4 A;  5C82 A;  1S72 B;  4LBV A;  1COW A;  1DAR A;  4II2 A;  5J35 A;  3FVL A;  1NJI D;  3MHP A;  1YJ9 B;  3HAG A;  4X7C A;  3KZW A;  3S6K A;  5F46 A;  1K73 D;  4BMH A;  3GYA A;  1R5O A;  3ZZI A;  2DET A;  4MCQ A;  3VNU A;  2VZZ A;  1S5K A;  2F4N A;  3PVD A;  2RB7 A;  3WT4 A;  3N5F A;  1KK3 A;  1VIX A;  2C4U A;  3ZZ0 A;  4A94 A;  1XJO A;  3P26 A;  5IB9 A;  1UD2 A;  4A32 A;  4CYP A;  5IK2 A;  5J1Q A;  2FT0 A;  4KOS A;  2F7V A;  2BEI A;  1S4M A;  1Y9K A;  5C88 A;  3D7D A;  2ZBV A;  4AVA A;  4OC1 A;  2OZG A;  5H86 A;  3QB8 A;  2WUU A;  4G5G A;  3H9N A;  2Z3N A;  4RCY A;  1DTD A;  4OP4 A;  5H5J A;  1VQ5 B;  5K8P A;  3FBU A;  2ZW7 A;  2D74 A;  1VQ7 B;  3VO2 A;  1RO5 A;  4YAW A;  3IGR A;  3BHX A;  4X2T A;  4LBZ A;  4XKW A;  1VHS A;  3JTK A;  5JM6 A;  2FSR A;  1YVO A;  1AMP A;  2QIR A;  4DYO A;  1JJ2 B;  1QFJ A;  3SXO A;  2V7V A;  1ARM A;  1OHH A;  1KK0 A;  4A33 A;  1TTT A;  3ISX A;  5DWM A;  1D8T A;  3KR5 A;  4KOU A;  1BAV A;  4Q36 A;  4ZY1 A;  1Q82 D;  2OK7 A;  1XIX A;  1S7K A;  3D2P A;  4NGS A;  3K9U A;  2BL1 A;  3CZX A;  5A8A A;  3BI1 A;  3VAT A;  4ZY2 A;  3W91 A;  4CAF A;  4YHB A;  4KUB A;  3TX8 A;  4P1V A;  3DSB A;  4PSW A;  5F4O A;  1YW4 A;  2NPF A;  4FXU A;  2QMU A;  2AFU A;  2ZPA A;  4P6V F;  3VWD A;  3D7F A;  3GY9 A;  2CF4 A;  1M4G A;  4Z4S A;  3OKX A;  2XNC A;  4B44 A;  4FD7 A;  7CPA A;  2AFO A;  2VL1 A;  3WY9 A;  2ZZG A;  1MJ9 A;  1VKC A;  5IX3 A;  3EO4 A;  1K4J A;  2HMA A;  3PGP A;  3BH4 A;  3A35 A;  2PJB A;  3FKS A;  1I8D A;  4OLL A;  2RC4 A;  4QUS A;  3NE5 B;  3OZW A;  4QUZ A;  5E96 A;  3FXT A;  2EK9 A;  4KOY A;  3CTA A;  4J0Q A;  4P22 A;  1M1D A;  3SLN A;  4EFD A;  3BNW A;  3OW7 A;  4OC2 A;  3QFT A;  5LRJ A;  1ELO A;  1ZLI A;  2BM0 A;  4PC6 A;  4RI1 A;  3W2G A;  3GB0 A;  2GFQ A;  3CCQ B;  1TF8 A;  1UD8 A;  3AST A;  5G20 A;  5DWN A;  5DS0 A;  1FRQ A;  2C27 A;  2X85 A;  2FVG A;  1PKV A;  3S6G A;  4MXU A;  2OTL B;  3KKW A;  1VQM B;  2BPO A;  3WYA A;  1VQK B;  3AVY A;  1UD3 A;  2VJJ A;  3T53 B;  1WSR A;  4MI4 A;  2JLM A;  1CJW A;  2LZJ A;  4AG9 A;  3BCD A;  2FIA A;  2PR8 A;  4CAV A;  2EWB A;  3CCL B;  4PXE A;  2YNE A;  5EC4 A;  4Q7A A;  1E3X A;  4XLF A;  3WQZ A;  2JBJ A;  1GHE A;  4K30 A;  3U6B A;  3A8K A;  4QVJ A;  3OEH A;  1N07 A;  2C6P A;  1W2B B;  4RS2 A;  3WC5 A;  1E1R A;  1WDT A;  1GR1 A;  3HUV A;  4YWY A;  4C68 A;  3S9N A;  4PC3 A;  3JU4 A;  3BJ7 A;  4X05 A;  4TMV A;  2VZY A;  4MFQ A;  2GJR A;  1E79 A;  3ONU A;  1R57 A;  2KCW A;  3EXN A;  3SI2 A;  4DQK A;  2YNC C;  3VMF A;  4AG7 A;  2PIZ A;  2FCK A;  1MK4 A;  1NMT A;  1MJB A;  2VJI A;  1WTH D;  3B3S A;  1NB9 A;  3R6K A;  4B5P B;  2GPJ A;  4N3N A;  4OAE A;  1AYE A;  5IYN A;  3D7H A;  2Z3P A;  1M4L A;  3DDD A;  2CBX A;  3B82 A;  1E64 A;  1VQ8 B;  4LQG A;  5HXD A;  5FA6 A;  4ZBG A;  1W0K A;  3ZJ0 A;  4AF7 A;  2QJ8 A;  3G71 B;  2J8M A;  2XND A;  4B4D A;  1TKF A;  2Z3K A;  2BF4 A;  1R43 A;  3FIX A;  3ES9 A;  4PK2 A;  4ZGN B;  3PB6 X;  1XRY A;  1AMO A;  5D29 A;  3I56 B;  2QVP A;  2ZEP A;  4WZE A;  3OZV A;  3WBJ A;  4QVT A;  1V0C A;  3J81 k;  4FK8 A;  4FUU A;  3OJX A;  2OB0 A;  3H4Q A;  1I12 A;  1Z4R A;  4XMY A;  2V8V A;  3DGV A;  2WR8 A;  4GM5 A;  1IY7 A;  1E43 A;  1HVX A;  4HKF A;  3KHX A;  4C7I A;  1QGA A;  5K8M A;  3Q39 A;  3BY2 A;  3KGQ A;  4XOT A;  3P2F A;  1G7T A;  4X7D A;  1P4M A;  3A3G A;  1M4D A;  3SJX A;  4KOT A;  5JGF A;  3UY5 A;  1A2Z A;  5JPH A;  1BQE A;  3SJZ A;  5AN9 A;  4YEL A;  4E0A A;  3AGQ A;  3QNV A;  4XOR A;  4JD6 A;  2BOA A;  4KVM E;  2VI7 A;  4ZGQ B;  4A38 A;  2XZP A;  2CW5 A;  1KK1 A;  4C7H A;  3T51 B;  4RJL A;  1Z2L A;  1Q2Y A;  2B58 A;  3B8H A;  3FEC A;  1KZL A;  4RD3 A;  3FF3 A;  3NFZ A;  4B13 A;  1S7L A;  3A3B A;  3MRU A;  3FH4 A;  4CRY B;  3H8F A;  5HVH A;  3WAB A;  2F8H A;  4P26 A;  4OME A;  2ABZ A;  3TT2 A;  1QVG B;  1EE3 P;  1H8L A;  2CTC A;  2OK8 A;  3V8I A;  4UEE A;  4EH1 A;  1N8R D;  1YW6 A;  3IC1 A;  1D1N A;  4LX9 A;  2Q7B A;  4E0F A;  2VXK A;  5FNZ A;  3FYN A;  3NH4 A;  4RDJ A;  1NSA A;  4G1B A;  3CMM A;  2PJ5 A;  4E8O A;  2AJ6 A;  3WC7 A;  4X8I A;  3W6X A;  4B47 A;  5JQ4 A;  3AVX A;  2W6J A;  2ZTG A;  4IHM A;  2G9D A;  3VAR A;  4XOP A;  4KSF A;  1KRH A;  1VHE A;  2ZEF A;  5GV7 A;  4G6I A;  3RBU A;  4G7X A;  4UCP A;  3KQZ A;  3IWW A;  2C77 A;  2QEX B;  3D7G A;  2O53 A;  1W87 A;  4U9Z A;  1KZF A;  4M6H A;  3RO0 A;  3PFE A;  5HVF A;  4YAL A;  5HZB A;  5THX A;  3ASR A;  1S7N A;  4F8Z A;  4UCN A;  2BSA A;  1K8A D;  4NFR A;  3KAS A;  3QE2 A;  1KQS B;  1GAW A;  1I7P A;  2E1R A;  3ZZT A;  1IU8 A;  2WSA A;  4XN3 A;  1QUE A;  2B5G B;  4UCM A;  3A1P A;  4P2N A;  3CES A;  1N06 A;  4WZL A;  3U2Q A;  4M3S A;  1XMB A;  2ZEL A;  4QFM A;  4TMT A;  2VBQ A;  4K3N A;  2EK8 A;  4AXV A;  3CW2 A;  3OZU A;  4RDK A;  3H94 A;  3T8W A;  1BLI A;  4Z4U A;  1SQH A;  1RXT A;  2ZW6 A;  2QDX A;  1IJF A;  1U6M A;  1B23 P;  2PJ7 A;  4Q7J B;  2M5S A;  1ZUN B;  1QSR A;  3TO9 A;  2FS5 A;  3GQB A;  3NH8 A;  1VQ9 B;  4X5K A;  2CK3 A;  4M0L A;  2C2W A;  5HZA A;  4FD6 A;  4M1K A;  4PC1 A;  4U9U A;  3G05 A;  2DER A;  1ELL P;  2R8V A;  4ZCI A;  3GVL A;  3ASQ A;  4HE6 A;  1ZM4 A;  3RY8 A;  4DNC A;  2CRV A;  2ZOG A;  1U2R A;  2PJ0 A;  2ZW5 A;  1I21 A;  4BIN A;  1NE9 A;  4ZX8 A;  3AGP A;  1B87 A;  2RFH A;  4B48 A;  1F2P A;  4UAJ A;  3JQR A;  2FIW A;  5CDF A;  1N0V C;  2DYI A;  1FX0 A;  3F0A A;  4P4E A;  1FNO A;  1QGY A;  4Z1M A;  4MYT A;  2JBK A;  4KKT A;  4MCP A;  3ONY A;  4Y9U A;  1IOF A;  5CPA A;  5KTA A;  4MHP A;  1E63 A;  4CGL A;  4A39 A;  2CND A;  4F7D A;  3NE7 A;  1VHO A;  1S60 A;  5HH1 A;  1XOV A;  1KTV A;  4DUK A;  3Q38 A;  4JYW A;  4KSA A;  1HZE A;  3CME B;  4DNR B;  2VYQ A;  2REF A;  4R76 A;  1WOO A;  3OFN A;  2YNC A;  2WZP P;  4F0X A;  2VBU A;  1LAM A;  2VQY A;  4XKV A;  2Q4V A;  4L8J A;  2ZED A;  4Z4W A;  2PQ8 A;  1KUX A;  5KSW B;  3WBK A;  2BM1 A;  4H89 A;  1G7S A;  2VZL A;  3QAH A;  1W35 A;  2B5G A;  2XOK A;  4QB9 A;  3R96 A;  4OC3 A;  1BMF A;  1QSO A;  1DG1 G;  2F1M A;  2FXF A;  4OP7 A;  1YLO A;  3ZBU A;  1DE4 C;  5AGE A;  3SEJ A;  4ACB A;  2GK6 A;  4XLA A;  3MCA A;  2B7C A;  2HQY A;  3MGD A;  4B5P A;  3VNV A;  4PSX A;  1KUV A;  1IYL A;  4UEF A;  1CX8 A;  2WZN A;  4LQ6 A;  4PXC A;  3H5Z A;  3ZUG A;  2IL4 A;  2Q4Y A;  4FWU A;  5HKK A;  2FX3 A;  2Z6B D;  2I3C A;  3L2N A;  1BOB A;  3GLJ A;  2PRB A;  1LAN A;  3ZBT A;  1YJW B;  1VQ4 B;  4XNH B;  3R9F A;  2ZEN A;  2X6X A;  3SI1 A;  2G3T A;  4OC0 A;  4UIB A;  4DK1 A;  4UWI A;  2PMD A;  5K8O A;  5HVG A;  2HLD A;  6CPA A;  2Z3M A;  3B35 A;  4M4S A;  1TUI A;  2JEW A;  4C2X A;  2E1B A;  2J8N A;  3P27 A;  2OH1 A;  5LMZ A;  4IAV A;  1IB1 E;  2WPW A;  2DPS A;  3B3C A;  2WSS A;  4TN1 A;  3QFS A;  3KEW A;  2CXA A;  2DXQ A;  3VH9 A;  3GIU A;  1F2O A;  2EBJ A;  4MFZ A;  3D4U A;  3WXM A;  1BLL E;  3GVJ A;  4FD5 A;  4XNF A;  1XBU A;  4CGN A;  4YU9 A;  3V7A A;  4U5Y A;  1VQ6 B;  1FDR A;  2BV3 A;  4RD2 A;  3OW2 B;  3ASS A;  4NSQ A;  4OPS A;  4XD7 A;  1UMK A;  3PUN A;  3A8J A;  3IO1 A;  4BBH A;  2AFZ A;  4TSF A;  1G7R A;  1IB0 A;  4P3I A;  3CXC B;  1YGH A;  3C26 A;  1ZM9 A;  2VEZ A;  4XLH A;  1KJZ A;  5IYW A;  3CCS B;  2Q51 A;  2ZZE A;  2VBV A;  5K8N A;  2ZL6 A;  2IJZ A;  2DF5 A;  4P4I A;  2X6Y A;  5F4J A;  2B4B A;  3B7I A;  2DY1 A;  2OTJ B;  1VQO B;  2F5I A;  2OBS A;  3W5V A;  2PJ3 A;  2K5T A;  5EBV A;  2PJA A;  3OOC A;  4J3G A;  3FX6 A;  2CC2 A;  2PC1 A;  2OBT A;  3V76 A;  4PAA A;  2EO8 A;  1CNE A;  2Z3O A;  3HLP A;  1FNC A;  1ZG9 A;  3LQE A;  3JQQ A;  2YWG A;  4LBW A;  5LRG A;  3SJE A;  4F6A A;  3TCV A;  1F60 A;  4W9Y A;  3S6H A;  1TKH A;  1Y7E A;  5AG7 A;  3B3T A;  4X7F A;  3CDX A;  1V0F A;  1OZP A;  5G22 A;  3DDY A;  3E1Y E;  4FN5 A;  4XLE A;  4UF4 A;  3PUM A;  3B3V A;  4EME A;  5KTD A;  5J8C A;  2CNM A;  1UD5 A;  1I18 A;  1YK3 A;  4NGQ A;  1WP6 A;  2X3U A;  3JRU A;  3LWU A;  5KW9 A;  5G21 A;  1EFR A;  4KOR A;  4ROX A;  3PB8 X;  3QFR A;  3CRZ A;  2ZL7 A;  1NB0 A;  3TFY A;  1TLL A;  1M1K D;  4YFJ A;  4MCS A;  1XEB A;  4NBS A;  2C6G A;  2PJ2 A;  1J9Z A;  4G1P A;  4Y7C A;  2RC5 A;  4E2A A;  1UFH A;  1WK4 A;  1XFO A;  4FAI A;  2D3L A;  1W34 A;  2IMO A;  4DJL A;  5IB0 A;  2BGI A;  2XNJ A;  4XPD C;  3BJ8 A;  2ZW4 A;  2PCU A;  5J8F A;  4RDL A;  3QSY A;  4C2Z A;  5A28 A;  1VF7 A;  2YWF A;  4NCN A;  4ZGY B;  1GAQ A;  3EFA A;  1SKY B;  1Z8X A;  5IYP A;  1CM0 A;  4ONU A;  4QHY A;  4U9Y A;  1CP7 A;  4P45 A; 
#chains in the Genus database with same CATH homology
 3RAM A;  1HEE A;  3NH4 A;  4NGP A;  4FBE A;  1NSA A;  3H8E A;  3WC6 A;  3BI0 A;  2PJ5 A;  1CP6 A;  3WC7 A;  4X8I A;  3D66 A;  4NGT A;  1QMU A;  3BXM A;  4IHM A;  2G9D A;  3VAR A;  3FMC A;  2PRQ A;  3CT9 A;  1VHE A;  2ZEF A;  1OBR A;  3RBU A;  4NGR A;  4TWE A;  3K9T A;  4F9V A;  3I1U A;  2ZOF A;  4Z65 A;  3PBB A;  3KQZ A;  3IWW A;  1BPN A;  3D7G A;  2O53 A;  2PE3 A;  1FT7 A;  2PJ1 A;  2POK A;  3PFE A;  5HVF A;  4H2K A;  4R7M A;  3KQX A;  2WYR A;  4F8Z A;  2BCO A;  4OID A;  4NFR A;  2V8D A;  3KAS A;  3FVL A;  3H8G A;  3KZW A;  8CPA A;  3IIB A;  1Z8L A;  4MCQ A;  2RB7 A;  3WT4 A;  1XMB A;  2ZEL A;  3N5F A;  1YSJ A;  4K3N A;  1VIX A;  2EK8 A;  4AXV A;  4O23 A;  1TF9 A;  4P4B A;  1VGY A;  5LYI A;  4A94 A;  3T8W A;  1XJO A;  4WWV A;  5IB9 A;  2BO9 A;  2CTB A;  3IFE A;  2PJ7 A;  5J1Q A;  4R8F A;  2PJ8 A;  2XEF A;  2F7V A;  4P44 A;  2DEA A;  3NH8 A;  2IQ6 A;  3RZA A;  3D7D A;  4OC4 A;  1IGB A;  4OC1 A;  4JZ0 A;  3B2Y A;  3CPX A;  1ZLH A;  5ELY A;  2PJ9 A;  2GRE A;  1HDQ A;  1ELL P;  2HB6 A;  4MHN A;  1DTD A;  4EWT A;  4OP4 A;  5K8P A;  3S9L A;  2ZOG A;  2PJ0 A;  4ZX8 A;  3BHX A;  4X2T A;  5JM6 A;  4ZYQ A;  2RFH A;  1F2P A;  3PFO A;  5THW A;  1AMP A;  4DYO A;  2CIJ A;  4KSI A;  1ARM A;  1Y0R A;  4P4E A;  1FNO A;  3PEI A;  2JBK A;  1BPM A;  3KR4 A;  4MCP A;  3ISX A;  2OR4 A;  1CG2 A;  3KR5 A;  5CPA A;  4MHP A;  1BAV A;  4ZY1 A;  5D8N A;  4A39 A;  1VHO A;  4NGS A;  4DUK A;  4P4J A;  3BI1 A;  3VAT A;  4ZY2 A;  4X3R A;  3TX8 A;  4JYW A;  3FED A;  3V7Z A;  3TC8 A;  4OC5 A;  1YW4 A;  2XEI A;  4UEZ A;  4R76 A;  2AFU A;  1LAM A;  3D7F A;  2J9A A;  2ZED A;  3DLJ A;  1GYT A;  2GU2 A;  4MHY A;  2CF4 A;  3S9M A;  2O4H A;  3CPA A;  4ZI6 A;  4PXB A;  4MMO A;  5CBM A;  7CPA A;  4OC3 A;  2AFO A;  3LMS A;  3K2K A;  2VL1 A;  1PYT B;  4R6T A;  1YLO A;  4P6Y A;  1DE4 C;  2PJB A;  1JQG A;  1CBX A;  4NJR A;  5LYL A;  2EK9 A;  4RUH A;  4ZX9 A;  4UEF A;  2AFM A;  1CX8 A;  2WZN A;  2PJC A;  4PXC A;  4EFD A;  4OC2 A;  1LFW A;  4FWU A;  4TNU A;  5LRJ A;  1ZLI A;  2I3C A;  3L2N A;  3GLJ A;  1LAN A;  5LYF A;  2ZEN A;  3GB0 A;  3SI1 A;  3SJG A;  4OC0 A;  3NA6 A;  4UIB A;  1TF8 A;  3V38 A;  5K8O A;  5HVG A;  6CPA A;  2PVW A;  5DS0 A;  3B35 A;  2Q4Z A;  2JEW A;  2FVG A;  1ARL A;  4MXU A;  2QYV A;  4IAV A;  3D68 A;  4UIA A;  1LCP A;  1RTQ A;  3B3C A;  1ZG7 A;  3VH9 A;  2NSM A;  1F57 A;  1F2O A;  1LOK A;  2EWB A;  3D4U A;  1ELM P;  4PXE A;  5JH9 A;  5LYD A;  2V77 A;  4Q7A A;  3PB4 X;  2JBJ A;  1BLL E;  1TXR A;  1XBU A;  2C6P A;  4YU9 A;  3MN8 A;  3WC5 A;  4CPA A;  1UWY A;  1TKJ A;  3HUV A;  4IK2 A;  4YWY A;  3S9N A;  2PVV A;  3KHZ A;  4MRI A;  3IO1 A;  2AFZ A;  3D67 A;  1YME A;  2AFS A;  4MHZ A;  2C1C A;  5I4M A;  4PPZ A;  3SI2 A;  4ONW A;  2HC9 A;  2XEJ A;  2PIZ A;  3IEH A;  4P4F A;  2Q51 A;  3PBE A;  3B3S A;  4OKO A;  1AYE A;  2NYQ A;  1Q7L A;  3D7H A;  5K8N A;  1PCA A;  2IJZ A;  1CPS A;  1M4L A;  2ZEO A;  4P4I A;  4BD9 A;  2PIY A;  3SJF A;  3B7I A;  4PQA A;  2V8H A;  4NGN A;  4NGM A;  4LQG A;  5HXD A;  2QJ8 A;  5F09 A;  3NH5 A;  2C6C A;  1TKF A;  1R43 A;  1HDU A;  3PB6 X;  1XRY A;  2PJ3 A;  5D29 A;  2PJ4 A;  2PJA A;  2ZEP A;  2QVP A;  3FX6 A;  3PRT A;  4A37 A;  4FUU A;  1ZG8 A;  3HLP A;  1ZG9 A;  4B6Z A;  2V8V A;  1QQ9 A;  3DGV A;  5LRG A;  3SJE A;  4GM5 A;  4W9Y A;  3FEE A;  1IY7 A;  2AFX A;  1TKH A;  1Y7E A;  3KHX A;  2PJ6 A;  3B3T A;  1KWM A;  3CDX A;  5K8M A;  3SI0 A;  3IJ3 A;  3KGQ A;  4P10 A;  4UF4 A;  3FJU A;  4NJQ A;  3B3V A;  4EME A;  3SJX A;  5JGF A;  4NGQ A;  2V8G A;  3JRU A;  3LWU A;  1Z5R A;  3QNV A;  3PB8 X;  2ANP A;  2BOA A;  4P4D A;  2OOT A;  3PB9 X;  4ZY0 A;  4A38 A;  3GUX A;  4MCS A;  1CPX A;  4F9U A;  2ZEM A;  3ISZ A;  2C6G A;  2PJ2 A;  4G1P A;  1Z2L A;  3FEC A;  3FF3 A;  3NFZ A;  1XFO A;  4FAI A;  2IMO A;  3MRU A;  3FH4 A;  4DJL A;  3H8F A;  5HVH A;  2PCU A;  2ZEE A;  2GLJ A;  3B3W A;  4WJB A;  3WAB A;  1LAP A;  2F8H A;  4OME A;  4MCR A;  2ABZ A;  4PXD A;  2Q43 A;  5LRK A;  1EE3 P;  1H8L A;  1Y0Y A;  3KL9 A;  2CTC A;  2ZEG A;  1R3N A;  4OIW A;  4UEE A;  2ZEH A;  1YW6 A;  3IC1 A;  2AFW A;  2XEG A;  2GLF A;  3PB7 X;  3KI9 A;  1CP7 A;  4P45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...