2WZPP

Structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
298
structure length
298
Chain Sequence
GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
molecule keywords PUTATIVE RECEPTOR BINDING PROTEIN
total genus 65
structure length 298
sequence length 298
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.60 Mainly Beta Ribbon Laminin Laminin 2wzpP04
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2wzpP01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wzpP03
2WZPP 2X53S
chains in the Genus database with same CATH superfamily
1TMF3 1W03A 5HXBA 4HKWA 2EA7A 3E5XA 4OHWA 1GSLA 1ZYBA 3ZYFA 4F83A 5C8WA 2Y6LA 1ZM2A 3MYXA 4FPHA 4CP0A 3PA1A 3LDRA 5JZGC 3E1YE 5FDQA 1URXA 1V6IA 3LN0A 1PMHX 4QGLA 2BU9A 1ZRCA 1RUJ1 4DQLA 3NNLA 2JDMA 1VQMB 1VBB1 5C3PA 2IXHA 2OS2A 4MO3M 2BOJA 2W1QA 2WFF3 1IQLL 4XBMA 2GPJA 2JDIA 3SLNA 3N7LA 4KWJA 2W2PE 3J9SA 4QQLA 3CPWB 1DLLA 3WUDA 3ZN6A 2GMMA 1H8TA 4YG6A 5BNOA 5LZ6A 4XE9A 4AI9A 2BO2A 5FZIA 1QX4A 2ZITA 3OPZA 4FXKB 5DPNA 4AEKA 1KJZA 1XNKA 2QGGA 4P22A 2P1BA 4LA2A 4NRMA 4XIKA 5K0UC 1PVC3 4CEYC 2OA2A 4MSVA 1RFNB 1R1A2 1C5HA 3LEIA 1WW4A 4XUTA 4MXWA 1OUSA 1SLIA 3KVAA 4XLHA 3I3MA 1GAQA 4XMIA 1QNWA 1J1TA 2WT2A 5DAVA 4LO6B 2VZ3A 2DCZA 1DQBA 1QNYA 1Q56A 1UU4A 1U2RA 2OT7A 1KZLA 4XHBA 4E1GA 4XKVA 5THXA 2W2NE 3LTGD 1OFSA 4CUEA 2CY6A 1SCSA 1S0GA 5GLUA 5IYWA 1VIWB 3ZXAC 3HS7A 4P02B 2VGDA 3OOXA 4B4RA 4QXCA 2YHJA 1Q3EA 1DG6A 2OKXA 2UWBA 4LBOA 4XMYA 1DDIA 2D3SA 4Z4ZA 1D4VB 4ZS3A 2FX3A 1WHEA 2PHLA 3CDZB 2D6PA 5IVCA 5DUXA 1E3ZA 1YNAA 2VW0A 3BIWE 3UJQA 1ZZ9A 2X53S 5FO1A 1XE1A 2I2SA 1K45A 1K3IA 4FT8A 3T2TA 5CBLA 1STMA 2ZGRA 3V0BA 1CWPA 1QJX2 3CP2A 3OUHA 4D94A 4RD2A 3SEJA 4D0EA 3PUHA 4HK8A 3SH5A 4ZZ8A 3WEZA 1AUTL 4RYDA 1F4AA 2QQIA 1NZIA 1XYPA 1AF9A 2Q8OA 4I02A 3LFMA 4WZCA 3U78A 3ZR6A 4OHYA 3TNQA 2JKXA 4FFGA 5LBEA 1LECA 1CX2A 2D6OX 1HX6A 1UMKA 2VJ3A 2VVVL 4TGFA 3DEMA 1PFXL 1WA4A 3USSA 2ZTGA 1KD1D 1NCQA 2X10A 2ARXA 3LFIA 5FPAA 1DU3D 4YVWC 3VZOA 2JJ1A 2PA7A 3LIGA 1OQEA 4TN1A 1GOFA 2DY1A 2C6SA 1H2KA 3HBZA 4Q2FA 1QVGB 2VNHA 4P26A 2CSGA 2DWRA 2QJVA 5GLWA 2PHFA 5ANQA 5AC92 1G9CA 4TT3A 3LQEA 4L92A 4AF9A 3ISXA 4ARYA 5BNOB 5EMNA 1EY2A 4WBBA 5KHHA 4CDUA 2W3JA 3POBA 4NPRA 2TNFA 4WVZA 2DV9A 3UESA 4Q4Y3 4AEDB 4CA9A 5KC5A 2C77A 4LC0A 1COWA 3LEKA 4YVWA 2VM9A 3WNLA 4EE2A 1JZ4A 3SISA 2WFPA 3GQBA 1OT5A 2ES3A 4HBNA 3KQEL 3OLUA 4Y1UA 2CGOA 2W68A 4Q0UA 1JL9A 1U8CB 3P27A 4XLCA 1F2NA 2R1DA 3U73A 2W87A 2XQRA 3SEPA 2CDOA 5C5TA 1RVF2 1V9U2 5I0UA 1WUVA 1PNGA 3AXDA 4A6SA 1NXMA 2CNDA 4E4DX 2VTXJ 3KSCA 3RPQA 2ZKLA 5IKQA 3CMGA 1LMJA 5F7UA 5BYNA 2GNMA 1QOSA 5GALA 1OB5A 3Q6RA 2ZHMA 5FMDA 4O7XA 4K8RB 1ULPA 3G4SB 2VZQA 5AVPA 1FI2A 1NRKA 1QJU2 3WW4A 1UZZA 4JCKA 5FZ0A 4M53A 5IATA 3CMMA 2Y80B 1S0DA 5K8SA 1POV0 3W5NA 4AE2A 2XXZA 2J1TA 5I93A 1XSRA 3FUOA 1RUI1 2JJLA 4M4PA 3M8LA 4UBGA 1RUG2 3GVJA 3ENSA 1S55A 2A75A 2ZHNA 4JRAA 3OE7A 2NQYA 4NHMA 1L5GB 1QXPA 4N9HA 1BEV1 3UKNA 5HBAA 1S2KA 5K7PA 1RHI2 4ZS2A 4JDOA 1EZQB 1VMJA 2VVUL 4QPYA 3URFA 3AVXA 2QCSB 1PM4A 1XNAA 4E27A 3ZXJA 5L2YL 3R6SA 2BM0A 1YITB 2Q0AA 3KV4A 4X6RB 4M4SA 2RR12 3JQRA 1AUYA 5FY9A 4RA0A 1LENA 1R093 4B7EA 1U5IA 2Z69A 1O3QA 2GNBA 1YQ8A 1CAUA 4MH0E 3H8UA 2LRPA 3ZPOA 3A21A 5IVEA 1YJLA 2ET1A 1UOFA 4HVQA 1UY0A 2ARCA 1HQLA 3T2OA 2HOXA 2EIXA 2DTYA 1V70A 1PKVA 1ZBA2 2VMCA 2VXRA 4H7MA 3VBRA 4BQWA 4CCEA 1ZAQA 2P3YA 1AVBA 1K42A 3GVLA 3RZHA 4N53A 4IE4A 3ZO0B 5LA0A 2G4IA 2XBVL 4HT1T 1RUNA 2YYOA 3P3PA 3QOPA 5LA9A 3HEIA 5CADA 2BMGA 3CF6E 2KB9A 1S0CA 2G9GA 5IK2A 2DYIA 1UOGA 4QWNA 2BGJA 4CCNA 2BM1A 1BYHA 4C8DA 2DIEA 1VQ9B 4MG2A 4UFJA 1YWKA 1IQFL 3THDA 3HAGA 4CCCA 4D6QA 3PMEA 1G8WA 3KL6B 4L11A 4E2GA 2WNUC 1ONAA 4Z0KB 3AMHA 3RI8A 1FNCA 1QFKL 1BBT1 1OLME 5GLZA 3TBDA 1PJ7A 2VULA 3DPRA 1FJSL 2BRTA 3MV11 4IGOA 4O1ZA 4P9SA 1PK6B 3AVVA 2D9RA 1QF3A 3AXEA 4GQ7A 3WP6A 1GZTA 2ZPXA 1DVAL 1BQPA 3FC0A 2C26A 4Q29A 2WS91 4RRWA 3POWA 1RUH1 4CP2A 3WF3A 2WG4B 1EAIC 4FXUA 4AF6A 4XQDA 1M1XB 3OD0A 1QFZA 3LKJA 4A7KA 2LM3A 5FZ6A 2Y0OA 4Q4Y1 2BNOA 2IXKA 1KLOA 1LGCA 1SBDA 4Y5Z0 5FO9B 4CXYA 1TNRA 4DRRA 2QQVA 4RHV2 3POYA 1H9PA 2ZCWA 2CGNA 2ORXA 3AP5A 2XHNA 1NCQC 1N05A 4NJ4A 2TGFA 5KXDA 3FE5A 2XJVA 1GR1A 3P5BA 5E16A 3TWIA 2KD7A 1QY4A 4XW3A 5FO8B 1Q8QA 1R081 3WCSA 5FZLA 1PX4A 2W2ME 3JUUA 4FOWA 2VUJA 4Y1XA 4XZPA 3I55B 3VD4A 2GDFA 1W8OA 2CWMA 1OB0A 2EXJA 4BPZA 1IS4A 1KEXA 4NWVA 5JBQA 2VOTA 2DCUA 2N7GA 3AFGA 1XBFA 3GIRA 2OIIA 3OCPA 2FCUA 5FY7A 1YCIA 2XOMA 2ZX1A 5K0UA 2HEWF 5CIRA 1S0IA 4YT7L 2NPFA 3BT2A 5CDFA 2JX9A 4LO5B 3RSJA 5AFEA 3OYWB 2V7UA 2VZLA 5G05L 4MHRA 3BCDA 1EMOA 4NIAA 4BISA 5FQ0B 3J7NA 4ASLA 4CZSA 4EWEA 1RQPA 1KGYA 3SOVA 1BJKA 2D6LX 2M74A 1GWMA 2PN5A 1XDTR 2HH9A 2VBTA 2VU9A 2W95A 2WA3A 1VBC2 1PHMA 4JKLA 1UF2C 1G86A 3ME2A 3LIHA 3WUCA 1PIV3 2VCAA 2WUHA 3N36A 3WZ1A 3V0BB 3FBMA 1JZ5A 1H6XA 3CCLB 1ZM9A 3IN9A 3CO2A 5I46L 1KK3A 2OYEP 1GZWA 4FQ4A 1C8NA 2VNIA 2ZZGA 1GNYA 4FPEA 4U2AA 2JDKA 2WWSA 4W4ZA 5D1IA 1EQGA 1NYWA 2PLV3 2VMEA 4TMTA 1CZSA 4IV3B 3GYDA 4A4AA 2EICA 4OOXA 2FDJA 4YVSB 3OZUA 3CMAB 1DARA 4C0SA 4FAGA 1VMHA 1AYM1 2GH2A 4MADA 5CKNA 4OHXA 1RJ7A 1EV11 4OYUA 1OVSA 4HSJA 4YW4A 1CAVA 1NCRC 3FWEA 3K46A 4EV0A 3AMNA 1QG0A 3IMMA 3CESA 1VBB3 1DYOA 3C7HA 5HCBA 5C9AB 1RXFA 5JVZA 4Q7JB 1EPZA 3VN4A 4E8DA 4BTUA 5F4JA 3GVKA 2EALA 2VOWA 1OGIA 2DVBA 1CIWA 3CL1A 3ITQA 4P9YA 4CSWA 2WQZC 1XKBA 3H8OA 2NV4A 1NCQB 3IDBB 4G7WA 1RUG3 4XC9A 3N35A 3JD72 4LBKA 1DLCA 5D21A 3I2DA 3U11A 3Q6QA 3DDYA 1CVWL 3H0OA 4B4QA 1NA1C 2Q1ZB 1I3HA 3B01A 5EPAA 2VJIA 3I1FA 1EYBA 2VOKA 3SLDA 3HO5A 1MQTA 2LUWA 2ZEXA 4FPFA 3VBUA 4II2A 1WCUA 3P3NA 4ZZ5A 3WOGA 1MS1A 1RUC2 1ZZCA 2JDAA 4U36A 5GM0A 4N8MA 3VDCA 4J1XA 1EXMA 1LJ7A 2ZXIA 2ZX4A 5FZGA 4CEWB 2P2KA 1P9JA 2XC5L 3SJPA 3OD4A 4RD0A 1S4MA 2WO1A 1VR3A 3ZFEC 5JAXA 1HIXA 2GZWA 4RGGA 2BJSA 1OBNA 3ASPA 1COV2 1RITA 1W0NA 1ZM1A 2QFEA 2ZGMA 2CYFA 3EQEA 3OG2A 2HJIA 4AGGA 5CKQA 3T53B 1NFWB 1N8RD 4XF4A 4FO9A 4TMVA 1D2EA 3T30A 1ULEA 4AXOA 1PO22 1YI7A 2HWE2 4CU6A 5L19A 5BNNA 5T5JA 2O1QA 4YFZA 1HT5A 3ZDVA 2J1EA 3N4MA 3TK5B 2WZPP 5A3UA 3IAQA 4ZONA 5CKMA 3H8RA 3POJA 3OF1A 1IPJA 3MQEA 1OVPA 2NN8A 4BLJA 4LE3A 4B3XA 4WWVA 1EFTA 4BTIA 4OTJA 2BN4A 2GNTA 3MO4A 3VD7A 2B9VA 5JBAE 1HA3A 2AZ5A 4XXAA 3LA7A 1Q86D 3OUIA 2JG8C 4HPKB 1UKRA 2BOXA 1LCLA 2A6ZA 4JQTA 5LASA 4CRQA 4YZ2A 4YFWA 5EJ1B 4AFCA 4MGTA 5LW9A 1IHMA 5A7SA 1QJEA 1FF7A 2C78A 2JIZA 4G1VA 1VMFA 1RJ8A 1Y3TA 2RS32 3VKFC 4NE9A 1GK5A 3UKTA 4BH9A 3G05A 1GMMA 4LKFA 2B8MA 4FPLA 2YGQA 1EV12 1VJ2A 2F4LA 5EQUA 5LRSA 1H1MA 1FRNA 1JOPA 3OKXA 5DUWA 2H6BA 1HREA 1HRV3 2HBTA 2BVNA 2WSSA 3BU7A 3HS5A 4OUSA 2ZHKA 2PYTA 3CXCB 3HS6A 2QTLA 1HCGB 3RZMA 5H59A 4P5HA 2WBKA 4XD7A 2KV4A 4AOCA 1ZUNB 3PVNA 3W2GA 3A8IA 1BVP1 3GDBA 4OTYA 4ORFA 1VBC1 5E88A 3RGBA 3VBFB 4ZHNA 1CNFA 4AVAA 1QEXA 2E7TA 1RUF1 2YPDA 4Y7BB 1L3JA 2QQUA 5F4OA 2WNVB 3H8XA 1FAYA 1URKA 2BGOA 2CAVA 2MEV1 4Q0VA 1J9ZA 3VBSA 4F8AA 1W7XL 1O8PA 3AL5A 1RL3A 2P28B 5KBFA 2Y60A 4CCMA 4LR4A 3OLTA 3Q8AA 4OCTA 1IQJL 1AXYA 3PNAA 1VLNA 4OVEA 5DZFA 3RR3A 3RFRA 5BNNB 4B48A 3WCRA 2XMLA 3U2QA 4Z4SA 1AYM2 2HWC3 3VHPA 5JOYA 4YW7A 1GP5A 5FYVA 3SCFA 1GR3A 3HO4A 1BMFA 5FPLA 3UV9A 2WT0A 4FP2A 1P4MA 2AYHA 1M06G 3H1WA 3CCMB 3BGAA 1JB9A 4IEVA 3OEBA 3T0AA 5JOZA 3NO8A 1TLLA 2PFWA 2MGRA 3I8TA 2QQNA 3K3OA 3O0WA 4HMZA 1GO2A 5K9YA 3N8YB 2UWLB 4RR3B 1IS3A 3KVBA 1VBA2 1G6NA 2GC2A 1UY2A 4BK4A 3I59B 3J8F2 2XKOA 3NKGA 1W8UA 2XR4A 3OGSA 1HRI1 5IAXA 4TMXA 2C9KA 3S30A 2K2TA 3T0BA 4CDUC 3AYCA 3UL2A 3ZKUA 2E63A 3HO3A 5DDJ1 3VZKA 4AWDA 4XJUA 4Y5SA 4M0NA 2XVGA 4QQOA 2QDXA 1J3RA 4XAEA 5COXA 1RUC1 2B4KA 2BERA 1W9SA 2CWSA 3N8WB 4X8VL 3WP4A 3ALQA 5JOXA 4PAAA 1IPSA 4JDMA 5CYYA 1DQ6A 2D3RA 1WWYA 3CQOA 1KS5A 1VBE2 3AVUA 1SHWB 2RDRA 2GJKA 1JBUL 1R1ZA 1LPZA 2P3JA 3MLKA 5JR2A 5I0DA 1A8DA 4QDSA 2QE3A 2JJ2A 3J7HA 1CZVA 1HRI3 3FLTA 3PMSA 4HLTA 4XZUG 4YRDA 2Q8EA 5C3SA 2VZTA 1RMU1 4XJ8A 3A4UA 4Y9UA 2WA4A 3WBJA 3U4SA 2OK7A 3ZDSA 2VQUA 4GH4B 5C8CA 1PO12 3GISX 2UWCA 2FDGA 2KA3A 2FQPA 3KQBL 2CC2A 1LHWA 4YW5A 1NG0A 4Z4VA 3ACLA 3AKPA 1W87A 5ERLA 3WT3A 3QFSA 1POV3 1AL0G 2L9LA 2WLQA 3ES4A 4XURA 2C1FA 2EXHA 3LCPA 4KG8A 4K9SA 4YG3A 4A7ZA 1DDLA 3THTA 2XNJA 1KS4A 4F7ZA 1RHI3 5BXXA 1W6NA 1W3XA 3J7MA 2XBO2 3DUIA 1W6QB 5D2AA 3BY2A 4BPRA 4BJ0A 1SFPA 4LBQA 4Y6DB 1UAIA 4Y76B 2EI6B 4Y1YA 2IWGB 3GM8A 1XQNA 4CU9A 2CBXA 4RD1A 2XBO3 4QB2A 3VBOB 5EV7A 4CEYB 1YGCL 2OTJB 2E32A 2B5HA 2QZ3A 4G9SB 4JV4A 4UFHA 4ES9A 4G1MB 1AR81 3GHMA 4URTA 5CAZA 2VCBA 1JA1A 1W9XA 3E1F1 4B3FX 4HZFA 2VCMA 2QQJA 5J3UA 4I09A 2D74A 1J84A 1DDGA 4M0LA 4GMP0 4XQFA 4YGEA 3OW7A 3RYPA 4EN0A 4QQPA 5A7WA 3ZFGB 3K3NA 3W21A 2RA0L 4P3YA 2WZ8A 3MW2A 4BLIA 3ZC3A 4C1XA 1POV1 5JB8E 5JW1A 1D4M1 2CRVA 2A6XA 2R16A 5BNOC 1NOVA 1LU1A 1MVQA 3RJ2X 1KK2A 1PZ7A 5C71A 3DKWA 2JDUA 3WDTA 4AGRA 4B47A 1D0HA 1W6OA 3HJRA 3LC3B 2I1LA 2BTVC 3B94A 2MEV2 4NHXA 3OPWA 4QKDA 4RM0A 2W2OE 3T51B 3QH6A 4NOTA 4AQ6A 2BPOA 4XTMA 2OYNA 5L9VA 1SLTA 4TN7A 5F39A 3QD6A 3UT0A 2ZGSA 3QBQA 3WNNA 3CJXA 4PI0A 3PA2A 4DXTA 2RS13 1W2TA 2PLFA 3U0ZA 1TVCA 3A0KA 1WMXA 4PIZA 4X07A 2F1MA 3AMMA 4K6BA 1V0EA 3ZFGA 1CAXA 3WDWA 4XJAA 5DABA 2Q5TA 5CFCA 1WW7A 2RM21 3P1IA 3Q39A 1W2OA 4LKDA 5HV4A 3OJXA 2VBUA 2QKDA 3DPRB 4Q27A 4B44A 2W1UA 1FFMA 4XAAA 1GKBA 3MICA 4JGYC 4NG9L 4G6IA 1UPSA 4K7JA 2VWLL 4AI8A 3WVJA 1F5JA 1VAMA 2J1UA 4KGQA 3KHCA 1V1HA 4RGKA 2VBPA 2VZSA 1NZCA 4O65A 4YT6L 3PUSA 3ZFFB 4WZFA 1C28A 4MLOA 4RRXA 3ZSEA 1Z78A 1E63A 4G1BA 4C16A 3DCQA 3ES1A 4H14A 5FZKA 4AVVA 3HOBA 4DNYA 4XN0A 3MHZA 3VZLA 2XZOA 5DUVA 1JODA 2TEPA 4R9CA 5FXZA 5CA6A 4D6SA 1QH6A 4LOSA 2BF4A 4FWTA 1NCRA 1SDDB 2WWJA 4XQ4A 5F2WA 1ALYA 3BTAA 4QX0A 1B35A 1N07A 4XOTA 2BZDA 5JMOA 5FKCA 1I1EA 1ODMA 2A3WA 2W39A 5C9AC 3LB9A 4AAPA 1DCSA 1V6KA 2VMFA 4BQ2A 1YQ2A 3KMHA 2E26A 4FTBA 3CP8A 3D3AA 4Z07A 5JI7A 2J2UB 2Y5FL 3POEA 2B7DL 2R49A 4FFFA 2F1LA 4XETA 1AR62 1VQ5B 2O8OA 1YC61 4M3CF 4Z2WA 1ZRFA 1ZRDA 3VDDC 4YVSC 1O3SA 4P6YA 2HMAA 1KC8D 4WM7C 3T2PA 1HAFA 1PO11 4MMXB 2OBRA 2EIDA 3LDKA 3ACGA 2V09A 4QAWA 4IEUA 4JZRA 4IW3B 2CGPA 1W6PA 5F3CA 3C2UA 4XXPA 4GU4A 3R4UA 5C4WA 3U10A 4EJRA 2JN9A 1JJ2B 1APQA 4A2UA 5H9QA 5FPUA 1QGYA 4UF0A 1M4WA 3HMYA 3NT1A 4FVVA 3RWNA 2DUPA 1DBNA 1RMU3 3EYPA 3ZXLA 3RZGA 3MIEA 4EN8B 3FL7A 4QX5A 2PLV2 3ZXGA 5FZ7A 4JX0A 1MS9A 3NJZA 1ST8A 4GB32 4O61A 4QPIA 4CXWA 3IPVB 3BOPA 3S57A 2FD8A 3AC0A 2PAMA 3ZFEB 4RQPC 5JSRA 1NXD1 3H94A 1QU0A 1RUD2 1WCSA 3AVRA 4N43B 4YGDA 2B7BA 2J95B 2ZX2A 2Q8DA 1ASJ2 3FN9A 1OA4A 2B39A 4Q5OA 5HV0A 1E79A 1E1RA 3O1RA 4NVPA 1AMOA 5T52A 1EP1B 4J0QA 4X7DA 1G7RA 2JIGA 3JBG2 4PT6A 3VBSC 1BPLA 1GZ9A 1W3VA 2R072 3ZZTA 1GWLA 3T2QA 1LAJA 3JU4A 4XF1A 1SQ4A 4AAXA 4HKOA 4DINB 2OUHA 3CA7A 1TME1 2R1BA 4ONUA 5FK8A 1CX4A 5FY5A 3SCGA 1EUTA 1X82A 4MXWB 4CVUA 1G1TA 3JBG3 4IGPA 3U14A 3AB0A 5KWRA 1JZ3A 3H5CB 4OHZA 2OQ6A 4MXVA 4YW1A 1RUH3 4OP7A 1MS5A 3C7OA 3IMNA 5LEJA 3JB4C 2R042 4FAHA 2P3UA 1H9WA 1WTHD 1UL9A 2HWF1 2VPVA 5FYCA 4AHZA 5A3OA 3T4VA 2CNAA 4XJZA 4CP9A 4EQVA 2WT1A 2DDUA 2ZS6B 1UZYA 4UW4A 3ZMOA 1R083 4AZZA 4EYUA 3V0AB 4YEJA 2GC0A 4MYUA 3GBGA 3J26N 4HETA 4CCLA 1IQIL 1UD8A 4UFKA 1AR71 4Q4W1 3WLUA 3OJBA 3B5LB 1DHKB 3OTFA 2G9ZA 2AGSA 3AJYA 1KJRA 4QPGA 4P6VF 3IIAA 2EI7B 4IE5A 5H9RA 1HZEA 5C4WB 1V9U1 1XFEA 4CQJA 3V0AA 2XC4L 4YAUA 2VMIA 4FI9A 3MIHA 3A0NA 4Q0QA 2E1BA 5GLTA 4DQAA 1PZ8A 1W0OA 2YGMA 3BB6A 1JN2P 3C8XA 4HE6A 5FLHA 2FDFA 3U75A 4RD6A 4XMAA 4YLZA 1H6YA 2WYRA 2WC2A 3MUY1 4E2QA 5EFUA 4JGYA 4BHPA 4P3IA 1QJU1 4M4RA 5FUPA 1KIGL 4MMYB 1OFNA 2WPHE 4NUBA 3ZFEA 3WNCA 5AC91 2E1RA 5J3OA 5C3QA 5JIUA 3M37L 3I2OA 5D8AC 2VJJA 2YZ4A 4FQZA 3KCCA 2WYSA 3N9NA 4BQ1A 4YARA 3ENRA 2XBWL 4ISIL 2VZOA 3BALA 1ZVFA 5FXVA 1Z6EL 2PQQA 1U5YA 2P5BA 3I2IA 3LTFB 1QOOA 1ZREA 4L0PA 4TWTA 3GJBA 3GZUC 4L9BA 4P5YA 2C2WA 4JHZA 4Q4V1 2W92A 5IWFA 5KIRA 2IXJA 1G9FA 4M0HA 1XKAL 1NPEB 4M3CA 2VWNL 1REFA 2Y81B 4WV8A 3SNMA 4BIFA 1SEFA 1FNZA 1GZCA 2RS12 3DKQA 3H50A 5FBJA 2JWPA 2VG9A 4UFIA 3VGIA 4CDXB 3UK9A 3ETPA 4LITA 2BP6A 3N8ZA 4OOSA 1SPPA 5EJ3A 4EN9B 5IK8A 1APNA 1QHDA 1RUD3 1S2BA 2XG3A 4CPBA 2A7AA 5FPXA 2W2QE 5CZKA 1GJRA 4RS0A 1V9U3 3ZBUA 2ENRA 2PHUA 5KXEA 4ZH8B 2EVXA 3I49A 2GN7A 3W59A 1G1SA 1UY3A 5JCTA 4P08A 1J58A 2ZXHA 1EP0A 4PH9A 2E7AA 2WN3A 3ZM8A 2Y33A 1ULFA 2NLRA 4RS5B 4LBJA 1I5ZA 1PK6C 3ASSA 2XL9A 3WNKA 2HWF3 3H7JA 3TRSB 3J7LA 4RDLA 5FYUA 3CJIB 3ZYJB 1L7LA 3HVDA 3ZFFA 3OW2B 4RL7A 3SKJE 2R32A 4PGOA 4QX2A 4YW3A 4I30A 2VW2A 1BBT2 4OI2A 1IOEL 4XFFA 2F17A 2EXIA 2VVEA 3HR9A 4NNJA 2J7MA 1W6QA 3VD3A 2RVAA 1QJFA 4LBQD 4QGMA 4QU1A 3TOJA 3FFGL 2ZAHA 4QGNA 3MW3A 4UAPA 4IEOA 3EMRA 5IKVA 3USUA 1V6OA 3LQ6A 1H1IA 4YVSA 5C5UA 2NYYA 3I2HA 5C7GA 3WHTA 2ZL5A 2CJIB 1PIV2 3I3EA 5FCCA 5L2ZL 3AMQA 4NROA 4OI4A 3RG0A 4A94C 3RZLA 1MS8A 5A80A 5I0SA 1KKEA 1FXZA 1YJWB 2OX0A 2JE8A 3NV4A 1GZWB 1NY71 1KQSB 1N3OA 4MGQA 1MABA 1GVHA 3B9CA 4XEZA 1GP4A 5J09A 2BQWA 1C8M3 5L7OC 1TEIA 1PRHA 3HT2A 5T50A 3VBHC 3VNUA 3TN91 4KKUA 3ZKYA 2GNDA 2H0BA 5JWPA 2DCJA 1VRH2 3KQ4B 2RC6A 1NKGA 4KI5M 4NAMA 4CUFA 2V4AA 3H3UA 3RYRA 4Q4V2 4PC3A 1W06A 3QFTA 1VQOB 2OXBA 1O5LA 1DGWA 3GF6A 4FPGA 2HWB3 3PL0A 2EI8B 5T3NA 4MYTA 1OB1C 2P93L 4IESA 2PHTA 4AEDA 5GV7A 1IQML 4LBYA 4FSJA 3OEAA 3MIGA 3VMFA 1WW5A 2MPFA 2BW8A 1ZA7A 1CAWB 2HWB2 2ZX3A 1YI2B 1V0AA 3N7JA 5C3RA 5BY5A 2WS92 3WQ1A 1HVXA 1UOBA 4PLOA 1JZ2A 5FDBA 1AJKA 2R073 4WM8B 5HCFA 1AZDA 2AYLA 4XL9A 3VO1A 2GU9A 1FPN2 2WAOA 3FHIB 1Y4WA 4WM8C 4MGYE 4GJYA 1N0VC 2QQOA 3HQRA 1N3QA 2ZEYA 3N7KA 3WNXA 4COZA 2YDEA 4LIUA 5DZGA 3ECQA 2JDHA 4E8CA 1SM4A 4HONA 2B7YA 2J1RA 1Y0RA 1A8MA 2PAEA 4KBBA 5FYBA 5FYZA 5BNPA 5BNPB 5IYRA 1R082 3OUJA 1TMF2 5FYTA 5FZBA 2BDRA 3KGZA 1K28D 1RUE3 4DS0A 4J1WA 5B4NA 1E5IA 3WQ7A 1PGW1 3D0JA 4PDWC 4TXWA 4RSUA 2X5IB 4IL7A 3N8YA 2P94L 5IVVA 4PF1A 4D0QA 2KNIA 4YYOA 3OZWA 4AVTA 4LA3A 2DFCA 1WMFA 1CR7A 4JKMA 3HWJA 2YC2A 4DMIA 5DAWA 1OI6A 5DAXA 2VC9A 2FDIA 5JVYA 1LRHA 1IQAA 3I3DA 4QX1A 1P0SL 1BCXA 2A1XA 1W8ZA 3B02A 3LSEA 4YGCA 1WDTA 1JHJA 4ZCLA 2ZZEA 1I6XA 3ABZA 3JD71 3WG2A 2OQ7A 4D69A 2HWD1 1R5BA 2DEUA 3POGA 4LO8A 1PVC2 1UKGA 2CL2A 1VRH1 4MMZB 2OPWA 3A23A 1W6OB 4Q1RA 3TB0A 2VH9A 1CN1A 4AVZA 2DERA 3GZTB 4Q4W3 5DQ0A 2WQ8A 4CXXA 2D7FA 1LOFA 2QQMA 1PJ5A 3V65A 5CVRA 1A34A 2Y64A 2VJXA 5IYYA 1LK9A 3CJIC 2CU5A 4RS5A 5D8AA 1FAXL 5FIXA 3R6JA 1I8DA 1QWRA 4OULA 1H4HA 4OMCA 1JYIA 5F8PA 5JI9A 3IITB 1VBE3 4XF9A 1C5MF 2B45X 4C91A 3HNMA 5HPOA 3B93A 3C7EA 4LKSA 2X85A 3RDIA 2AEZA 4AG4A 4Q0SA 5FNZA 1BQEA 1Q8OA 3OGGA 3OBAA 2J42A 5EWSA 5SV8A 3VBFC 4LIVA 2E51A 5EGMB 4M3CB 5FYHA 3OP1A 2GSYA 3TNPB 1KTVA 4AVCA 1RQRA 2WNVC 4H7LA 3WF4A 4W50A 2YWEA 3PU8A 2M5SA 1W8NA 4G4FA 1T5EA 1AHSA 1XXNA 4YW6A 5CG8A 4HSLA 1YJNB 2HWC2 4D7TA 1BEV2 2PHBB 1N06A 1LOAA 3KK6A 1RHI1 4EN6B 1KXGA 1OLRA 5AN9A 1Q43A 1UX7A 4LBLA 5ABJA 5FP4A 2ADEA 1I0UA 4CUDA 3NWKA 2LALA 3IJEB 5IT6A 1GQGA 2FDKA 3KRKA 2JG9A 1BEV3 2RG4A 1DG1G 1VHOA 3ONUA 4X8IA 1ENRA 2BOUA 3WDYA 1GNHA 5A8AA 1PGW2 2VNOA 4X8SL 3SJZA 3ASRA 1OB2A 1MR5A 1WLTA 4NPLA 2Y5GL 4P2NA 2YMZA 4XILA 4CDXC 4PLMA 4NCNA 5JPMB 3W5HA 1T6BX 4Q4X2 4OZXA 4I3PA 4BQ3A 4YZ5A 1TVGA 5T55A 4NHYA 5AC93 4UXAA 2ZX0A 1K73D 3APBA 1H8EA 3I54A 3KF5A 1XNDA 4MGKE 2D6NA 2RR13 1WKYA 4JVAA 3VBHB 2VZVA 3ZPNA 4FN5A 2YU2A 1CVUA 3AZWA 4QM9A 2X3UA 1HB3A 4XABA 4C0HA 5IJRA 3N8WA 4FPKA 3WY9A 1WU1B 2JE9A 3AJZA 2OUJA 3K4AA 3O7OA 1Y7BA 1YFWA 1JYTA 2DCYA 4EH1A 4XUOA 3A3GA 1TUIA 1UNBA 4RLZA 1Y9QA 1KRHA 4ZY9A 5LATA 3N9MA 1E3XA 5BNQA 1JMUB 1W28A 1WZXA 1MQTB 3LIWB 1SKYB 4C1WA 1KD7A 2BBVA 5L9RA 3AP9A 2Y26A 5DG2A 2XB6C 4CDQA 1OHHA 2GH8A 4IV3A 3SH3A 4QHYA 4QPIC 1A78A 4GD4A 3J81k 2A5ZA 2WZR1 1Z6CA 3LA3A 3KZ4C 4N3NA 2ET7A 1VAVA 1A6CA 1VAKA 4NRQA 3R05A 4QDRA 4XR6A 4LHKA 2QQPA 4XPVA 4WZTA 1V6NA 2GAUA 2XVKA 2Y8KA 2WNOA 4GWMA 5FUIA 3CCEB 3OPOA 5K0HB 2AH2A 3OJWA 1X7NA 4RS5C 1XJAA 3RNSA 1W90A 2D5HA 3MZHA 2XWBB 2FZ1A 1ZNPA 4LO4B 4GQNA 3W2IA 3AZXA 1LEMA 3FCSB 4UAJA 4W8JA 1FOD2 3TEZA 3DXUA 2PUQL 3N9LA 1MRZA 4UW5A 3HQUA 1ND3A 2ZMLA 1YO8A 3BQJA 1OUXA 1WP6A 4XOPA 2C5BA 3X29B 5CEHA 4A3XA 2W94A 1DIWA 4LUMA 5F5CA 2Y5HL 5C6CA 3QCWA 1QJY2 3HIFA 3CCVB 3PGHA 3FFQA 1ZRIA 1WSRA 1FYUA 2VNVA 3W2EA 3ZN4A 2D44A 3ZYPA 4UF0B 3S5AA 1O5UA 1SG3A 3SKVA 1BLIA 5FK7A 5FP8A 1R1A1 1JHNA 1T2XA 3ZXKA 4A3ZA 5BV6A 1VALA 3WQZA 3CPXA 1DZTA 1H30A 1W9YA 3AMPA 4IW3A 4QT6A 2Q1JB 2WR9A 3ASTA 3AVTA 3NJVA 5GKAC 5LBCA 2R6HA 3RYKA 3N7MA 4DNRB 5GJ6A 4GWJA 1J1LA 1WSVA 2AC1A 1IQHL 4XORA 2ZMNA 4XN3A 1MPXA 3L9JT 4XCBA 4FPOB 5FBZA 3D6EA 4DUVA 4A41A 1BXHA 4P9WA 3Q3AA 4AI1A 1O7FA 3RQ0A 2E31A 4QPGC 3VLBB 1RIRA 4RFRB 2R30A 3V65B 1CJPA 2BT7A 4P25A 4X7FA 1HDKA 3ELAL 5FWJA 3ZIWA 1ATBA 2HWC1 4HL0A 4IV1C 4ZXYL 1LOEA 4L8QA 4LHSA 3DN7A 4LBZA 4HK9A 3ETQA 1F7MA 5ACA2 2DETA 1CQEA 4NGAL 2X09A 3M3OA 5DG1A 5TV2A 5FPVA 2WZR2 2Y0IA 1IQGL 1V1IA 1C4RA 5TY0A 4FOVA 3WF2A 4CTEA 1ATAA 2KVOA 4YNIA 4JYVL 4QHBA 2VD7A 2R062 5A7PA 4CYDA 1UY1A 1WPCA 4QU2A 1UZVA 4N7IA 2BSFA 4LBQB 1OGJA 2Y6GA 1AYN2 3NNGA 4PCRA 1NQDA 4C90A 1W8FA 4LE4A 1HXS3 1H2LA 1SLAA 3FMGA 1HB4A 1KJLA 4LHLA 5A32A 1BMV1 2WFXB 1EPWA 3ZYIB 1VBD2 3I2FA 1FNYA 2WPDA 4XJWA 2HBUA 2NM1A 3VBUB 4DPNA 5I8SA 2DVFA 3MCAA 3ZIAA 1DQ5A 2JDZA 3GHNA 3M3EA 4W6XA 1PJ6A 1CGPA 2AUYA 2XBO1 3SKBA 4ZV4A 4BMBA 4E4ZA 4KWLA 1JZ7A 1FPN3 5FZ4A 1QJY1 1SFNA 4OUEA 2V72A 1YX2A 4H2AA 4HG6B 1PGL1 3BODA 4D3WA 4QFMA 1OHFA 3ZUGA 3AYEA 4W6WA 1WLCA 3LE0A 3I2KA 5IVBA 1KRIA 2I45A 2VZRA 4RCYA 3O0VA 2YC0A 4YM2A 2XEXA 1UD6A 1AR82 1T6GC 2NMNA 3K77A 1UMIA 4X6QB 5EYYA 3UGFA 3DF0A 1GV9A 2RC5A 4RQPB 1XU1A 4WVMB 4LORA 1GOGA 3EO6A 2FD6A 5CFDA 3VUOA 2VNGA 5I0RA 1ULGA 4FOYA 2HWE1 4M00A 2WDBA 2V5DA 3N9QA 4O9EA 4PABA 1G7TA 1WCQA 1D4M2 3GCWA 4PBOA 1B2RA 1HLCA 1WOSA 1FOD1 2VAUA 4Q8LA 2IFRA 3GJAA 3MBWA 2OK8A 4V2WA 2AENA 4B3GA 1XNBA 4CP1A 1FSBA 2YWFA 2UWAA 5JUVA 2UU8A 1H4GA 2WAAA 2YBKA 1ZM3A 3A8JA 1GQHA 4GULA 3WDVA 3HNYM 5IK5A 4IEQA 3F6UL 3NSTA 4CPBD 4DXZA 4AFAA 5F1AA 1VPHA 3LAQA 5ACA1 4MV2A 1N0UA 2VYQA 3VD5A 1QXRA 4QVJA 3KQCL 3OY8B 3THCA 1BK0A 5JDBA 2EAKA 3MF9A 3WNPA 4DXSA 2WJSA 1K8AD 3TH3L 2ORZA 1W05A 3CC7B 2WLPA 3HBKA 1WGPA 2I07B 1CAUB 4Q0PA 5KHIA 1UCXA 2KXLA 1VLYA 2XGXA 4JQRA 4JTNA 2ZHLA 4LULA 1K5MB 3VHOA 3ZXFA 2WR8A 2Q1MA 3K75B 5L9BA 4CUAA 3KD4A 5JXGA 1EQHA 4OPSA 3MGUA 2V73A 5IHRA 3JQWA 2VBSA 2CAUA 4COVA 1RXGA 2V4VA 1WOPA 4AVBA 1D0GA 2QMUA 3PVDA 3BUCA 2E6VA 4X8TL 4RD7A 4YHBA 2V5YA 1AR91 1HRV2 3KT7A 5FZAA 5IFTA 1VHEA 2BGIA 4ZHAB 4NMIA 4RJLA 3WNOA 4LXLA 4EZ4A 3OOCA 3CMEB 1QQP2 2IC1A 2IFWA 2XGJA 3BN6A 4Y1VA 2A6YA 3WYAA 1UYXA 1QFYA 2IZWA 3LDBA 4SLIA 3AGPA 1Y43B 3LGRA 5JPNB 1VBD3 2WPKE 4H9GA 4HIZA 1OOPA 1CEJA 5E8DA 2JECA 2WNUA 3O5SA 3PJYA 3VBOA 3NTGA 2W52A 1W34A 4R9AA 3PHMA 4AC9A 1R092 1G1RA 4IE6A 3DGTA 4L2NA 4FPJA 3I59A 3M3CA 4Z2AA 5A6QA 2VH6B 3LWCA 4COXA 4AEJA 3TEYA 3MPPG 4NRPA 3BPSA 1CONA 2X5IA 2XNCA 4IEZA 2NPRA 2V7VA 1LESA 3OGVA 4X05A 1DZRA 1FV2A 2R0HA 2DCTA 4XLFA 1DQ4A 2ZOEB 5KNLA 4QHZA 4D0FA 4Z4RA 5J35A 1VBD1 2YU1A 3DXTA 1W0JA 3H9AA 3MLLA 4Y4YA 1UO9A 4Q4X3 3VL8A 2E33A 2H0VA 2ZGNA 5J36A 1IZ3A 4CUCA 2VWOL 4LPLA 4LLOA 2QQLA 2TUNA 4Q4Y2 2D1JB 3A35A 1A3KA 2XVLA 4Y22A 3J8F1 5A3MA 3PVBB 2PLV1 4UW3A 3KV9A 3B82A 1NJID 5HZAA 3E97A 4R4XA 5FTTC 2BVVA 4CDUB 3BIEA 4AHXA 4BE3A 3CZUA 1G2LB 2BT8A 2WJVA 4ZXXL 1W9WA 2XJSA 5DDJ2 5FJKA 1JZ6A 2C4XA 3ZMNA 5IYQA 3ELNA 1VBE1 3BCWA 3BYWA 4RR3C 1PGL2 2G00L 3CTAA 2XJQA 2VVDA 2EIGA 3QSYA 2Q4SA 3KCGL 5J1XA 4RFT0 5FO0A 1X7AL 1XSQA 3H1YA 2R7EB 3GZAA 3KCXA 4YG0A 4Z4YA 3CHXA 5FFOC 2RMU2 4IEXA 5FYIA 3MFAA 4C43A 4BQ4A 2R071 4DXRA 1WBFA 5C8CC 2UYAA 2D98A 2UY8A 2X0KA 4JMQA 5FZ1A 2WO2A 4RPBA 4P00B 5BNNC 3U37A 2EXKA 3CENL 4UZUA 1HW5A 2Y34A 1YLLA 1HRI2 3I97A 5LMZA 5FWEA 3ST7A 4Y5TA 1WW6A 1OKQA 2FHRA 1VBB2 4PJYA 5JVVA 5LBBA 3SLIA 4A42A 2HWF2 1US2A 2XL7A 3I2JA 3JQXA 1B09A 4XYXA 4YZ1A 1UD2A 1IQNL 1AYM3 2QTZA 1HB1A 2VQ0A 4XUQA 4GWIA 4AQSA 1CPMA 3A3BA 1AR63 4JGZC 4P9IA 4Y1ZA 1OMIA 2P3KA 3D5OA 4G5GA 1C8M1 2B42B 3AL6A 3CCJB 5FP3A 3BC9A 5A1AA 2W9XA 5FY1A 5L73A 3USUB 3AYDA 3KHBA 1GICA 3LQCA 2JG9C 1XB2A 3NMBA 4A45A 1ZX5A 4B1MA 1Y9GA 1PO23 2P4EA 4IQPA 4G7XA 4ASUA 3CC4B 1GU3A 1K12A 1UN1A 1F60A 2JE7A 2XJPA 4RRZA 2VZUA 5LWBA 1AX2A 2HKXA 1TTTA 3NNJA 3P6BA 4YZ4A 1UIJA 1SDWA 1S0BA 4IERA 5F5IA 3UNPA 3VHRA 3FBYA 1WCDJ 4A6OA 1G1QA 1FX0A 1LB2A 4H55A 4Y9RA 1UZWA 5EXOA 1YLOA 4GMP3 3AP6A 5FQ0A 1W04A 2VBBA 2QBXA 2Z4FA 1W6PB 4DY5A 4PQ9A 3G6EB 4IETA 3RVHA 4ET7A 1UX6A 4RD4A 3WQBA 3RI9A 5KHKA 4LMFA 3N8VA 4N9IA 4ZKTB 1RGSA 4RDKA 1F15A 1RC6A 4QPGB 1TLEA 4AYUA 2ZKNA 3A8KA 2WFF2 3KB5A 2W3KB 2ZGTA 2WYJB 1YHFA 3KV6A 5LB6A 4I0AA 3ATGA 4BU2A 1R5OA 1AL23 2Z5WA 1VF7A 5KXCA 4Y71B 4M1KA 2QVSB 5FZ3A 4AFDA 2QE7A 4Z1VA 3LOIA 4R9BA 1W2BB 4JAAA 1EFUA 4M10A 1D8TA 5HKKA 4LNVA 3OB8A 1TME3 5FXWA 4URAA 4WM7A 1O4YA 2QDNA 5C4WC 3AK0A 3LPGA 5CG9A 3MUZ1 5ISLA 4YAFA 4CEWC 2R043 4CU8A 4QXHA 1AJOA 3UYJA 2BEOA 1KDMA 2X05A 2EFGA 1SZBA 2UWPB 1VLOA 3H3LA 3OZVA 1UWWA 2D6KA 2PAKA 3LA2A 5EP9A 4C0BA 5A70A 5KHJA 4UFMA 1Y9MA 5IYNA 4EROA 3S5QA 2YC4A 3WSOA 1FX5A 5A7NA 4QMAA 4LEJA 3D4KA 5CU1A 1C57A 1FNMA 1W39A 2JB4A 1OD5A 2XH6A 3IAPA 3PDQA 3F2ZA 4DB5A 2OPKA 5E8AA 3AP4A 3E20A 2QN6A 2CHHA 2IVJA 3AZVA 4I01A 3TN92 4CCOA 4DIQA 1NB9A 4KWUA 4YZUB 1LR5A 3ZX7A 4B3NA 1NFUB 1NFYB 1UZJA 4LK7A 3NE5B 2WPJE 4Y22B 1COV3 1HT8A 4WVVA 3TN93 1LHNA 5LEKA 2G9FA 4D8MA 2X6YA 4M11A 5ABJB 3BOWA 2XNDA 3KEWA 5FMOL 3WW3A 3QFCA 1V6LA 3VKOA 4S2FA 3WDXA 1UXXX 3ZXDA 3B78A 4ZAEB 2RS52 2RS31 2WO7A 4IUGA 2RDNA 2P37A 1W0KA 1ULCA 2VW1A 5EZWA 2D40A 5FUNA 2RJKA 3VBRB 4LUKA 3ROUA 1OOPC 4JC1A 2VVFA 3I7DA 2UURA 5C33A 3E5UA 2WPIE 3ONYA 3NAPC 2XOKA 1O91A 2RJ2A 1AR83 3C7GA 3CLPA 4MX3A 4S2DA 1ACCA 2DBIA 2VZ1A 5D8AB 1LQDA 2FDHA 1U0AA 5FR3A 3OEEA 3CU7A 1UD1A 2V7WA 1XNCA 4BQXA 2JJ6A 3WHUA 1O3RA 1ADXA 1LULA 2BQPA 4JYUL 4FXGB 3E6DA 4GKXA 5HZBA 5LA2A 1IQKL 1CQXA 1D2SA 3DYMA 2BQ6A 4OQ9A 1U67A 2GJRA 2OZ6A 4XUPA 2BWCA 4FTEA 2ZJCA 3WV6A 2VWMK 1LPGA 3F95A 1IJFA 1ND2B 1PVXA 2W2IA 5IAVA 2ZMKA 3BNWA 2TBVA 4N53C 2VUCA 1RUD1 3Q8EA 1C8M2 4KGGA 2Y6FA 1JYCA 2D43A 2KM2A 4BXWA 5FZ8A 5GZDA 1JNYA 1UU6A 3GZEA 2DURA 3NVCA 4LTAA 1OKOA 3ZSKA 1F31A 1V00A 3NAPA 5F5QA 5GZGA 4OFGA 4Q26A 3MMPA 1KLJL 1CIYA 4KQ7A 1G7SA 3EGFA 1ODNA 1O6UA 5FYMA 4LBVA 3VB9A 3VKMA 4ISRA 5FXXA 3Q8CA 3HQXA 4Q4V3 1H85A 1D1NA 1YIPA 4FFIA 4M01A 2O8QA 1UZQA 1MZFA 2O0OA 1PMIA 1VE0A 5IVFA 2A3YA 1JYNA 2XC0L 2DYCA 3BPZA 1FRQA 3O12A 3O14A 3SQOA 4RDJA 1CQ9A 5J96B 1EAH2 4BCUA 1G7CA 4WZKA 5FZOB 4COYA 2WPLE 1D2QA 1L7QA 1S72B 2VVCK 2GD4A 1FMD2 1JUHA 1W9FA 2PHDA 5KN5C 2BVBA 1G9BA 4RCZA 1SBEA 4AFBA 1IGZA 5SV5A 1RUC3 4GB31 4XDPA 2HWD2 4Z4WA 3S0MA 1EPIA 4AHYA 1F9KA 1PVC1 1C5IA 1TG7A 2BGPA 2DVAA 2O14A 2DBNA 3PUIA 5JIAA 1O59A 2GP5A 1N7DA 2I9AA 4YM3A 3T1LA 3BKZA 3OSDA 1FE2A 4NHLA 1LODA 2OZJA 1UY4A 2YGLA 2IXIA 2D97A 1XQBA 1RUI3 2ZGKA 2WNUB 3ZYBA 3JQPA 4RHV3 2VMGA 3JBG1 2QEXB 2RS51 1E43A 5F3GA 3RWKX 5CB7A 3EBRA 1KK0A 5FZDA 3OBTA 1D4M3 2AACA 1UZKA 3KT1A 3MV01 1IOXA 5A88A 1IS5A 2FBEA 1YQ6A 1LNSA 1CAWA 4N53B 5L36A 4DO0A 3AX4A 1HV0A 1QDCA 4P9JA 3H42B 2RJLA 5FKBA 5J98B 4PLNA 3CW2A 4RQPA 1QOTA 3BPSE 2BV3A 4XOGA 3U4XA 3BTYA 2J34B 1EFCA 2KR2A 4NIIA 2VNJA 3V7AA 1YUDA 1IJEA 1PTHA 5DS0A 3AVYA 2XLGA 4KU8A 4BIOA 4X06A 4JZFL 2EF6A 1PK6A 4LOTA 1J3PA 4F7DA 4G3YC 2YPJA 1WOOA 1W8TA 1JOBA 1GOHA 4HN0A 2F4NA 3KQRA 1B23P 5C3OA 1DQ1A 1YRZA 4XJ9A 1VQKB 1QVFB 2RE9A 2VQTA 1OLMA 4CCKA 3MI8A 1TNFA 2JKBA 1VBC3 4RN5A 1FT9A 2WZNA 3M3IA 4QKBA 3ZIXA 4DRVA 1CJDA 1W6MA 3MFCA 3LOBA 4QUZA 1QJX1 4YALA 4YM1A 3V76A 5A33A 3Q7DA 2Z79A 3PTYA 4DEVA 5ABJC 3TYJA 1COUA 1IPKA 4LKEA 1EPGA 2ZTNA 4X7EA 2MHFA 4XLAA 2KL7A 1PGEA 2JIJA 2K46A 2XUMA 2ZBJA 1SLLA 1REDA 1ENQA 2ZBVA 3IDEA 1Q81D 4IEWA 3PENA 1XB9A 2VCCA 1V5VA 1FDRA 3G6JB 5FP9A 2CK3A 1OLQA 2XJUA 4D7SA 1JUIA 2PTMA 4JGZB 4XKWA 5FZOA 3ZSJA 1F7EA 1AYN3 2OYUP 2ZEZA 1BK1A 1F0SB 5DZEA 4AGVA 2F4PA 1HQNA 1UD5A 1UOJA 1S0EA 3ZFFC 2Q6KA 3HN1A 5CFDB 5HCHA 2BUKA 1GNZA 3IDAA 5L46A 3I3QA 1YFYA 4CSYA 4BMEA 1UD3A 2WNVA 3A22A 1KLIL 2XBYL 3NJPC 4R9DA 4KKTA 2A71A 5FPBA 1V6JA 2Z42A 3OBRA 2W46A 5BPXA 3VBFA 4BXFA 3OPTA 2J38B 2HCJB 1Z7S3 2RDSA 4JHTA 3OEHA 1QFJA 1N47A 1DZQA 1H8VA 2RHPA 1S4CA 1W8WA 4HPKA 4ZGQB 2W91A 1Y0YA 2C5HA 3HNBM 3ILFA 4MZUA 1G9DA 1K37A 2VZPA 3W5MA 1XOYA 1LKNA 1VBA3 1RUE1 1JYXA 5FMCA 1WU8A 4WZLA 1EBVA 1HX2A 3D82A 2BBAA 1POQA 1RUJ3 3T56B 1ULOA 2YV8A 4FTSA 2DVDA 2ADDA 2YGOA 3K51A 4YM0A 1LGBA 1FMD1 1NFXB 2GK6A 1MZ5A 1YFXA 4RR3A 3TAYA 2GREA 1DP0A 4X8UL 3BTZA 3QE2A 1NLQA 1PIV1 3POIA 3QFRA 5HXMA 2B7CA 3OGJA 4Z92B 1JV2B 1OSGA 2W5FA 5KSWB 3T08A 3V56A 2F43A 1WD3A 3IBMA 4HN1A 5GLVA 4UZEA 2R063 3VZJA 4QVAA 1NUKA 1RUF3 4PDWA 4XTPA 3WF1A 4WVWA 5J7MA 3P5BL 1RUG1 2XLFA 1ND3B 3LPFA 4YVWB 4XL1A 3ZOIA 4CDWB 2JG9B 4XM3A 3MEPA 1EPHA 4INDA 4Z8BA 2B9UA 5JZGA 3VDBA 2QDRA 5FREA 1NLSA 3VBOC 1N1VA 1OPMA 2Q6OA 2WYFA 2WINB 1OF4A 3E6BA 3G7DA 3O1TA 1HQWA 2HWB1 4RGAA 4WVMA 4BTTA 4PIXA 4CDQC 1U12A 1MVEA 3R0RA 1O3TA 3O1MA 1YUKB 3H9NA 2HLEA 2C4TA 1FMD3 4P14A 4QM8A 1CNEA 1JU3A 4PC2A 2A6VA 2FMYA 5FY0A 2Q8CA 2D3LA 3TK6B 5FZCA 4F3JA 4R4ZA 1MOXC 1FPN1 4TLGA 1LTEA 2Y7XB 1QMJA 2B5OA 3PVEA 5FZHA 3ZFGC 4TKOB 1QGLA 4HOOA 4N7UA 1HZ8A 2ZZQA 5IVYA 4YPJA 1DYPA 1YYNA 3VKLA 4MGIE 2J22A 3QH0A 2OBTA 3O1SA 2W86A 4FM5A 2XJRA 4Q1PA 5E1RA 2PHXA 4K40A 3W20A 2VNRA 2W0XA 1XE7A 3LF7A 4NR1A 5FZEA 1CPNA 1X33A 3B8HA 4K20A 4GH4C 1TPGA 2OVUA 1Z7S1 2WQ4A 4LLFA 4OMDA 3WY6A 1VB4A 4KH9A 4AEMA 4E4HA 1QGAA 1NA1A 1RTVA 1NX9A 3TEXA 2V7XA 1V6MA 2SLIA 5FYSA 3HPNA 3CZJA 3CCUB 3O1OA 4XACA 1EP2B 2PIAA 3POSA 2R9VA 1VQ8B 3W5VA 1V3XB 2FCVA 2YXSA 2RR11 1F4HA 2JENA 4BK5A 4KWKA 2R6QA 1JW6A 1C1LA 2NZ9A 5APAA 1K9MD 3MLJA 5C9AA 3W58A 4FP3A 4I0WB 4XFBA 5E89A 1AYN1 3CBNA 4ZU5A 4AEDC 4BDVB 3NV2A 1K36A 1OC1A 5A7QA 3WD5A 2JDNA 2XDVA 1OURA 2BSAA 3VNVA 2WPME 5KW9A 3ACFA 4META 5A3NA 3K2OA 3RJRA 5F4MA 1VRH3 1H2NA 3SOQA 3Q38A 2C24A 3E5QA 1SMVA 3OYWA 4GB33 4MGSA 5B4XA 4CDWA 1BF9A 5FO7B 1VQLB 1ZBA1 3M1HA 5F1RA 5JXIA 1X9TA 1CX1A 5L7OB 3JQQA 3JZVA 1EGFA 1H2MA 3NL1A 1ENSA 1ASJ3 2PHWA 1OA2A 4IE0A 4ZXKA 5L7OA 4M3CE 2ZL7A 2BOKL 2BNNA 4UYBA 3H7YA 2V4DA 1XE0A 4RHV1 2MEV3 5T54A 5JBBE 1SBFA 4Z4UA 3CD6B 2VTFA 1MZ6A 4QDQA 5KC6A 5KR7A 3OAAA 1T6XA 3EHKA 1AR72 1O8SA 2I74A 5JXJA 2R061 5B2GB 3HPTA 2CF4A 4BZ4A 1LOFC 4AVSA 1F5FA 1YUGA 3L2YA 1GUIA 1LOCA 2DUQA 4Y24A 1RUH2 3WW2A 2VBDA 5DMYA 2EAAA 2YROA 3NRUA 4JDNA 4MUVA 5F6KA 3HT1A 5BSYA 1WMDA 3PLQA 3UKVA 4AK3A 1DFQA 2FLGA 4KKSA 2XKPA 2RMU3 4LO7A 3QMOA 3VO2A 4YELA 1EWYA 1W2NA 2YBSA 3KCYA 1GWKA 1LHUA 3KM5A 1LHVA 4FPCA 4K1YA 1R5NA 3KT4A 4PF5A 2ZL6A 3W9AA 4DNTB 4ES8A 2D93A 2XWJB 5LA1A 1I9RA 4DUWA 2VTXA 4LK6A 3TEWA 4QXBA 1H8TB 3JU9A 2PHRA 3JB8A 4KL1A 3IT8A 3THPA 2E53A 5JR7B 1QJU3 3JCIA 4QV2A 3RMYA 2PXJA 3ZN6B 2VH0B 2GK7A 1GBGA 1X9PA 2Q30A 3IB3A 1OPOA 4MOAA 3VKNA 4XFIA 4II3A 4PC7A 3ASIA 4ACAA 5FJHA 5IW0A 1YIFA 5LK5A 1KFUL 5FZFA 4YGBA 2ZAAA 2FZ2A 2WFTA 1DQ0A 3HD8B 3FPPA 4ISQA 4UWDA 1OH3A 3TGFA 1NE6A 2RDQA 5FV3A 2J1SA 3MIDA 3WDUA 3IKWA 1VQ7B 2WIIB 5GZFA 3ILNA 4V1PA 4NN0A 2X6WA 3Q9OA 3IZOA 3WNMA 3O1PA 1YFUA 2P6CA 1X36A 4OLLA 2NMOA 2W3IB 4CE8A 4IV1A 1EP3B 4E9KA 2K2SA 2BOHA 2JG8A 3WXPA 2WWUA 5H9SA 5A6XA 3BTXA 3IIIA 3MHPA 3CCRB 4WM8A 4CUBA 3Q8FA 3AFKA 2Q6LA 1L7RA 2ARBA 1ELOA 2FLBL 2DOGA 4QX7A 4AI0A 3O1UA 4AFMA 1DGRA 1UMZA 3BH4A 4FFHA 5G04L 1IGXA 3KL9A 5A1LA 5LK7B 3LO8A 2MGPA 4RRYA 1N08A 1AL21 1LGNA 1SACA 2IXCA 5JMCA 2HYKA 1DIYA 3AZZA 3DYPA 4DOUA 1FATA 2BGCA 5FY4A 1MQ6L 2NP0A 2NPIA 3BCFA 1GQPA 4P1VA 1ZZ7A 2ARAA 4KG0A 1VQPB 4AI2A 2P3TA 4KU7A 2ZGQA 4IGQA 3VBRC 1GFF2 1XYOA 3RZZA 1IJQA 3NV3A 2WS93 1E5HA 4XFAA 1QUFA 4R8HA 2LS6A 1QGZA 4LBWA 3IM0A 2PELA 4GZ9A 3PIGA 3JD73 5I0TA 1RINA 1DX5I 3MDPA 4UT5A 3ZR5A 5A3WA 1G2MB 2ZGLA 1QXJA 5JBCE 2P3FL 5FL7A 1MS4A 1PO21 4OOVA 2GMEA 5F9TA 3EB7A 3D8CA 5JB9E 3FZ3A 3CRZA 1UYZA 3S7IA 1JA0A 2WNEA 1JXNA 2DU1A 2GMPA 3FHAA 3LZZA 3S6PA 2V7TA 2W26B 1LEDA 1QQP1 1KDKA 1RUI2 1UXZA 5DAPA 1CESA 5LBFA 3WF0A 3RZKA 2ZEWA 3NJXA 4BB3A 2F9BL 5FZMA 2ZXQA 2J1AA 3FUQA 5DN2A 2HYXA 1W6MB 2BPA2 1QJZA 1IS6A 4K8FA 2XQXA 3LAGA 1AX1A 1ZZBA 2YFZA 4XFCA 3WX5A 4AHWA 2GC3A 4IV3C 2JB8A 3KV5A 1RVF1 4N43C 4PIYA 4COWA 5A6ZA 2K2SB 5IKRA 1UZ0A 3CCSB 1DDXA 3VBSB 3MIFA 2WYGB 4D7YA 5GZCA 3W2FA 3GGLA 3WNBA 4BXSA 3GBFA 5JSPA 4XF3A 2PMDA 1BKZA 3R4SA 4LBMA 5GZEA 2P26A 3PUMA 1PM7A 1Q8VA 4Y79B 2CV6A 2JDPA 3CEWA 3FJSA 1E1QA 3JXSA 1NDHA 4ZU4A 2LZJA 2ILMA 1CZTA 3H3ZA 3WG3A 4E4SA 3I3BA 4EWDA 2VECA 5IFPA 3C9AC 4P12A 2G1MA 2WG3C 3D0SA 4GALA 1IGOA 1YQCA 2HDNB 3RY8A 1NB0A 1N1IA 1EPJA 1BX0A 1AL22 1ZA4A 3CNAA 3ZYGA 1IQDC 1C3HA 4IE7A 3BT1A 4QB6A 1QH7A 2FZZL 1OXCA 1RYYA 1N1YA 1MS0A 5FMOS 5FY8A 4CDXA 2RS33 3NNFA 3SITA 2QTWB 3NW4A 4A7IA 1H8HA 2VUDA 3KLSA 1EV13 3Q8BA 4NO4A 2MNGA 2DFBA 1OD3A 2J4IB 2BZ6L 2PR3B 1QH0A 1TMF1 2VE1A 3H1MA 2AR6A 4OZOA 1BX1A 5DN6A 2A73B 4ZXEA 2RM23 1E57A 1T6YA 4ZCMA 2Z2SB 1IVOC 4NIGA 2Y38A 4JRLA 4BM8A 2W6IA 1SLCA 1AR73 1S2EA 4IEPA 1GANA 1AXZA 3VHNA 1JZ8A 5IK7A 2VRSA 2AEYA 5E6HA 1SPPB 4EN7B 1N1SA 4WZEA 3LNNA 2BWAA 2J7KA 1A3PA 2FCTA 1B35C 1DF0A 3ACHA 3M3QA 3T3YA 3SEEA 1AX0A 1LU2A 4HKLA 3WBKA 1UZPA 3I2GA 1U5XA 1JU4A 2XUEA 5B6IA 3K4ZA 3N9PA 5FAXA 1BZWA 3VDAA 3W2HA 4AQ2A 3ON7A 4COUA 1RB8G 1IOAA 1WD4A 2LTNA 1AIPA 3L2HA 1H8TC 4ZU7A 1WBLA 4QX8A 1EAH3 2EIBA 1WA6X 4I0BA 2P3FN 3CB4A 3M4FA 1MEC3 4YWAA 2UWOB 5FYYA 1W9TA 4YSFA 4I2OA 4ACBA 2XLAA 2P3IA 2RS53 3CIHA 3FHQA 2WFF1 3GBWA 4K3UA 4YZ3A 4ATFA 5CFCC 3CJIA 3EXUA 3VV1A 1X50A 4K1ZA 3LVBA 3ZPYA 5JLVA 3D26A 1UPIA 3AKRA 2Y82B 4XCAA 1Q5OA 4BOWA 2XONA 5FMBA 4SBVA 4JGYB 2PQSA 1NQLB 2LW8A 4CDQB 5JSOA 2XZLA 1UW8A 2QUOA 4NHKA 3I4IA 3M36L 2GC1A 1IKPA 4UFLA 2OTLB 1J59A 3CKHA 3S6XA 1QDOA 2FLRL 2MHPA 2BNMA 2LROA 3J8F3 2BFUL 3T09A 3U1XA 1MQTC 1APOA 4BDXA 1BBT3 1BMV2 1DYKA 3LD8A 1QIUA 1RMU2 2XHKA 1PMJX 5FP7A 2BMWA 4J6GA 4B7KA 1SCRA 4ATEA 1UYPA 2VMHA 1N3PA 2X29A 1R64A 4P9LA 4GKYA 2R041 5KHGA 3CFWA 4DZGA 1MZEA 4XVHA 5BUVA 3INAA 1NLRA 4Y4RA 3ZSMA 3ZXEA 2OBSA 3O0XA 1IP0A 1KQRA 1PXXA 4UZFA 4V2VA 3NQHA 4EZHA 3U6BA 5T5PA 3FPKA 5A3TA 5L30L 3ZZ0A 4DK1A 2DTWA 3S7EA 2VXJA 2X5IC 2YB7A 4CP9B 1ZZ6A 1F20A 1AXKA 3PVOA 1WLWA 4QX3A 5F3IA 5FRAA 2BYVE 1S0FA 4NPMA 5LY2A 4R52A 2YWHA 2UY9A 2H6CA 2BFUS 2DVGA 2ZZFA 3CS7L 1WORA 1H0BA 2QA4B 5BNPC 3BI3A 1YUFA 3ILRA 1BLZA 4GJZA 3WXMA 4GWNA 4QQHA 5DSZA 3N3HA 3AGQA 2W1WA 4AR2A 4FOQA 1JBCA 2A6WA 2P95L 3RRDA 1S0JA 5M0TA 3Q3KB 1ENXA 3LEMA 4Q4X1 1UMHA 1XFOA 1JI6A 5A7OA 1FOD3 3VZNA 1QUEA 4WQMA 2JKHL 3KGLA 4CU7A 3U7UG 1NAEA 3AKSA 1F35A 3U6KA 4LHNA 1RUOA 2C5DA 1GP6A 2HWD3 4XNFA 2DUOA 2VQAA 2C0ZA 2VOXA 4R71A 4CEWA 5A89A 3EJKA 5CISA 3IWZA 1FNDA 3ACIA 2VNKA 3M7AA 4GA9A 4KMQA 3PTRB 4XBQA 1OH4A 3WINE 2V31A 4ASKA 4X8PA 3E6CC 1KSNB 1GLHA 5A1FA 5CFDC 1DGLA 2YGPA 4ITCA 4BQ5A 5T5OA 4Z1MA 4E0FA 1GAWA 4BYYA 1UYYA 3R6KA 1HAEA 2W08A 4IXLA 5AFBA 2D3NA 1E5RA 1UQXA 2FMDA 2VY0A 4JTOA 3VDDA 1R091 2BQ7A 3A1PA 2VL4A 2WSVA 3FLRA 3I56B 1NQJA 1F0RB 2IVIB 1HB2A 1JS9A 1QQP3 3PUQA 4KNCA 4L97A 4LQRA 4A7YA 4B4DA 1EMNA 4N90A 4OQ8A 3FX3A 3PURA 4CDWC 3FJOA 2ZGPA 4A44A 1IKQA 2J1VA 5ANNA 1KK1A 1BJQA 6COXA 2EIEA 2W1SA 4K21A 4QQ2A 4XDOA 1VQNB 2XJTA 2VO5A 5FZ9A 5EIYB 1HRFA 1OF3A 2QQWA 1W99A 2E7QA 4OUMA 4UW6A 5K0UB 2Q1FA 4XUNA 1ND3C 2QQKA 2WO3A 3B3QE 3VBHA 1IG0A 3LC5B 4EWAA 1WHFA 3SW2A 1S0UA 1ZM4A 3ZYHA 3OFNA 2GJPA 4X8NA 5A3PA 1CVNA 1CAVB 3WR0A 2WSUA 2ZZJA 1W35A 2IUWA 2HLDA 2YUEA 2RV9A 2CDPA 5EJZB 1JYVA 4ASMB 4U9UA 1XYNA 2P16L 3RS6A 2ADXA 2D5FA 4GIQA 4Y20A 5JZGB 3PUAA 2HEYF 3M70A 1OQDA 3UGGA 3M2MA 3MF6A 3O1VA 3QH7A 4AQTA 2JD9A 4L8JA 4QKFA 3B00A 3T0DA 4XDQA 1Q9SA 4CUGA 4PDWB 1G9AA 3IPVA 2VUAA 3LEGA 3AVWA 1U5ZA 3B7MA 3IDCB 1C1FA 3MPBA 5CNAA 5KXBA 3VD9A 5HXVA 5F6LB 3V64A 3BU0A 3ZN5A 4Q8KA 4W6YA 1MEC1 3G71B 3GCXE 2PE3A 2Z6BD 1COV1 1SFYA 1BVVA 4I3GA 4XIOA 4AL9A 1I7PA 4P9XA 4XFGA 2SBAA 2RM22 2FVGA 2YFUA 2WRAA 2RMU1 1MACA 3SMHA 2B46X 3ZZUA 1X8MA 2PMWB 4OPVA 4XLEA 1QKQA 3PUNA 4N43A 4TSFA 1A8PA 3WP5A 3QACA 2ATFA 1J83A 1OQ1A 3GALA 3U07A 4DFSA 1N1TA 1NY72 4W65A 2WL1A 3LN1A 5F3EA 3BY1A 1NA1B 2H9EL 2UYBA 4XQWA 3A7QA 1J9CL 2GALA 3ASQA 1Q82D 1PO13 1XNTA 2WZEA 1XRUA 1O4TA 4HFSA 5FLIA 4DQKA 5A7WB 1VB2A 1US3A 4RD3A 2X6XA 4TTGA 4RPDA 2AHOA 2ERFA 1CCVA 1FAKL 4ZGNB 3NJYA 4FPYA 1K5MC 4B4PA 4BXSV 4CCDA 2P17A 4QD2A 4PC1A 2WN2A 4X0CA 4TLFA 1HKDA 4GXLA 3GXUA 2ZGOA 1MS3A 1B35B 3SHRA 5A3LA 2W47A 4JZDL 1AR61 3GCWE 4AF7A 1NCRB 3DV8A 2I9BA 2P34A 1YHQB 3PIJA 4JGZA 2K0GA 2DCKA 4IDZA 3T1MA 4FK8A 4B1LA 5C70A 4N3GA 5E6TA 1YXWA 2E9QA 2CTVA 2HORA 5TSWA 3WP3A 1OA3A 4XONA 4B43A 3POFA 1O4ZA 1AR93 3MIBA 4UI9L 1W2AX 2R0FA 5F5AA 4BA6A 3PU3A 4JKKA 4NAOA 1J3QA 4QHOA 3AVSA 1YI9A 3MDLA 1HN0A 1ZBE1 3R4DB 3ZYRA 4BWOA 2VBVA 5A33B 4YW2A 3AM2A 5IVJA 1VBA1 2P6HA 2JG8B 1VQ4B 3DYOA 5DDJ3 5IKTA 2J94B 1L3YA 5A32B 4IV1B 3UGHA 4ZCIA 4AW7A 5FOBB 5J48A 1RUF2 4GMP1 4NIHA 2D6MA 2HWE3 1DGWX 4MHUA 4XBNA 5F19A 1HN1A 1ULDA 4MVTA 4MYEA 4OHVA 4NA9L 5FA6A 1LOBA 5F2SA 1HJFA 2JD4A 4ARXA 1CAXB 1IB0A 1RVF3 1R1A3 3TZIA 1UIKA 4XFHA 2AREA 2WKKA 1ASJ1 2A70A 2ID4A 5AVAA 3NAPB 3WG1A 2QZ2A 3NV1A 3GCXA 2DU0A 2JDYA 1Q8SA 1WCKA 3SXWA 4DY3A 1OOPB 3KS7A 4Z0LA 4PHZA 2A3XA 2DF7A 3AZYA 4ZPIA 5FPZA 2XZPA 5I91A 4XBLA 4LT5A 3KQDL 2JXAA 1Q7YD 2QNKA 4Q4W2 3W5UA 5LRRA 2GQFA 3K4DA 1K5JA 1X8EA 4XHXA 1E62A 5CFCB 5HCAA 1QIQA 3ES9A 2F6BA 3QLQA 3V64C 3FLPA 4GAZA 5FOJB 3CCQB 4TMZA 1HJGA 4PBPA 2ZBUA 5DUUA 1TME2 3BVCA 4DUXA 2YY1A 3VBUC 4PQQA 4Z4TA 2K9ZA 4S2GA 4YAOA 5EHDA 2XBXL 3RMXA 4ISHL 4BQYA 4TSVA 1HV1A 5A6YA 3MW4A 1CD3G 5LY1A 3SH4A 3NTBA 1LMMA 1H42A 5TR9A 1O5DL 1HXS1 1K5MA 2YBPA 3NKTA 4XLWA 4YXWA 1LHOA 1QJX3 1TZOA 4D6RA 1DQ2A 3ZLIA 4Z6AL 4Y33A 1S1AA 3LSDA 1YJKA 4E2SA 1VP6A 4JZEL 4D90A 3SOBB 2WJYA 1PZ9A 1VRBA 1WMEA 1T6ZA 1HJ7A 1NE4A 4LJHA 5F32A 3WW1A 3FKSA 4YAWA 2JICA 3OY8A 4XF0A 1DGRN 1XPWA 1YIJB 4UOJA 4Z82A 2VOVA 4CCJA 1EUUA 4DK0A 1MEC2 1QJY3 4RUTA 1W0PA 1E64A 1H1AA 5DAQA 2BOIA 2VR4A 3GSIA 1MQ5L 1ZBE3 2VMDA 4Y20B 5H5JA 5IK4A 1XE8A 4O02B 1RUE2 3PJQA 1ND2C 1ZBA3 1KITA 2RS11 4FCAA 5JXHA 3RZJA 4OI0A 4HE5A 4PC6A 2CW5A 5FIUA 2GN3A 1ZBE2 3DL3A 2Q6IA 2H9EC 3K48A 2OYZA 2X8KA 1TQ5A 2C4UA 3AKTA 3B9IA 4NIDA 1ATDA 1NBMA 1P8JA 3AKQA 3ZSLA 3VL9A 1YEWA 1NT0A 4BDWA 1W8HA 1RUJ2 3KWVA 1AR92 1HRV1 1LPKA 2ZA9A 4TYSA 1XC6A 4B8EA 3UJOA 4Y7AB 5TRDA 2ZABA 3OGRA 1FV3A 4J25A 1LOGA 2WZR3 1W6NB 4WM7B 3SCHA 4GU3A 3WNDA 4QXKA 3GNEA 3KF3A 5LCWL 4TZDA 4NBSA 1D7PM 5IYPA 4KBZA 1IG3A 4OI1A 4IEYA 3C3VA 4AI3A 1E5SA 2XPJA 5T5LA 1YQ5A 4MGZE 1I5PA 4OPOA 1ND2A 2GP3A 3K9XA 5DXDA 4L99A 5ACA3 3VDDB 5I8TA 3AP7A 1G7YA 4ROXA 5IUQA 3ZBTA 1W8BL 1REEA 2G19A 3B69A 5J37A 2Y6KA 2IXLA 1XU2A 4K1XA 1M1KD 1KFXL 1ZZ8A 3P26A 3ORJA 4NWWA 4O9GA 3ZVXA 5I8YA 4S2HA 3T4HB 1M90D 5FLJA 2V7QA 5EYXA 3VZMA 1W2UA 1VQ6B 1F8VA 1FNBA 4QKNA 1B9WA 2Y7ZB 4M2LA 2YG0A 1BHGA 4Y3OA 1CCFA 2C9AA 4CEYA 1UU5A 3C7FA 3UETA 1SKQA 1SLBA 4DEQA 5BSXA 1V0FA 2ZACA 3OBZA 4HVRA 1GYKA 4Y26A 1TOZA 5GV8A 2BV4A 1HXS2 1EAH1 1WLDA 3N9OA 4LBNA 5K4LA 4FBFA 4PI2A 2Y6JA 4TMWA 5JOWA 3NNMA 1ZRRA 1Z7S2 1PGSA 2WABA 3HN3A 4QB1A 3WG4A 2RNLA 1IQEL 1VJSA 2P3MA 3AYAA 1EFRA 1Z0HA 4HANA 1Q4GA 4H3WA 5H9PA 2W6JA 1Q8PA 2ZGUA 2YWGA 2ETEA 5F37A 1JTZX 1JYWA 2OW4A 3N8XA 4B29A 2D3PA 1JH5A 3CC2B 4HXCA 1JOJA 3WQ0A 1ATEA 1TE1B 1KMHA 3VR6A 3SC7X 1I18A 3J4UH 1UD4A 2Y6HA 4GH4A 4P9GA 5C8CB 3FFZA 3F1SB 4X7CA 3DPRC 4HVOA 4UBHA 1YJ9B 4Y7CA 2JEMA 4QPIB 1PX3A 3DECA 4QPWA 5HI0A 2HEVF 1PNFA
chains in the Genus database with same CATH topology
1TMF3 4HKWA 2EA7A 3E5XA 4OHWA 1GSLA 1ZYBA 4F83A 5C8WA 4FPHA 3MYXA 4CP0A 5JZGC 1V6IA 5FDQA 1URXA 3LN0A 4QGLA 1ZRCA 1RUJ1 1VBB1 2IXHA 2WFF3 3N7LA 1IQLL 4XBMA 2JDIA 4QQLA 4KWJA 3WUDA 2W2PE 3J9SA 3ZN6A 1DLLA 5BNOA 2GMMA 1H8TA 4YG6A 4XE9A 2BO2A 3OPZA 4FXKB 4AEKA 4XIKA 1XNKA 4P22A 4LA2A 5K0UC 1PVC3 4CEYC 2OA2A 4MSVA 1RFNB 1R1A2 1C5HA 1WW4A 4MXWA 1SLIA 4XLHA 4XMIA 1QNWA 1J1TA 2WT2A 4LO6B 2DCZA 1DQBA 1QNYA 1Q56A 1UU4A 1KZLA 4XHBA 4E1GA 4XKVA 2CY6A 2W2NE 3LTGD 1OFSA 4CUEA 5GLUA 1SCSA 1S0GA 3ZXAC 1VIWB 3HS7A 2VGDA 4B4RA 2YHJA 1Q3EA 1DG6A 2UWBA 4LBOA 4XMYA 2D3SA 1D4VB 1WHEA 2PHLA 2D6PA 5DUXA 1E3ZA 1YNAA 2VW0A 3BIWE 3UJQA 1ZZ9A 2X53S 2I2SA 3T2TA 5CBLA 4FT8A 2ZGRA 3V0BA 1QJX2 3CP2A 4D94A 4D0EA 4HK8A 3SH5A 1AUTL 1NZIA 1XYPA 1AF9A 2Q8OA 4I02A 4WZCA 3TNQA 1LECA 1CX2A 2D6OX 1HX6A 2VJ3A 2VVVL 4TGFA 3DEMA 1PFXL 1WA4A 3USSA 2ZTGA 1NCQA 2ARXA 1DU3D 4YVWC 3VZOA 2JJ1A 2PA7A 1OQEA 1H2KA 3HBZA 4Q2FA 2QJVA 5GLWA 1G9CA 2DWRA 5AC92 2PHFA 4TT3A 4L92A 4AF9A 5BNOB 1EY2A 4WBBA 5KHHA 4CDUA 4WVZA 4NPRA 2TNFA 2DV9A 5KC5A 4Q4Y3 4AEDB 1COWA 4YVWA 3SISA 2WFPA 3GQBA 2ES3A 4HBNA 3KQEL 3OLUA 4Y1UA 2CGOA 2W68A 1JL9A 1U8CB 1F2NA 4XLCA 2R1DA 3U73A 1RVF2 1V9U2 5I0UA 1WUVA 1PNGA 3AXDA 1NXMA 3KSCA 3RPQA 2ZKLA 5IKQA 1LMJA 5BYNA 2GNMA 1QOSA 5GALA 2ZHMA 5AVPA 1FI2A 1NRKA 1QJU2 3WW4A 1UZZA 4JCKA 3CMMA 2Y80B 1S0DA 5K8SA 1POV0 4AE2A 5I93A 3FUOA 1RUI1 3M8LA 4UBGA 1S55A 3GVJA 3ENSA 1RUG2 2A75A 2ZHNA 4JRAA 3OE7A 2NQYA 4NHMA 1L5GB 1QXPA 4N9HA 1BEV1 3UKNA 5HBAA 1S2KA 5K7PA 1RHI2 4JDOA 1EZQB 2VVUL 4QPYA 3URFA 2QCSB 4E27A 3ZXJA 5L2YL 3R6SA 2Q0AA 4X6RB 2RR12 1AUYA 4RA0A 1LENA 1R093 4B7EA 1U5IA 2Z69A 1O3QA 2GNBA 1CAUA 4MH0E 3H8UA 1YJLA 2ET1A 4HVQA 1HQLA 2DTYA 1V70A 1PKVA 1ZBA2 2VXRA 4H7MA 1ZAQA 1AVBA 3GVLA 4N53A 3ZO0B 2G4IA 2XBVL 4HT1T 1RUNA 2YYOA 3P3PA 3QOPA 5CADA 2BMGA 3CF6E 2KB9A 1S0CA 2G9GA 5IK2A 4OHYA 1BYHA 2DIEA 1YWKA 1IQFL 3HAGA 3PMEA 1G8WA 3KL6B 4L11A 4E2GA 2WNUC 1ONAA 4Z0KB 3AMHA 3RI8A 1QFKL 1BBT1 5GLZA 3TBDA 2VULA 3DPRA 1FJSL 4O1ZA 1PK6B 1QF3A 4GQ7A 3WP6A 3AXEA 2ZPXA 1DVAL 1BQPA 3FC0A 4Q29A 4CP2A 2WS91 4RRWA 3POWA 1RUH1 2WG4B 1EAIC 4FXUA 4XQDA 1M1XB 3OD0A 3LKJA 4A7KA 2LM3A 2Y0OA 4Q4Y1 2BNOA 2IXKA 1KLOA 1LGCA 1SBDA 4Y5Z0 5FO9B 1TNRA 4DRRA 4RHV2 3POYA 1H9PA 2ZCWA 2CGNA 3AP5A 1NCQC 2TGFA 5KXDA 3FE5A 2XJVA 5E16A 1ZRFA 3TWIA 1QY4A 4XW3A 5FO8B 1Q8QA 1R081 3WCSA 3JUUA 2W2ME 4FOWA 4Y1XA 2VUJA 4XZPA 2GDFA 2EXJA 2CWMA 1OB0A 4BPZA 1IS4A 4NWVA 2N7GA 3AFGA 2OIIA 3OCPA 1YCIA 2ZX1A 2HEWF 5CIRA 1S0IA 4YT7L 2JX9A 3BT2A 5CDFA 4LO5B 3RSJA 5AFEA 3OYWB 3BCDA 1EMOA 5FQ0B 4ASLA 4CZSA 4EWEA 3SOVA 2VU9A 2D6LX 2M74A 2PN5A 2WA3A 1XDTR 4Q0UA 1VBC2 1PHMA 3WUCA 1UF2C 1G86A 3ME2A 3V0BB 1PIV3 3WZ1A 3N36A 3FBMA 3IN9A 3CO2A 5I46L 2OYEP 1GZWA 4FQ4A 1C8NA 2ZZGA 4FPEA 4U2AA 2WWSA 5D1IA 1EQGA 1NYWA 2PLV3 4IV3B 3GYDA 4YVSB 4FAGA 2GH2A 1AYM1 4OHXA 5CKNA 1RJ7A 1EV11 4HSJA 4YW4A 1CAVA 1NCRC 3FWEA 4EV0A 3AMNA 3CESA 1VBB3 5HCBA 5C9AB 5JVZA 1EPZA 3VN4A 4BTUA 2EALA 3GVKA 2VOWA 3CL1A 2DVBA 1CIWA 4P9YA 2WQZC 1XKBA 1NCQB 3IDBB 4G7WA 1RUG3 3N35A 3JD72 4LBKA 3U11A 3I2DA 3DDYA 1CVWL 3H0OA 4B4QA 1NA1C 2Q1ZB 1I3HA 3B01A 2VJIA 2VOKA 1EYBA 1MQTA 3HO5A 4FPFA 2LUWA 3VBUA 5I8YA 5IT6A 4II2A 3P3NA 3WOGA 1MS1A 1RUC2 1ZZCA 4U36A 5GM0A 4J1XA 1LJ7A 2ZXIA 2ZX4A 4CEWB 2P2KA 1P9JA 2XC5L 3OD4A 1VR3A 3ZFEC 5JAXA 1HIXA 2GZWA 4RGGA 3VBRA 2ZGMA 1COV2 1RITA 2QFEA 1ZM1A 3EQEA 4AGGA 2CYFA 2HJIA 5CKQA 3T53B 1NFWB 4XF4A 4FO9A 1ULEA 4AXOA 1PO22 1YI7A 2HWE2 5L19A 5BNNA 5T5JA 2O1QA 4YFZA 1HT5A 3N4MA 3TK5B 2WZPP 5CKMA 3OF1A 1IPJA 3MQEA 4BLJA 2NN8A 4LE3A 4BTIA 4OTJA 2GNTA 5JBAE 4XXAA 2AZ5A 3LA7A 4CRQA 2JG8C 4HPKB 1UKRA 2BOXA 1LCLA 2A6ZA 4YZ2A 4YFWA 4AFCA 1IHMA 1FF7A 2JIZA 1Y3TA 1RJ8A 2RS32 3VKFC 4BH9A 1GK5A 3UKTA 3G05A 2B8MA 4FPLA 2YGQA 1EV12 1VJ2A 5LRSA 1H1MA 5DUWA 2H6BA 1HREA 1HRV3 2WSSA 3BU7A 3HS5A 4OUSA 2ZHKA 2PYTA 3HS6A 1HCGB 4P5HA 4XD7A 2KV4A 3PVNA 1BVP1 4OTYA 4ORFA 1VBC1 5E88A 3VBFB 4AVAA 2E7TA 1RUF1 4Y7BB 1L3JA 2WNVB 1FAYA 1URKA 2CAVA 2MEV1 3VBSA 4Q0VA 4F8AA 1W7XL 1RL3A 2P28B 5KBFA 4LR4A 3OLTA 4BOWA 1IQJL 1AXYA 3PNAA 1VLNA 4OVEA 5DZFA 3RR3A 5BNNB 3WCRA 1AYM2 2HWC3 3VHPA 5JOYA 3SCFA 1GR3A 3HO4A 1BMFA 3UV9A 2WT0A 4FP2A 2AYHA 1M06G 3H1WA 4IEVA 5JOZA 3NO8A 2PFWA 3O0WA 2MGRA 3I8TA 4HMZA 5K9YA 3N8YB 2UWLB 4RR3B 1IS3A 1VBA2 1G6NA 2GC2A 3I59B 3J8F2 2XKOA 1HRI1 3S30A 2K2TA 4CDUC 3AYCA 3UL2A 2E63A 3HO3A 5DDJ1 3VZKA 4AWDA 4XJUA 4M0NA 2XVGA 4QQOA 1J3RA 5COXA 1RUC1 2CWSA 3N8WB 4X8VL 3WP4A 3ALQA 5JOXA 4JDMA 1DQ6A 2D3RA 1KS5A 1VBE2 2GJKA 1JBUL 1R1ZA 1LPZA 2P3JA 3MLKA 1A8DA 2QE3A 2JJ2A 1HRI3 3FLTA 4HLTA 3PMSA 4YRDA 1RMU1 4XJ8A 3A4UA 2WA4A 3ZDSA 4GH4B 5C8CA 1PO12 3GISX 2UWCA 2KA3A 2FQPA 3KQBL 4YW5A 1LHWA 1NG0A 3ACLA 3AKPA 3WT3A 1POV3 3ES4A 1AL0G 2WLQA 2C1FA 2EXHA 3LCPA 4KG8A 4K9SA 4YG3A 4A7ZA 1DDLA 3THTA 1KS4A 4F7ZA 1RHI3 5BXXA 1W6NA 2XBO2 3DUIA 1W6QB 4LBQA 4Y6DB 1UAIA 4Y76B 2EI6B 4Y1YA 2IWGB 1XQNA 2XBO3 3VBOB 5EV7A 4CEYB 1YGCL 2QZ3A 4G9SB 2B5HA 4JV4A 4G1MB 1AR81 3GHMA 4URTA 5CAZA 5J3UA 1W9XA 4B3FX 4HZFA 4I09A 4GMP0 4YGEA 4XQFA 3RYPA 3OW7A 4EN0A 4QQPA 2RA0L 3MW2A 4BLIA 4C1XA 1POV1 5JB8E 5JW1A 1D4M1 2A6XA 2R16A 5BNOC 1NOVA 1LU1A 1MVQA 3RJ2X 1PZ7A 3DKWA 3WDTA 4AGRA 1D0HA 1W6OA 3LC3B 2BTVC 3B94A 2MEV2 5JPMB 2W2OE 3T51B 3QH6A 4NOTA 4AQ6A 4XTMA 1SLTA 3QD6A 2ZGSA 3QBQA 3CJXA 2RS13 3U0ZA 3A0KA 4PIZA 2F1MA 3AMMA 4K6BA 1V0EA 3ZFGA 1CAXA 3WDWA 4XJAA 2Q5TA 5CFCA 1WW7A 2RM21 2QKDA 3DPRB 4Q27A 1FFMA 1GKBA 3MICA 4JGYC 4NG9L 4G6IA 1UPSA 4K7JA 2VWLL 4AI8A 3WVJA 1F5JA 1VAMA 4KGQA 1NZCA 4YT6L 3ZFFB 4WZFA 1C28A 4MLOA 4RRXA 3ZSEA 1Z78A 4C16A 4AVVA 3ES1A 4H14A 4DNYA 4XN0A 3VZLA 2XZOA 5DUVA 2TEPA 4R9CA 5CA6<