2WZPP

Structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
298
structure length
298
Chain Sequence
GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE RECEPTOR BINDING PROTEIN
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 65
structure length 298
sequence length 298
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.60 Mainly Beta Ribbon Laminin Laminin 2wzpP04
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2wzpP01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wzpP03
2WZPP 2X53S
chains in the Genus database with same CATH superfamily
5FUPA 3ASIA 3WOGA 5FWEA 2D5HA 4MGIE 2XJTA 1DFQA 2XKPA 4HANA 2W3KB 3KM5A 1FJSL 1M06G 4XIKA 1US3A 1LULA 4N90A 3BPZA 2JG9B 4IQPA 3LE0A 1AMOA 3N9OA 2VH9A 1OB0A 4PQQA 3AFGA 3QH6A 1OLMA 4YVWB 1MPXA 2WO3A 4XN0A 5A3WA 2WNVB 4ISRA 1RITA 1VF7A 1UCXA 1WW6A 3NMBA 3I1FA 3SEPA 4X8VL 2R1DA 1LHVA 1IS3A 1RUG2 3GYDA 5CKMA 1J3PA 5FUIA 1CCVA 2B42B 1H4GA 1IG3A 3Q9OA 3HN1A 1CAXA 1VRH1 2ERFA 3V0AB 1Q4GA 1HAFA 3P5BA 2UWCA 4RPBA 1AF9A 2ZL6A 2DVDA 3N9MA 4Y7CA 3PIJA 5KXCA 3K3NA 1RUE1 5EIYB 1WOPA 4XOPA 2X10A 1X9PA 1KFUL 4IEYA 5I46L 1BK0A 2W1QA 1VE0A 1RUI2 1U5ZA 1RUC1 1NCRC 4X7DA 1C1FA 4FVVA 1JUIA 2F4NA 1V6MA 2AH2A 2I74A 3ZYHA 1L3YA 4YZ5A 2F4LA 2R0FA 4NBSA 3HBZA 4HONA 2DDUA 1NRKA 1X33A 5KHGA 2NMNA 1DQ1A 1E79A 5EJ1B 4PABA 4CCDA 4GQ7A 3HS5A 1XU1A 4X8TL 5GV7A 1OLME 4AGRA 4P9SA 2R30A 1LHWA 3VBOA 1YX2A 2GQFA 1T6GC 1EPJA 2YB7A 1LOEA 3A22A 2BWAA 2OPKA 4JRLA 1Y0YA 4QHYA 4WM8B 4BZ4A 3VBOC 1LGNA 4PAAA 1ZAQA 1ZZ8A 1KQSB 3VD9A 4QB2A 1KD1D 4AE2A 2TBVA 3GCXA 4DUXA 3IIAA 3FPPA 4K9SA 2J1RA 2ZACA 2BQPA 4NGAL 4B3XA 1KS5A 1TVGA 2YFUA 4ZPIA 2YXSA 5BSYA 4AVSA 5F37A 3SCHA 3SITA 4JZFL 3FFQA 5FYBA 1JTZX 3LIHA 1IJFA 4H55A 1FSBA 2PLV1 5A7WA 4GWJA 4Q4V3 1OOPC 2C4UA 3WXPA 2VVCK 3WUDA 4AWDA 4OUSA 2Y8KA 3ACGA 4AQTA 1S0GA 2E26A 5C71A 3MIHA 3ZFFB 4RR3B 1ZM1A 3RDIA 1YXWA 3MV11 1PGL2 1ODMA 3FE5A 3T0DA 5ABJC 1ZBA2 2JICA 4PC1A 1HXS1 3RJRA 5A32A 1COV1 2V5YA 3WBJA 4JHTA 2Q6KA 2UU8A 3CC7B 1XJAA 3E1YE 4H14A 4YAWA 4CA9A 5H9PA 2XC4L 3POWA 4OZOA 2A7AA 1CWPA 2ZZJA 3U2QA 1N7DA 1JB9A 4LIUA 4XE9A 5C5UA 2WQ4A 4QQ2A 3HAGA 4CCJA 2P3IA 3VBRA 4S2FA 4Z4UA 3BB6A 3ZKYA 2GJPA 3CMEB 2WQ8A 5TY0A 1EFUA 3VBRC 4NNJA 1S0DA 3NWKA 4QXKA 4OUMA 4C43A 3KV5A 4P25A 3SJZA 3RZHA 4RDKA 4A45A 1RMU1 4F7DA 3LWCA 2PN5A 2NYYA 1LENA 1JA0A 2BZDA 4IE6A 5FMDA 4XLCA 2B9VA 5F5QA 2VQTA 1IGZA 4LITA 5F3EA 5C3SA 3SKBA 2WYFA 1KJLA 4CDXB 3RJ2X 1QH6A 2VC9A 4IW3A 1YFXA 1RUJ3 5FLIA 2W87A 1GR3A 4YELA 1YCIA 4LBZA 1GNZA 2DIEA 1NQJA 4QMAA 4XOTA 4XL1A 2O8OA 2D40A 2GSYA 2JB4A 1GVHA 5FBZA 4BB3A 1FNYA 4BHPA 5I8TA 4BCUA 2H0BA 3I8TA 3E6DA 1PO11 5LCWL 1ST8A 4CCEA 1P4MA 4LUMA 3B5LB 4X7EA 4AFCA 3BQJA 3DKQA 5FIUA 4IE0A 4AEDB 1W0KA 4N53A 5J98B 2P6HA 2AR6A 2JDZA 2RS53 3MDPA 2Q6LA 1ALYA 3LQEA 4IV3B 4PC2A 2VZQA 1VBD2 4H7MA 3FJOA 4NWWA 4OI0A 4HN0A 4JZRA 5LEKA 3R4DB 1LOAA 1NE4A 2XXZA 3U10A 1ZM3A 2WINB 1I9RA 3DXUA 5FZOB 3L2YA 3HQRA 5CBLA 3ENRA 4YT6L 1H1IA 1YNAA 3PA1A 3OLUA 1H8TB 3VKMA 5DAVA 3EBRA 1VBE3 1GOFA 2RM23 2BT8A 3N8ZA 4IEZA 2PAMA 4HK8A 4XLFA 4J1XA 2HBUA 1ENSA 4NHXA 2CDPA 4LEJA 2NN8A 1YGCL 4YYOA 1M1XB 3PLQA 3TK5B 4ZCMA 1RVF2 3ZZTA 3VBHB 3PUHA 4XF9A 5AVAA 1VQ7B 4RGKA 1RYYA 2OTJB 2GJRA 4LOSA 4HK9A 5IVBA 1E5SA 1PVC1 3HPTA 5F9TA 3KVBA 1NG0A 5K4LA 1BEV3 1L7QA 1UD5A 2RNLA 4I30A 5JZGC 4ASLA 3LSEA 4A7ZA 2FCVA 1UOFA 2CTVA 2IXKA 4DMIA 4E4ZA 3G6JB 3T2TA 4L11A 4W50A 3JZVA 4R9CA 2HWC2 1L7LA 2VUJA 4ZCIA 2V7VA 5LEJA 3TN92 3H7JA 3QFSA 3KRKA 5FP3A 3KB5A 4GWIA 5FP8A 2P4EA 2YBSA 5BNPB 2CV6A 1G7SA 2VJJA 2B39A 3N8VA 4RDLA 4DUVA 1UZJA 2OQ6A 4NOTA 4KWKA 1OD3A 1F2NA 2QJVA 1LCLA 1JU3A 2XH6A 2H9EC 1IS5A 5HPOA 2GC1A 5A1LA 4YM0A 1PM4A 4X7CA 1X8EA 3WW1A 3BY2A 2CF4A 1JBCA 1QNWA 2GD4A 2ZXQA 3OFNA 1W34A 3CHXA 2XEXA 5FYZA 2JE8A 3D26A 2JIZA 1DLCA 2VMHA 3V65B 1OFNA 5KSWB 1ZZBA 4GULA 3SKVA 2Y0IA 2B4KA 5DG2A 4F83A 1W8UA 1Q9SA 1CPNA 4Y24A 4AFBA 1XU2A 4R52A 1HX6A 1I1EA 2WDBA 4FAGA 4BK5A 2ZX2A 1KKEA 1Z7S1 1XXNA 2P37A 2AZ5A 2P3KA 4QQOA 2VOWA 3JQPA 1YQ8A 3ZPOA 5JOZA 5IVFA 4CCNA 2WO2A 5I0RA 1DP0A 1RUJ2 3U6KA 4MHUA 5E88A 3IITB 2OZ6A 1RFNB 2QZ3A 1JZ6A 3WP5A 1BMV1 3PUQA 4LBYA 5JR7B 2Y6FA 4Y20B 4UBGA 3OGVA 1HZEA 4QKFA 3U0ZA 2ZBUA 3BT2A 3AVVA 1W0JA 1R083 4QT6A 5K0UA 1UY4A 3CU7A 3HN3A 1EPGA 2ZEXA 2VRSA 4DY5A 1UZ0A 4XR6A 5KC6A 1IQLL 1MQTA 3CKHA 4KNCA 4YALA 3K46A 3SQOA 5K0UC 1W8HA 2RS52 1VQNB 1WCSA 5H5JA 3HPNA 1PIV1 3I3MA 3O1PA 4LE3A 1PMJX 4LTAA 3R6JA 1JYNA 1SKQA 3HO3A 2XNJA 2J95B 1Y4WA 2XOMA 4L0PA 5GLVA 3N3HA 5DUXA 4X8NA 1KMHA 3RRDA 1BF9A 3VKFC 2WPIE 3FHAA 3VZMA 3N8YA 4H2AA 4XQDA 1ZBE3 2W2PE 3V0BB 4QKNA 2VUDA 1GAQA 2RM22 2LALA 3KQDL 4XEZA 4AEMA 1E3ZA 2GREA 4HPKB 1BHGA 3SEEA 3VB9A 4B3FX 1AR72 2BOUA 1Z6EL 3BC9A 3OD4A 4QV2A 2QQVA 4CDUC 2QEXB 4QPIA 4CU8A 2Q8EA 2WNUA 1JV2B 4IEXA 5T5LA 3GBWA 4ISIL 1B23P 1KSNB 1POV0 4MADA 1KLIL 4E9KA 4FFIA 1QOTA 2VZOA 4E27A 1HB3A 3AP4A 5A70A 5A7QA 2BYVE 5DZGA 4D7YA 2ZPXA 3WW4A 2QNKA 1W2UA 1CIYA 2PUQL 4XBLA 4XUNA 4CRQA 3IZOA 4M53A 4TTGA 1A8PA 4U36A 5FZMA 5KXBA 1P9JA 2D3LA 3G05A 3FL7A 3OBTA 1GNHA 4TLFA 1PGSA 3LTFB 2HJIA 2B7CA 5H9QA 2ZHLA 3OF1A 4HBNA 3B9CA 1YO8A 2B9UA 4KI5M 4JGYB 4QM8A 3PDQA 5IFPA 3HVDA 3SKJE 1QH0A 4CPBD 1B35A 1VQ5B 4RS5A 1RUI1 1J1TA 1FAYA 5LK7B 1GV9A 5FUNA 5HXMA 5A3PA 1V6IA 4RD0A 4JQRA 1WTHD 4CEWA 4WZTA 1B35C 4ASMB 4XD7A 2AYHA 5CU1A 4CYDA 1HIXA 1HA3A 1E43A 4DXRA 3OPWA 1EP2B 1Y0RA 2ZS6B 1BKZA 3OBAA 1XQBA 2D6PA 3PUAA 4UBHA 2QQWA 4FPCA 1QOSA 1IJQA 4XJ9A 4X05A 1C4RA 3S7IA 1VIWB 2Z4FA 2W94A 4NIAA 3R6SA 3PL0A 4M00A 2DU0A 1DG6A 4XDPA 4X7FA 1XOYA 1G7CA 3RZJA 4H7LA 3MIDA 4CP9B 3RYPA 3NQHA 1TEIA 5C8CC 2Z42A 3VMFA 1SLIA 4HKWA 2TNFA 4PCRA 1W99A 4ZHAB 3BU7A 3KL9A 5FP7A 4DNRB 1R082 2DVBA 4AL9A 1ZRRA 3E6BA 1AIPA 1MR5A 5C3RA 4M2LA 4DK1A 2TGFA 4K40A 2BQ7A 4ZY9A 2BEOA 4JYUL 4XAAA 4EN8B 1KITA 5A33B 2VNOA 1PRHA 4UT5A 4Y1VA 3J7HA 5LZ6A 2QVSB 4YHBA 3J7MA 4KKSA 1REDA 2C5DA 3RWNA 2G1MA 4FCAA 3WX5A 5FAXA 3ASRA 3K3OA 2X09A 3BKZA 3C2UA 1MVEA 3JQWA 1SG3A 1UD3A 3Q3AA 5CISA 4QU2A 1YQ2A 1JZ5A 3O0XA 1NXD1 4LLFA 1UOBA 2BU9A 1UY2A 3H94A 5FK7A 1ZBE2 1ZBA1 3VL9A 1W90A 4OULA 3N9QA 4W4ZA 5THXA 2VVEA 4BXSA 2LM3A 1WW5A 1Y43B 3H3LA 5CKNA 4MMXB 4O7XA 5FYMA 3K2OA 2Y33A 2FD8A 1J3QA 1CCFA 1BJQA 1GMMA 1KD7A 5FP4A 3ZYFA 3WCSA 2P5BA 3KQ4B 3H9NA 3VBSA 4A42A 5K7PA 3WQ0A 5AN9A 2JN9A 1VQ6B 1QXRA 3OY8A 3T2PA 2KL7A 3PA2A 2E32A 1RUNA 2I9BA 3VBSC 2DYCA 3GCWE 1QGAA 2VNHA 1TUIA 4RCYA 5E6HA 2A6ZA 4QU1A 3CP2A 1QJEA 4BISA 3LPFA 1CZVA 2FBEA 4FOQA 2RS33 3I2HA 3I2FA 4BIFA 4COZA 4UOJA 4Z6AL 2R7EB 1OGJA 3TOJA 3LC5B 4JKKA 1BBT3 4XF3A 1DGLA 2BM1A 2WZ8A 4XVHA 3THPA 2R063 4KGQA 1XNCA 5BNOA 5C4WC 5J3UA 1RHI3 5IAVA 3RNSA 3ZDVA 4BLIA 5KHHA 1R1A1 1N1TA 4UF0B 1JXNA 5DDJ3 1QUEA 4MG2A 4LO4B 1QMJA 1UYYA 2WSVA 3KK6A 1E5HA 1F15A 2X8KA 3T51B 5DPNA 2UWBA 2W68A 2WZEA 4K1ZA 1FRQA 2V4VA 5DG1A 2JENA 2VPVA 4QQHA 1R5NA 1RQRA 3OD0A 4PLOA 2FD6A 4G1MB 3WQ7A 4B1MA 2J7MA 4JDMA 2XC5L 4AAPA 5BNNA 1F4AA 1FOD3 1XBFA 1Y7BA 2LROA 3VD5A 3ZN6B 1EV11 4XLWA 3LGRA 3M7AA 5LBBA 5JUVA 4AG4A 2VMEA 2JDMA 1I0UA 5I93A 3LSDA 1OMIA 4D6RA 2ZHNA 5BNNC 3HQXA 5F7UA 5FMOS 2I1LA 3ON7A 4N7UA 5JSPA 5EJ3A 1CAVB 3H50A 2X0KA 2VW1A 3ACLA 3UESA 2UYBA 4N3GA 1SQ4A 4BTUA 5BYNA 1QFKL 4ACAA 1VBD1 3WXMA 2WPDA 4ZHNA 3TGFA 2V4DA 3OUHA 3IMMA 1QGYA 5F8PA 5J09A 1UPIA 1O4YA 1YJWB 3ZXGA 3CCSB 2YPJA 2A71A 4GB33 3MFCA 1WW7A 3CLPA 3NKTA 4GWMA 3CDZB 1PK6A 4CDQB 1CX4A 5F2SA 1T6ZA 1AX2A 1HV0A 4WZEA 3GIRA 4NIGA 4OOVA 4M0NA 1TNRA 3P3NA 3OJBA 5IYYA 1ND2B 4AR2A 4YW4A 5J1XA 5LK5A 5LA0A 1RVF1 4OUEA 4WM7A 2A6YA 3LEKA 1OKOA 5T50A 4JDNA 4CDWB 4Z07A 4GU3A 2BFUL 1WU8A 3X29B 5JXJA 5FPXA 4WM7C 1W35A 1ONAA 3GVKA 2BSAA 1V6KA 1WHFA 1QJU3 4XJ8A 3QACA 4CVUA 4XETA 2Y6HA 1YUFA 4DUWA 2WT1A 1YLOA 2K2SB 4CUFA 2P3TA 3I2DA 2VCAA 5L7OC 4NR1A 2HWC1 1ZRIA 1HREA 4FWTA 5ACA2 2WIIB 2VZVA 2XL7A 1H85A 4UFHA 3OEBA 4PIXA 1H0BA 3T53B 3LAGA 1GNYA 3TN91 2ZXIA 3LEMA 2E9QA 2RMU3 4HKLA 2XUMA 3SISA 3NV1A 2W95A 1UWWA 3VBUC 3U14A 2VJIA 4V2WA 2KNIA 4D94A 3VD4A 4PT6A 4M10A 3SW2A 2PR3B 3ETPA 3QLQA 4KL1A 4M01A 1VBC1 3M4FA 4JKMA 2XVGA 1YIFA 4XQ4A 2DV9A 5DXDA 1VMJA 1FMD3 3CA7A 3T1MA 2JG8B 1D4M3 2RS32 2HWB3 2J34B 3E5QA 4AVBA 3VDBA 3OJXA 4O65A 3LFMA 1GZ9A 2ZMNA 4Z4TA 5F6KA 1BBT2 4RRYA 3BIEA 3ONYA 5FZ7A 1NY71 4X06A 4PDWA 2PHFA 2WT0A 1HB4A 2ZX1A 5FZEA 4B29A 2R062 4ZAEB 4YFWA 1XYOA 1OB5A 1IPJA 3A8IA 4CSWA 2JG9A 5A1FA 1WLTA 3NV3A 2SBAA 4YVWA 1WP6A 1DQ2A 5EYXA 2SLIA 2WNVA 4LBVA 1NX9A 1W39A 2JG9C 2WPKE 1EMOA 5KHIA 1ADXA 2JDAA 1W8TA 1W6QB 4XZPA 3VLBB 3TNPB 1CQEA 2WNVC 2BBVA 4P14A 5FDQA 3KHBA 3FBYA 3CXCB 1FOD2 1R5BA 2JECA 3ZDSA 4JYVL 1RINA 3K4DA 5FZ9A 1KK1A 2PMWB 4TMTA 3WNOA 1AYN2 1FX5A 1TQ5A 5KW9A 1C28A 2ZGMA 1HRI2 2BW8A 4FP2A 1XFOA 2FDHA 2AEYA 1MEC3 3B82A 1DQ5A 1S2EA 4MGKE 5KWRA 3VZJA 3LDRA 5FWJA 1V1HA 3ZX7A 4FFGA 3AVTA 4AFAA 1UXXX 3A8KA 1OA3A 4R9AA 2I2SA 5T52A 1GSLA 5DZFA 2OYUP 1LEMA 3JQQA 1YRZA 2W0XA 2JIGA 3NV4A 2YC4A 3RPQA 1FPN2 4LHKA 4E2SA 3OBZA 2BRTA 3WY9A 4XPVA 1SCRA 3WP3A 3NJVA 1IQNL 3UKNA 3R6KA 4EV0A 2VTXA 4CP1A 1ZZCA 3M8LA 1AR71 4K8RB 3DCQA 1DIYA 1YUDA 2WZPP 4BTTA 3MLKA 1O3SA 3TBDA 1RJ7A 2TEPA 3P1IA 5TV2A 3P5BL 2O14A 4BA6A 1W8NA 5FIXA 2VMFA 3T2QA 2D6MA 2FX3A 1JBUL 3HT2A 1WLWA 1EMNA 1OQDA 3OUIA 1DYPA 4WM8C 2ZZQA 3IMNA 1SLLA 3B69A 3FJSA 2QDXA 4COYA 1Z78A 4YGCA 5A3NA 3QCWA 3FPKA 1CEJA 4AW7A 2IZWA 1BQEA 2VZSA 4O9GA 4MGZE 3MW4A 1IQHL 1NE6A 4XFIA 5HZAA 4TMWA 4QPGB 1QIUA 4FO9A 5KR7A 4XZUG 2RMU2 3S5AA 3ZYJB 1SFYA 1W06A 2XC0L 2A1XA 3ZSMA 5IT6A 2E53A 4B4DA 1UY3A 3Q6RA 2QN6A 4ZH8B 4N43B 3MIBA 3ZFFA 3DEMA 2D93A 4RR3A 3URFA 3IWZA 5L9VA 4CPBA 3AK0A 4KG8A 3W5VA 2RDQA 5F1RA 1TG7A 3D6EA 1J83A 4RR3C 4QUZA 3O1MA 2C1FA 4Y33A 3P27A 3WR0A 1MS9A 4COWA 1ZA7A 3J8F3 3AZWA 4Q4W1 2ZL7A 3IJEB 3LIGA 5FY9A 2MGRA 2Q4SA 4MGQA 1IQEL 1N1SA 4AQ2A 2CC2A 5B4NA 2ZBVA 3MO4A 1V9U3 3I2OA 2VMCA 2QBXA 2BZ6L 3CCJB 1BQPA 5LBFA 3SLDA 4MOAA 4LBMA 1MQ5L 4XDQA 3TZIA 2Y6GA 3BCFA 2WG3C 4GU4A 3FX3A 1CQ9A 4HKOA 2Q1ZB 4B4QA 1ZZ9A 4Y4RA 3EGFA 5CNAA 4AHZA 3IBMA 4IEWA 4WZCA 2QE3A 3O1TA 3MF6A 1AR82 4MYTA 1JYTA 1SACA 3W21A 1OD5A 2R16A 1HQLA 4HN1A 4B3NA 2W3IB 4N53B 3Q8EA 2BERA 1MEC2 3AMHA 1H1AA 4CDXA 1RXFA 4Z4RA 1QJX2 2WZR1 1C8M3 4ARXA 3HNMA 3HMYA 4P26A 2CY6A 3AP6A 3AVYA 2C2WA 4RCZA 4Y9RA 3WF2A 4CDXC 4CXXA 3LTGD 4QKBA 2XJVA 3VBFB 4ZXKA 1O3QA 4MH0E 3KVAA 5C9AB 3VZKA 4ZCLA 3AVUA 3VD3A 5AC93 1UZYA 3JU9A 3WW2A 2XMLA 1KEXA 5J3OA 2CK3A 4AEDA 4RM0A 1D0GA 4PBOA 1C3HA 2PQSA 2WS91 2V09A 5KXEA 3ZXEA 1IQJL 2QQNA 1E1QA 4AEDC 4XKWA 3OOXA 4RRZA 1N07A 2XNCA 4IV3C 3CFWA 1X82A 2RR13 2BOIA 3ZYBA 2NPIA 1HV1A 5HXBA 1ENRA 1PNFA 2WN3A 3LQ6A 1U0AA 4DPNA 2Y5GL 4GQNA 4OCTA 2L9LA 5FPBA 1V0FA 5BV6A 1H8TA 1K5MB 5APAA 2PHTA 3RY8A 4ZU7A 3SJPA 3HD8B 1WW4A 1JOJA 2V7UA 1H8TC 1H4HA 1N47A 3GXUA 1H2LA 2ZZEA 4YW5A 3VBHA 5HI0A 1QQP3 4D7SA 4DO0A 4XFCA 1W0PA 4XJUA 5FMBA 3QH0A 2JWPA 1GR1A 4UW5A 4Q4X1 4P12A 3VBHC 3WVJA 1KDMA 1XNAA 5FQ0A 3SOVA 4Q2FA 2M5SA 2EA7A 1PZ9A 2A6XA 1RUH3 6COXA 4LNVA 4C91A 1OH3A 2XKOA 3H8RA 2GMPA 4HZFA 4ZXEA 2JJ6A 4EQVA 3OPZA 3ZKUA 3UETA 4HL0A 1Z0HA 4P6VF 5COXA 5IYPA 1LPZA 2JEMA 3B00A 4FXKB 4AHWA 3K75B 1WWYA 3VO2A 2PYTA 2UWAA 5IHRA 1E3XA 4EWAA 1E57A 5BNPA 1LQDA 3ZSLA 2R1BA 2ZAAA 2P3MA 2YWHA 1V70A 2XVKA 5BNPC 4MGYE 4CUGA 2VNKA 4JGZC 5JOWA 3ZYIB 1V9U2 5K0HB 1KK2A 1OF4A 3ZZ0A 1WDTA 4V2VA 5F4JA 2A75A 5JOYA 3I2KA 1W2OA 4RN5A 2JE9A 4P9LA 1TPGA 1O6UA 1LPKA 4IEUA 1CVUA 1XE8A 2PQQA 1FNDA 3VD7A 3TYJA 4F8AA 4IL7A 4NHYA 1E63A 4QGNA 1K28D 5EFUA 3V65A 4YFZA 3AKSA 1S4CA 3LAQA 4X07A 1D2QA 4Q0PA 3F1SB 1H9WA 5HCAA 4XW3A 5BUVA 3N4MA 3NTGA 5CYYA 2FDKA 1CZTA 3QE2A 3PU8A 5A7PA 2QQIA 4AVZA 5KNLA 4Q0QA 1JZ2A 5E89A 1WHEA 1BK1A 2CHHA 1MQTB 3FLTA 4NIIA 4OI2A 4NIDA 1V6LA 4MSVA 2EXHA 3ONUA 1D1NA 3O0WA 2V7QA 1E64A 5FZHA 2YBPA 2BOKL 4RHV3 2BGOA 1WMEA 4MX3A 3KF3A 1RUF2 3HQUA 4Y20A 3CMMA 2ZEYA 5GLWA 1WMXA 2BPOA 2XQXA 1LMMA 2XJQA 4XIOA 2FDIA 2BNNA 4TT3A 4EH1A 1E5IA 4XFHA 1UYXA 2GU9A 5DS0A 2VOVA 1X50A 2DFBA 4YG0A 1VQ8B 3G4SB 5F6LB 5ACA1 1FF7A 2PMDA 1CAUA 2B45X 1PGEA 4C1XA 3G6EB 5GZDA 4JTOA 1H2MA 3EB7A 4OQ9A 2OXBA 3F2ZA 3HT1A 3MW3A 4ROXA 3B01A 4A6OA 2XZOA 1ZX5A 5FY0A 4DRVA 2RDSA 1S4MA 4FTSA 2GAUA 2P3JA 4M4SA 4URTA 2ZGRA 3MI8A 3KL6B 3V0BA 3NJPC 2BNOA 2BF4A 4LK7A 2AYLA 3TB0A 3EO6A 4HPKA 1T2XA 4LPLA 2QTLA 3N8WB 5JCTA 4FQZA 1BBT1 3BPSE 1U2RA 2XWJB 4LORA 2EF6A 3PNAA 4XMAA 5FR3A 1BZWA 1QQP2 5FY7A 5GZFA 5EJZB 1CZSA 1W9WA 1VBB3 4YNIA 1J9CL 3I2JA 5GALA 3B94A 2X6WA 2WYGB 3GSIA 4Q0UA 1NA1B 2DBNA 1I8DA 4YEJA 1OVSA 1QWRA 4CCLA 3DN7A 4AI0A 1YITB 1H6YA 5JB9E 4Z0LA 2C26A 1HQNA 5ANQA 2P3UA 5FZAA 3CJIB 3QFCA 4B47A 2JDYA 1IJEA 5A80A 3ME2A 1DHKB 3NAPB 2XHNA 1ULDA 2KVOA 4CEWB 2KR2A 3R4UA 1NUKA 2HWF2 2RDRA 1W6PA 4UFJA 4W8JA 3JBG3 2W1WA 2VJ3A 1AYN1 3ZN4A 4ET7A 1I5PA 4EZHA 1HRI1 3FUQA 2WC2A 3CF6E 1PMHX 3HO4A 3CO2A 5GLTA 2R073 2PHDA 4XORA 5I8YA 2P34A 5T5PA 2BQ6A 4J25A 1FFMA 4UYBA 3LO8A 3MIFA 1AYM2 4JGYC 4A2UA 3KQCL 2EAKA 3USUB 3KV4A 2PHUA 1FPN1 2I07B 3KLSA 4CU7A 2GK6A 3WBKA 5AFEA 1BLIA 1DQ6A 4BDVB 4AYUA 4XLAA 3NTBA 1S0FA 2LRPA 2ARAA 2C5HA 5DQ0A 3I3QA 3PVEA 2ADDA 2YY1A 5FYIA 3H8XA 2XONA 1ZUNB 1JYXA 4IGPA 1EGFA 2VG9A 2HYKA 2WFF2 4XONA 4E1GA 4I0AA 2VOTA 3U75A 2FVGA 4CP9A 5H9RA 1OUXA 2Q8CA 4HG6B 2YC2A 4GMP3 1UW8A 4GH4B 4Q26A 1R64A 2AENA 3DYMA 3TRSB 3JB4C 2A6VA 4QXHA 1BVVA 3APBA 4LBQD 4TGFA 2PE3A 2C9AA 5FZCA 5FYSA 2YU2A 4NG9L 2UY9A 5L2YL 5EWSA 1O5UA 4MGTA 2EIBA 4DIQA 2OT7A 1R091 4B48A 1REEA 1BCXA 3FUOA 4E0FA 3SOQA 1ATBA 1K42A 3N7JA 5C3PA 3DL3A 4D0QA 3I3BA 4LO6B 5C5TA 2IXLA 4P9WA 2JKHL 4O02B 1FNCA 2ES3A 3I97A 4IV1B 1VBA3 1MACA 1POQA 3MV01 1SBDA 5FMCA 4EE2A 2VMIA 2VY0A 3USSA 1HW5A 2C78A 3ZLIA 1SLAA 4O1ZA 3HNYM 4Q0SA 2B5HA 2NLRA 4N9HA 2GC0A 4HXCA 1B2RA 3OTFA 1DLLA 4XLHA 4YM3A 2OBTA 4AI8A 1QF3A 2YGPA 4UWDA 1OVPA 1OQEA 3Q38A 1J58A 4X8IA 4ACBA 2C77A 4RD4A 1HB2A 2VZTA 5F4OA 4MYEA 4Z0KB 4BTIA 1W05A 4Q4Y1 1GWKA 2ZGOA 1V0EA 4M0LA 1Q43A 3OJWA 4EN9B 1FT9A 1MS3A 3ZSEA 4I01A 2EI8B 3IAQA 4AVCA 4CU6A 5T5JA 3F6UL 4YZUB 1G9DA 2HWD3 2BVBA 4RLZA 1NCRB 4P2NA 4NRMA 1W6OA 2JDHA 1RXGA 1AR81 4UZFA 4COVA 4IEQA 2FZ2A 1ULFA 2FLBL 2VNVA 3JD72 3LKJA 2GC2A 2VL4A 1W6MB 5EPAA 4UF0A 1W04A 3A1PA 2W2NE 5FLHA 2BPA2 4U9UA 4W6WA 1A34A 4WVMA 4A41A 1QJX1 1GOHA 1GZWA 3MGUA 2J7KA 3A0KA 1Q81D 3TWIA 4D69A 1A78A 2MEV2 4GKXA 5C3OA 1Q82D 1YFYA 1XYNA 5GZEA 4I0BA 1QVGB 3OUJA 1VQ4B 5CKQA 2EXIA 2OKXA 1ATAA 1PM7A 3ZN6A 1PK6B 4QGLA 1U8CB 3N36A 2BGJA 1AL0G 2AHOA 3G71B 5GLUA 4YVSA 1VQMB 3THCA 2HDNB 4QAWA 3PJQA 5HXVA 2DEUA 3ZXLA 1BJKA 2VVFA 1ZRFA 5EGMB 1CAVA 3C7EA 4XJZA 4UFLA 1OA4A 1LNSA 3ZXKA 3A3GA 4K1XA 2R041 4PQ9A 3ST7A 3PUSA 5FYVA 5I0SA 1GJRA 1K37A 2YHJA 4IGQA 3AXEA 4TZDA 2XDVA 3CCMB 3GISX 4YG3A 1OOPB 1R1ZA 1IQIL 1FAKL 2XLFA 4XILA 4HMZA 4CDQA 1WLDA 4GXLA 3CMGA 2CAVA 2W46A 2F1LA 1YQCA 2RA0L 3QMOA 4WZLA 4NCNA 4AOCA 1AR93 5LRSA 1ND2A 4CDQC 5JVVA 5FZFA 1WBFA 3W2EA 5K8SA 3AP5A 2BT7A 5G04L 4ZZ5A 2VCMA 3OZUA 2ZX4A 1ND2C 1WPCA 5CDFA 2D3SA 3RZMA 1COUA 4FXUA 1GFF2 2R0HA 1HLCA 4CDWA 3O5SA 3LDBA 2WG4B 2H0VA 1HRV1 5SV8A 3O12A 3WNPA 2GNBA 1PGW2 4CDWC 2VR4A 2XBO2 2QFEA 1G86A 4XACA 3KD4A 4ZGNB 1VALA 4DXTA 2K2SA 3PTYA 4FXGB 4HT1T 2VMGA 4I3PA 1WCKA 2VQUA 1UKGA 3ACFA 4XFGA 2Y7XB 1OT5A 2P2KA 2ZABA 2B8MA 4ES8A 2WABA 2VUAA 4MO3M 5I0TA 3O1SA 4IEVA 2DCJA 1YFWA 2WLPA 4PDWB 4BQ2A 2UWOB 2R9VA 3ZFEB 2ZXHA 3KCXA 3CRZA 3BOWA 2ZAHA 1DDIA 3NNMA 3MFAA 4KWUA 3GZTB 2A3XA 1G9FA 3JQXA 4LBLA 3CCUB 1KXGA 2VNGA 4IERA 1QY4A 1AVBA 1WUVA 4LO5B 4X0CA 4XBMA 5GZGA 2ZOEB 2JG8A 2RE9A 2W39A 2BDRA 2DVAA 1S0BA 2ZTGA 5J37A 2PIAA 1ULEA 2PTMA 4WQMA 1C8NA 3LFIA 1XRUA 4I09A 4XN3A 1UIJA 3J81k 4NIHA 4BQ4A 4KBBA 1YIJB 4NRPA 3R0RA 3WNBA 2WAOA 3MBWA 1LPGA 1OLRA 2F6BA 1F0RB 1MZEA 1VRH3 3ZIAA 2NZ9A 3GDBA 4AVAA 1APNA 2IC1A 1VRBA 2OBRA 1VAVA 1IKPA 5EV7A 1W6QA 2ZGUA 4QM9A 2WJSA 4C0BA 2XNDA 1OFSA 3ACIA 3N9NA 1RUF1 2YGOA 1K36A 3K4ZA 2AUYA 4F3JA 1RUE3 4OQ8A 1H30A 1MS4A 4XM3A 2A3YA 3GVJA 3AL6A 3CENL 3GBFA 3OG2A 3VUOA 3VDDA 1RUC3 4Y4YA 1HAEA 1W8FA 2D7FA 2WSSA 3ELAL 4XUOA 5CEHA 3H8OA 1OI6A 2YG0A 3KEWA 1N0VC 3MYXA 2F4PA 4XAEA 4Z4ZA 4TSVA 4HSLA 3LNNA 3H9AA 3DYOA 2Z79A 3ZZUA 1W8WA 4U2AA 4RGGA 3KCGL 5BSXA 1APQA 4BXSV 1VAKA 5IVYA 2WYSA 1ZRCA 5FZ3A 3I49A 1ZM2A 4DEQA 1EXMA 1IVOC 2J38B 2ZCWA 5IW0A 2D98A 5FO0A 4OVEA 3DXTA 1PO23 4CXYA 2WL1A 4P00B 3BALA 4Q7JB 1DQBA 2XBVL 2BMWA 4X8UL 5IKTA 1ASJ3 1O5DL 4WVZA 3NSTA 5IK8A 2VUCA 2X3UA 4TXWA 3M2MA 3CC2B 1QQP1 4YW1A 2ZZGA 1GKBA 1PJ7A 3AC0A 4Z8BA 4NO4A 3P3PA 3OGSA 2Z6BD 3HS7A 2WA3A 2D6NA 3CMAB 1BX1A 3M3CA 4AF7A 3U4SA 4IESA 4YXWA 2PLV3 1T6XA 2Y60A 1MVQA 1MZ6A 2IWGB 1CAWB 4QDSA 2OIIA 2VVDA 5JBCE 1F7MA 1KK0A 4BDWA 4BLJA 1XNTA 2ORZA 3GALA 1DZRA 4LR4A 2GDFA 2VTFA 4MUVA 3MUZ1 1LRHA 3M36L 5IYQA 4QPGA 1S72B 1HXS3 2VBDA 4M1KA 1HN0A 2HWF1 1XNBA 3PMSA 5A7SA 5JXHA 3FLRA 1COV3 3POFA 3JXSA 1LHOA 2LUWA 5FZBA 2F17A 2W91A 2BN4A 4N43A 1OBNA 3AYCA 4QX2A 4BPZA 2PA7A 3UL2A 2OUJA 1CGPA 3D4KA 1JUHA 2GPJA 3GGLA 2FZ1A 3UK9A 1VP6A 1XQNA 4JZEL 1KQRA 4Q1RA 2WPME 2VOKA 3NVCA 4L2NA 4Q1PA 2JDNA 1H8HA 3N7LA 1YUGA 5FY5A 3ZYPA 1AYM1 3KV6A 4AF6A 5LB6A 3IDAA 4Q27A 1GUIA 1TME1 5E6TA 1F7EA 4R71A 3VHPA 1IOAA 1C5IA 1VB4A 4QDRA 4Z1VA 4TMZA 5IFTA 3BTAA 3KSCA 3UGHA 3FBMA 1RMU3 4DRRA 4LBOA 3BN6A 1S0JA 4YRDA 3RVHA 4AEJA 1VRH2 3ZYRA 2X5IB 1N3QA 3AZYA 5FRAA 3DECA 3S5QA 2EAAA 2ENRA 3ZC3A 5HCBA 4O61A 2WFF1 1D4VB 4JAAA 5EXOA 2FHRA 2D43A 5JIAA 5DSZA 1QJY1 1LOFA 1SM4A 4Z2AA 3AKTA 3BY1A 1RUE2 5HBAA 4LBQA 1LOFC 1WCUA 4YLZA 3MCAA 5JXGA 4N7IA 4CUAA 3D8CA 1LKNA 4A94C 4UZUA 4KU7A 3A7QA 3MF9A 1IQAA 2QUOA 2EI6B 3IDEA 2JDPA 4URAA 4GALA 4OPVA 1LHNA 2VBUA 4M3CF 4Y3OA 3T3YA 4RDJA 1M4WA 2YWGA 1X8MA 2OYNA 4NHMA 1YLLA 4YPJA 3WDUA 2UY8A 4UI9L 3RZZA 2XR4A 4N53C 3D82A 3L9JT 1UQXA 2PHLA 4BQWA 1BPLA 3LA2A 3NRUA 3ZXAC 3VBFA 1JH5A 5A3TA 1OF3A 3WF3A 5FZ6A 2C9KA 1KIGL 5C9AA 1UOJA 1PO22 5HCFA 4LO8A 4ZS2A 2Z69A 1T6YA 5HV0A 3VBFC 4EJRA 4XBQA 3I3EA 1ZREA 1K73D 4XTMA 4P5YA 5CB7A 5C9AC 1IKQA 4AI9A 1ASJ2 1WMFA 4GAZA 1GWMA 2JKXA 3OPTA 3T0BA 4P3YA 3BODA 5FZDA 5ISLA 3K48A 2ZKNA 2KA3A 2B7BA 2VH0B 4Q4V2 3WDYA 3GM8A 4FFHA 3KF5A 3TEWA 2ZGPA 4NPMA 3C3VA 1U5XA 5FQ0B 3MHPA 4ZXXL 5FO7B 4LA2A 4Y1ZA 4AXOA 1DARA 1K5MA 1RGSA 5D8AA 3MPPG 1OA2A 2CGNA 2OK7A 1WLCA 4E8CA 5IVVA 1ND3B 3JUUA 3ZR6A 2BVNA 1POV1 1K5MC 1GO2A 4B8EA 3POJA 1IQFL 3CPWB 2D97A 3H0OA 4DNYA 1WMDA 5JSOA 2RV9A 3M37L 1RTVA 3S30A 1HVXA 3JD71 2P1BA 2HWE1 1VQ9B 3ES1A 1TLLA 1MZ5A 1B9WA 5E16A 3FC0A 2D6OX 1YFUA 3ZMNA 3EJKA 4PI2A 2XL9A 3SH3A 3O1OA 4DOUA 3FWEA 2W47A 2DCUA 1OB1C 1CIWA 2HOXA 1AXYA 4N8MA 1RQPA 2CDOA 2MEV1 2ZGLA 3Q8AA 4CEYA 2E7TA 5FXZA 3ZO0B 1VB2A 1DDLA 5L2ZL 4PIYA 5T54A 3AXDA 3G7DA 5C8CB 3BT1A 1KLJL 1YQ6A 1QEXA 2GK7A 5FBJA 4K21A 1I3HA 5FREA 1QJFA 1GP4A 4J0QA 3SC7X 1HT8A 1L3JA 5A6YA 2ET7A 1PVXA 4Y5Z0 1Z7S3 4GJZA 4FTBA 2CNAA 1WCDJ 1QFJA 1LMJA 4IEOA 3LOIA 2PAKA 4Y22B 4BMEA 1BX0A 1PJ5A 1HRFA 4I0WB 4D0EA 3EHKA 5JMOA 3M3EA 1PZ7A 1UYZA 5A88A 3IPVB 5A3UA 1HZ8A 2ETEA 5A1AA 2PXJA 4FI9A 3WV6A 1F9KA 4D0FA 5AFBA 4UZEA 4ASKA 1ULGA 5DAXA 3CB4A 4FQ4A 3UKTA 4CCMA 2YPDA 1V3XB 2PHRA 4QD2A 4P9YA 3LA3A 1CAUB 3UGFA 1W9YA 3MICA 1QJZA 3MLJA 1VPHA 1NYWA 4JZDL 1MQTC 2IVJA 4NAOA 3BTZA 2PAEA 1YJKA 5FY8A 2WJYA 1Q7YD 1PZ8A 1XPWA 4R4ZA 3MLLA 4EN6B 1K3IA 4TLGA 1PIV3 1N08A 1PGW1 3OSDA 2XBO1 3LN0A 1CR7A 4OOXA 5FNZA 2CNDA 5LW9A 2ZL5A 2Q1FA 1ATEA 4LBKA 3W58A 1VBE2 2W3JA 3GF6A 3VKOA 2BP6A 5JI7A 2AACA 5A8AA 4JC1A 2CJIB 3PVBB 3VZOA 5LBEA 4XNFA 3CCQB 3PTRB 1CVNA 2YFZA 4TN7A 3WT3A 1X36A 4II3A 3MPBA 4ZU5A 4UXAA 4H9GA 4HVQA 5IK4A 4DK0A 1OHHA 1W2BB 4KBZA 5J48A 1Y9QA 4QPIC 3CJXA 2QA4B 3K4AA 1K5JA 2WNUC 2C6SA 2XQRA 3TNQA 3FHQA 2GH2A 1BEV2 3BIWE 1RUD3 1UPSA 3ZPNA 1RUG1 1D2EA 5BNQA 3N8WA 4YAOA 3O7OA 4HOOA 4DINB 4V1PA 1QIQA 1E62A 2E1RA 1B09A 5FPVA 4XHBA 3WHTA 4OHYA 4AK3A 1F8VA 1W6PB 5LWBA 4PC3A 4RRXA 5FY1A 5FPZA 2WFXB 3PUMA 3VO1A 1NA1A 4RRWA 4QHZA 4ZXYL 5IJRA 1NCQA 3B8HA 2W86A 1JW6A 1YC61 3CTAA 1LESA 1NFYB 5FPUA 4BE3A 1EAH3 1NA1C 1ENXA 4K1YA 3WQZA 3T08A 1W0NA 3HEIA 3ILRA 3CJIA 2JJLA 3GZEA 4PI0A 2E1BA 4IE5A 2DCYA 3HOBA 3MZHA 4FP3A 3WP4A 5FP9A 4AC9A 5LA1A 4CCOA 1EPWA 1P0SL 3BCDA 5FO1A 3NAPA 1DDXA 5T3NA 5A3OA 1RC6A 4RS5C 1KRHA 3ISXA 3UJQA 1RUI3 4NN0A 5FY4A 1EP1B 3V76A 4XQWA 4AQSA 3NAPC 1I7PA 4CEWC 3ELNA 1YI2B 4L8JA 3WG1A 4XDOA 2NP0A 1GZTA 2ARCA 4Y6DB 1H8EA 3AZVA 4BYYA 3BOPA 2ZGNA 3KQEL 1KS4A 4LOTA 2HCJB 5JDBA 2YGMA 1Q5OA 1LGBA 4KGGA 1VHOA 3KT1A 4EN7B 4GMP0 2MGPA 2XLGA 2DERA 5F19A 4AEKA 2DOGA 3USUA 4LO7A 4DS0A 4RUTA 4A3ZA 4RFT0 1W03A 1VR3A 2VGDA 5D2AA 4PLNA 5D1IA 4YARA 2P6CA 2W6IA 3T09A 3K9XA 1CPMA 3GCWA 4G9SB 3DPRB 1EP0A 2JD4A 1Q56A 2CRVA 1A3PA 1HDKA 2KB9A 1GBGA 1SPPB 2WPJE 4XXPA 4Z4WA 3AYAA 2BVVA 1CVWL 1V6NA 1JZ4A 4B3GA 4FOVA 2WNEA 4E8DA 4YZ2A 3B7MA 4LHLA 1PFXL 3OLTA 2R32A 2VH6B 1OLQA 4AI3A 2Y38A 1XDTR 2YGLA 1PIV2 2C24A 2OX0A 3LZZA 4GH4A 1JN2P 1U5YA 2W6JA 4TMVA 2HEYF 1PGL1 1W28A 3M3IA 4MXWA 5JVZA 3R05A 4D6SA 2R6QA 2Y5FL 2GNTA 1PXXA 3WEZA 4UAPA 2J2UB 2BMGA 1EPHA 1XB9A 1BYHA 1KZLA 4GD4A 5IK7A 1SEFA 4BQXA 4CCCA 2BGIA 1FRNA 3W2IA 5CFCB 1CNFA 4QHOA 3IM0A 2WT2A 3LEIA 1YHFA 2W08A 4IV1A 2EIDA 1PX4A 5KC5A 2EIGA 3OEAA 3ES9A 4HE6A 4XHXA 4ARYA 3AZXA 2OUHA 1WD3A 4IV1C 1RUD2 4Y1YA 1STMA 1JYCA 4I02A 1MS0A 4ONUA 1QOOA 1XYPA 1V1IA 1W6OB 3ES4A 3MMPA 3C7OA 4QFMA 3AMPA 3AB0A 2QQMA 5JW1A 2YU1A 2A6WA 2WLQA 3POIA 1O3TA 1T6BX 1XE7A 4IETA 2CBXA 2Q6OA 4BU2A 4BDXA 5BNOC 1QKQA 1EQHA 4WVMB 1JYWA 1Q8QA 1R1A3 2HYXA 2C5BA 5F1AA 1EAH2 1GZWB 2Q6IA 3B93A 5IYWA 2VBSA 2VE1A 3AX4A 3KMHA 3PVOA 2QDNA 4NHKA 3QBQA 4A3XA 1W6NB 3N9LA 3CCRB 1NCRA 4OHWA 2XZLA 4HFSA 3OYWB 4GKYA 1TNFA 3SLIA 2DUQA 4Z1MA 5FLJA 1W6MA 2Q8OA 4YVSB 1JZ8A 2MPFA 1UNBA 2GMEA 1IG0A 1EV13 1FI2A 4G1BA 2EALA 2XGJA 3RI8A 4D3WA 4PC7A 2OYZA 1EY2A 4I3GA 1OH4A 4DEVA 1NQLB 1NZCA 5ANNA 1UKRA 3IB3A 1H2NA 2VZ3A 4LULA 1WGPA 1SLCA 1GU3A 1VBD3 3WP6A 4FPKA 1HKDA 1S2BA 2QZ2A 4QGMA 1UD6A 2Y82B 3GBGA 4EWEA 1J9ZA 4CP0A 5L46A 1FNZA 2Y80B 1PO21 4LKEA 4NWVA 5J36A 3RR3A 4TN1A 3S57A 2E6VA 1PK6C 5TR9A 5CZKA 4L9BA 3VHOA 1ASJ1 4Y5SA 3AKPA 1N1IA 2O0OA 1TTTA 4WZKA 1U67A 4RS0A 3BYWA 3ETQA 4XABA 3I2GA 1UIKA 4Q4V1 3FMGA 1LR5A 1SMVA 1W3VA 5FFOC 1OOPA 1RVF3 1VQKB 4GZ9A 1G8WA 5BPXA 2XUEA 1YUKB 4BMBA 1WSVA 3T2OA 1UZQA 2D9RA 3W2HA 4IGOA 3AVSA 3QFTA 5A3MA 2OTLB 4W6XA 2CGPA 5FJHA 2ZGSA 1UX6A 5FO9B 4RSUA 4XL9A 5F4MA 1EFCA 1URXA 5ABJA 1LAJA 3N7MA 3BTXA 4LHSA 5GJ6A 3AKQA 3SNMA 3SH4A 4RYDA 4XC9A 2VQAA 2W52A 1C5HA 4XCAA 2HWC3 3BNWA 2WQZC 1ZM4A 3BTYA 3TN93 2AC1A 3WQBA 5IVJA 1S0IA 3D0SA 3IN9A 1OPMA 1D8TA 2VBPA 2XG3A 4XLEA 5A6ZA 4DXZA 3KT4A 1FYUA 1O7FA 1DYOA 4NPRA 2VWLL 3U78A 4M3CA 1X9TA 4NAMA 1F0SB 3WDXA 1VBC3 3SHRA 3GJBA 4F7ZA 1UYPA 1GQHA 3H1WA 3GCXE 4YT7L 2D74A 1XC6A 4YAFA 4XXAA 1EUUA 4A44A 2A70A 1H42A 1UU6A 3KCYA 3ZFEA 1DBNA 2JDIA 4OPSA 1LU1A 1HJFA 4JKLA 3ZVXA 1RHI2 4LHNA 2OW4A 4PDWC 4AAXA 1JU4A 2WPHE 5DDJ2 3ZFEC 3AGPA 2UURA 2WA4A 3HWJA 2VCCA 1O8SA 1CX2A 1YQ5A 2EXJA 4Y5TA 3KGZA 3E5XA 3GNEA 1UZVA 1R1A2 2P3YA 1OHFA 1RUJ1 3U11A 4YVWC 1DX5I 4K7JA 1W87A 2DUPA 1NJID 4QKDA 3T1LA 5HZBA 4W6YA 3VDDB 4Y26A 5JIUA 1YIPA 4YM2A 1SBFA 3H1YA 3WNLA 4LLOA 1EV12 4SBVA 1DCSA 1NLQA 2DCKA 4H3WA 2XPJA 2RS51 2QTWB 4X8SL 2BFUS 3MIGA 4KG0A 1UY1A 3WG3A 3AFKA 2V73A 2VCBA 2BO2A 4M3CE 5DN6A 1Q8VA 2XBWL 1NLRA 3WUCA 3A8JA 3W5UA 4NUBA 4WV8A 1S2KA 3LIWB 4GB32 4S2HA 4AVTA 2OPWA 4Z82A 3Q8BA 2B5OA 4A7IA 2P3FN 5C8WA 1GYKA 1VBE1 3OPOA 3ZFGB 1ODNA 2RM21 2ZX0A 1JS9A 4E4HA 1UU4A 1MS1A 5KBFA 2G9GA 3D3AA 4E2QA 2VU9A 3PJYA 1JHJA 3U7UG 3NJXA 3AMQA 1AUTL 1WORA 4JCKA 4MHRA 5CVRA 3WF4A 4Z2WA 4UAJA 4COXA 2H6BA 1AR73 3NNJA 1QHDA 3I56B 4JVAA 3WD5A 5CFDB 3SCFA 3OKXA 4WVWA 5A6XA 1QJU2 1N8RD 4MMZB 2B7YA 4KWJA 3WG2A 1IQML 3BH4A 4EZ4A 4B4PA 1BEV1 4BIOA 4N9IA 5JZGA 5IVCA 1TLEA 1NB0A 3U1XA 3PUNA 1REFA 1DQ4A 2M74A 3VDCA 2ZGQA 1LOGA 3KWVA 2J1UA 2FLGA 4DQKA 2D44A 3SH5A 1JZ7A 2E7AA 5JPMB 3AYEA 1ATDA 1NKGA 2PHWA 1CAWA 4BQ1A 1VAMA 3ALQA 4JGZB 4E4DX 3WNKA 4CSYA 1EYBA 2WYRA 2V4AA 3ZFFC 2PHXA 2DETA 1FMD2 1PX3A 1J1LA 1VBC2 2YDEA 1D4M2 1JMUB 4ASUA 2IFRA 2HWB2 4M4PA 3E6CC 2ZMLA 3E1F1 5FZGA 5IVEA 2FLRL 4CZSA 3POYA 5F3CA 2GN7A 2QGGA 5IUQA 3ECQA 2Q1JB 5DUVA 2VOXA 2HLDA 4MV2A 1NBMA 4Q4W3 4E2GA 4XTPA 4IE7A 1AZDA 1NY72 3SLNA 2WPLE 1JNYA 5HKKA 2XJUA 2F43A 1UMKA 1RL3A 5CIRA 4FFFA 5C6CA 1MZFA 2VBBA 2BGPA 1G2LB 4P1VA 4UW6A 2QDRA 3NJZA 1J59A 5C33A 1DQ0A 4OLLA 1NB9A 4LBQB 3W5NA 3FHIB 5IKRA 3WLUA 4B44A 4LE4A 1TMF3 2WAAA 3S0MA 2VMDA 2VZRA 1R081 1Y9MA 1PMIA 3ZMOA 2J1AA 5K9YA 1EPIA 5B6IA 3R4SA 2EIEA 1XB2A 2X5IA 2YBKA 1F20A 2EI7B 1I18A 3VGIA 3WDWA 4BK4A 2OYEP 1E1RA 2X5IC 3CC4B 3OZWA 2Y6LA 1KGYA 1W0OA 3U6BA 4MLOA 1QVFB 1Y9GA 1T5EA 2WZR3 3ZXFA 1JZ3A 2Y81B 4PGOA 3W2FA 4CQJA 1LOBA 4JHZA 5FYHA 1OB2A 4UFKA 3HR9A 1G1TA 1ZBE1 4HIZA 3U73A 2W1UA 4XMYA 1NQDA 1IP0A 3TH3L 2DU1A 3ILNA 2EFGA 4YG6A 1SFNA 4QX1A 3WDVA 2G00L 5FKBA 3LF7A 3LCPA 2XZPA 1JOPA 2RC5A 3S7EA 1O59A 3HS6A 4WWVA 2K2TA 4CDUA 4YZ3A 2WS93 1GANA 1UXZA 1I5ZA 3GZAA 2ARXA 1DZTA 1UD1A 2IFWA 4G7WA 4CUEA 2XJRA 3L2HA 5FDBA 1W9TA 1ZM9A 3NKGA 3FCSB 4Q5OA 1SLTA 3E20A 3VV1A 2DWRA 5KIRA 2VW2A 3O14A 3WNMA 4AQ6A 5D8AB 3UGGA 4WZFA 1RUD1 2FCTA 4LJHA 2JB8A 1SDDB 2YGQA 1G7RA 5LY1A 1S0CA 1UZKA 5F3IA 4MXVA 3H42B 2WKKA 2E51A 3M3QA 3WNDA 1EUTA 3RI9A 2YV8A 5HCHA 3GZUC 3PUIA 3OE7A 4P9JA 2ZHMA 5AVPA 1LECA 3POEA 1Z6CA 2V5DA 4ORFA 4LKFA 2G4IA 3I59B 4OHXA 2FQPA 3C8XA 4QX3A 3RWKX 3LB9A 4UFMA 4Q4X3 1PKVA 1KRIA 1EAH1 5BY5A 3IT8A 1ND3A 5DUWA 2YUEA 2HEVF 4BM8A 5I91A 3LA7A 3OP1A 3WNCA 3KS7A 4CEYB 4DQAA 2QMUA 2VM9A 4ZS3A 2GC3A 4XF0A 1ND3C 3J8F2 3AJZA 2RG4A 1UMIA 2QQUA 1ZRDA 5IKVA 2I45A 5JBAE 3ZXDA 1IOEL 4C90A 2VVUL 1VHEA 4P6YA 1M90D 4Q4W2 4RL7A 2WZNA 1K45A 3VHNA 1G1SA 3AVXA 1AUYA 4MYUA 3WY6A 2WR9A 3KGLA 2DFCA 2ZX3A 5GLZA 3CNAA 5TRDA 4OZXA 1N06A 4FPYA 4XCBA 4KKUA 1SDWA 2X6XA 1IGXA 5C8CA 2R49A 2GP3A 2WRAA 1NDHA 1TMF2 2XHKA 4RD3A 2VD7A 2A3WA 3M70A 3ZSJA 4QB6A 5B4XA 2P94L 5EP9A 1UAIA 1DDGA 4HE5A 3PU3A 3BPSA 4XMIA 5LRRA 2V72A 3O1VA 1AJKA 1TE1B 3NL1A 1VMHA 5F32A 1GK5A 3ZM8A 4TSFA 1C8M2 2VZLA 2WSUA 4BQ5A 3BVCA 4LKSA 2AREA 1KC8D 1Y3TA 5FMOL 3ASPA 3AMNA 2Y34A 3LVBA 2VJXA 4P02B 2D3NA 1V6JA 5JVYA 4Y22A 3F95A 2WZR2 4FAHA 2AEZA 2CU5A 4CUCA 4II2A 4AI1A 3IPVA 4UW4A 2V7WA 4QX8A 5AC92 2QQLA 4X6QB 5CG8A 5IYNA 1IHMA 2BBAA 1AL23 1ELOA 2VQ0A 2V7XA 2DTWA 2QE7A 2MHFA 4ES9A 1NPEB 3AM2A 4ITCA 2H6CA 1YWKA 1XE0A 3OW7A 1A3KA 2FMYA 3AVWA 2QQKA 2GALA 2P28B 2UWLB 5ACA3 1HX2A 2D6KA 2NPFA 1W8OA 4RQPB 4YW7A 2HEWF 2WS92 1WOOA 1OKQA 1QDOA 4R9DA 2IXCA 2RR12 1BVP1 1VQLB 4CTEA 1BMFA 2BOHA 5E8DA 2W9XA 3HNBM 2AGSA 1UD4A 2YROA 1CQXA 5FPLA 4QVJA 4EWDA 1V6OA 3NJYA 5A3LA 4LKDA 5L36A 4UW3A 1CESA 2FMDA 5JOXA 3WW3A 4FM5A 2RS31 2UYAA 2JIJA 1QGZA 5EHDA 4GJYA 1N1VA 2EICA 3H3ZA 4XJWA 2E7QA 1XNKA 3ROUA 2NPRA 3B78A 1IOXA 4DZGA 1FAXL 1HJ7A 4XQFA 5FZKA 3AL5A 4NRQA 1EBVA 4OP7A 2IUWA 2R061 4Z4SA 3B02A 1RHI1 5C4WA 4YW6A 2CSGA 5F5CA 4LBWA 5DDJ1 4R9BA 2EVXA 4NPLA 1NCQB 3CEWA 3VR6A 2YZ4A 3ASQA 2V31A 1RUH2 4RJLA 4OYUA 1V5VA 2D1JB 4Q4X2 2D3RA 3OBRA 1AJOA 3I55B 4WBBA 4LC0A 1YYNA 3DYPA 2RHPA 1HJGA 2I9AA 1GICA 4OTJA 5FZ0A 4Y71B 3AP9A 3NW4A 4B43A 3UNPA 3WNNA 3O1UA 1VMFA 5FV3A 4YZ4A 1FOD1 2IXIA 4GWNA 3OAAA 2Y7ZB 3I4IA 2VNJA 3BGAA 2BUKA 5JB8E 2Z5WA 3OB8A 3SCGA 4XJAA 2ILMA 2VTXJ 4RA0A 5B2GB 1BXHA 4ZGQB 3W9AA 2FCUA 2PHBB 4KH9A 4HVRA 4L92A 4PC6A 2BM0A 1AYN3 2BWCA 4QPWA 2CAUA 4ISQA 1HRI3 2JD9A 2RJ2A 3RG0A 2WR8A 3AKRA 4PLMA 2E63A 2VVVL 2OS2A 4YM1A 3T56B 4DFSA 2E31A 2J42A 4GB31 2QQPA 4K8FA 3UJOA 2F1MA 3POBA 1YJLA 3PURA 1JL9A 2OK8A 1O4ZA 1W8ZA 1FPN3 2ARBA 5DUUA 3N9PA 3A0NA 3CIHA 1LODA 5ERLA 5FZ4A 3VNVA 4OI4A 1UD2A 2ZA9A 5EQUA 1Q8SA 4OHVA 1U12A 4OOSA 3DF0A 2VECA 3PHMA 2XOKA 1RUOA 2JE7A 2VAUA 1AHSA 1NZIA 4XFAA 1I6XA 1UZZA 3TEYA 3QFRA 2BNMA 1FV3A 4Y7AB 5FYYA 4MVTA 4DXSA 1IQGL 4RHV2 1WA6X 5E8AA 3LPGA 1VLOA 2Z2SB 2XJSA 3T4HB 1XE1A 1QJU1 1TOZA 3TAYA 3EQEA 2NV4A 2YMZA 4JX0A 3DPRA 5A7OA 1MS8A 2XJPA 4A6SA 4MXWB 4FTEA 3HBKA 3BU0A 2ZJCA 5L7OA 2J1SA 1SPPA 3DPRC 1AL22 4QB1A 1GZCA 1SHWB 3J7NA 5FXWA 4S2GA 1K9MD 1SKYB 4X6RB 2RMU1 4IEPA 3ZIWA 4B1LA 4YW2A 3ABZA 3WZ1A 4BWOA 4FPGA 1UZWA 1EP3B 3VBUA 2F9BL 2J1VA 5FZ8A 3VZLA 5FOBB 3FKSA 1R093 3ILFA 5L9RA 4LK6A 1EZQB 1HCGB 1O91A 2FDJA 1AR63 1HQWA 4IXLA 4X8PA 3IKWA 4A7YA 1FMD1 1D4M1 2A5ZA 2HWB1 3RMXA 1SCSA 3W20A 2C4XA 1OC1A 4Y79B 5C3QA 4I2OA 3QSYA 1Q8OA 3UT0A 2YC0A 1GOGA 5I8SA 4P5HA 2LTNA 4KKTA 3ZXJA 5CFCA 1VBB2 2W2ME 2ID4A 3KT7A 1LB2A 4CUBA 1VLNA 2WN2A 1TZOA 1GP6A 3VL8A 4L99A 2K46A 5CFCC 5FCCA 1CAXB 1OUSA 1A8DA 3KQBL 3ACHA 2DCTA 3A23A 2DVFA 1S0UA 4Q4Y3 2B46X 2JJ2A 1RJ8A 3B3QE 3ZPYA 3ZBTA 4Y76B 4A7KA 2WNOA 3KCCA 1CJDA 3MIEA 4NA9L 4HVOA 2BTVC 1MRZA 3NNFA 4Q0VA 2CWSA 2NM1A 5T5OA 4PF1A 3OZVA 2BQWA 4BH9A 4CUDA 4R4XA 1QXJA 3JBG2 1FV2A 2JKBA 1N1YA 1AR83 4YW3A 1WBLA 3VDAA 5KHJA 5C7GA 4C16A 4RPDA 4DNTB 1MEC1 3V0AA 4QWNA 4B7KA 2R072 3GJAA 4LUKA 4EN0A 3PGHA 3LQCA 2X53S 1DGWA 2WJVA 1F60A 1QJX3 4XF1A 1XKBA 1W6NA 3W2GA 2WFTA 3MQEA 1RB8G 5T55A 1LTEA 3Q3KB 3OYWA 5FOJB 3LN1A 3VBOB 2XWBB 4FOWA 4NE9A 4Q29A 1NFWB 1IQKL 1YI7A 4QQLA 3ZR5A 1UX7A 4QXBA 5DMYA 5LY2A 2PLFA 3RGBA 4JTNA 3DKWA 1JJ2B 1VJSA 4YVSC 3JU4A 4XBNA 2WUHA 2ZBJA 2DVGA 3V64A 4UFIA 2WO7A 1AXZA 3HJRA 5JSRA 4QDQA 3WF0A 3AYDA 2FDFA 2NMOA 3GQBA 4Y7BB 2VULA 3V64C 1GP5A 2R043 1QX4A 3TK6B 1D0HA 4YGDA 3PMEA 3OCPA 1CN1A 5A7WB 5CG9A 1OSGA 1PNGA 2ET1A 2WO1A 5FJKA 5FXVA 3WQ1A 4WM8A 2W2OE 3VN4A 1LEDA 4NHLA 5ABJB 1NFUB 1SZBA 1NAEA 4OI1A 3DV8A 2Q0AA 1HN1A 5D21A 2CWMA 3MDLA 4FPEA 4K3UA 2GN3A 3J7LA 5A32B 4NROA 5L9BA 4G4FA 1MQ6L 4D8MA 3CZJA 4MGSA 4XFFA 3DDYA 4HLTA 2VBTA 1QU0A 3FFZA 4MMYB 1R092 4DY3A 1H1MA 4FPHA 4Y1UA 1VBA2 1WD4A 5LA2A 5IAXA 4K20A 5BXXA 1D7PM 2Y64A 2ZEZA 1HRV3 3CCVB 1AR62 2W2QE 4HSJA 4FOYA 2YWFA 4M3CB 4RD1A 1N05A 1DGRN 4QXCA 3VBRB 3DUIA 2BJSA 2RS13 2XBYL 2QQJA 2ORXA 1UD8A 4NMIA 5J96B 3J8F1 3CZUA 4C1WA 5IKQA 2ADEA 4G3YC 4KQ7A 1HB1A 3SOBB 3LD8A 1F31A 4FPJA 1UMHA 4XFBA 1J84A 1LGCA 3M1HA 2J1TA 5G05L 1O5LA 1IS4A 4C0HA 1CD3G 1DVAL 3ZYGA 2WFPA 1V9U1 2W92A 3I7DA 1LOCA 2D5FA 2JXAA 3RSJA 5JMCA 3MEPA 4CCKA 2XB6C 4Q4Y2 2IXJA 4TYSA 2WYJB 1UOGA 4M11A 1KJRA 3OGRA 4G6IA 1MS5A 1H8VA 2JG8C 3RYRA 1DYKA 4IW3B 2HWD2 5C70A 4XURA 4AZZA 4JDOA 1JHNA 2VYQA 4NJ4A 3QD6A 2GNMA 1TMF1 4R8HA 4CU9A 2ZEWA 2Y6JA 1XKAL 4LA3A 1SBEA 3GHMA 3JCIA 3RZGA 3S6XA 2J4IB 4D7TA 1X7AL 1XNDA 2ZGTA 3UKVA 1OGIA 1UL9A 1IGOA 3H5CB 1KK3A 1C8M1 5GV8A 2P16L 2J94B 3T4VA 2YWEA 1RIRA 1QDCA 4J1WA 1QGLA 2VNIA 2KXLA 4CP2A 1M1KD 2QCSB 1KTVA 1WA4A 3CL1A 4G1VA 4WVVA 4LMFA 5KXDA 1RUF3 5IYRA 2D3PA 1SLBA 3CESA 5AC91 4AFDA 5DABA 3RMYA 2GH8A 3KZ4C 3J9SA 3VDDC 3VNUA 2XBXL 3N35A 4P08A 1XFEA 2IVIB 3P6BA 1WOSA 2E33A 1O8PA 2HMAA 4EROA 2QKDA 2OVUA 1AX1A 4CE8A 2HLEA 3PVDA 2OA2A 1FX0A 4QQPA 3ZUGA 5H9SA 4XOGA 2RR11 4G7XA 4IV3A 2R042 3WHUA 5JR2A 5J35A 1DF0A 3BI3A 4KMQA 3ZFGA 5DAQA 3A3BA 2XGXA 1AR92 5FZOA 5JZGB 3OEHA 1CJPA 1KFXL 1G9BA 2MNGA 4YWAA 3PENA 2CL2A 1KLOA 3ZFGC 3A4UA 4C8DA 5F2WA 1GLHA 5FXXA 2ZGKA 1EWYA 4BXFA 5GKAC 1IPKA 4AGGA 1DIWA 1APOA 1QFYA 5LATA 2ZHKA 2VWNL 1UN1A 5EMNA 5F5IA 3ASSA 1FNMA 5CFDA 3I2IA 1HT5A 3NV2A 3RS6A 3OGGA 3RFRA 5DAWA 5E1RA 2DURA 2W26B 3LEGA 1RUH1 5FK8A 5CFDC 1HRV2 5FTTC 1ACCA 1ZZ7A 1L5GB 1ZA4A 1URKA 2RS12 1G1RA 3ZBUA 3THDA 1O3RA 4FPFA 5CA6A 4OPOA 4LIVA 3OW2B 4QX7A 2HKXA 4JRAA 5FYTA 2CYFA 2BV3A 5GM0A 4QPGC 1Q8PA 3FFGL 3H1MA 2JX9A 2HWF3 2Q5TA 4ZONA 5KN5C 4JGZA 2RJKA 2JDKA 1DZQA 3C9AC 4N43C 5A6QA 5LMZA 3H3UA 5JAXA 5FO8B 4ZKTB 1IZ3A 3PIGA 4FBFA 1G6NA 1S55A 4K6BA 1W7XL 1XSRA 1W8BL 2J1EA 5CAZA 3KQRA 2Y5HL 1UMZA 2P95L 1C1LA 2DYIA 1AYM3 2JJ1A 1ZYBA 1TME3 3O1RA 4P9GA 1U5IA 4GA9A 4RFRB 3N8XA 1LJ7A 1QG0A 5A7NA 3CW2A 1NFXB 1EPZA 1WCQA 3A35A 4AGVA 1WSRA 3RZLA 3WG4A 1H6XA 3ASTA 2BGCA 5K0UB 5FYCA 1N3PA 4M0HA 5JPNB 1E5RA 5JBQA 1DGRA 1N0UA 2C4TA 3KHCA 1A6CA 2G9ZA 2KV4A 5FYUA 4RHV1 3C7HA 4YSFA 1NT0A 1JOBA 1VJ2A 3POGA 3RZKA 2WFF3 4OHZA 4P22A 2CW5A 2OZJA 2H9EL 3RYKA 1J3RA 1QJY3 4AI2A 4FT8A 3CCEB 1RUC2 3BUCA 4FSJA 1Q3EA 1MOXC 4YGBA 3RQ0A 3UYJA 4META 3VKNA 2X05A 4YGEA 5TSWA 2N7GA 3HIFA 3N8YB 1AL21 3I54A 4LQRA 1PO13 1V00A 2C0ZA 3LC3B 2VXJA 4D90A 3Q39A 2Q8DA 1C5MF 3THTA 2X6YA 2V7TA 4CDUB 4XF4A 5FA6A 3EYPA 1FDRA 3EMRA 3MHZA 1PJ6A 3H8UA 5GZCA 3D0JA 4QPIB 2HORA 5IWFA 2WNUB 4L97A 5JBBE 1F5FA 2X85A 3DGTA 4LBJA 3GHNA 4HETA 1FE2A 1VQPB 2TUNA 1UU5A 3FZ3A 3SEJA 1W2AX 2DTYA 5F3GA 2GMMA 3M3OA 1W9XA 3T0AA 2RVAA 2VZ1A 1OPOA 1VBB1 1CX1A 1O4TA 1YI9A 1H9PA 4RD7A 5JLVA 3IDCB 2GNDA 2P17A 2PLV2 4BOWA 1NOVA 4PBPA 2DY1A 3NO8A 4C0SA 5FL7A 4AHYA 2WWJA 1PVC3 4AFMA 1IPSA 2VWMK 2LW8A 2QQOA 4O9EA 3S6PA 2W2IA 4IDZA 3SXWA 3KV9A 5D8AC 1G2MB 3NE5B 1IQDC 4ATFA 1AXKA 4AF9A 2KD7A 1TVCA 3FN9A 2PFWA 1POV3 3VZNA 3OEEA 3NNGA 2B7DL 1HXS2 2RJLA 1FNBA 1B35B 1JYIA 4RS5B 2VZUA 1R5OA 3P26A 3AGQA 3JBG1 1COV2 3A21A 2DUOA 2PELA 3I59A 2RDNA 3JD73 3C7FA 1VQOB 1N3OA 1F4HA 2HWE3 4BQ3A 1QUFA 1IS6A 2R071 1G7YA 2JDUA 4D6QA 5F5AA 2ATFA 1JA1A 4TMXA 5I0DA 3ORJA 3V7AA 3V56A 3CBNA 1G1QA 4PJYA 4IUGA 3LDKA 3UV9A 4COUA 4JGYA 4ZU4A 4ATEA 1P8JA 2MEV3 4CEYC 1QH7A 1FATA 4Q8KA 1QNYA 1W3XA 2W5FA 1JI6A 4QHBA 4G5GA 3W5MA 1TME2 3E5UA 1RMU2 1KDKA 1OXCA 2ZMKA 1ULOA 3GVLA 4M4RA 3Q8CA 4A4AA 5F39A 1L7RA 4S2DA 1WU1B 4BJ0A 4YAUA 5FKCA 1EAIC 1EFTA 2EIXA 1GAWA 2VXRA 4OTYA 4AHXA 2XLAA 3IAPA 3IDBB 2HBTA 2VWOL 4N3NA 3MW2A 1K8AD 1G9AA 2P3FL 4GMP1 4XUQA 2XVLA 3ITQA 1NLSA 4B7EA 1QJY2 1YHQB 3WNXA 1YJ9B 2GZWA 3NT1A 5L30L 4XYXA 4Y9UA 3D5OA 3ZSKA 4L8QA 5I0UA 3N7KA 1PO12 1DG1G 3E97A 5IATA 3O0VA 1MABA 3AVRA 3Q6QA 2A73B 3IIIA 1OURA 3Q8FA 5A33A 3OGJA 1DU3D 3H7YA 2K9ZA 3AMMA 4Z4YA 1VBA1 4FPOB 5SV5A 3SMHA 1QFZA 1AR61 3VBSB 4PF5A 4YZ1A 1JODA 1UZPA 2XBO3 1G9CA 3OY8B 4RD2A 2RC6A 2NQYA 1NXMA 3CCLB 3J26N 4SLIA 3ENSA 5JWPA 4OMDA 2P93L 2UWPB 4IE4A 3K51A 1COWA 5L73A 1LHUA 4P3IA 2VBVA 1Q86D 4ISHL 2LZJA 2ZITA 4BPRA 4RQPA 4Z4VA 3WSOA 1W2NA 5C4WB 4MZUA 5L19A 2X29A 4Z92B 4PH9A 1FXZA 4QX0A 3ATGA 4FPLA 4RQPC 4FN5A 4DB5A 4ZV4A 1ULPA 5BNOB 3WCRA 4JQTA 4B4RA 1S1AA 1WKYA 2IXHA 1W9SA 2YYOA 4ZZ8A 1PVC2 2WWSA 3CD6B 5M0TA 3HO5A 3WF1A 2HWD1 4KU8A 1VLYA 2WBKA 1K12A 3WDTA 5H59A 1ULCA 1RUG3 1UY0A 4P9XA 2G19A 4OFGA 1UO9A 1UF2C 3FLPA 3T30A 3VKLA 5BNNB 1LK9A 5CADA 5JXIA 2WWUA 5DAPA 2O1QA 2G9FA 1ZNPA 4QX5A 2HWE2 3OOCA 3VHRA 3NNLA 3POSA 1PHMA 1YEWA 3AJYA 3I3DA 2J22A 3AZZA 2R6HA 5J7MA 1CONA 1NCQC 5A89A 1D2SA 2BOJA 3QOPA 3U07A 2QTZA 4FK8A 3CPXA 4BXWA 3WINE 1EQGA 2OQ7A 3ZIXA 3CJIC 4LT5A 1W9FA 1CNEA 5FZIA 3JQRA 4QVAA 1F35A 1H2KA 1BLZA 5EZWA 4Q8LA 2W1SA 1OQ1A 3J4UH 1AX0A 2O8QA 1ZZ6A 5LASA 5HV4A 1WZXA 3ZN5A 5EYYA 4RGAA 3INAA 1ENQA 2VO5A 2VZPA 4LXLA 3BCWA 4PIZA 2ZZFA 3TEXA 2ADXA 2BV4A 3ZOIA 1PTHA 1DGWX 2OBSA 1KJZA 4GIQA 4XUPA 1GWLA 1S0EA 1Z7S2 2Q1MA 1SFPA 2DF7A 1G7TA 1W2TA 4J6GA 1ZVFA 2Y0OA 4JV4A 2MHPA 4TWTA 3MUY1 3W5HA 2VNRA 4WM7B 1JYVA 4W65A 1IB0A 5FZLA 3U37A 4NVPA 4QPYA 3Q7DA 1BMV2 1QXPA 4AVVA 4RD6A 2KM2A 5DZEA 3TEZA 2DBIA 1AR91 3PVNA 2VW0A 2DCZA 5LBCA 5JI9A 5IK2A 4EYUA 3CP8A 1EFRA 2Y26A 5L7OB 4E4SA 4BQYA 2LS6A 2BOXA 2ZTNA 3JB8A 5LA9A 3QH7A 2HH9A 4INDA 2K0GA 1XSQA 4TKOB 3AP7A 1F5JA 3W59A 1V0AA 4OMCA 4CXWA 5IK5A 3CS7L 3CQOA 2Y6KA 1US2A 4KWLA 1LU2A 3VBUB 2D6LX 3U4XA 2GJKA 3LOBA 4JMQA 1GQGA 4PHZA 4LBNA 4P9IA 1C57A 5KHKA 2CGOA 3K77A 1YJNB 2Q30A 1GQPA 4XUTA 2FZZL 2FDGA 2P26A 4GH4C 1A8MA 5FPAA 2RS11 3C7GA 2ZKLA 4Y1XA 3EXUA 5FZ1A 1ZBA3 3B9IA 2BSFA 2GP5A 5DN2A 3WYAA 2EXKA 1X7NA 4XKVA 4DQLA
chains in the Genus database with same CATH topology
3ASIA 1N1VA 3H3ZA 3MPPG 4ZH8B 1OA2A 4XJWA 2E7QA 1XNKA 3WOGA 3ROUA 2CGNA 2D5HA 2NPRA 1WLCA 4N43B 3MIBA 1IOXA 4DZGA 1FAXL 3ZFFA 1HJ7A 1ND3B 3JUUA 3DEMA 4XQFA 4MGIE 1POV1 2D93A 1K5MC 4RR3A 2XJTA 1DFQA 2XKPA 3URFA 1EBVA 4HANA 2R061 3IWZA 3B02A 3AK0A 4B8EA 2W3KB 1IQFL 3KM5A 1FJSL 1RHI1 1M06G 4KG8A 2D97A 5C4WA 3H0OA 4DNYA 5F1RA 1WMDA 4XIKA 1LULA 3D6EA 4N90A 3BPZA 5DDJ1 4R9BA 2EVXA 4RR3C 2JG9B 5JSOA 2C1FA 3M37L 1RTVA 1MS9A 4IQPA 3WR0A 3S30A 1HVXA 1NCQB 2VH9A 3VR6A 1OB0A 3CEWA 3AFGA 3JD71 3QH6A 2YZ4A 4YVWB 4COWA 2V31A 1RUH2 4XN0A 2HWE1 3J8F3 3AZWA 3ES1A 2WNVB 4ISRA 2D1JB 1RITA 4Q4X2 1VF7A 1UCXA 2D3RA 1WW6A 3OBRA 1MZ5A 1B9WA 1AJOA 4Q4W1 4WBBA 5E16A 3FC0A 3IJEB 1YYNA 2D6OX 2RHPA 2I9AA 2MGRA 1YFUA 4X8VL 3EJKA 2R1DA 3ZMNA 1LHVA 1IS3A 1RUG2 1GICA 2XL9A 3SH3A 4OTJA 4DOUA 4Y71B 3AP9A 3GYDA 2Q4SA 3NW4A 5CKMA 3FWEA 1IQEL 1J3PA 1N1SA 1CCVA 1OB1C 1CIWA 2B42B 1H4GA 1AXYA 3Q9OA 4YZ4A 4AQ2A 1FOD1 2IXIA 2MEV1 4GWNA 2ZGLA 4CEYA 3OAAA 1V9U3 2E7TA 3HN1A 1CAXA 2Y7ZB 3I4IA 1VRH1 3ZO0B 1VB2A 1DDLA 2ERFA 2BUKA 3V0AB 1Q4GA 1HAFA 5L2ZL 5JB8E 2BZ6L 1BQPA 2Z5WA 2UWCA 3SCGA 4LBMA 1AF9A 1MQ5L 2ILMA 4PIYA 4RA0A 4XDQA 4XJAA 5T54A 3AXDA 3G7DA 3TZIA 5C8CB 5B2GB 1BXHA 3BT1A 1KLJL 2WG3C 3BCFA 2DVDA 2PHBB 2GK7A 3FX3A 1CQ9A 4HKOA 4KH9A 3W9AA 2Q1ZB 4K21A 4B4QA 1I3HA 5KXCA 4HVRA 5FREA 4L92A 1ZZ9A 1AYN3 2BWCA 2CAUA 4ISQA 1RUE1 3EGFA 5CNAA 4AHZA 1HRI3 4XOPA 3IBMA 3RG0A 4IEWA 4WZCA 2QE3A 1KFUL 3AKRA 3MF6A 1AR82 4PLMA 4IEYA 5I46L 2E63A 2VVVL 4YM1A 1RUI2 1U5ZA 3T56B 1RUC1 1SACA 4DFSA 1NCRC 1HT8A 1L3JA 2ET7A 1OD5A 2R16A 1PVXA 1C1FA 4GB31 4FVVA 4Y5Z0 2QQPA 1HQLA 1JUIA 4HN1A 4K8FA 1Z7S3 3UJOA 4B3NA 4FTBA 2F1MA 1YJLA 1V6MA 2W3IB 4N53B 2CNAA 2AH2A 1JL9A 1WCDJ 1L3YA 2I74A 4YZ5A 1LMJA 4IEOA 1MEC2 3AMHA 1H1AA 2R0FA 4CDXA 3HBZA 2DDUA 1NRKA 3LOIA 2PAKA 1O4ZA 1QJX2 4Y22B 1FPN3 4BMEA 2ARBA 2WZR1 1C8M3 5DUUA 1HRFA 3HMYA 1X33A 4D0EA 3A0NA 4I0WB 1LODA 2NMNA 3EHKA 2CY6A 3AP6A 5KHGA 3M3EA 1DQ1A 1PZ7A 1E79A 4OI4A 1UD2A 3HS5A 1XU1A 2ZA9A 3IPVB 1Q8SA 4GQ7A 1U12A 4X8TL 1HZ8A 4OHVA 4CDXC 3DF0A 2ETEA 2VECA 3PHMA 2XOKA 1RUOA 3LTGD 2JE7A 3WV6A 1AHSA 4AGRA 1NZIA 4XFAA 1I6XA 1F9KA 4D0FA 5AFBA 1UZZA 2R30A 1LHWA 1ULGA 2XJVA 3VBFB 4ZXKA 3VBOA 1O3QA 2BNMA 1FV3A 4FQ4A 4MH0E 1T6GC 3UKTA 4Y7AB 5C9AB 1EPJA 4MVTA 1IQGL 1V3XB 2PHRA 4RHV2 1LOEA 3VZKA 2BWAA 2OPKA 4JRLA 1UZYA 3JU9A 4P9YA 4QD2A 5E8AA 3WW2A 5AC93 3LA3A 1CAUB 4WM8B 4BZ4A 3VBOC 2Z2SB 3MICA 2CK3A 1QJZA 1LGNA 2XJSA 3MLJA 1NYWA 4JZDL 1ZAQA 1MQTC 1ZZ8A 1QJU1 4AEDA 1TOZA 3TAYA 4AE2A 1D0GA 2PAEA 2TBVA 1YJKA 2WJYA 1PZ8A 4PBOA 3EQEA 1C3HA 2WS91 2YMZA 2V09A 3DPRA 5KXEA 4R4ZA 3IIAA 1MS8A 2XJPA 1IQJL 3MLLA 3ZXEA 4EN6B 4MXWB 1E1QA 3FPPA 1PIV3 4K9SA 4FTEA 1PGW1 4AEDC 2ZACA 4XKWA 2BQPA 2XBO1 4NGAL 3LN0A 1CR7A 2ZJCA 1KS5A 5L7OA 2YXSA 4AVSA 3DPRC 5HXVA 1AL22 3SCHA 4RRZA 1GZCA 4IV3C 3CFWA 1X82A 1ATEA 4LBKA 2RR13 3W58A 3SITA 4JZFL 1VBE2 2NPIA 3FFQA 4S2GA 3GF6A 1HV1A 1JTZX 3VKOA 5JI7A 1SKYB 1ENRA 1PNFA 2RMU1 4IEPA 4JC1A 4X6RB 4H55A 3ZIWA 1U0AA 1FSBA 4DPNA 2CJIB 2PLV1 2Y5GL 4GQNA 3PVBB 3VZOA 4YW2A 4Q4V3 4XNFA 1V0FA 3WZ1A 5BV6A 4BWOA 1H8TA 1K5MB 1OOPC 4FPGA 2PHTA 3WXPA 1CVNA 2VVCK 3WUDA 4AWDA 3WT3A 4ZU7A 3VBUA 4OUSA 4AQTA 2F9BL 1X36A 1S0GA 3VZLA 4II3A 5FOBB 3MPBA 3HD8B 4ZU5A 3FKSA 3MIHA 4UXAA 3ZFFB 1WW4A 1R093 1JOJA 4HVQA 5IK4A 3ILFA 1H8TC 4RR3B 1EZQB 1ZM1A 1HCGB 3RDIA 4DK0A 1H4HA 1OHHA 1N47A 1YXWA 1O91A 1AR63 1PGL2 1HQWA 4IXLA 3FE5A 1H2LA 4X8PA 5J48A 3IKWA 4A7YA 1Y9QA 5ABJC 1ZBA2 2ZZEA 1FMD1 4QPIC 2JICA 3CJXA 4YW5A 3VBHA 5HI0A 1HXS1 3RJRA 1QQP3 2WNUC 1D4M1 4D7SA 2A5ZA 5A32A 2HWB1 3RMXA 1SCSA 4XFCA 1W0PA 4XJUA 3TNQA 1COV1 3QH0A 2V5YA 2GH2A 1BEV2 4UW5A 4Q4X1 2UU8A 3BIWE 1RUD3 3VBHC 3WVJA 4Y79B 4I2OA 1KDMA 5FQ0A 3SOVA 4Q2FA 1Q8OA 4H14A 2M5SA 2EA7A 1PZ9A 1UPSA 5H9PA 3ZPNA 1RUG1 2A6XA 2YC0A 1RUH3 2XC4L 3POWA 5I8SA 4P5HA 6COXA 2A7AA 2LTNA 4LNVA 4KKTA 2ZZJA 3ZXJA 5BNQA 1N7DA 3N8WA 5CFCA 4C91A 1VBB2 3O7OA 4XE9A 2W2ME 3KT7A 4DINB 2XKOA 2WQ4A 1LB2A 4QQ2A 2GMPA 4V1PA 1VLNA 1B09A 3HAGA 2P3IA 4HZFA 3VBRA 4XHBA 4S2FA 3VL8A 4L99A 3WHTA 4OHYA 5CFCC 3BB6A 1CAXB 5FCCA 2GJPA 2JJ6A 4AK3A 3OPZA 1F8VA 1W6PB 1A8DA 3KQBL 4HL0A 2DCTA 1Z0HA 4RRXA 5COXA 5FPZA 1LPZA 2WFXB 2JEMA 3B00A 4FXKB 2DVFA 4AHWA 2PYTA 2UWAA 1NA1A 4RRWA 4Q4Y3 3VBRC 1E3XA 4EWAA 2B46X 4NNJA 2JJ2A 1RJ8A 4ZXYL 3B3QE 1E57A 1NCQA 3ZPYA 5BNPA 2W86A 1JW6A 1S0DA 3NWKA 4Y76B 4A7KA 1LESA 3KCCA 4QXKA 1CJDA 1LQDA 1NFYB 3ZSLA 3MIEA 4OUMA 2R1BA 4NA9L 4BE3A 4HVOA 1EAH3 1NA1C 2BTVC 1ENXA 2ZAAA 4Q0VA 2CWSA 4K1YA 3WQZA 2NM1A 1RMU1 3ILRA 1V70A 2XVKA 5BNPC 5T5OA 3CJIA 4MGYE 2E1BA 4JGZC 2DCYA 2BQWA 5JOWA 4BH9A 4CUDA 3MZHA 3ZYIB 1V9U2 4FP3A 4R4XA 3WP4A 5K0HB 3LWCA 2PN5A 1EPWA 1QXJA 2NYYA 3JBG2 1LENA 1P0SL 3BCDA 1FV2A 4XLCA 2A75A 2JKBA 3NAPA 5JOYA 1DDXA 5F5QA 5T3NA 1N1YA 2JE9A 1TPGA 4P9LA 1AR83 4YW3A 1WBLA 1IGZA 1LPKA 4IEUA 1RC6A 1CVUA 1XE8A 2PQQA 4RS5C 5KHJA 3TYJA 4F8AA 4C16A 4IL7A 4QGNA 3UJQA 1RUI3 4NN0A 4DNTB 4XQWA 4AQSA 1K28D 5EFUA 1MEC1 3V65A 4YFZA 3V0AA 1KJLA 3NAPC 4CDXB 4B7KA 2R072 3AKSA 3RJ2X 1QH6A 4CEWC 3LAQA 3ELNA 1D2QA 4L8JA 3WG1A 1YFXA 4Q0PA 3F1SB 1RUJ3 4LUKA 1H9WA 5FLIA 4EN0A 3PGHA 1GR3A 2NP0A 2X53S 4YELA 5HCAA 1DGWA 1YCIA 4XW3A 5BUVA 1GNZA 3N4MA 3NTGA 2DIEA 2WJVA 4Y6DB 1H8EA 1NQJA 4QMAA 4XOTA 3AZVA 4XL1A 4BYYA 3BOPA 2ZGNA 1QJX3 3KQEL 2O8OA 4XF1A 1XKBA 1W6NA 2D40A 2WFTA 3MQEA 1KS4A 1RB8G 5T55A 1LTEA 3Q3KB 4AVZA 5KNLA 2GSYA 5JDBA 3OYWA 2YGMA 5FBZA 1FNYA 1Q5OA 4Q0QA 4BHPA 1LGBA 5FOJB 3LN1A 4KGGA 5I8TA 5E89A 4BCUA 2H0BA 3VBOB 1WHEA 1BK1A 3I8TA 3KT1A 2XWBB 4GMP0 4EN7B 3E6DA 1MQTB 2MGPA 3FLTA 2XLGA 4FOWA 1PO11 5F19A 4AEKA 4Q29A 4OI2A 1NFWB 4LUMA 1IQKL 3B5LB