2WZPP

Structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
298
structure length
298
Chain Sequence
b'GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE RECEPTOR BINDING PROTEIN
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
total genus 65
structure length 298
sequence length 298
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.60 Mainly Beta Ribbon Laminin Laminin 2wzpP04
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2wzpP01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wzpP03
2WZPP 2X53S
chains in the Genus database with same CATH superfamily
3FLRA 1T6XA 2BUKA 1I3HA 2VOWA 4AVZA 1QDOA 1FX5A 3KVBA 1GFF2 3B94A 5JPMB 1YIFA 4N53B 3J7NA 3VBFA 3I3BA 3FE5A 4JCKA 2YGOA 3Q39A 1KS4A 3E5XA 4BDVB 4JKKA 4KBBA 4B4QA 3QLQA 2GNMA 3CMEB 1MPXA 4XXPA 1AR61 4XILA 1CN1A 2PLV2 5F3IA 5FUNA 1FAXL 3OAAA 1GQGA 2OPWA 5THXA 4XIOA 1FX0A 3N8XA 2BGPA 2ADDA 1KRIA 5AFEA 5FV3A 1GJRA 3T3YA 4BIFA 3LCPA 1LR5A 4RD0A 3MIEA 1ZBE1 1KXGA 3AL5A 3BVCA 3V65B 4YAFA 3SLNA 1PM7A 2ZITA 3VBUA 2Y6FA 1GZWB 5FZ0A 4TYSA 1H0BA 1WW7A 1VB4A 4OUMA 4B7KA 1W9WA 1WBFA 3ZDVA 2RS53 4E9KA 4MOAA 2XNJA 2P3JA 4FPJA 2HJIA 1CCVA 1H2MA 4LA3A 1UY0A 2YFUA 4LHNA 5IVYA 1W35A 2DFCA 1ULGA 1SLLA 4WVMA 1MQ6L 2WJVA 1XNCA 1XNTA 3MI8A 4B1LA 1EFCA 2EXIA 3AVTA 1ZREA 2Y5GL 4OI0A 1YQ2A 3LKJA 2W87A 4RM0A 5J3UA 1BQPA 4CEWC 3LVBA 2RJ2A 2ENRA 5L2ZL 2P94L 1KK0A 4JKLA 5DABA 2JKHL 3IPVA 1JOBA 3VDDB 3ZBUA 1W05A 3JXSA 4J6GA 4PF5A 3CCQB 4B4PA 1R64A 1TVGA 4BTUA 3NNGA 4M11A 2B8MA 2BNOA 2PHLA 2W94A 1W8BL 2E6VA 2HLEA 4Z07A 1JOPA 1L7LA 2PUQL 4YZ2A 1US3A 2QQIA 1T2XA 1AR81 4ES8A 2Y0IA 1FATA 1JZ8A 2P26A 1PIV2 2VBDA 2C4UA 4YPJA 4P14A 1GYKA 3VBOC 3ZSEA 1MS8A 3LA3A 2Y8KA 4BTIA 3WP6A 1UNBA 1X82A 1HB1A 3IIAA 3JBG2 1DBNA 4QB1A 4A6OA 3ME2A 5GKAC 4QXKA 4M0HA 1LRHA 1OLMA 4X8PA 3VNVA 3IZOA 4DUXA 2BOHA 2Q8CA 3O1SA 2WA3A 3U7UG 5FZ8A 1BPLA 3FKSA 4XF3A 5C71A 2ILMA 1WOSA 1N3PA 2JDKA 1FE2A 4AQSA 1NOVA 1S0EA 1EAH1 2XL7A 1K12A 3BYWA 2P3YA 1SLCA 1CAVA 2D1JB 3MYXA 4KL1A 4TMZA 5IK7A 2R6HA 4C16A 1QH6A 1MABA 3KMHA 5A7WB 4AFBA 3JCIA 3VN4A 1MS0A 3FMGA 4FVVA 2GSYA 5CFDB 3AGQA 5FL7A 3T2OA 4A94C 3GGLA 1I8DA 1QXPA 3POEA 2BEOA 3SLDA 2FZZL 4FXUA 4UZUA 3OGVA 1OLME 1EBVA 1KD7A 1GWKA 4P08A 3RG0A 4EJRA 2K2SA 3URFA 3ASRA 4E8CA 4DRVA 3CCRB 1RUF1 3A7QA 4Q2FA 1ND2A 1ALYA 1OD3A 2DFBA 1VIWB 2KNIA 3MMPA 1IP0A 4R8HA 2A3YA 4I01A 4Q8KA 4BDXA 2WT2A 2DYIA 5LRRA 2PLV1 3CL1A 4QGMA 2CWMA 1ASJ3 1HKDA 3Q3KB 2IWGB 4N53C 4OCTA 4PLOA 1LPKA 1JN2P 1IGOA 2ZGRA 1LPGA 3PUQA 1WWYA 4XL1A 4OVEA 1JI6A 5FCCA 3O1PA 3CA7A 3TAYA 1SBEA 1S2EA 1I0UA 3HS6A 2D93A 3LFIA 1I5ZA 4CXXA 1OSGA 1YJ9B 1W8WA 2CBXA 4Y1YA 1DQ6A 3G7DA 3VZMA 2PHXA 1KFXL 1LQDA 1GZTA 4QPGB 4M3CE 3WQ1A 4XFAA 4YZ3A 1N3QA 2WFPA 4CYDA 1JZ7A 3RZJA 2ZXIA 3OW2B 2WNUB 2WYRA 1UO9A 3ZXEA 2ZGKA 3FLPA 5FBZA 2GJRA 4HL0A 1PGW2 3OG2A 5K0HB 2VOTA 5FJKA 1QJZA 4CCCA 2OBRA 2D43A 2VMIA 4DNYA 2JECA 4OFGA 3ZXAC 2ADEA 4YT7L 4XF9A 1JA1A 1TOZA 5FZOA 1JMUB 4D0FA 4MHRA 4NUBA 1VQ5B 2BFUS 2J1EA 4M2LA 4J0QA 4UZFA 4OOVA 3H8RA 1CJPA 4BH9A 1YYNA 2EIBA 5FXZA 3RMYA 4ONUA 3CU7A 1W2AX 4EWDA 4DMIA 1QH7A 2C6SA 1A8PA 2VZLA 4X8IA 1KK2A 5FY4A 3VZLA 5FK8A 5T55A 1VRH3 5AFBA 5HV0A 3R4SA 3N9PA 5LW9A 1AL22 3WEZA 5CKMA 4GH4B 4LOTA 1NCQA 2EIGA 4Q4W2 5A6YA 2I45A 3THTA 4BQ4A 4P9IA 4LR4A 4MGKE 4P9LA 3ZYPA 2YU2A 4QKNA 1KLJL 1UWWA 5KXDA 1Z7S2 3LO8A 1LAJA 1RUD1 3KT4A 3PTYA 3HOBA 3T1MA 4XE9A 3JBG1 2YDEA 4LMFA 5BNPB 4INDA 2QCSB 1RMU3 2QFEA 1H8VA 5FYSA 3Q3AA 3NE5B 4NHYA 2HWB2 5IVBA 5JR2A 4XN3A 3O1RA 5JOZA 5A88A 1PMIA 3DN7A 3AYCA 5LCWL 1V6KA 5J36A 4Q27A 2V4AA 5T5OA 4IE4A 2A6YA 4UZEA 3IKWA 3CF6E 1EPJA 1H1IA 4KKUA 3U78A 3OBRA 1H2NA 4FT8A 4XTPA 2ARAA 2ATFA 4RFRB 3RWNA 5A32A 2ZCWA 1BVVA 3DYOA 3TWIA 4N3NA 2VWMK 1G8WA 1NAEA 4WVVA 2Q6OA 3I3QA 2I07B 3BIWE 3CTAA 1DHKB 3LAGA 1JB9A 4ZU7A 1XU1A 2K46A 5FIUA 5FYIA 2O0OA 1WCQA 2OK7A 2QQVA 2YGPA 2DTYA 3NQHA 4FBFA 5CFDC 5JZGA 5EWSA 1UQXA 1YFXA 4QWNA 1VQMB 4XFFA 4E4SA 1NCRA 4RS5A 4Q4V2 1HVXA 2QDRA 2VUDA 5IYQA 2Y6JA 3E5QA 1E3ZA 1EZQB 2E26A 1EFUA 4DIQA 3EB7A 3WY6A 2WSVA 3HO3A 4W8JA 5FY8A 2Y60A 1C28A 2XJUA 1K3IA 2NPFA 2G1MA 4HPKB 4HONA 2QE7A 4YYOA 1PO23 4XDPA 4RLZA 1LHOA 3AZXA 5CKQA 3OUIA 4ZXYL 3WF3A 4QB2A 3I2FA 5JXGA 3H9NA 4YW2A 1ATBA 3ST7A 2XOKA 2YBPA 4BWOA 4WZLA 1T6GC 2WNVB 1CAWB 1N07A 2V09A 2VMFA 4E4DX 4JDNA 3ABZA 1HB3A 3C7HA 2FHRA 2KM2A 4L97A 2WNOA 3GCXE 3AVVA 4M00A 4BZ4A 4COWA 1JTZX 5FUIA 4ASLA 3O7OA 4OQ8A 2DCUA 4CZSA 4CU9A 3VBRA 4FWTA 3NKGA 5EXOA 4GKXA 1JH5A 4FPKA 1S0UA 1M4WA 1GAWA 4ASUA 1RUE2 1VBB2 3RWKX 3GVKA 4GULA 3E1YE 4PCRA 1CAXA 1PGW1 3PVNA 1QXJA 4QPGC 4HN0A 4EWEA 4FXKB 1SKYB 3I97A 5DAVA 1HXS2 2VMDA 3CPWB 2WNUC 1HX6A 4RHV2 4QDSA 3A3GA 2JG8A 4JQRA 3ZZTA 2R7EB 3N8WA 1MS3A 3D4KA 2OYZA 4I2OA 2XVLA 2R042 2GK7A 2J1SA 1CQEA 4FPYA 5FQ0B 5KHGA 5FP4A 2EAKA 4KMQA 1NQLB 2PYTA 1MEC3 1Q8SA 1NFYB 1JNYA 3BH4A 3OSDA 3UGHA 3S30A 3MFAA 3DYPA 2BNNA 4XJZA 1IS5A 5LK7B 5LBBA 1ENRA 1W34A 2EALA 5B4NA 1AL21 5FREA 2GJKA 1ULOA 5C6CA 2A70A 4NRPA 4NRQA 4TKOB 2CGNA 3X29B 4AFCA 2XBO2 4Q4W1 1IS4A 1JW6A 3ILRA 2HOXA 5C8WA 3I1FA 4Q0UA 3I3DA 2RM23 5B4XA 1XE1A 1Z0HA 1W3XA 3ILFA 1U5XA 1ST8A 3PA2A 4AVSA 4GH4C 2B9UA 3KK6A 2AR6A 1UMKA 5AC93 1T6BX 3OZUA 2E9QA 1POV0 4DRRA 4AHYA 2Y5FL 2LALA 1GP4A 3ZM8A 3ZX7A 1QUEA 5FUPA 1APNA 2OQ7A 3CS7L 4Y33A 1RUI3 2HWB1 4RD3A 3VV1A 1EPHA 3VR6A 1COUA 4LKDA 2ZOEB 4RR3C 4NHXA 4N7UA 2QDNA 2JJLA 3VZKA 5BNPC 3G6JB 1HQWA 4RPDA 4XMIA 4LO6B 2C77A 4JRLA 1Y0RA 2I2SA 4ZKTB 5FRAA 5IKQA 1U5ZA 1S1AA 1H1AA 2BU9A 3TEYA 5DZEA 1MQTB 4Y1ZA 2EIEA 5EYYA 4FPOB 2RMU2 4IE0A 1UMHA 4WZEA 4DQAA 3AVWA 4F3JA 1QIUA 2OQ6A 3EO6A 5GZFA 4JYUL 3AKTA 4XXAA 5L73A 1PNFA 2RVAA 2OYEP 4FFIA 3MUY1 1VQ8B 2WS93 1GOGA 2FQPA 3WQ7A 4EN0A 2VVEA 4AYUA 1PHMA 1AUYA 1FOD3 1UL9A 3H0OA 3WW3A 4XJWA 3LD8A 1CJDA 1UOGA 5A3TA 1QF3A 2XUEA 2EF6A 3M36L 2VTFA 1QH0A 3OYWB 1QJU2 4LO4B 3S5AA 2ZEYA 3M2MA 4QD2A 5GV7A 3NRUA 4Y24A 4HK8A 4Z4UA 1HRV2 4AEDB 1OT5A 2FD8A 3WXMA 3LF7A 5J37A 3HQUA 1XBFA 1GR3A 2GREA 2WNVC 1NB9A 1OGIA 5HCBA 4AAPA 2VBUA 4YXWA 2JDHA 1ULFA 1XNKA 5CG9A 5J96B 3B9CA 2L9LA 4XHBA 4QM9A 4XDQA 4NJ4A 1TTTA 3W21A 5KHJA 1AZDA 4LUKA 3WX5A 4XUNA 5A70A 2PE3A 2DVGA 1KC8D 1R5BA 1HXS1 2KVOA 5IK5A 4L99A 4JGYA 4RHV1 1QOTA 1N47A 3H7JA 4AGGA 4WZKA 3LB9A 4MGTA 5D2AA 4BHPA 4DFSA 5CFCC 1W06A 5HCAA 4YAUA 1IHMA 2DVBA 4GWIA 2DERA 3MDLA 1PMHX 2WQ4A 1U8CB 3RGBA 2R041 5ACA2 1LENA 4Q7JB 3UGGA 3K48A 1FMD3 3CJIB 4IEUA 2BPOA 2FDJA 3T0DA 2XMLA 2HORA 4AGRA 2XDVA 5CIRA 1DIYA 5BNOC 4OULA 1RGSA 2ZPXA 4CDQA 1E63A 1R091 3AP6A 5FZMA 2PMDA 4FPEA 3CESA 3LA2A 1UAIA 1W8UA 4YHBA 2VD7A 1F15A 3B00A 1QEXA 2XBO1 5JCTA 1IQEL 1ZZBA 3IJEB 4KI5M 1O4TA 4YW1A 1IZ3A 2P1BA 3RYRA 1PFXL 4PIYA 1A78A 3AKSA 1B23P 2B45X 1VMJA 4NROA 3ZKYA 3OPWA 4XFCA 1I5PA 4RCZA 4HANA 3D3AA 1TMF1 5C4WB 2YB7A 4EQVA 3QCWA 1QOOA 4L0PA 1VJ2A 1QU0A 3ASQA 3KF3A 4XM3A 3AK0A 4DQLA 2WR9A 2MGRA 1BHGA 1WMDA 4ITCA 1KLIL 1H6YA 3C8XA 5COXA 4ZU4A 1VB2A 4UFLA 1ZUNB 3LQCA 1SEFA 2GJPA 3UV9A 4Y22B 3A0NA 5LB6A 2WRAA 2VWNL 4B1MA 4LBQB 4L2NA 4FN5A 3H94A 4G7XA 1RUG1 1R1A1 5C33A 4F83A 1JA0A 1YFYA 2NV4A 2K0GA 3I3MA 4QDQA 2ZEXA 2WFF1 4OOSA 3NJPC 4LO5B 4ISQA 4SLIA 4W65A 2RMU1 5F1RA 3MIFA 4KKSA 2CJIB 2J1TA 3H1WA 1UD6A 1CVUA 2D9RA 1UY4A 3NT1A 1VBC2 4PIZA 4AZZA 5F4OA 2WZR3 3RY8A 2JG9A 5M0TA 1MQTC 4AL9A 4ZZ8A 4CP9A 4A7ZA 2GDFA 2XG3A 1CWPA 4FOWA 5C3RA 1XFEA 5T5LA 2FZ2A 2KB9A 2R073 2W5FA 2ZX2A 2BPA2 4MYUA 1IQDC 4C8DA 3K51A 3POBA 2JIZA 4ZV4A 3SEPA 4RRZA 3BU7A 4B4DA 1QJU1 4Z0LA 3B5LB 4IESA 4LHLA 2HWE1 3B3QE 2IZWA 1BMFA 4H7LA 1GWLA 2NN8A 2Y81B 1AJKA 3ASSA 2P2KA 4WVMB 2DUQA 3WNOA 2DWRA 2VCMA 5HXMA 3O1TA 2WN2A 1HJFA 1U67A 4L11A 1EP0A 3DDYA 3HNBM 3TOJA 4RD2A 3OW7A 1FPN3 2DOGA 3HPTA 1QJX3 3C9AC 2OBTA 1PVC3 2ZHNA 4XBLA 1V6MA 4AEDC 1JHJA 4BMEA 4XLEA 2FCVA 3RZGA 3MICA 2J1VA 4EYUA 1UZ0A 1XQNA 4S2FA 2Q1MA 1XQBA 1HJ7A 4PABA 1L7QA 5FYBA 1HREA 4L8QA 4QQPA 1CPNA 3EHKA 3W5VA 2K2TA 2C5DA 5LA0A 5IYNA 4UF0A 2Y6LA 1OBNA 3VKLA 4GMP0 5IT6A 5ACA1 3RYKA 5FBJA 3CMAB 4CSYA 4CDWA 4GU4A 4NIIA 2DIEA 3ZPOA 4ZAEB 1YQ5A 2W3JA 2ZMNA 4BPZA 5ISLA 4QPIB 4ACBA 1EFRA 1IQHL 2HWF1 1W0PA 1JYXA 3MF9A 4QVAA 2CDOA 4Q0SA 4BMBA 3O1MA 3I49A 3CJIC 4M0LA 1WSRA 2VCCA 2P28B 2VCBA 4EN8B 3NW4A 1CAVB 1STMA 2HEYF 4HVRA 4ZGNB 4FO9A 1KGYA 3TN93 1TME1 3U14A 3PMSA 4OHWA 4OPOA 5K8SA 2BBVA 3SH3A 1K5MB 5F39A 1W03A 4JZEL 4NBSA 5A3PA 4A3XA 4Z2WA 2KA3A 4CCJA 2ZX4A 1NRKA 3KWVA 4LKEA 4FM5A 2Y7XB 5L9VA 4FOYA 3J8F3 3FLTA 1UY3A 5JBQA 4BXSA 4DOUA 1WMEA 1OOPB 5C4WC 1WLTA 1OPMA 3OUHA 4RDLA 1XKBA 4NIGA 1NX9A 2VJJA 1H30A 5F2WA 5C7GA 2K2SB 2GQFA 3TGFA 2KL7A 2A3WA 1ND2B 4M3CB 5FZGA 3WHUA 4FTBA 4DXRA 4G4FA 5G04L 5C3PA 4R9DA 1KITA 2RS13 3POJA 4QKDA 5F6KA 1F0RB 4BQWA 4ZXXL 5DPNA 3R4UA 2XC5L 3VL9A 3CENL 3ZFGC 3MHZA 2QN6A 2HWC3 1E3XA 4HVOA 4NAOA 1MOXC 5DUXA 4OI2A 3DYMA 4OZOA 1C5MF 5EJZB 1VBC1 2P6CA 3FWEA 1R1ZA 3CCEB 4HT1T 3H7YA 3VL8A 1QY4A 3RZHA 5FMBA 2MNGA 3F95A 4BM8A 4XLWA 3WV6A 2WL1A 2FCUA 2AENA 2TNFA 5KR7A 4HIZA 1XDTR 4LKSA 5JMOA 3JQQA 2VZ3A 3GYDA 5H9PA 3AZZA 1TUIA 2WIIB 2JE9A 4ACAA 4XOTA 2DF7A 3PLQA 5FZ9A 3VLBB 1EUUA 3FHAA 1H85A 3R6KA 4UW6A 4PQ9A 4X8SL 4OYUA 1DDGA 2YG0A 1S2BA 3BY2A 4Z0KB 1YFWA 4Y26A 4BCUA 5FZOB 1F31A 3G6EB 3KL9A 5CNAA 1QFZA 2VBBA 3BN6A 5GM0A 4IW3A 1SG3A 5JWPA 1AR92 4V1PA 3I2GA 3PTRB 1IGZA 1AYN1 1QXRA 2JJ2A 3A23A 4K8RB 2FLBL 4B3XA 1XNDA 3OLUA 1VBA3 5KXCA 1OH3A 1SKQA 2E7AA 1VBE3 3GVJA 3IBMA 2R6QA 1AHSA 4Q0QA 1NKGA 3T30A 5FXXA 3KB5A 4HLTA 4O9GA 3LN0A 5E89A 2Q5TA 5JI9A 1KLOA 1AF9A 5JMCA 3FFGL 2BSFA 3WF0A 5JR7B 3WT3A 1W7XL 3AB0A 1SMVA 1YC61 5T3NA 2VC9A 1VAMA 3GIRA 3ISXA 4UFKA 1PZ7A 1ZBA1 4MMZB 3LIHA 4A4AA 5FZEA 1W6QB 3BI3A 1N8RD 1X8MA 3NV2A 3WDXA 1W8FA 3U37A 1O5DL 4PC3A 4PJYA 3CP2A 1YI7A 5JUVA 2ID4A 1P9JA 1W90A 2BGCA 5FY1A 1UZZA 1O59A 1VHOA 5GZCA 4QPIC 3JD72 4N43B 4YG6A 4QQOA 5HKKA 4YVSA 1ZBE3 1N1YA 3BALA 2AHOA 1QJY2 4ZS2A 4CCEA 2D6NA 3ZXKA 2CAVA 2W91A 3IDCB 4YVWA 5EPAA 2RC6A 3POYA 1A3KA 2VW1A 2A7AA 1YIPA 3T08A 5KC5A 5ABJA 3Q8BA 5I0SA 1XXNA 1K5MC 3WCSA 2QZ3A 4MV2A 1SPPB 4OI1A 2FVGA 2BOXA 1PX3A 4D8MA 4RS5B 1DZTA 2ZX1A 3U07A 5FXVA 4KU7A 2VVVL 1OLRA 1OOPC 5DDJ2 4IEXA 2XLFA 2FMDA 3UESA 1QMJA 2YC4A 3RZZA 1RUC2 4GIQA 1LB2A 1X33A 4PDWA 3D5OA 2UWBA 2J38B 3ZSJA 1JOJA 2W47A 1ELOA 1MZFA 4GXLA 1H6XA 1PM4A 4GWMA 4KWKA 1JL9A 2P3MA 2QVSB 4GA9A 2V5DA 1O3QA 4N3GA 1XKAL 2V7XA 4NWWA 4A7IA 2RR12 1P4MA 3FBYA 1LK9A 1AR83 1UKRA 3VBRB 1BXHA 5BXXA 4YT6L 1EP3B 1HIXA 2UWOB 3FN9A 3M3IA 2RS32 5APAA 2I9BA 1W9XA 4IGQA 1RL3A 1CQXA 4P22A 3AMQA 2HBTA 2VNHA 2HWD2 6COXA 4IUGA 3R4DB 1RUH1 2VO5A 1LHWA 2UY9A 5BNNC 3CBNA 3GXUA 1UD8A 3H1YA 1A6CA 5JXJA 1EAH3 1EUTA 3VHPA 2X5IA 4Q8LA 4Y7AB 3CHXA 2BZ6L 4QGNA 3ZO0B 1H9PA 4XAAA 1AR91 1N0UA 4HETA 1D8TA 3ILNA 3DKWA 5CZKA 4AQ6A 1N3OA 3BCWA 1H4GA 3ZYIB 1R083 2R30A 1C8M1 1C8NA 4NIHA 2XONA 3PU8A 1NPEB 5LZ6A 4GU3A 2JDIA 4RD7A 5GLWA 5FLIA 4AI9A 1UX7A 1W8TA 4ORFA 5FYMA 1DG6A 1NDHA 4IGOA 2B9VA 1W6OA 3HQXA 1HB4A 4EN9B 3VNUA 1DG1G 2LROA 3NJZA 2VR4A 1OUXA 3CC2B 5A6ZA 2GMPA 1HRFA 1JUHA 2PQSA 2B7CA 4DY5A 1JYTA 1RUF3 3FHIB 5C70A 4FPCA 2E33A 2J94B 1VHEA 3MF6A 4I02A 1CESA 3VKOA 3ZSLA 2TBVA 1BF9A 2PLV3 1IQML 3OEHA 1UZJA 3PUNA 4E2GA 4DPNA 3RQ0A 1WW6A 2VOKA 2ZACA 2CSGA 3GCWA 4YZ5A 3RNSA 2WPLE 1BEV3 1DGRA 4FFFA 4Y71B 1WHFA 2CDPA 1NFUB 1UD3A 4OMDA 3QFTA 1W2BB 4YFZA 1IOXA 3I55B 1ND3B 2F6BA 4IV1A 1QJY1 4BOWA 4N43C 3M1HA 1K37A 3LOIA 1AMOA 3V64C 2WO1A 4YW5A 2Y64A 1NE4A 4NWVA 4Q0VA 2Z2SB 4PI0A 2ZA9A 1H1MA 4CDUA 2RHPA 3DF0A 1W6PB 4G5GA 3N36A 4RD1A 1YEWA 1HRI2 2H9EL 2ZEZA 3ZN5A 1OQ1A 1S2KA 4O65A 2C78A 1AX1A 2WG3C 4OPSA 4CSWA 1W6MB 4W6YA 5KNLA 1K9MD 1EPIA 2J22A 3MCAA 2BOKL 5FZ4A 1S0FA 2UWPB 2NMNA 4AVVA 5FIXA 4KBZA 4KWLA 3LPFA 4IDZA 4ZZ5A 2E1BA 1RUC1 2A1XA 2XLGA 3Q8CA 2XZPA 1H2LA 1FNMA 4BA6A 5JXHA 3SJPA 4R71A 3POWA 4AE2A 1PZ9A 2GC3A 2PHUA 1ACCA 2W1UA 4IETA 4LULA 1FV2A 1QIQA 1MS1A 1PK6B 4RPBA 1UPSA 3TZIA 1LOAA 3VHNA 3RYPA 5JPNB 1RJ7A 1VP6A 4P3IA 1POV1 3I2HA 2IVJA 5FK7A 2NM1A 1VBD1 4KU8A 5KWRA 5SV5A 2WFXB 1RUD3 1J58A 2C4XA 3CRZA 2RS31 1PGEA 4FP2A 3JBG3 5JVVA 5IVJA 3W20A 2A6VA 1Q56A 3VBRC 4IEOA 4LITA 2HWD1 2QKDA 1ULPA 2JJ6A 1S0CA 4CA9A 2ZTGA 4A2UA 4PI2A 1RITA 3NNLA 5FY5A 3S5QA 3NJYA 4XCBA 3I2IA 3ZYRA 4S2HA 5FR3A 1X36A 2JEMA 1CAUA 3PMEA 1RFNB 1WBLA 2OTJB 2VY0A 2HEWF 4PC6A 2ZHMA 5IK2A 3O0WA 4UFJA 3SJZA 3GZUC 4I0BA 1OGJA 3MPBA 4ATEA 2P4EA 2FX3A 1AR72 2G9GA 1ASJ2 4XQFA 4FSJA 1XYOA 5EFUA 2ORXA 3H3ZA 4D0QA 4MUVA 3WNDA 2D98A 1O8PA 2ZX0A 1S0DA 2E51A 2VZTA 3EMRA 1GSLA 2VMGA 3BB6A 4LLFA 3CW2A 4LXLA 3AMNA 1VJSA 2WPJE 2N7GA 1WDTA 3BODA 3GNEA 1PJ7A 1SLAA 5KC6A 1WSVA 1FNYA 4P12A 2F4LA 2VZRA 1U5IA 3UJOA 1GNYA 4BLJA 2W3KB 3SC7X 1NXD1 1OXCA 2XJPA 1COV1 1IGXA 3IDEA 1JXNA 4I09A 4W50A 4AFMA 1ZM4A 4OUEA 2W6JA 1GNHA 3RSJA 4Y76B 1EAIC 3LGRA 2JKXA 3W5NA 1DARA 1RC6A 3K4AA 5A3UA 1W2UA 2PHBB 1OVPA 5IFTA 4UAPA 5K4LA 2F1MA 2Q1JB 3VDAA 1K5JA 3WLUA 1JYWA 4HKLA 1ND3C 4CU7A 4RS0A 1HJGA 2VQUA 3MIDA 3HN3A 1VLYA 3FL7A 4GAZA 5DAWA 4K9SA 5GJ6A 3DPRB 3POFA 4WM8A 4CPBA 3KD4A 3MW2A 1HRI1 1EV11 4D6QA 4ATFA 4NRMA 3ON7A 2WYFA 4NMIA 4XFBA 2WSUA 3T4VA 3TH3L 2OS2A 4XACA 3PHMA 3DKQA 1VRH2 2B7YA 3E5UA 2EI7B 5EYXA 3NAPB 1A8DA 4NG9L 2BWCA 3WDYA 5F19A 4YAOA 3OY8A 1QX4A 2J7MA 1GBGA 2D7FA 1GLHA 1Q3EA 3GBFA 3U2QA 1BKZA 4AI1A 1VQKB 1QFJA 2ZEWA 4GB33 3WF4A 1PX4A 2VVDA 1RMU2 3WW4A 5DN2A 1KD1D 4WVWA 3TBDA 1H8HA 3UT0A 1PK6C 2BO2A 1GOHA 4EZHA 3ETQA 1HZ8A 4GWJA 4U2AA 5J09A 5EMNA 4Z4RA 5IVEA 2D6KA 1Y9GA 5IKTA 4PAAA 3LEKA 2ZHKA 3NTGA 2VTXA 4XBMA 4IEYA 3KQDL 3HJRA 5FYCA 5FZ1A 2CF4A 1VQNB 1GWMA 3VD3A 2XNDA 1V70A 3CMGA 3S6XA 1N1TA 4OQ9A 2IXKA 5H5JA 1WUVA 4AK3A 2JWPA 5JSPA 4LKFA 2WG4B 4JGZC 3FHQA 4MXWA 1KEXA 2YUEA 1IQAA 4H2AA 3SKVA 4R9AA 2PQQA 3I59A 2RJKA 4JHTA 4CEWA 3USUA 1ZAQA 1V1HA 2DV9A 1ZRRA 1BMV1 3KM5A 5I0TA 4Z4WA 3ZFFB 1DLCA 4DY3A 4META 2NPIA 4BQ5A 4P9YA 2Q1FA 4YRDA 1AR71 3THCA 1ASJ1 1NB0A 1FJSL 4ZPIA 3MV11 5DUWA 4B3GA 1UXXX 3Q7DA 1OUSA 4Y20B 4QQ2A 4BQ3A 3FJOA 2AZ5A 4XF4A 1QG0A 4B8EA 2BZDA 3KLSA 3OF1A 3N7MA 4HKWA 1Y4WA 4DNRB 5L9BA 3WDTA 1BLZA 4XMAA 4V2WA 5IKRA 1KS5A 3VBOA 1C5IA 4QX2A 5FP8A 1YUGA 4YELA 1QNYA 1TQ5A 1PZ8A 4GJZA 3UKTA 3CB4A 1YJWB 1SCRA 1XRUA 3G71B 5JB8E 2JDYA 3AVRA 3HD8B 4YZUB 1OB2A 2ARXA 2IFWA 3E20A 2X85A 4Q4X3 1LESA 5G05L 2JDNA 1LOBA 3GALA 3ZMNA 2WWUA 2BDRA 4XURA 2YWHA 5IYPA 1YRZA 4GD4A 4QX1A 1RUJ1 1CZSA 3T2PA 2F1LA 3IDAA 2Q0AA 2SBAA 1CNFA 1KJRA 1O4ZA 3HS5A 2D3PA 5I91A 1ULDA 1ODMA 4GKYA 4TMVA 1YI2B 4AW7A 3H8UA 3P5BL 4GMP1 2AYLA 3GJBA 1JJ2B 2VU9A 4YWAA 1MEC2 3O14A 4H3WA 4Q4Y3 2VH6B 4OUSA 4RHV3 1DDXA 3H5CB 1NY72 5C8CB 1DU3D 1VRH1 1WLDA 3RRDA 3DPRC 2VXJA 2VG9A 5L7OB 3KV5A 2GALA 1C57A 1Y0YA 4QHOA 1VQOB 2VULA 2CK3A 3M3EA 4P00B 3OGGA 4WVZA 1WU1B 3BKZA 5FJHA 2R043 2VAUA 2BMWA 3QSYA 2ZX3A 5H59A 2RM22 4N53A 1G7CA 4AOCA 5CG8A 5LMZA 3VKFC 5C3SA 3IT8A 3NAPC 2OW4A 1IQFL 2YGMA 5FY9A 2AEZA 5EP9A 1SLIA 4U9UA 5AC92 1N1VA 1R093 3FUOA 1REFA 4PC2A 5KHIA 3KHCA 5IAVA 2FMYA 3SOVA 1RUI2 3D82A 4UW3A 4KG0A 2NMOA 2D6PA 1TVCA 1G9FA 3RPQA 3RVHA 4E2QA 1LNSA 2AGSA 1L3YA 2XOMA 1TMF3 3N7KA 4QKFA 1K73D 3KV6A 5A7OA 5KXEA 3V65A 4NNJA 3KCCA 2Q30A 2GNBA 4OOXA 1AYM1 4JQTA 4M01A 1GZWA 1WOPA 1OB1C 2GP5A 3WG2A 3SCHA 5EHDA 4LA2A 3H3UA 3I3EA 4M53A 1XSRA 3ACIA 4OMCA 2G4IA 1XYPA 2DTWA 1VQ4B 3GF6A 4Y79B 5FYUA 3HAGA 2XLAA 2ZGUA 4XC9A 3IM0A 3LWCA 1RUG3 2DETA 1EQHA 4MX3A 1R1A3 1LGNA 2Q8DA 2ZL5A 3JU9A 2J2UB 2BYVE 1PJ5A 2D44A 4ZCLA 1MS4A 1TEIA 2WS92 2IFRA 4TGFA 5DQ0A 2WFF3 2EAAA 2RDRA 1FFMA 3E1F1 1FOD2 2ET1A 3VHOA 1XOYA 2RMU3 5LBEA 4JTNA 1XSQA 1V0AA 2E7QA 4XEZA 5GZEA 4RGKA 4XF0A 1W6NB 4K1YA 2WFTA 3ZFFC 1ZRFA 5F4JA 4XABA 5C9AA 1SHWB 3CCUB 3SKJE 4XQ4A 4QB6A 2W92A 4NHLA 3AKQA 2DCKA 2PHFA 1M1KD 1U12A 4QU1A 5F3EA 4IXLA 4YVWB 1UPIA 3IMMA 1GKBA 4BK4A 5IFPA 4XCAA 2Y6KA 4NR1A 1QGYA 2WZEA 4ET7A 3T1LA 1FSBA 3M37L 1U5YA 4WQMA 4CUBA 2J1UA 5KW9A 2YMZA 4UI9L 2PAMA 2HWE3 3T51B 2WLPA 1QUFA 3LNNA 1CIWA 1AX0A 1NFWB 1TG7A 3WNBA 1H2KA 3KEWA 5FP3A 1SACA 2VPVA 1EPZA 3NJXA 4Y3OA 1CVWL 4R4ZA 1T6ZA 5CU1A 1C4RA 2YFZA 3A0KA 4RRWA 4QPWA 3T0AA 2VZQA 1V6OA 4PDWB 1W8ZA 3WW2A 2WA4A 4K3UA 1Y43B 4X6QB 3N8YA 4CTEA 3PVDA 2I74A 4CP1A 4ES9A 4QMAA 1FMD2 3H3LA 1QNWA 5E1RA 5A7WA 1NZIA 5JBAE 1LOCA 1MEC1 5FO0A 2P34A 3WD5A 3KV4A 3OGRA 5CFDA 2BF4A 1FNBA 2P3FL 3L2YA 2WNEA 4N8MA 4QFMA 5LA1A 1GVHA 3WW1A 3PU3A 1N06A 1SBDA 5FDBA 4LE4A 5DN6A 3IB3A 3M8LA 5I0UA 3SHRA 5C8CC 4A45A 2XNCA 1GU3A 4CU6A 2GP3A 2RM21 1PO11 3GZEA 4QGLA 5CISA 4L8JA 1Q82D 1IS6A 3B02A 5L7OC 1ULEA 2HWF3 5LRSA 4WZCA 1YUFA 5F5IA 4B29A 4QV2A 3UYJA 3OUJA 5HCFA 2VBTA 5AC91 2XBVL 4GWNA 5LBCA 3WXPA 1YQ8A 3M3OA 4QQLA 3ACGA 1GZCA 1RUI1 4Q5OA 3IAQA 4NHKA 1XE7A 1FNZA 3B9IA 1TME3 3VZJA 1RUNA 4Z1MA 4TSVA 1J9ZA 5JOXA 3AJZA 3DCQA 4JZRA 2WJYA 3WP4A 5LWBA 3VZOA 1US2A 4AC9A 4RQPB 1C1FA 3P1IA 1POQA 1JYIA 5E16A 4QPGA 3WP3A 3H8XA 1PTHA 3U0ZA 2QE3A 2Q8OA 3A8KA 4WBBA 1E64A 4FK8A 2WNUA 4Z4TA 1DQ1A 1YX2A 3SCFA 1V9U3 4XUQA 4Y9UA 4TMWA 3PUSA 5CAZA 1OPOA 1LHVA 2Q6IA 1W2OA 5C5TA 2GAUA 4Y1UA 4BB3A 3AVSA 4OHVA 3ZLIA 3ZIAA 4I0WB 4MGYE 2F17A 2X53S 3CZUA 2QEXB 2WS91 4BQ2A 1IJQA 2DCTA 4LHKA 1TLLA 3AVYA 3DV8A 5FO7B 3CZJA 2YGQA 1C5HA 5K0UB 3OB8A 2R062 5A33B 4D7YA 2E7TA 4X6RB 3WNLA 2Y0OA 4Y4YA 3ITQA 3Q8FA 4RUTA 1EQGA 3RZMA 5FFOC 1N05A 3N9NA 3OGJA 4K1ZA 3BTXA 1CEJA 1J3RA 2X0KA 1A8MA 1W8HA 2WAOA 5F32A 3IDBB 2MPFA 3OZVA 3CFWA 4YLZA 4YALA 4WM7B 2DU1A 3WDUA 1IG0A 3K46A 4GH4A 1RXFA 4E27A 1RHI2 2PIAA 3CLPA 3FJSA 4PQQA 3MW4A 3UL2A 1FI2A 4B47A 2ZAHA 2JD4A 1FPN2 1LOFC 1OB5A 2QZ2A 1QJX2 4LORA 1PVC2 2VNRA 2ZL7A 4XLCA 3ZXJA 1R5NA 2JE8A 3VBHA 3N8ZA 2RE9A 4RR3A 3BCDA 1F5FA 1V6LA 3I56B 5BNPA 4AF6A 5EV7A 3KZ4C 2D40A 1K8AD 5GLZA 2CNAA 1RVF3 1D4M3 5JW1A 4JZDL 2PHTA 2WSSA 2A3XA 3A22A 3C7OA 4FP3A 3H50A 5FPXA 2WT0A 1QDCA 5LEJA 5F7UA 4JZFL 1AYN3 3F1SB 2VZPA 2Y6GA 3VDDC 4Y6DB 4HXCA 5I8YA 1IG3A 1W2NA 1D0GA 2CC2A 1FMD1 3ZN4A 1HAEA 2V7VA 1PIV1 3KF5A 1W8OA 4MGIE 2VW0A 3INAA 1L7RA 1F7MA 3I2KA 3RZLA 4ISIL 3BPZA 1W0JA 4LBMA 2GD4A 4P02B 5HPOA 2QQJA 1XB9A 1GZ9A 1NZCA 4CUEA 3ZFEB 2YROA 4OHZA 4HSLA 3MO4A 5A1AA 1ZBA3 3CC7B 1AVBA 5DAXA 1S72B 4X8VL 1MZ5A 3OJWA 1Q43A 2VOVA 4HN1A 1IPJA 4HE6A 1BK0A 5KIRA 3LOBA 4K6BA 3WG3A 3WNNA 3L9JT 3QFCA 4HG6B 2FDGA 1OFNA 3THPA 4AEKA 1FNCA 4FPLA 3HQRA 4N9IA 1G1QA 4HPKA 2PAEA 4UT5A 3J8F2 2WQ8A 2YY1A 2X29A 1SZBA 1UCXA 2WN3A 1YUDA 1LGCA 4LJHA 3F6UL 3HT2A 1DZQA 4CUAA 4Z92B 2WNVA 1CAWA 1MZ6A 5E8DA 1DYPA 1D0HA 4BTTA 3POIA 1J3PA 4C1XA 2UWCA 4HFSA 4LBZA 2DURA 3ZDSA 4M3CF 2Y80B 4D6SA 3OD0A 2OVUA 1H8TB 1ATDA 2RS12 3V0AB 4BIOA 1YJNB 2C0ZA 4II3A 2RDNA 3I2JA 5CVRA 4XQDA 1KK3A 2HWC2 4F7DA 1N08A 5CFCA 1UX6A 4RQPC 3VBSB 1NA1B 3A3BA 2R0FA 4YFWA 3T4HB 4JTOA 2OUHA 3K3NA 5FZKA 3HNMA 4XZUG 3KGLA 1W04A 2KXLA 2WZNA 1RJ8A 2J7KA 3ETPA 2PAKA 1E62A 2R061 5FP7A 4ZY9A 2ZXHA 5EGMB 1C3HA 2JD9A 5BNOA 3AXDA 4KWUA 4HZFA 1V00A 1FNDA 2C9AA 5FQ0A 1Z6EL 4COVA 1PGL2 4JYVL 4M4PA 1V3XB 5K0UC 4D6RA 2XZLA 1RXGA 2XJQA 3QH0A 3WOGA 2R1BA 4FFGA 3ZR5A 1E79A 3HO4A 4C0BA 2VTXJ 3JU4A 1RHI1 2IXLA 3RJRA 4QQHA 4YM1A 2DDUA 1FPN1 2V7TA 2ZGSA 1QJX1 1W9SA 4QKBA 4WM7C 1PVC1 1WP6A 4R9CA 4XLHA 4ZCMA 3I7DA 2C9KA 1QKQA 1BBT3 5T5JA 1Q8VA 4B43A 4AR2A 1RUH3 1LULA 2ZGLA 3UKVA 1NJID 1XE8A 3N4MA 3CCSB 4CE8A 2AREA 3ORJA 4NE9A 1O8SA 2HKXA 2XVGA 2YWFA 1EGFA 4XPVA 1O6UA 5DG2A 2VUCA 1ZA4A 5FLJA 1AR93 3OY8B 2GH8A 3LSDA 1NLRA 5FKCA 4L9BA 2VWLL 2ZZFA 3SEJA 1C8M3 2IXJA 3A35A 1IQLL 3PURA 1M06G 1Z7S1 3H1MA 1PKVA 3NTBA 4RD6A 5FOBB 3WVJA 2TGFA 1G7RA 1GANA 5BSXA 2PA7A 1QQP2 3OJBA 1MQTA 4XQWA 5BV6A 4FCAA 5D8AB 2JICA 1TNRA 2X6WA 3KQEL 1NLQA 1SQ4A 3MDPA 2P3KA 2IUWA 3ALQA 4IV3B 5DAPA 5JVYA 1IOEL 1U0AA 4EN7B 1ZBE2 2ZL6A 1Q5OA 3ZFEC 2IC1A 3LFMA 2W86A 2I1LA 4AI8A 2VL4A 1EMOA 2ZS6B 3MV01 1S0JA 1G9BA 5T54A 3MQEA 5FPBA 3EGFA 2GU9A 3QD6A 3K4DA 1XFOA 5J1XA 3RS6A 1WCDJ 4FPHA 5FZIA 2XJSA 4OI4A 4X7DA 3PUHA 3VDBA 2BVVA 3J8F1 3OYWA 1HQLA 3CDZB 3THDA 1OH4A 2DVDA 3WNXA 1ONAA 4FQ4A 3FFQA 2P93L 1YQ6A 2XJVA 4UBGA 3OEEA 3M3QA 4Y1XA 5ANNA 3USUB 2P3IA 3C7EA 4AEDA 1SFPA 3LEIA 3N8VA 1G2LB 3VO1A 5A1LA 3VDCA 4Q4V1 3ES4A 5JI7A 2VMEA 3CC4B 1Y3TA 5CB7A 4AXOA 2W46A 4E2SA 3GQBA 3U4XA 4XKVA 4AVTA 1DQBA 4HMZA 1NQJA 1FAKL 3PENA 2PHWA 1WU8A 2K9ZA 2MEV2 1JZ2A 2VJXA 4XHXA 4LC0A 3NVCA 3P27A 1H8TC 5DSZA 4J1WA 2OA2A 3BCFA 1FV3A 3KL6B 2QQOA 4H14A 3NKTA 5A7QA 4RRXA 4NPRA 4K20A 2JDMA 2XBXL 5JSRA 1RUC3 3VBSC 1NA1C 2W6IA 2ZKNA 4YGEA 2J1RA 4DEQA 2W2IA 3BOWA 4B3NA 2X8KA 4BQYA 3O0XA 1NXMA 3AYAA 3GZAA 1F8VA 4WZTA 1DX5I 1QJEA 1D2SA 4IEVA 3OBTA 1MVEA 4K1XA 4Q1PA 1D2EA 3CJIA 3C7FA 4LBWA 3KV9A 3CJXA 4LLOA 1W2TA 1RUE1 1VBB1 4CDXB 1UIKA 3OOCA 3ACLA 2PFWA 3N7LA 4CUGA 1W39A 1OA2A 1JU4A 1B9WA 1POV3 3HVDA 1J83A 1VMHA 2OZJA 1VBD3 3OFNA 2QA4B 1OF3A 4AHXA 3V0BB 1GQPA 3HBZA 4DO0A 1DZRA 2BT8A 4DINB 1J1TA 1EAH2 1BX0A 2CL2A 3SXWA 3ZUGA 2WWJA 2XEXA 2CNDA 4BPRA 4LPLA 2GK6A 4ROXA 1J3QA 1ENXA 2RS33 5FXWA 4RGGA 1AJOA 4CEYB 4CUDA 4XBQA 1J1LA 2YV8A 3VHRA 5C4WA 4CCKA 1R082 2O8QA 4LO7A 4CCOA 4QAWA 2J95B 4NVPA 3J7MA 2FCTA 2CWSA 4COUA 4KKTA 1E5IA 2WZ8A 2GC1A 4E4ZA 4Y22A 4CXYA 1Q8QA 2V7UA 5EZWA 4YM3A 1Q81D 4LBQA 3POSA 2JDPA 2BTVC 1RUF2 3PUAA 3ZFGA 4IE6A 3LIGA 2V4DA 3ASPA 4Q29A 3BPSA 1MACA 5IYWA 2XC0L 4LOSA 4PLMA 2XKPA 3LZZA 4NAMA 1SLBA 2XHNA 1VLOA 1B35B 4AGVA 4R52A 4BK5A 1JBUL 3HNYM 1QQP1 1LOGA 1IOAA 3PL0A 5I93A 2AC1A 2DVFA 5L9RA 3POGA 2QTZA 1BEV2 1XNAA 4OHXA 4AFDA 5ERLA 2VNGA 3PIGA 2EXKA 3ZVXA 1OLQA 2XR4A 1N0VC 3LTGD 3F2ZA 2VMCA 4QX0A 3VKNA 4I0AA 2V7WA 4LBNA 5D8AC 1OD5A 4N7IA 3VBFB 5LATA 4QX8A 4IV3C 2GZWA 3HIFA 1COV3 1CONA 3BPSE 2JIGA 2P6HA 4P9SA 3W5HA 5H9SA 4UFMA 2WQZC 3ONYA 2Y7ZB 4O02B 3N3HA 1EPGA 2H6BA 5FP9A 1X7NA 3PGHA 3BUCA 3CXCB 2DEUA 2LZJA 1IKPA 1S4MA 5A3LA 4F8AA 5GV8A 5FO8B 3T53B 5T52A 1OKQA 2BWAA 1KDKA 4Y7CA 3ZR6A 2FDFA 1X8EA 4H9GA 4PT6A 3WDVA 1V6JA 4MMYB 1V5VA 3TNQA 1RINA 3PNAA 3VBUB 1LHNA 1HRI3 1RYYA 2MEV1 5IK4A 1EMNA 1EV13 4UW4A 1ZZ8A 5C9AB 2KD7A 1REDA 3SW2A 5FLHA 4GQNA 2VZSA 3CCLB 4NA9L 2XVKA 2DCZA 3ZXLA 2DY1A 4COZA 3M7AA 5IVCA 5FY7A 3WBKA 3NSTA 4LTAA 1HRV1 3SKBA 4KWJA 1V0FA 5IUQA 2VJ3A 4OLLA 3NV3A 1DDIA 4XFIA 3ZXFA 2D3SA 2VH9A 2YHJA 1YGCL 4HBNA 4JRAA 2AYHA 1RUD2 3MHPA 1ZM1A 2BW8A 1HX2A 4QPIA 4LBKA 3VMFA 1W9YA 3S6PA 3TEZA 4JVAA 3GM8A 3UKNA 3IPVB 4JHZA 2PHRA 2OT7A 2J1AA 1H9WA 3IWZA 1QGAA 4DXTA 2BQ7A 4CDXC 1ATEA 1TNFA 4D94A 2BQWA 2RNLA 1JZ3A 2XBWL 4K40A 2WWSA 3N8YB 2QJVA 1O3SA 1MS9A 1NBMA 4QHYA 3BNWA 3BU0A 5C3OA 1ZM2A 2NYYA 5JIUA 4BQXA 1K5MA 1R081 3PVEA 2BV4A 1FAYA 1Q9SA 3FFZA 4S2GA 4DZGA 1K42A 2VRSA 5GLVA 2XUMA 5FDQA 1VQ9B 3OKXA 5A3OA 4CEYC 5JSOA 4RGAA 3HO5A 1OOPA 1HT8A 4AEMA 2YYOA 2ZBUA 1PRHA 5I0RA 3HR9A 5CBLA 2BJSA 4TLGA 2NPRA 2GMMA 1AIPA 2C5BA 2JENA 5FYZA 2A5ZA 4K8FA 1HDKA 3AJYA 4M3CA 3W5MA 5TY0A 3P3PA 2C5HA 4X7FA 1A34A 5HV4A 2MHPA 2XHKA 1AR73 2BQ6A 1F35A 2P16L 1S0IA 1XB2A 1F0SB 3RI8A 2G19A 1G1SA 4XF1A 3Q8AA 2J42A 3NO8A 1BEV1 1OF4A 4O7XA 1XU2A 1VLNA 3KGZA 4M4RA 2VZ1A 1TZOA 3N7JA 3QFRA 3FX3A 5FPZA 1B35C 2LM3A 3O5SA 4QDRA 4QXHA 3NMBA 2PHDA 4TMXA 3M4FA 2YGLA 1ZX5A 4NN0A 3IAPA 1AXKA 4M1KA 2W2PE 4A7KA 2DVAA 4FXGB 1SFYA 3RFRA 2XGJA 2QQPA 2VVCK 2RDQA 2P3UA 3SLIA 1HW5A 1CQ9A 1F60A 5DUVA 5ANQA 5TV2A 5A3NA 3WSOA 5BNNA 2V5YA 4D0EA 2VQ0A 2VVUL 3VBFC 1HN1A 1ZRDA 2V72A 3CQOA 1EP1B 4PHZA 2DBNA 3W5UA 1RUJ3 3APBA 1NQDA 5IYRA 4YEJA 3ZYGA 4P5HA 4HOOA 4YG0A 4AAXA 2VH0B 4YZ4A 3FCSB 3HS7A 4XJ8A 3BOPA 3MZHA 1YCIA 1RQPA 3W9AA 2FLGA 4Y5TA 3FPPA 5BNQA 4GMP3 1Q8PA 4MMXB 3A8JA 2GH2A 2VJIA 3SEEA 3A4UA 1JYVA 1K36A 2D6MA 2OUJA 3VBUC 4DQKA 4GB32 5F5AA 3ROUA 4TN1A 3AZWA 4PH9A 1WA6X 5AVPA 3WF1A 5C9AC 4CVUA 2HEVF 4DXZA 1ADXA 4QHBA 2W95A 2X05A 2G9ZA 1DQ2A 4YSFA 3SITA 1JS9A 5FY0A 1G1TA 2P95L 4YGBA 3C3VA 1W6QA 4NIAA 3VBHB 5DMYA 1DYOA 2V4VA 3MLJA 4RR3B 2QQNA 2EFGA 5FZ6A 4R4XA 3P6BA 2VQAA 1YLLA 2ZMLA 2BQPA 2G00L 4CPBD 2D97A 1REEA 4R9BA 4UYBA 4XUOA 4N43A 5F3CA 3VGIA 3U73A 5JDBA 4XJ9A 2B7DL 3V64A 2A71A 4G9SB 1NCQB 4NIDA 5FPLA 2VCAA 2Z6BD 1LEDA 2DUOA 2XB6C 1WCUA 4CCLA 1D2QA 3WF2A 3V76A 4ZCIA 2HMAA 4JAAA 2BVNA 1VQ7B 2R49A 1AYM3 1UZPA 3AM2A 3V56A 2JKBA 3EXUA 5BSYA 4EZ4A 1YJKA 3SH4A 5DAQA 4JDOA 5CDFA 3KQCL 1AR63 3ZSMA 5JOYA 3AL6A 4JDMA 5IHRA 1NUKA 2BFUL 4BQ1A 4FOQA 4XJAA 3MGUA 4ZU5A 1IQNL 1SPPA 4EV0A 5JIAA 4NHMA 2E31A 3GCXA 4O61A 2I9AA 1J9CL 2YBSA 3RR3A 4MGSA 4XETA 3E6DA 5IVFA 3VD9A 3TK5B 4RSUA 3J26N 5L2YL 3NNJA 4BU2A 2VYQA 5A32B 1E5SA 4QHZA 1BVP1 1QGZA 3SISA 5CKNA 5D21A 2JXAA 3I4IA 4P5YA 4GJYA 3AFGA 2XQRA 4W6XA 1YUKB 4CQJA 5AN9A 2PR3B 1G2MB 1GP5A 3HT1A 1AL0G 4Q4X2 5CEHA 3ENSA 5JZGB 2WAAA 5J3OA 1EPWA 2G9FA 3BIEA 1YO8A 3K2OA 1BLIA 1UD2A 1NCRB 3AZVA 4D7TA 1W87A 5FPAA 4IEWA 3DGTA 1JU3A 5TSWA 2WO3A 4RD4A 3LDRA 4ARXA 5CFCB 1CZTA 1ND2C 2BN4A 5DXDA 2EI6B 1AX2A 4Z1VA 3B78A 3ZPYA 5BPXA 1DIWA 5FMDA 4PC7A 2HLDA 4E4HA 1LPZA 4LE3A 2XGXA 1O5LA 1VPHA 4Q4Y2 1A3PA 3KQBL 1RIRA 3O1VA 1OHFA 3SMHA 2J34B 5BNOB 5I8TA 2Y34A 1IKQA 1EYBA 5K9YA 1GK5A 3WQZA 5FPUA 3QBQA 3SNMA 1W0OA 3WCRA 4XR6A 3ZN6A 1MR5A 3AZYA 1VQPB 4PBPA 4XORA 3J9SA 1IQKL 5DG1A 2CAUA 4P6VF 5FMOS 4A42A 2V31A 1CAXB 4GB31 1YIJB 1R092 2YPJA 3RI9A 3UETA 4MGZE 3AMPA 4BE3A 1ATAA 1QFYA 3ASIA 1FYUA 1KZLA 2JG8B 5A6XA 1M90D 2ZABA 1VE0A 3N8WB 2LTNA 1J84A 1MS5A 3D0JA 4XVHA 1WORA 5A80A 1PO13 3JB4C 4Z82A 3UGFA 4C0HA 1W3VA 3LA7A 3UJQA 2WPDA 2LUWA 4P26A 1HB2A 1KDMA 2XKOA 3VUOA 1RTVA 1TMF2 3B8HA 4WZFA 1N1SA 1QGLA 1CNEA 5E8AA 1CR7A 4OHYA 3NNFA 4FPGA 4CCNA 5T50A 3ENRA 3KVAA 2ZBJA 4YW3A 5LASA 1ZZ6A 4AHWA 5H9QA 2TUNA 4NO4A 2C24A 2W2NE 3VBHC 1HAFA 3WUCA 2VZUA 4H7MA 3TB0A 3Q6QA 4XYXA 1DQ0A 2W26B 4XN0A 5FAXA 1ND3A 1RUG2 1KJZA 1R1A2 3T0BA 3ZYJB 4GZ9A 5FZCA 1UD1A 2WR8A 2NP0A 3VO2A 5HXBA 1NCQC 4TN7A 2CV6A 4AWDA 2WFF2 3R0RA 2Y38A 3BTYA 3OBAA 2Q6KA 3B01A 5FZHA 4X7EA 4RDKA 2W2QE 3CNAA 1W6PA 2F4NA 5JXIA 3JD71 3HEIA 3HWJA 5FTTC 4PBOA 2QDXA 2F4PA 3IITB 2BSAA 1PGSA 2RS52 4XUTA 1F7EA 3W58A 5FMOL 5FZ7A 1WTHD 5CADA 3DEMA 5A7SA 2VNIA 1O91A 3KT7A 2Q8EA 1W6MA 1OC1A 4LQRA 4YM0A 4PC1A 1GR1A 4MH0E 4ARYA 4QPYA 2EIDA 1VQLB 4IEQA 2DU0A 4JKMA 1SM4A 3IIIA 1LECA 3L2HA 1GMMA 2VGDA 2IVIB 1AXYA 3EYPA 2WDBA 4URAA 5FYYA 2OIIA 3R05A 4QT6A 2HWE2 3NWKA 2JJ1A 1PK6A 3Q8EA 3GHNA 4Q4X1 3KCYA 3GCWE 3EJKA 3M70A 2OK8A 1DGLA 1ZA7A 4X8NA 1IQIL 4JX0A 4Z4VA 1APOA 2VBPA 4IGPA 3HMYA 2PXJA 1OKOA 1B2RA 1BJKA 3ECQA 2W0XA 5DDJ1 2Z42A 3OEAA 2D3NA 2Y5HL 2XC4L 1JYNA 5JZGC 1BCXA 2O1QA 4TZDA 1NCRC 4RS5C 4X8UL 4JGZA 3HN1A 1UZYA 2Y6HA 3DXTA 3GDBA 4BISA 1UMIA 2VW2A 5IWFA 4A7YA 4Q4Y1 3SCGA 5B2GB 3LSEA 3Q9OA 2W1SA 4LK6A 5F8PA 5HXVA 3H8OA 2JN9A 2XWJB 4P1VA 1BQEA 1DVAL 5F2SA 2Z4FA 1GO2A 2WO7A 4DS0A 4FAHA 3K4ZA 4I30A 5KXBA 1UN1A 2RR11 2ES3A 4QM8A 2VUAA 4HKOA 4DB5A 2B42B 3WUDA 3M3CA 4P9XA 1ZZ9A 1PIV3 2A6XA 4KNCA 4YNIA 1B09A 5FYTA 2Y82B 4DNTB 4UFIA 1O3RA 2YC2A 2BNMA 1CX2A 2HWF2 2CY6A 2FD6A 1S55A 4MZUA 4ZHAB 4IEZA 1JZ4A 2MHFA 4JGYB 3JQXA 4MHUA 2WPIE 3WZ1A 1WMFA 4IL7A 4OP7A 1I6XA 2PLFA 4QX5A 1F9KA 3USSA 3J7HA 1TME2 5JAXA 4AVCA 3NV1A 1TLEA 3SOQA 2C26A 3HPNA 4XTMA 4ZXKA 2B39A 4G3YC 2JG8C 2ZMKA 1DP0A 2QUOA 3TYJA 1RB8G 3CEWA 3QACA 2QGGA 3S7EA 2D3RA 2CW5A 4E0FA 4E8DA 2O8OA 4CDQB 3RMXA 1UYYA 1BZWA 4X06A 1R5OA 4RYDA 2CGPA 1ENQA 4V2VA 5FZ3A 4CCDA 4FPFA 1COWA 1V9U2 1WA4A 4AI0A 4KH9A 2R32A 1NT0A 1UYXA 5BUVA 1UD4A 1PMJX 3N9MA 3NNMA 4OPVA 4NOTA 5EJ3A 3ZFGB 3MIBA 2BBAA 2VQTA 2ERFA 3LDBA 5HI0A 4KGGA 3KRKA 2KV4A 1P8JA 2BVBA 4P9JA 1W9FA 1QJFA 1IQGL 3T2QA 3AVUA 1UW8A 5GALA 3GISX 2GNTA 4BYYA 5L30L 1JYCA 3DPRA 5FA6A 5EQUA 1VQ6B 1GV9A 5FKBA 2BOIA 3GBWA 5B6IA 2FZ1A 3B69A 2RS51 5HCHA 2YWEA 5CA6A 4UFHA 4B7EA 2R063 3NAPA 2Z79A 3K9XA 5LA2A 1FF7A 1W9TA 3DL3A 3RDIA 4M0NA 3SQOA 4FOVA 3S7IA 4WV8A 2BGOA 4LNVA 2YBKA 3SOBB 3MUZ1 3U10A 2BOUA 2QQUA 4DUWA 3OEBA 1W28A 4XW3A 2E1RA 5F4MA 2JG9B 3MFCA 2P3TA 1RVF2 1D4M2 1WD3A 1RHI3 4Q0PA 2XJTA 1JHNA 1H4HA 1X50A 3JQWA 1FDRA 4CP9B 3AMHA 4FQZA 1DF0A 4BJ0A 2CYFA 3I2DA 3CCVB 3JUUA 2EA7A 1AYN2 4EE2A 1LOEA 1EWYA 5F1AA 2GMEA 3WNCA 2VBVA 5FZFA 3ASTA 4MLOA 3IMNA 2OXBA 2PMWB 2HYKA 2Z69A 4MVTA 1LJ7A 1VMFA 1SLTA 1XPWA 4XKWA 1Q7YD 3B82A 1QWRA 1AL23 1KJLA 3I54A 4I3GA 1ZZ7A 5GZGA 2R9VA 3MBWA 4Q4W3 1ZBA2 2VXRA 3CP8A 3ATGA 2X6XA 3QMOA 1FT9A 3AP5A 3CCJB 5LY1A 1Z7S3 1LU2A 5J48A 1ZRCA 1WW5A 1W8NA 4XFHA 5J35A 2B5OA 1Q4GA 3ZFFA 4AF9A 2WUHA 1H42A 1V6NA 2QMUA 3ELAL 2A75A 4MYEA 2UWLB 5F3GA 3FPKA 4C43A 3K77A 2HWB3 2YZ4A 4Y20A 1LKNA 2ARBA 4ZGQB 2WPHE 4RDJA 1CGPA 4UF0B 5FYVA 2H6CA 4YG3A 1L3JA 1YI9A 1Y7BA 1UIJA 1TE1B 5IW0A 1WLCA 5F6LB 5LA9A 4JGYC 1IB0A 4CDWB 4AQTA 4J25A 1OURA 2X6YA 4HK9A 5EIYB 3WBJA 1E1QA 4M4SA 1F5JA 2ZZEA 5FWJA 1T6YA 4GQ7A 4K21A 5JB9E 3ZIWA 5IAXA 1WMXA 2YXSA 2C1FA 5IKVA 4D90A 1V9U1 4JMQA 4A41A 2QQWA 2Z5WA 5D1IA 3GSIA 1PO22 2B4KA 2VWOL 2A73B 5GZDA 1UY1A 4M10A 4Y5Z0 4XDOA 4CDQC 3JQPA 4ZH8B 2MGPA 3LQEA 4Q4V3 3MIHA 3O1UA 4CP2A 1UOJA 1AUTL 4II2A 2YPDA 2FDHA 5JLVA 3LEMA 3NL1A 2WT1A 2ARCA 4X0CA 3ZZ0A 4ISRA 4LO8A 3GHMA 3AP9A 4AHZA 4W4ZA 1CD3G 4Z4SA 3A8IA 3W2HA 2HCJB 3WNKA 3WG4A 2BMGA 4B3FX 1H8EA 2VZVA 5DUUA 4COYA 2BP6A 1YWKA 3AXEA 2W08A 3HBKA 2D3LA 4G1VA 1UZQA 5TR9A 5C8CA 2F9BL 2VOXA 3BTZA 4RJLA 3KCXA 3KHBA 3AGPA 3OTFA 3EQEA 5L7OA 3B7MA 3T2TA 4UAJA 3SH5A 4HE5A 4LIVA 4FTSA 1UF2C 4C0SA 2BRTA 5C5UA 1E1RA 4HVQA 2YWGA 1NLSA 2EXHA 5BNNB 3ZYBA 4YARA 1DGWX 1F4AA 1HT5A 1UU5A 1RUE3 1VBB3 2IXHA 1JODA 1OI6A 2C4TA 1UOFA 1BBT2 3ACHA 4WWVA 1UZWA 3QOPA 3LDKA 1RUH2 4PLNA 1HXS3 3AKRA 2ZGTA 1RVF1 1D4M1 1XNBA 2ZJCA 2X10A 3MLKA 1WHEA 1HZEA 4NGAL 3PVBB 1DYKA 2AACA 2O14A 1SDWA 3ZSKA 3WHTA 5FOJB 2DUPA 1VRBA 4Y4RA 4P25A 2JG9C 5KBFA 5A89A 1HQNA 1OB0A 3FZ3A 2OBSA 4UW5A 2BGIA 1C8M2 2QQLA 3E6CC 1YHFA 1J59A 5K7PA 2VVFA 4X7CA 1V0EA 1Q86D 3PIJA 4X8TL 3ACFA 2OZ6A 3ES1A 1QVFB 1YITB 3N35A 1RMU1 1CIYA 2FDKA 1CX4A 1CPMA 4KQ7A 4ZXEA 1KFUL 2XBO3 3CCMB 3MLLA 4LBOA 2RA0L 2VM9A 4Q26A 4XBNA 2V7QA 2R16A 4IW3B 3D26A 1LMJA 2V73A 1I9RA 3GBGA 3K3OA 4JV4A 1SDDB 2EVXA 2VECA 3OPZA 2BERA 1QQP3 2ORZA 1O7FA 4D3WA 2H0VA 3AMMA 1G6NA 1KMHA 2VNOA 4MO3M 1IJFA 1LMMA 3WINE 2OTLB 1W6NA 5LBFA 1S0BA 3LC5B 4TSFA 4NPLA 4AVAA 5H9RA 4XJUA 4Z6AL 4D7SA 1Y9MA 2WYJB 5J7MA 3OP1A 1LOFA 3D8CA 4QX3A 3PVOA 4IE7A 1RQRA 5FYHA 5FWEA 2WZPP 3CMMA 5FO1A 3J7LA 4UBHA 1G7SA 4AG4A 3WNMA 5JOWA 3BGAA 1SBFA 4P9GA 2H9EC 3OD4A 4CDWC 5LY2A 3TEWA 5T5PA 2ZBVA 1Z6CA 5I46L 4QXBA 3WR0A 1E57A 4ZS3A 1UKGA 4RFT0 1GUIA 1PO21 2JE7A 2OX0A 3BY1A 3WG1A 3OJXA 1BK1A 1IPKA 4YVSB 2AEYA 4Z4ZA 4XOPA 3VDDA 4B48A 1Y9QA 1O5UA 2AH2A 4LBYA 3LN1A 4H55A 1W0KA 1VR3A 4URTA 5A3WA 4GALA 3AP7A 3U4SA 2ZTNA 5JBCE 3ZOIA 1VF7A 1VAVA 2HDNB 1Q8OA 3MIGA 5SV8A 5IK8A 2E32A 5DZGA 1KTVA 2WABA 5KHHA 3T09A 2WC2A 5GLTA 3GZTB 2MEV3 4DEVA 4XL9A 5E6TA 1W0NA 3ZXGA 4LBJA 3OCPA 4DK0A 5A1FA 4AI3A 5ABJB 4XD7A 3CIHA 3QH6A 2XZOA 1QJU3 2QTLA 1IS3A 1S0GA 4W6WA 5FZAA 2ADXA 4A3ZA 1ENSA 2BM1A 1C1LA 3N9LA 3R6SA 1G1RA 2FDIA 1HRV3 3ZYHA 3I2OA 3KCGL 2F43A 4P6YA 2LS6A 2QNKA 1VBD2 1GP6A 5FO9B 2ZAAA 1EFTA 3VD5A 5IVVA 3OPOA 3OOXA 1F20A 2D5HA 4B4RA 1QHDA 4RN5A 5L46A 2E53A 4Q1RA 3Q38A 3UNPA 1QFKL 1I18A 2NZ9A 3OPTA 4YM2A 2ZGQA 1DGRN 2JIJA 2IXCA 3RJ2X 2LRPA 5I8SA 1BBT1 2PTMA 1UZKA 3ES9A 1YHQB 2NLRA 1K28D 2JDUA 1KKEA 2WJSA 2OYUP 3TRSB 4EH1A 4XNFA 2ZZQA 1NY71 4IERA 3ZXDA 1DQ4A 1OFSA 2D74A 2LW8A 2XL9A 1VALA 2DBIA 3ONUA 2WYSA 2GC2A 3ZN6B 5ACA3 2FLRL 3FUQA 4CRQA 3FC0A 2BGJA 1DFQA 2BT7A 4RQPA 4P2NA 4N90A 1ZRIA 3KSCA 1NE6A 1F4HA 4AFAA 4ASKA 3AVXA 1GOFA 1JBCA 1GAQA 2XJRA 3P5BA 2QBXA 4N9HA 5AVAA 1LCLA 1CCFA 5A7NA 2X5IB 3OZWA 5KSWB 2BM0A 3N9QA 4BXFA 1HV0A 4LIUA 4O9EA 2DYCA 4DK1A 1KIGL 1PXXA 3O0VA 1GICA 3LTFB 4CXWA 2HBUA 4FTEA 3E97A 1CX1A 1KQRA 4OTYA 3AP4A 1ULCA 1O3TA 4PF1A 2CU5A 3DUIA 3J4UH 5K0UA 5A33A 3ZIXA 4EWAA 1COV2 2XBYL 1LU1A 2ETEA 4G7WA 1QOSA 1W6OB 3VKMA 1HN0A 1CVNA 1YLOA 3BTAA 3DXUA 1UU6A 1YXWA 4TT3A 1NFXB 1WPCA 2GN3A 3KQ4B 1EXMA 4WM7A 4Y7BB 3GVLA 5EJ1B 3WY9A 4OZXA 4YW7A 4PIXA 2WZR2 4YW4A 2GNDA 4LBQD 1ZVFA 5HZBA 1GNZA 5FZDA 1KRHA 5L36A 4TTGA 3OGSA 2X3UA 1FOD1 2B7BA 2ZGOA 2R072 1OQDA 2CTVA 1EV12 1L5GB 5LK5A 4QU2A 4AEJA 5F5QA 1I7PA 1PJ6A 1VBC3 1OMIA 5TRDA 3MW3A 3LAQA 1DLLA 4KGQA 4IV1B 3R6JA 3CPXA 4LEJA 2UURA 4C91A 1IVOC 4L92A 5A7PA 2EICA 2XWBB 1OHHA 3W59A 2DCYA 2WBKA 3CD6B 2ZGPA 1WCSA 4YVSC 4Y5SA 4P3YA 1S4CA 1ODNA 5C3QA 3CO2A 1IJEA 1OA4A 2VUJA 4CDUB 4XMYA 1LEMA 1URKA 3U6BA 4YVWC 1CZVA 4NPMA 2CGOA 1X7AL 2M74A 4BXSV 1ZYBA 2Q1ZB 2Q4SA 3H9AA 1KQSB 3N9OA 5JBBE 2WO2A 3ZFEA 4ZHNA 5ABJC 1OA3A 2GC0A 2QQMA 1HLCA 2P3FN 5BY5A 5L19A 2UYBA 1FRQA 4AQ2A 2BOJA 1UXZA 5LEKA 4MADA 2Y26A 1MVQA 4XOGA 3I8TA 4TLFA 3PJQA 5IYYA 4JGZB 4DXSA 1K45A 3AC0A 1G9CA 2RJLA 4ASMB 2W3IB 3U75A 4BLIA 4G1BA 1KSNB 1FXZA 1FRNA 4PDWC 2W2OE 2QTWB 3A21A 2GN7A 2ZKLA 2D6LX 1ZM9A 1WGPA 3PUIA 4KG8A 1MZEA 4XLFA 4YAWA 4Z4YA 1T5EA 3UK9A 1ZZCA 3CKHA 1URXA 3DECA 1JZ5A 2WYGB 4A44A 2D5FA 2J4IB 2Q6LA 3KQRA 1UZVA 2M5SA 4QXCA 2AUYA 2CRVA 1BMV2 3TN92 1ZNPA 4PGOA 4RCYA 1H8TA 2UY8A 1WCKA 5F9TA 1APQA 3V0AA 5F5CA 1D4VB 5A3MA 2NQYA 2E63A 2P5BA 1E5RA 3U6KA 4Y1VA 3Q6RA 5KHKA 3OE7A 4JC1A 1O4YA 1VAKA 3VBSA 1NA1A 2UU8A 4S2DA 3BC9A 2KR2A 1BJQA 4E1GA 2A6ZA 3WYAA 3W2IA 3P3NA 1WKYA 1QVGB 4LBLA 1N7DA 4I3PA 2JB4A 4FI9A 3KT1A 4A6SA 4MYTA 5I0DA 5DS0A 1HA3A 3QE2A 4QUZA 1CAUB 2RG4A 3PJYA 3AYDA 1F2NA 2X5IC 2W1WA 3PUMA 2W52A 4XAEA 4U36A 3D6EA 3OBZA 3MPPG 2ZHLA 4SBVA 4LK7A 1MQ5L 3C2UA 2XQXA 2TEPA 4LHSA 4TXWA 4MGQA 1UY2A 2B46X 2VNKA 4EN6B 2SLIA 3G4SB 1UMZA 3BQJA 2PN5A 3JB8A 2W9XA 1U2RA 3MEPA 3ZKUA 3B93A 3LEGA 1RUJ2 2WZR1 1WZXA 5KN5C 3ZMOA 1PVXA 2VBSA 1HCGB 5GLUA 4TWTA 1M1XB 3WQ0A 3EBRA 1BX1A 2D6OX 1ZM3A 2R1DA 5E6HA 3PDQA 1V1IA 2OYNA 2R071 3PA1A 2WINB 4IEPA 3TEXA 1XE0A 2VZOA 3WP5A 3W2GA 2FBEA 1G7YA 3JZVA 2YU1A 3ELNA 3O1OA 3LC3B 3LIWB 2DCJA 2EXJA 1JUIA 3AYEA 1AXZA 2P17A 1OQEA 4C1WA 5JVZA 1BYHA 5FNZA 1NG0A 2ET7A 2ZXQA 1N1IA 2ZZGA 2VMHA 4IV1C 4HSJA 2OPKA 2WLQA 4YGDA 1XYNA 4WM8B 1UYZA 1XC6A 4XFGA 3LQ6A 1LGBA 4Z2AA 2PELA 2ZGNA 1GQHA 1VBA2 1G9AA 1JV2B 3A1PA 1VBE2 3VZNA 3OLTA 2XXZA 4IQPA 2BV3A 4CDUC 5D8AA 3TNPB 3FBMA 4XUPA 2EIXA 3H42B 4IV3A 3NJVA 1D7PM 2EI8B 3AKPA 3S57A 3QFSA 1G7TA 3ZZUA 4RL7A 2VNVA 2R0HA 4FAGA 1AYM2 4XLAA 1WLWA 2HYXA 2W1QA 4LUMA 3RZKA 3VB9A 3ZBTA 2UYAA 4QX7A 3KS7A 1AR62 2VE1A 5FZLA 5A8AA 4IE5A 2CHHA 1YFUA 2OKXA 3WDWA 3S0MA 1OVSA 2RV9A 1UD5A 4RRYA 1WD4A 4X07A 5HBAA 1PNGA 2WKKA 4F7ZA 1W99A 3BT1A 4Z8BA 1YNAA 3JQRA 4QVJA 3C7GA 3TN91 3K75B 1E43A 1V6IA 4AI2A 3AX4A 4O1ZA 4LT5A 2Y33A 4BXWA 4YW6A 4ZONA 1JZ6A 2XH6A 3JD73 3T56B 5FPVA 3D0SA 2W39A 3WNPA 4MXWB 5E88A 1XJAA 4Y9RA 1EP2B 5IJRA 4J1XA 3U1XA 3NV4A 1QJY3 4P9WA 2X09A 1YJLA 2VNJA 3I59B 1NYWA 2W2ME 1D1NA 4CEWB 3WQBA 4COXA 2P37A 1LODA 2JDAA 3J81k 2QQKA 3AFKA 4B44A 2IXIA 5FMCA 2RS11 5CYYA 3V7AA 3ZPNA 1E5HA 3W2FA 1YQCA 2WPME 1I1EA 3VD4A 2HWC1 4CDXA 1EY2A 4G6IA 4K7JA 4ISHL 4RA0A 5A6QA 4DUVA 1Z78A 2GPJA 1UU4A 3V0BA 4D69A 1X9TA 5BYNA 3O12A 5DDJ3 3LE0A 1UYPA 1DDLA 2RC5A 3VBOB 4CUCA 4CU8A 5DZFA 1IPSA 4YZ1A 2W68A 3IN9A 2WPKE 4XZPA 5HZAA 3LPGA 1G86A 1AR82 4CEYA 3E6BA 2YC0A 1MRZA 1LHUA 1X9PA 3U11A 3ZYFA 1PGL1 1SCSA 4X05A 1TPGA 1DGWA 3BT2A 5IATA 2ZGMA 1WOOA 1SFNA 4TMTA 2XPJA 4LBVA 3P26A 4EROA 2JB8A 3W2EA 4UWDA 4FFHA 4BDWA 1UOBA 2JDZA 2JX9A 5FZBA 1IQJL 4CP0A 3GJAA 4AF7A 2ZZJA 2RR13 4G1MB 4OTJA 5F37A 4MG2A 3VD7A 3QH7A 4YGCA 2H0BA 1HV1A 1KK1A 1PO12 3TK6B 4CUFA 3ZC3A 4XIKA 5J98B 2HH9A 3G05A 2A6WA 1LTEA 4MXVA 1DQ5A 1WW4A 4AVBA 1DCSA 2B5HA 2C2WA 1B35A 2UWAA 1VBA1 1P0SL 1VBE1 2HWD3 4CCMA 4NCNA 4XONA 4MSVA 4UXAA 2RDSA 1RUOA 4C90A 1G9DA 4WM8C 4UOJA
chains in the Genus database with same CATH topology
2WPIE 3WT3A 1W7XL 3AB0A 3WZ1A 1SMVA 1WMFA 4IL7A 3FLRA 1ZBA3 1I6XA 2BUKA 5T3NA 1AVBA 1VAMA 1I3HA 2VOWA 1PZ7A 4QX5A 1ZBA1 4MMZB 4AVZA 1F9KA 1QDOA 3USSA 4X8VL 1TME2 1FX5A 1MZ5A 5JAXA 4AVCA 3NV1A 1TLEA 1Q43A 3SOQA 2VOVA 4HN1A 1IPJA 1W6QB 1GFF2 3B94A 5JPMB 1YIFA 4N53B 4XTMA 4ZXKA 2B39A 1X8MA 3NV2A 3WDXA 4G3YC 5KIRA 2JG8C 3VBFA 4K6BA 2ZMKA 3LOBA 3WG3A 1O5DL 3FE5A 3L9JT 4JCKA 4PJYA 3CP2A 2YGOA 2QUOA 1KS4A 3E5XA 3TYJA 1RB8G 3CEWA 1YI7A 4KBBA 4B4QA 3QACA 1OFNA 3QLQA 1P9JA 2GNMA 3THPA 3S7EA 4XXPA 1AR61 4AEKA 2D3RA 2BGCA 4XILA 4E0FA 1CN1A 2O8OA 2PLV2 4CDQB 1FAXL 1UZZA 3OAAA 4FPLA 3RMXA 4N9IA 1G1QA 1GQGA 4HPKA 1BZWA 5GZCA 4XIOA 2CGPA 1FX0A 3N8XA 1ENQA 2PAEA 3J8F2 4QPIC 1KRIA 2YY1A 2X29A 1SZBA 3JD72 4N43B 5AFEA 4FPFA 1COWA 4YG6A 4QQOA 1V9U2 1WA4A 1UCXA 4AI0A 4KH9A 5HKKA 4YVSA 2R32A 1NT0A 1YUDA 1LGCA 5BUVA 1UD4A 3LCPA 4BIFA 3F6UL 3HT2A 1DZQA 1ZBE3 4Z92B 4NOTA 2WNVA 5EJ3A 1CAWA 3ZFGB 1LR5A 1MZ6A 3MIBA 1N1YA 3BALA 5E8DA 1DYPA 1D0HA 3MIEA 4BTTA 1QJY2 1J3PA 1ZBE1 2ERFA 1KXGA 4C1XA 2UWCA 2D6NA 3ZXKA 4HFSA 2DURA 3V65B 3ZDSA 5HI0A 4KGGA 4M3CF 3KRKA 2CAVA 2Y80B 3IDCB 4YVWA 1PM7A 3OD0A 2OVUA 1H8TB 1ATDA 2RS12 2KV4A 3VBUA 2BVBA 4P9JA 3POYA 1IQGL 1GZWB 3V0AB 4BIOA 1A3KA 4TYSA 5GALA 1UW8A 2VW1A 3GISX 1H0BA 2A7AA 2C0ZA 2GNTA 1YIPA 4II3A 4BYYA 5L30L 1JYCA 1WW7A 1VB4A 4OUMA 5KC5A 5CVRA 3DPRA 4B7KA 4XQDA 5ABJA 1GV9A 1WBFA 2HWC2 5I0SA 1XXNA 1K5MC 3WCSA 3GBWA 2QZ3A 2RS53 4MV2A 5CFCA 4E9KA 1UX6A 4RQPC 4OI1A 3VBSB 2FZ1A 1NA1B 2P3JA 3B69A 4FPJA 3A3BA 2HJIA 2R0FA 2RS51 1CCVA 2BOXA 1H2MA 4YFWA 4LA3A 4JTOA 2OUHA 4RS5B 4LHNA 5CA6A 1DZTA 2ZX1A 3KGLA 3U07A 2DFCA 1ULGA 4KU7A 2VVVL 1SLLA 1OLRA 4WVMA 4B7EA 1MQ6L 1OOPC 2R063 2WJVA 5DDJ2 2KXLA 3NAPA 1XNCA 3MI8A 1RJ8A 2Z79A 4IEXA 3K9XA 2XLFA 2FMDA 2PAKA 1FF7A 2R061 2EXIA 1QMJA 2ZXHA 5EGMB 1C3HA 5BNOA 1ZREA 2Y5GL 3RZZA 1RUC2 4GIQA 1LB2A 3DL3A 3AXDA 3RDIA 1X33A 4PDWA 4M0NA 4OI0A 3D5OA 4HZFA 1V00A 3LKJA 4FOVA 3S7IA 4WV8A 2UWBA 5J3UA 2C9AA 1BQPA 4CEWC 2J38B 5FQ0A 2ENRA 1Z6EL 5L2ZL 4COVA 1PGL2 2P94L 3ZSJA 4JYVL 4LNVA 3SOBB 3U10A 2BOUA 1JOJA 1V3XB 2JKHL 5K0UC 1MZFA 3IPVA 3VDDB 2XZLA 4GXLA 4XW3A 2XJQA 3QH0A 4GWMA 3WOGA 4J6GA 2R1BA 2JG9B 4PF5A 3MFCA 4B4PA 2P3TA 1RVF2 1D4M2 1JL9A 1E79A 1RHI3 1WD3A 3HO4A 2QVSB 2XJTA 1JHNA 1H4HA 4GA9A 1X50A 4Q0PA 1O3QA 1XKAL 4BTUA 4C0BA 3JQWA 3JU4A 4NWWA 4M11A 1RHI1 2B8MA 4A7IA 3AMHA 1DF0A 2IXLA 2BNOA 4FQZA 2RR12 3RJRA 2CYFA 2PHLA 4WM8C 4QQHA 1W8BL 3FBYA 1AR83 2E6VA 3I2DA 4YM1A 4Z07A 1UKRA 2DDUA 1FPN1 3VBRB 2PUQL 4YZ2A 3JUUA 2ZGSA 1QJX1 2EA7A 1AYN2 1AR81 4WM7C 1BXHA 1LOEA 1PVC1 4YT6L 1WP6A 1FATA 1HIXA 2Y0IA 5BXXA 4ES8A 2UWOB 4R9CA 2P26A 1PIV2 5F1AA 4XLHA 3M3IA 2GMEA 2RS32 4P14A 1GYKA 3VBOC 3ZSEA 3I7DA 1MS8A 1QKQA 1BBT3 3LA3A 2I9BA 1W9XA 4BTIA 5T5JA 3WP6A 4MLOA 1Q8VA 1X82A 1RUH3 3IIAA 3IMNA 1LULA 3JBG2 2ZGLA 1DBNA 1RL3A 4P22A 3AMQA 3UKVA 2HWD2 1XE8A 3ME2A 5GKAC 3N4MA 6COXA 4QXKA 2HYKA 1RUH1 3R4DB 2Z69A 4MVTA 4M0HA 1LRHA 4X8PA 1LHWA 1LJ7A 2UY9A 2BOHA 5BNNC 1SLTA 2AREA 4XKWA 1UD8A 2WA3A 1QWRA 1AL23 1KJLA 2HKXA 3I54A 3U7UG 3H1YA 1A6CA 1BPLA 2XVGA 3FKSA 1EAH3 1ZZ7A 4I3GA 4XF3A 3VHPA 2ILMA 5GZGA 1EGFA 4XPVA 2R9VA 1N3PA 2X5IA 5DG2A 1FE2A 1ZA4A 4Q8LA 4Y7AB 4Q4W3 1NOVA 5FLJA 1AR93 4AQSA 1S0EA 1ZBA2 2VXRA 1EAH1 2XL7A 2BZ6L 3OY8B 1SLCA 4QGNA 3CP8A 3ZO0B 1H9PA 2GH8A 2X6XA 3ATGA 3QMOA 1AR91 1FT9A 1NLRA 3LSDA 3AP5A 1CAVA 2D1JB 3MYXA 4HETA 4KL1A 3ILNA 4L9BA 1Z7S3 3DKWA 2VWLL 2ZZFA 1LU2A 1C8M3 2IXJA 5IK7A 4C16A 4AQ6A 1N3OA 3A35A 1QH6A 1IQLL 1H4GA 3BCWA 5J48A 1M06G 1Z7S1 3ZYIB 3H1MA 1ZRCA 1WW5A 1R083 2R30A 4XFHA 1C8M1 1MABA 1PKVA 1C8NA 3NTBA 1Q4GA 3KMHA 3ZFFA 4AF9A 4AFBA 5FOBB 3JCIA 1NPEB 3WVJA 3VN4A 1V6NA 2TGFA 2JDIA 1MS0A 3ELAL 1GANA 3FMGA 4RD7A 2PA7A 2A75A 4FVVA 5FLIA 5GLWA 2GSYA 5CFDB 1QQP2 4ORFA 1DG6A 5FL7A 3OJBA 4MYEA 4A94C 1MQTA 1W6OA 4XQWA 3HQXA 1I8DA 2UWLB 1QXPA 4EN9B 5BV6A 4FCAA 2BEOA 5D8AB 2HWB3 2YZ4A 2JICA 4Y20A 1TNRA 2X6WA 3NJZA 3KQEL 1LKNA 2FZZL 2ARBA 2WPHE 4FXUA 4UZUA 1SQ4A 1HRFA 2GMPA 3MDPA 1CGPA 2P3KA 3ALQA 4IV3B 1JUHA 4Z1VA 5JVYA 2H6CA 1IOEL 4YG3A 1L3JA 1EBVA 4DY5A 1KD7A 1YI9A 1U0AA 1Y7BA 1UIJA 4EN7B 1ZBE2 1RUF3 1TE1B 3RG0A 1WLCA 3FHIB 4FPCA 4EJRA 5F6LB 4JGYC 1Q5OA 3ZFEC 4CDWB 2K2SA 3URFA 2J94B 4DRVA 2IC1A 1RUF1 2W86A 3MF6A 4AQTA 4I02A 2X6YA 4AI8A 1EMOA 1ND2A 2ZS6B 4HK9A 4Q2FA 1ALYA 1S0JA 1CESA 2DFBA 1E1QA 1G9BA 1VIWB 2KNIA 3VKOA 1F5JA 1IP0A 5T54A 3ZSLA 2ZZEA 3MQEA 2TBVA 1BF9A 2PLV3 1IQML 3EGFA 4R8HA 3OEHA 1UZJA 2A3YA 2GU9A 4E2GA 3QD6A 4GQ7A 4K21A 4DPNA 4I01A 4Q8KA 3RQ0A 4BDXA 2WT2A 3RS6A 1WW6A 5LRRA 2VOKA 2ZACA 1WCDJ 2PLV1 5JB9E 3CL1A 4FPHA 4QGMA 2XJSA 4OI4A 4YZ5A 2CWMA 1ASJ3 3RNSA 3ZIWA 1HKDA 2WPLE 1BEV3 3Q3KB 2BVVA 2IWGB 4N53C 3J8F1 4PLOA 1LPKA 1DGRA 1JN2P 3OYWA 2YXSA 1HQLA 1IGOA 2C1FA 5IKVA 4D90A 4Y71B 1WHFA 1V9U1 4JMQA 2ZGRA 1NFUB 2Z5WA 5D1IA 1UD3A 2DVDA 1LPGA 1PO22 3WNXA 1ONAA 4FQ4A 3FFQA 2VWOL 4XL1A 2A73B 5GZDA 2P93L 4OVEA 4YFZA 1IOXA 5FCCA 2XJVA 4UBGA 4M10A 1ND3B 2F6BA 3CA7A 4IV1A 3OEEA 3TAYA 3M3QA 1QJY1 1SBEA 4Y5Z0 4CDQC 1I0UA 4Y1XA 3USUB 2P3IA 4ZH8B 4AEDA 2MGPA 3HS6A 2D93A 4Q4V3 3MIHA 4BOWA 4CP2A 3N8VA 1I5ZA 1G2LB 4N43C 3M1HA 1AUTL 1OSGA 4Y1YA 4II2A 1DQ6A 4Q4V1 3ES4A 3G7DA 5JI7A 1K37A 3LOIA 5JLVA 3NL1A 2WT1A 4ISRA 4LO8A 3VZMA 1Y3TA 3V64C 3GHMA 5CB7A 3AP9A 2PHXA 1KFXL 4AXOA 4YW5A 1LQDA 4AHZA 1CD3G 1NE4A 4E2SA 4QPGB 4M3CE 3WQ1A 3GQBA 3U4XA 4NWVA 4XKVA 4Q0VA 4XFAA 2Z2SB 4YZ3A 1N3QA 4AVTA 2WFPA 4CYDA 1DQBA 2ZA9A 4HMZA 3WG4A 2BMGA 1H1MA 4B3FX 2ZXIA 1NQJA 1H8EA 1FAKL 2WNUB 5DUUA 4CDUA 4COYA 2PHWA 2RHPA 3DF0A 2K9ZA 2MEV2 1W6PB 3N36A 4XHXA 1YWKA 3AXEA 3NVCA 2W08A 3ZXEA 1HRI2 1H8TC 4J1WA 2OA2A 2H9EL 2ZGKA 3FLPA <