2WZPP

Structures of lactococcal phage p2 baseplate shed light on a novel mechanism of host attachment and activation in siphoviridae
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
298
structure length
298
Chain Sequence
GVRQYKIHTNLDGTDDKVWDVTNGKVRFYQPSNLGLQSTNNIWQSNGIGVMGTRSITQPQIEFKLETFGESLEENYQLMKDFVNDILSKKFVTLEYQTEIFQVYADLALADVTKTEGYGKNGTFSEKITFDIITKWYTYENLTFDKIQNGKVIAGMSKIYGGTAPGNYKYIKGTSYTYYGESDIDRLSRWDIKEEIFSFMGILYPKLPKTPAGVRFLDDIGNEYTAIVFKTEQVQDYILINTDVNDETYQGWKGTTALNLFPVMDFERYRTRIIEKGQMELINLSKAEFKIKRKADFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Lactococcal Phage P2 Baseplate and its Mechanism of Activation.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Viral protein
molecule keywords PUTATIVE RECEPTOR BINDING PROTEIN
total genus 65
structure length 298
sequence length 298
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.60 Mainly Beta Ribbon Laminin Laminin 2wzpP04
2.40.30.210 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 2wzpP01
2.60.120.880 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wzpP03
2X53S 2WZPP
chains in the Genus database with same CATH superfamily
2WWJA 1FMD1 1HRV1 2KM2A 4MHUA 2O8QA 1WOSA 4Z2AA 2GPJA 4DQKA 2D6OX 2C2WA 1ND2C 2H6CA 2JG9B 1CESA 4X7DA 2XWJB 3CJIA 1P8JA 1L7RA 2EIEA 3LAGA 5IYRA 3IKWA 1IOAA 2F4LA 2VO5A 3O12A 4PQQA 2CJIB 3ES4A 3U4SA 4QQLA 1EPGA 1GR3A 4UF0A 4CCMA 4CEYA 4YVSA 3LNNA 1TLLA 1GP5A 2PHLA 2RM22 2KL7A 2XKPA 3ZUGA 1HRV2 4Y7AB 2YWHA 1LJ7A 1B09A 1REDA 2QUOA 1ULFA 3H5CB 1YJKA 2BVBA 2X5IB 3PDQA 1TMF1 2HWE3 4LO4B 2NLRA 1H2NA 2PAEA 2GNBA 2CL2A 4O9EA 2JJ1A 3HEIA 1GKBA 4YRDA 3MUY1 5KN5C 2I07B 3ABZA 1N07A 3DPRC 2FDIA 1F35A 3OEAA 2L9LA 1JZ8A 1N1VA 2R072 2BVVA 2FVGA 1NKGA 5JMCA 2XXZA 4ZONA 2HBUA 1YFWA 4BK4A 2WPLE 3ZIWA 2W1WA 1BLZA 1S0JA 2GC0A 2LTNA 4ZCMA 3MFAA 4S2HA 2WPHE 3PUAA 4WM7A 1CPMA 3HN1A 5JXHA 4D7SA 3SH5A 1PX3A 2JB4A 2B39A 4FOQA 4CU8A 3T53B 4AZZA 1NRKA 1K5JA 4CP9B 5IVYA 2QE3A 3POWA 3D6EA 5A7QA 1K36A 2PHRA 3U4XA 4OQ8A 4IUGA 2WQ4A 4MGKE 2YY1A 3RDIA 1WGPA 4BJ0A 4GQ7A 1GR1A 5KHJA 2RM23 2YBKA 3GJBA 2ZXHA 3PIJA 1Q86D 3AVXA 1HN0A 3NAPB 2WNUC 4JTOA 3GCWE 5EQUA 2XVGA 5FLJA 5T5JA 2E6VA 1VBA2 3L9JT 1ATAA 1AXYA 4BHPA 3WF1A 2WBKA 5T50A 1CVUA 4G1VA 1FJSL 1OSGA 3Q3AA 1OVSA 3GF6A 3TN91 2J1SA 4FPHA 3HNYM 2WT1A 4IV3C 4GU3A 4Z1MA 5C70A 3SITA 2OUJA 2G9FA 4IGOA 4CPBA 5C5UA 4CEWC 2EFGA 1VJ2A 2AUYA 3GQBA 3AYCA 1LPGA 1VQ7B 1K5MA 1LOGA 5BNOA 3HPNA 3PVBB 1N0VC 4YNIA 3P1IA 2R6HA 1EUTA 5IVFA 5KWRA 2GJKA 4HBNA 5FZ9A 3LTFB 4QX7A 2VBSA 4ISHL 1IQEL 1SQ4A 1X8MA 4XUTA 5HCBA 5CFCC 4FPGA 3VGIA 2WPIE 2PIAA 3CIHA 4ASLA 1UW8A 5FZMA 3AYDA 3GVKA 4G6IA 3J4UH 2ARCA 3PJYA 4XXAA 2PHUA 1OFNA 4UWDA 4LORA 3ECQA 2Q6IA 5CKNA 1FX0A 3OUHA 3VLBB 1CVWL 1OOPA 5F32A 3P5BL 3WW3A 2GSYA 4BQ4A 5JOWA 3WNPA 3KQCL 3KHBA 2RS11 1OQDA 3DYOA 3I7DA 4ATEA 4Y9UA 1DVAL 2VBDA 4BXSV 3ES9A 1EWYA 3MV11 2VXRA 2X5IA 2GC3A 3I54A 5CDFA 4OHXA 3I97A 3LPFA 4QPGB 3H8OA 1SLLA 1JZ2A 2WA4A 2QCSB 3LAQA 1W9TA 3P3PA 3FLPA 1BQEA 5FZKA 4A7ZA 5BNNA 4C8DA 3E1F1 3WXMA 1C8NA 5DSZA 5E6TA 5F3EA 1WU8A 1TUIA 3N8ZA 1R5OA 4Z0KB 1S0GA 1Y7BA 1LENA 3E6CC 2YXSA 5HCHA 1RUD1 3CMAB 2PHFA 3BIEA 3MBWA 3HQUA 5JB9E 2FCUA 1M06G 3NW4A 2MGPA 1Y3TA 5LA1A 4BCUA 1W0JA 4K3UA 3NT1A 4L99A 4Q0VA 5F37A 1UN1A 1V70A 4HSLA 4CDWC 4N53A 1AXZA 4NRMA 4CP9A 2WIIB 3C9AC 1UD3A 3CXCB 1W2OA 2VBBA 2NZ9A 3M3IA 4YG3A 5F6LB 1CQ9A 4QPIB 1UYXA 4FFIA 5LRRA 1T6YA 4DXRA 1QJZA 2YB7A 1UIJA 2OA2A 5DMYA 1IGXA 1ZREA 3WG1A 1UKRA 4B8EA 4IE6A 1YUFA 2ATFA 2P3FL 4GH4B 4XL1A 5LRSA 2KV4A 1NLQA 1DX5I 4TN1A 1DGRN 2WABA 2Y7ZB 3F2ZA 2MGRA 3KHCA 2CGNA 4WZEA 3T3YA 4Q4Y1 3TH3L 3FBYA 2CNDA 3RMXA 3IIIA 3ZX7A 3LEGA 5J7MA 4HMZA 2WPDA 4LBZA 4B29A 1OI6A 1YQCA 1B23P 2HWD1 3FFZA 2P16L 4HKLA 4LO5B 3WT3A 2A6ZA 1FMD2 1W9WA 1K5MB 4XBLA 5BNOB 3C7GA 3P5BA 1PGL2 2VJIA 1VIWB 3I8TA 3KRKA 1J9ZA 1G7SA 2OBTA 1UX7A 1ZX5A 2F4NA 2WRAA 2Y5FL 1SKQA 4AVSA 4A94C 4RL7A 4P6VF 3JD72 2IC1A 4WZCA 4X6RB 4X8PA 5DAQA 4YW7A 4GB33 3T08A 4OZXA 1BK0A 1GZTA 1W6MB 3HN3A 4IEYA 3ZFGB 1LNSA 4AOCA 1CIWA 1YWKA 4DRRA 2AYLA 1I6XA 2DIEA 1JXNA 1QF3A 2ZZJA 3M3QA 3TB0A 3KK6A 2ZL6A 3CCSB 1FPN1 1WW6A 2BT8A 2XONA 3HWJA 3I2KA 1DYOA 4YELA 1UOBA 1VLNA 4JHTA 2Q8EA 1BCXA 2W46A 1UXZA 5F3GA 1FF7A 3WNLA 5IKQA 1ZZ9A 2WFF3 4RQPC 5T55A 4FPEA 1BEV1 2XWBB 5FZHA 3C3VA 2W6IA 3NNJA 4KNCA 4PDWB 5ANQA 2PYTA 4YT6L 2WR8A 2DU1A 1GLHA 2D44A 3FHQA 3N8WB 1IJFA 1BJQA 1WW5A 4XJWA 4XW3A 4RA0A 2P3FN 1NA1B 1RJ7A 4Q2FA 4LBLA 1TMF3 3OSDA 2WL1A 4JGZB 4QPYA 3RYKA 4JZDL 3MIDA 3NVCA 4NROA 4PC1A 1LOFC 4Z0LA 1DGRA 1E63A 4AK3A 1Q5OA 3TRSB 3GIRA 1C1LA 1W03A 3C7FA 3OBTA 3QFCA 4XLHA 2A5ZA 4LTAA 3SISA 4AC9A 1YITB 4J1WA 3V0AB 3Q8FA 1I1EA 3GSIA 4HANA 2JD9A 2YDEA 5L46A 5BSYA 3QH7A 4GXLA 1I7PA 4DK1A 3NMBA 3VKOA 1KSNB 3E20A 5EMNA 1CAUB 1HRV3 1EPHA 2P3JA 3D82A 4TLGA 1UF2C 2VCMA 4QGMA 2J1RA 3HO5A 3EO6A 3OZUA 3KF3A 3WNBA 4I02A 5EXOA 3TN92 5JSPA 4JZEL 4MHRA 1D4VB 4Y76B 3VHPA 4CDQA 3HJRA 1CAWA 1S4CA 3VL9A 2XHKA 5EV7A 2BDRA 3ZXDA 3VBSC 4W8JA 3CC4B 3U75A 2JJ6A 3WW2A 5GZCA 3IDBB 1HX2A 3GNEA 5JPMB 1EPIA 1MR5A 1W2UA 4BU2A 1O4YA 1NDHA 4P25A 3S7EA 4HE6A 4P26A 2UURA 1DDLA 3N35A 2Q6LA 1TLEA 3POIA 5FJHA 4E4ZA 4A42A 4H9GA 4TSVA 2HWD2 4XMAA 2OVUA 1WU1B 4MMYB 4KKSA 3CD6B 2BJSA 2CDOA 2R0HA 4I30A 3LQEA 1ASJ1 2VR4A 4KG8A 1JYCA 2WO7A 5H9PA 3VBFB 3AXEA 4OOXA 1EY2A 5IKTA 3CRZA 1RXFA 2OUHA 3EJKA 2YPJA 4HKOA 1FE2A 1W9YA 3ZXFA 1N3QA 4CRQA 2PELA 4LNVA 3FWEA 3ZPNA 5JIAA 4TSFA 4DIQA 1I0UA 3A3BA 4WM8B 1HCGB 5JVYA 1GAWA 4WVMA 4A45A 5FMDA 1W8UA 3EGFA 5A7WB 1IHMA 3VR6A 3WQ0A 4R9DA 2VGDA 3T51B 3I2JA 2CBXA 2DFCA 1XYNA 2VZRA 1IVOC 4MGYE 2DVDA 4Q0SA 1MEC2 4E27A 3LIGA 5A3UA 1W04A 2D6KA 3GVJA 3V64A 1S0UA 3IBMA 2ZGLA 2CDPA 4C90A 3WF0A 1JYIA 4O9GA 2MHPA 1BEV2 2XBVL 2IXLA 4IEQA 2H6BA 2JDMA 3MMPA 1S2BA 1AR63 4YAUA 1W99A 2JE8A 2VZ1A 2Y34A 2ZHNA 2VVUL 3AMNA 3BU7A 3CJIB 2I45A 2EXHA 3VBOC 3M8LA 4AFCA 5A6QA 2B9VA 3V0BB 2JG8A 3IN9A 5FYCA 5A1FA 1GUIA 4NVPA 1FNYA 1UD1A 4XDQA 4Y24A 1IQLL 5F4OA 4YT7L 1GMMA 5FZIA 2DU0A 2VWMK 2ZMLA 1Q3EA 1JHJA 3EHKA 3H3ZA 3MYXA 5FO9B 1VALA 1OB5A 1RIRA 5JR2A 4SBVA 2J1UA 4CEYC 2VZOA 3CB4A 2Q6KA 1BHGA 5KW9A 1HV0A 1FPN3 4L9BA 4E0FA 1J1TA 1KK2A 2ZITA 1NYWA 1RL3A 1BVP1 3ILRA 5DUVA 5HCFA 1VQOB 2WSUA 2VH6B 2Y33A 2YGQA 1U67A 2WNVA 3AB0A 4CCOA 4Q8KA 1PJ5A 3POEA 3KVBA 1TEIA 2YBPA 3AJZA 3INAA 3VZNA 4ISRA 1KLIL 1KJZA 1KKEA 2DUPA 1LOCA 4CDQB 4RD0A 1DQ2A 4Q0PA 2OYNA 1E57A 4ZXXL 4HL0A 5H9SA 5FV3A 2ERFA 2R9VA 1W6QA 2PA7A 4RYDA 3USSA 2W39A 2WS91 3KCCA 2DYIA 4O7XA 5F39A 3JQQA 1XSQA 3MUZ1 2VUAA 5IYYA 4G5GA 1W6PA 1OKOA 2G9ZA 4ZU7A 5CG8A 5CBLA 3OEBA 3AK0A 1O3SA 1Q8QA 4MYEA 4P9WA 4IERA 2AEYA 4UFIA 2C6SA 2BOKL 1GV9A 4Q4Y3 5J98B 2ILMA 4EJRA 2Y7XB 3J81k 1STMA 4B3NA 1V6MA 3OD4A 4H7LA 1QHDA 3K75B 2YWGA 1CN1A 2HEWF 1FRQA 3B3QE 1WTHD 1AVBA 1EP0A 3KSCA 2Y26A 1V6IA 1Z0HA 2MHFA 3WZ1A 1EFUA 5JR7B 1W0PA 1WD3A 2ZZFA 5T5OA 1R083 4FXUA 4WZTA 4M3CA 5T52A 3ZYRA 2E33A 5IYWA 3CCUB 1QKQA 1QQP2 2VQTA 5H5JA 5FMCA 5I0UA 4B1LA 2VVEA 1NFWB 4U9UA 1KC8D 1DGWX 3NNGA 2X09A 3T2PA 2X53S 1UMZA 1Z7S1 1FAXL 3D4KA 3URFA 3ONUA 1W9FA 3HOBA 2RC5A 4QHYA 2C1FA 3WINE 1X7AL 2VOKA 4LE3A 1W0NA 4QXKA 4YGEA 1PNFA 1UZKA 4CCLA 1U8CB 1O3TA 3O1UA 2WO1A 2ZHKA 2LALA 3KCYA 5IAXA 4CCJA 2GMPA 4AI0A 3T2TA 2YGLA 1A3KA 4QQPA 2EA7A 1Y9GA 3B9CA 1RYYA 1FNMA 1JOBA 2IXKA 5LBEA 2D3RA 1GOGA 3OUJA 5CA6A 1UKGA 4PJYA 1W87A 1SFNA 4INDA 3PENA 1US3A 2W95A 5BXXA 1G7RA 1DFQA 2H0BA 1CONA 2W08A 2WSVA 2C0ZA 3H1WA 4EH1A 1BK1A 1H8TB 1HDKA 1WW7A 1QJY3 2VAUA 4OHYA 3BQJA 4QT6A 5JDBA 4FPOB 4NWWA 1GVHA 5T3NA 1XKAL 3LVBA 5FMBA 4AE2A 1A8PA 2FQPA 2PUQL 4CDUB 1H8HA 1KS5A 1YUGA 3J8F3 5JOYA 1H1AA 2JJLA 3UYJA 2W6JA 4X8UL 2UWOB 2CK3A 5DG1A 4FTSA 1VQ5B 5DPNA 2GDFA 5L9VA 3K3OA 1G6NA 4BDWA 5HXBA 3ILFA 5F8PA 2VCAA 1W9XA 1WDTA 3HR9A 3JQXA 5BNPA 1VBA3 2V7WA 2DUOA 2K9ZA 2XOKA 1FI2A 1QNWA 3HNMA 2PR3B 2J4IB 2WYGB 2NMOA 4YZ5A 2LS6A 4EV0A 4N53B 5A3NA 4XAAA 5KR7A 4MMZB 1XE0A 4NJ4A 3MPPG 2XJSA 5L9RA 3AZYA 5FOBB 3SW2A 2JECA 4EN0A 2KD7A 1XBFA 3ZIAA 2RMU2 5FZ7A 4CDWA 4XETA 3W5VA 4COUA 2R32A 2HBTA 1OFSA 4R52A 4N90A 1ULOA 4LLFA 4XEZA 1QG0A 3HVDA 3V65A 5M0TA 1I5ZA 4GH4A 2QQIA 1COV2 2OKXA 1X50A 1ZM9A 1CQEA 3BOWA 1LOBA 4OPOA 1VQ6B 5ISLA 4PCRA 1HT8A 2GJRA 1FNCA 3JU4A 1LQDA 2GN7A 1QY4A 2DURA 3R4SA 3OPWA 1F7EA 1CIYA 4RGKA 3M3EA 4K20A 4AEDC 1SEFA 4GULA 3W58A 2XBO2 1EMNA 2XNDA 3S0MA 2ZGQA 3PGHA 1QUEA 2GK6A 5CZKA 4LUMA 5FK7A 1YYNA 4AEKA 1ST8A 1ZM2A 1N8RD 1VF7A 5FZAA 2BOHA 2J94B 1O8PA 3KV5A 3VDDB 1M1KD 3ZSLA 4AVVA 2R061 4AWDA 4TN7A 4DRVA 2XBO3 4YW5A 4CSYA 3WD5A 4G4FA 1WMEA 2OXBA 3WY9A 1LEDA 2VMIA 4BXFA 1NCRB 3RZHA 1ND3C 4IW3A 2NQYA 4CDXC 4PBOA 2HWE1 2WKKA 4HFSA 3FZ3A 1GSLA 3OFNA 4RS5C 1W06A 1S0EA 4XOGA 5IVBA 1PO12 4QM8A 3BT2A 4J0QA 1V00A 3PURA 2WPME 4XM3A 3DF0A 3O0WA 2FZ1A 1PM7A 4QKBA 5FIXA 3UESA 1RUOA 3GISX 4M53A 4GWJA 4K6BA 2ZZQA 1Q8SA 2CWSA 5DDJ1 3O1SA 2C9KA 2D1JB 3J9SA 3D8CA 3W5HA 3WDTA 3K77A 1SDDB 2J1EA 4IDZA 4YZ1A 4TT3A 1L3YA 3KWVA 4AEDB 4ROXA 1RJ8A 2MEV3 3RWNA 3O1OA 2VBTA 4GMP3 2HJIA 4CEWA 4QUZA 4MZUA 1HVXA 2DCYA 1GFF2 4D0QA 4K8FA 4P9YA 1KFXL 3KF5A 4XFAA 4EWAA 3WNNA 5FYBA 3ASIA 4HK9A 3G6JB 4UXAA 4UFMA 4XKWA 5FR3A 1XSRA 1FT9A 1IQFL 2NM1A 4MOAA 2DTYA 5BNPB 3TNQA 3S30A 1J83A 1RUE2 3ZLIA 1HRI3 5K0UA 1PIV1 1V6NA 2Y0IA 4KBBA 1DLLA 2W3JA 2C26A 3PU3A 1NAEA 2Z2SB 3SKVA 4RDKA 2YC4A 1OB1C 3TAYA 5A1LA 4KKTA 3I2IA 1XNKA 2WPKE 3WBJA 1A78A 4Q1PA 2VZPA 1QJY2 4P00B 2JN9A 3OBRA 2BM0A 3A22A 1W9SA 3LFMA 1ULPA 4OHVA 5HPOA 1R093 4YW6A 3MLKA 1ATBA 1QFJA 1AYM1 1M4WA 3TBDA 5H59A 2WQZC 1NFYB 1CD3G 1HB4A 4Z1VA 1NZCA 5B2GB 4Z92B 1QUFA 3GXUA 5DAVA 4C16A 2XL7A 1U12A 2GNDA 4GWIA 4YEJA 2B7BA 1PZ7A 2A3WA 2PTMA 4NA9L 1H0BA 3B94A 1JYTA 1COV1 5CFDC 2Z69A 1FV3A 1CAXB 3GZAA 4OMDA 1RUG1 1UZQA 1QXJA 3VBSA 3WG4A 3AP6A 3J7NA 4AVBA 5LK7B 1UY4A 4FOYA 1IQIL 3FUQA 5A32A 1FX5A 1OGJA 3HT2A 2JEMA 4I0AA 2XZOA 4P9XA 2NV4A 1WP6A 4CPBD 2HWF2 1TPGA 4JX0A 5FY7A 4H14A 4FXGB 3WYAA 3EMRA 4IEZA 4PLNA 2CHHA 1VHEA 3A4UA 2UWAA 4X8TL 1C8M1 2R042 1ZM4A 3MPBA 3LD8A 4PLMA 5BNPC 4CTEA 5FWJA 3U11A 2D5HA 5A89A 2B9UA 2CSGA 3R0RA 3R6SA 1UZPA 1A34A 2BOJA 3ASTA 3VBRC 4DXSA 4NO4A 2V7UA 4XLCA 1YUDA 2DVGA 3ZR5A 5CVRA 4WBBA 3WX5A 1E3ZA 1QFZA 1EAH3 1GQPA 1SMVA 2HWB3 2QTWB 2D3LA 2Y0OA 5A6XA 4JZRA 1UD2A 3N7MA 2JDNA 4AAXA 1JZ4A 2QTLA 1LHWA 2UYBA 3OCPA 2IFWA 5JXGA 5KXCA 3KMHA 4XXPA 2CV6A 5DAXA 1KRIA 2ET1A 4UAPA 5HV0A 2M74A 2WS92 4X7EA 4AQ2A 5HBAA 2UWPB 4MUVA 3AZZA 2ZHMA 3DCQA 4Q4W2 3WQZA 1BLIA 2AHOA 3AVTA 1UOGA 3N7LA 4M4PA 4XAEA 1H9PA 1OQ1A 2GU9A 3I4IA 4Q0QA 5CFCA 5I8TA 4IEWA 5EFUA 1GU3A 2DBIA 3V0BA 1XDTR 4FN5A 2D6LX 2JG8B 1U2RA 2C4UA 1ND2B 1G9CA 1RVF1 2VQ0A 1O3RA 1TZOA 3MEPA 3SNMA 3ZYHA 3PTRB 2AACA 2GP3A 2XB6C 3FBMA 3JD71 4YLZA 4OHWA 1W6NA 1JZ7A 4IE0A 1U5XA 4Q4W1 1JYXA 4N7UA 1SFYA 2WJVA 1DGWA 3CZJA 1TG7A 4LHLA 3M2MA 1MPXA 3PUSA 4QX3A 3ZDVA 2YU2A 4COYA 4YARA 5FZFA 4YM3A 2RS12 5AC92 3LC5B 4BTIA 2WZR1 2RS52 4G3YC 3Q8EA 3AP9A 1AL22 2B4KA 1YLOA 4LA2A 3VZJA 4DY3A 4QX0A 4BLIA 1QQP1 2V4DA 4QQOA 3ZXLA 5KBFA 2XNCA 1H1MA 3WF3A 4N43C 1LGCA 2DDUA 4UBHA 4XUOA 2VZLA 1VQKB 4IE4A 4RHV2 4LOSA 3MLLA 2F1MA 1NPEB 3N8YA 3ONYA 2R073 2ZTGA 3B7MA 4HVOA 2P3IA 2MPFA 4C1WA 2K0GA 5FO0A 4XZUG 1NZIA 2BMGA 3MFCA 1FFMA 4BPZA 2OPWA 1S2KA 2HLEA 3NKTA 4OUEA 3AP5A 4GMP1 5C4WA 5FZEA 4Q26A 5L2YL 1MVEA 2HWE2 5A70A 1G9DA 1G9AA 4BQ1A 4EZ4A 1OA2A 2YUEA 3MF9A 1PM4A 2ORZA 1IQNL 1WBLA 1RUG2 3DGTA 3IITB 2BVNA 2RDSA 4XQDA 4D6RA 1JHNA 2QA4B 1GK5A 4UF0B 1VQMB 2H9EL 2WPJE 1PJ7A 4KWLA 2RDRA 3ZIXA 2P3YA 2XQRA 5L7OA 3N9NA 3G4SB 2BGCA 2BOIA 4QFMA 2WNUB 3SC7X 1Q8PA 2ZMNA 3VO2A 3AVVA 1SACA 1LPKA 3W5UA 3K4ZA 4I0BA 1T6GC 4KU7A 3NJVA 4DB5A 4ACAA 3LEKA 4O65A 2W52A 3ACLA 3LGRA 1ATDA 1J1LA 1FDRA 2VZTA 5IAVA 3KM5A 4OP7A 4XDOA 4HG6B 1PGW2 3WXPA 4C43A 4DPNA 3CF6E 1E5RA 1IOXA 1CQXA 1N1SA 1XE8A 5FP3A 2VTFA 1NFUB 1JOPA 5FZ4A 4YPJA 1QXRA 1U5ZA 2P3KA 1VBC3 3QH0A 3CCRB 2XG3A 2QBXA 5BPXA 3CDZB 3CMMA 1G8WA 2W1SA 4FP2A 3FL7A 3T2OA 5EIYB 4GKXA 4BLJA 2RG4A 5JOXA 1D4M3 2BNMA 2VNRA 3WSOA 1MQ5L 5CFCB 4K1XA 3U6KA 1JL9A 1PGW1 3SCHA 1W0KA 1ND2A 5ERLA 4MH0E 2Y81B 1D0GA 4F83A 1O5UA 4TZDA 1KD1D 1WCUA 2JX9A 1BVVA 4CE8A 2CF4A 3WV6A 2HWC2 3ZKUA 2W94A 1W6NB 4BQ2A 1ONAA 1V6KA 1QVFB 3TZIA 3AVUA 1NLRA 1IQHL 3H9AA 2XUEA 1IG0A 3I3QA 4EE2A 1GYKA 2WYSA 4YVWB 2BBAA 4EN9B 1O5DL 1N7DA 4FPCA 1X82A 4CDUA 5C5TA 4HPKB 5C71A 2B7YA 3H50A 2JE7A 4RFT0 4AHYA 2FLGA 3OPZA 5K9YA 4X8IA 5J3OA 1NG0A 3BTAA 4AAPA 4CU9A 1UY1A 4ZZ5A 2VNIA 1QFKL 1HRFA 2P3MA 3JQPA 2BNOA 4QQHA 5FQ0A 5IK5A 2RS51 1BYHA 1QEXA 3VMFA 3ZXEA 3AL5A 4CCNA 3N8YB 1O59A 4LITA 2HORA 1XFEA 2EIXA 1MS5A 4FPLA 2GJPA 4HSJA 5FKCA 2DUQA 1H2MA 2UY8A 1QXPA 1DCSA 3POBA 2RS53 4J6GA 3LF7A 4FK8A 1GZWB 4TGFA 3QLQA 2A70A 1PNGA 3THCA 3I55B 3M1HA 4KL1A 1IJEA 4Y1XA 1JBUL 1WMFA 2V7XA 1E1QA 1O4ZA 2XR4A 2TUNA 4M0NA 1DDIA 4CDWB 1YHQB 1KTVA 5DG2A 3VBUB 5LK5A 1RXGA 1FYUA 5C9AA 2ARXA 4W6YA 4IEXA 4A7YA 3NQHA 1EV12 2YG0A 3BGAA 2I9BA 3PA1A 1VAVA 3O5SA 2DCUA 3WHUA 3OJXA 3C7HA 1IG3A 1UU4A 1YEWA 3FKSA 2A71A 2WYJB 1Q4GA 3UL2A 4LKDA 1NJID 1VP6A 1WCSA 3HD8B 2QMUA 1YC61 3PVOA 5FCCA 2D6MA 3RJ2X 1WHEA 4BXSA 1XNDA 2WWUA 3ACGA 5IYPA 3VUOA 4XLEA 1SLCA 5FZ3A 1ZM1A 4QWNA 2Y5GL 4I2OA 1HX6A 5BUVA 1D4M1 3USUB 1R1A1 2P4EA 1CNEA 4IESA 3IPVB 4Q4V1 2IXJA 3BCWA 4V2WA 2XQXA 4NRPA 4R4ZA 1WCKA 2D74A 3CTAA 2WFPA 5JPNB 1N3PA 1VBC1 3AMPA 3KQEL 4XUQA 1RUE1 5K0HB 3CL1A 2K46A 2X29A 4D0EA 1NCRA 4MGSA 5FXVA 1VHOA 1QJU2 4I09A 3O1PA 3HPTA 4G7WA 2WO3A 3SCGA 3PUQA 3ZFGC 3N7JA 2FZZL 3U73A 1YJ9B 2R043 3AX4A 4O02B 3DUIA 5B4XA 3K4AA 4Q4V2 1VQ4B 4XFIA 1ULGA 1MRZA 3WQBA 1QGZA 2ZBJA 1G9FA 1IPKA 4XF4A 2W9XA 2C24A 4EN7B 3W2HA 4M2LA 5B6IA 1DU3D 1LGNA 3K46A 4IXLA 4RS5A 4H55A 4LULA 2X05A 5TY0A 5IK4A 4LHSA 1L5GB 3GCXA 4RQPB 5FZOB 5JVZA 1ZZ6A 2X6YA 4C1XA 2CW5A 5TSWA 5CEHA 1VB4A 1HV1A 1TVGA 1WLTA 1POV3 4LKEA 2Q1JB 4SLIA 4TWTA 2EI7B 4B7EA 3QACA 2VXJA 4UOJA 4Z82A 1F8VA 1S55A 1X9TA 4AI1A 2JIJA 3Q6QA 3DKQA 4IQPA 1VAMA 3ZMNA 4BXWA 2P6CA 3AP4A 2QQUA 4BZ4A 3CS7L 3ZVXA 5JBQA 4DFSA 2VMCA 5KHHA 3GCXE 4JGZC 1CZSA 1LULA 4YW1A 5F9TA 5TR9A 5JXIA 3ZSMA 1R092 4MGTA 2W3KB 1XYPA 3WNMA 1N1IA 4Y71B 4Z4VA 1OUXA 1W35A 2W5FA 3BCDA 5FY0A 3GGLA 3VD5A 3TK5B 1NY71 5FTTC 4HVQA 1VBD1 4FXKB 4JGYB 2QZ2A 1HRI2 3W2FA 2BT7A 4QKDA 3B01A 2ZEXA 3FLRA 3AVYA 1NX9A 4Y4RA 1JZ6A 4Q4X3 2Q8CA 4CCDA 1W8OA 2BP6A 1U0AA 1BF9A 1K45A 1MQTC 1UOJA 4RD4A 1I9RA 1OC1A 2ZZEA 5A7NA 5K8SA 1OPMA 1RVF3 2J1VA 4PDWA 5JI7A 3ZSJA 4AVTA 4NCNA 4NIAA 2XJTA 3VBSB 2DVBA 1E5SA 2QQJA 1UY0A 1K3IA 2QQPA 4N9IA 1REFA 5F19A 1ZBE2 2J7MA 2V4AA 1XNAA 1LKNA 5DZGA 2JKBA 4JKLA 4NG9L 3IDEA 3BNWA 4Z2WA 3ORJA 5C8WA 2JIZA 2BV3A 2VNKA 1XQNA 2RR11 2YV8A 4JCKA 3ZZ0A 1YJLA 4JKKA 4QXCA 4YW3A 5ACA3 1RQRA 3H8UA 1Z78A 3IMNA 5KIRA 4AL9A 2Z79A 3IB3A 3M3CA 4KWJA 4OULA 2R0FA 4XC9A 4YVSB 2HWB1 3RMYA 3RSJA 1KMHA 1O5LA 1ULDA 1ZZBA 1EP2B 3E6DA 4FTEA 5KNLA 1MS3A 2GC1A 2ZJCA 2OIIA 5FL7A 1APOA 1OPOA 2VJJA 2CU5A 1QGAA 1CAUA 2R6QA 2XEXA 2R49A 3M36L 1IS3A 2P93L 3KL9A 2F4PA 4ZGQB 4JQTA 2ZAAA 1KRHA 3FLTA 3H1YA 4XBNA 2D97A 2B7CA 2FDKA 3ACFA 3Q8AA 4RQPA 4OI1A 3W59A 2XKOA 3ZOIA 5JW1A 1VBB3 1AMOA 3T0DA 4PI0A 1PK6A 5I46L 6COXA 1EP1B 4RD2A 5C33A 1LHNA 4LUKA 4LQRA 5GV7A 4Y5TA 3U2QA 2C4XA 2WZR3 2V7QA 2VW2A 1LCLA 1YGCL 3Q7DA 2JKXA 2OPKA 2YGMA 4KI5M 4RR3C 1DLCA 4YWAA 3CJIC 3TNPB 2Q30A 4X8NA 2ZBUA 1COV3 1SG3A 4XPVA 4ASMB 5L36A 1VMJA 4X07A 1FXZA 3N8XA 1TQ5A 4CUBA 3ZZUA 3QBQA 4EWDA 3N7KA 3ZXJA 3GZEA 4UW6A 4Y9RA 3NAPA 4O1ZA 1XB9A 1UY3A 5BY5A 3HIFA 4B48A 4M3CF 1NQDA 1GWMA 4CP0A 2DBNA 3THDA 3SCFA 2Z5WA 4NAOA 1L3JA 4KBZA 1ZBA1 3ZN6A 2QTZA 5LBBA 3POYA 3VD4A 5J36A 3VHOA 2V09A 4R8HA 4XF0A 1NB9A 1OLRA 3TEYA 2EXJA 4QM9A 1N47A 4BQWA 1FSBA 4WV8A 1QDOA 2Q1FA 2EALA 3IIAA 4ZU4A 3GBGA 4QXHA 4KWUA 1IJQA 3NNLA 4RUTA 3FPKA 1JU4A 2J2UB 1IQGL 4QPWA 1PK6C 3WQ7A 2G9GA 3DYPA 3J8F2 3E5UA 4YAOA 4QXBA 5F5CA 3RY8A 1KIGL 2XJQA 4YZ4A 3BALA 1AR82 3VBOA 4TXWA 4QDQA 1XKBA 1W90A 4GJZA 4AYUA 2DVFA 4P9GA 1BJKA 4UYBA 2VNOA 2MEV1 1HIXA 1WOPA 2ID4A 1C8M3 1GAQA 3MF6A 5GZDA 4NHLA 4OYUA 3V76A 3CCVB 5DZEA 1VB2A 1AR92 1Z6CA 5FO1A 3KCGL 2E1RA 4XF3A 3ITQA 3ZR6A 1ATEA 4HETA 3IWZA 4CXYA 4BDXA 4RPBA 4CQJA 4NNJA 3FFGL 1N0UA 2BRTA 2LZJA 4ZCIA 5GV8A 1V0FA 2A6YA 3Q9OA 4JHZA 3RG0A 4XURA 1P9JA 1H42A 4GU4A 4Z4WA 1XU1A 1KJLA 1PMIA 2EIDA 2ENRA 1RUG3 2EXKA 3MIEA 4BTTA 3AMMA 2RC6A 3KT1A 5EYYA 1VAKA 3DPRB 1WKYA 3R4DB 3CNAA 3OF1A 4YW2A 1F0SB 2BYVE 4IV1A 2FLRL 2G00L 2AENA 2GALA 4LXLA 3A8KA 1AYM3 1F9KA 5IVVA 3ON7A 3CESA 3WP5A 4RHV3 1T5EA 3BODA 4GIQA 1MS9A 5IW0A 1EP3B 5G04L 3MQEA 1OD5A 1W6PB 4LE4A 5DZFA 2DCKA 4RDJA 1HB3A 3ZKYA 1VBD2 2Y6FA 1MEC1 2V72A 3KT7A 1F4HA 2YC2A 1NY72 3AL6A 2X6WA 5LA9A 2E31A 3ZYJB 4QPIA 4IGPA 2A6VA 2PMWB 3W2IA 1IGOA 1PIV3 1HRI1 3KV6A 5FPZA 3RFRA 3GDBA 1YIFA 4HN0A 3W2GA 4PAAA 3K9XA 4M11A 1Q8VA 3OG2A 4L2NA 4GWMA 3S5QA 3S57A 5C8CB 4YVWA 2Y82B 1OD3A 3AMQA 1K42A 2Q4SA 2QQVA 3PLQA 3VZMA 4HPKA 3SH4A 5A1AA 4EQVA 4NBSA 4C91A 2B5OA 1JB9A 1B35B 3CC7B 1ODMA 1W8NA 1ZAQA 2BZDA 1HLCA 5CKMA 4D7TA 4NIDA 2HYXA 2OTLB 2F43A 3QE2A 4X06A 2BO2A 2RNLA 2EAKA 4IV3B 2VH9A 1HZ8A 2WR9A 3BT1A 2PHDA 2O8OA 1LU2A 2BEOA 2P3TA 2PLV3 4GB32 3BPSE 4NN0A 4DK0A 4KMQA 2WZNA 1HQLA 4Y6DB 4UW4A 2FHRA 5CIRA 5DDJ3 3NV1A 3ZN4A 5IYQA 2DY1A 1HN1A 1VBA1 1UZZA 2JDKA 3AXDA 4LO6B 1RUC3 4XJ8A 4AF6A 3AZXA 5IVEA 1OA3A 2VW0A 5IVCA 1GZWA 2BUKA 4OHZA 4E2SA 1VBE3 2XC0L 4YGDA 4YYOA 2OYZA 1RFNB 2WFTA 2PLFA 1RUH2 1LR5A 1W6MA 2UYAA 3BYWA 5E88A 3BPZA 3N9OA 3RYPA 3J8F1 3NV2A 1E5IA 1PIV2 1RB8G 3HNBM 1COUA 4QD2A 4XHBA 3WDXA 4YZ2A 1JYVA 4UFKA 4LBKA 4ES8A 3HO4A 1SBFA 4IETA 3E97A 2YFZA 2DVAA 4I0WB 4AGGA 3RZJA 2JENA 3GALA 1KQRA 1NE6A 2R063 4DUXA 2RJLA 5F2SA 4UZEA 3KB5A 2IZWA 1QOOA 3ZFEC 1JYNA 1X7NA 1LGBA 3DEMA 1E1RA 1AR62 1P0SL 4QPGC 1QDCA 2J1AA 4IEPA 4L8QA 4GWNA 1NQJA 3CMGA 4PH9A 3I1FA 1MS1A 5HCAA 3WHTA 1G1SA 5ANNA 4N43A 5D8AC 3N8WA 3OEHA 1KS4A 3I3BA 3T4VA 5CADA 3I2OA 1EQHA 2WG3C 1NA1A 3DYMA 1G7YA 1UOFA 2VW1A 3J7HA 1D2EA 4DNTB 1ZA7A 2D93A 3B69A 1LRHA 4JGZA 4YAWA 1BPLA 4IL7A 1OH3A 3VDDC 3BC9A 3IDCB 2BFUS 2BW8A 2FCVA 4QHOA 3ILNA 5FYHA 3OYWB 4ZGNB 5IATA 3LB9A 3ZBUA 1BZWA 3HAGA 2QN6A 1D2QA 1Z7S3 3V0AA 3QCWA 4P22A 1RUI1 4RCZA 3LC3B 5LY1A 4QX1A 1WCDJ 1QOTA 2DEUA 2WYRA 1O7FA 4XJUA 4AQSA 4B4RA 2ZHLA 1K73D 5A33A 1ND3B 3AC0A 4QPIC 3ZC3A 2DCJA 3CEWA 1V1HA 2XJUA 5FY1A 1CR7A 5EPAA 2ARAA 4M4SA 2ZGOA 4RS5B 5GLZA 4RD7A 5JXJA 3B8HA 2Q1MA 1F5JA 4ZXYL 2WC2A 3MO4A 1Q82D 5FZOA 3APBA 4CUCA 4QB6A 1XQBA 2BERA 2ZEWA 4OUSA 1P4MA 2PMDA 1GNYA 2HDNB 1UXXX 4AEDA 4OVEA 2VWLL 1EAIC 5JBAE 1CAVA 1JODA 1LMJA 1C5HA 2Y64A 5IKVA 1C1FA 3A21A 1HA3A 1AJKA 1RHI1 1HZEA 3GZTB 5KHIA 1GP4A 4Q0UA 5GZFA 1NXMA 2DWRA 2EIGA 2VOXA 3X29B 1OF4A 3C7OA 3I2HA 1QJY1 3RS6A 3ZYPA 3U07A 4XMYA 1F20A 3I59B 4BQXA 4P1VA 4QKNA 3SMHA 1UYYA 2FLBL 1PMJX 3KV9A 3KQ4B 3POSA 3VBFA 3CPWB 2RDQA 5GZEA 2W2QE 1KJRA 1X33A 3K4DA 4JDNA 4P6YA 1TME1 2EVXA 2WLPA 2YYOA 4JGYA 1J59A 1OLME 4D90A 2AC1A 2JDIA 1UY2A 2QDRA 3JUUA 5JZGC 2YPDA 2W2IA 2YHJA 3ZPOA 2F1LA 1PVC3 1UMHA 2CTVA 4M4RA 2VL4A 4PGOA 2WZR2 2XUMA 4J25A 5CYYA 4ATFA 3LE0A 1FRNA 3N8VA 3LQ6A 1X8EA 2A3YA 1EZQB 1G1RA 1NBMA 1HXS2 4B47A 4UBGA 1D7PM 5D1IA 5FZDA 4ARXA 4FQ4A 1Y0RA 2UY9A 1YI9A 1MACA 1KK0A 4JTNA 3RZLA 1VMHA 1Y9MA 4UZUA 1JBCA 1F4AA 4RFRB 5A7OA 2VBPA 1R081 3ENSA 1SCSA 1RUD2 1Y4WA 4PC7A 1YI7A 2LUWA 2K2SA 2QNKA 4KQ7A 3H8RA 1W2BB 2WFF2 1OHHA 3CZUA 1OB0A 4FT8A 3S5AA 2D98A 4N8MA 4CU6A 2ZEZA 1A8MA 3ELNA 4B4QA 4Y33A 3OYWA 4JYUL 5G05L 1EPJA 1YHFA 1C28A 1WBFA 3ASRA 3OEEA 1WMXA 4JVAA 1W6OA 4Z4YA 4FPJA 4MADA 1WCQA 3EYPA 3NJYA 5LZ6A 1EV11 2LW8A 3F1SB 2OZ6A 5C3RA 4M1KA 1AYN3 5IVJA 2P2KA 2SBAA 4QVAA 3DDYA 3VV1A 5JSRA 3A23A 3BCFA 4Z4SA 1VRH2 1ZRIA 1LB2A 1MZEA 2WNVB 5DAPA 1DARA 5GM0A 3VKLA 2VG9A 1YJWB 5FMOL 4PABA 4RS0A 2OTJB 4QGLA 1JYWA 4YALA 3ZYFA 4E2GA 1JOJA 2DF7A 1SBDA 3RQ0A 1LAJA 3FPPA 4CUFA 1R1A2 1PX4A 1US2A 2RE9A 1W6QB 3OBAA 1HB1A 1FNZA 1YXWA 3RYRA 4BA6A 4H2AA 5I0RA 1CAVB 2DYCA 3JQWA 2C77A 1CAXA 1QWRA 1LOFA 2WAAA 3MW3A 4XF1A 1VRH1 3UETA 4Y26A 3N4MA 3R6JA 3VZLA 4EN6B 2VNVA 3O0XA 1WOOA 4Q5OA 4LBMA 4AQ6A 1H8VA 3GHNA 1ZA4A 4L0PA 4WZFA 5FP8A 3HS6A 4W6WA 5FP4A 3GBFA 2YZ4A 4HE5A 2VUDA 3I59A 1URKA 2J34B 2Q1ZB 2VCBA 4ZS3A 5JCTA 1LODA 1W8FA 1FV2A 1UAIA 4G9SB 5THXA 5C3QA 1YIPA 3VBFC 1BXHA 2ZGTA 3JCIA 1IPSA 4A4AA 4QDRA 1RITA 1RMU2 1A8DA 2QDNA 5J35A 4FTBA 1W8TA 2JKHL 4Y4YA 5CNAA 2GAUA 3UT0A 5L19A 2FD6A 3OPOA 1NOVA 4PIZA 4XLFA 1YFYA 3UJQA 3T09A 2NPIA 2GREA 4RDLA 2ZX3A 1DZTA 3A0KA 3ZMOA 3WP6A 4XILA 4E2QA 4ZH8B 1QFYA 2W87A 2XGJA 2FZ2A 2QGGA 5GZGA 2WT0A 3LTGD 1SM4A 2Q8DA 2PHBB 2BN4A 3AZWA 4CYDA 4JKMA 4UI9L 1IOEL 4M00A 4WM7C 4XMIA 1VLOA 2DFBA 4XFBA 4HT1T 3E6BA 1HJFA 4D69A 1ZYBA 1QOSA 4XN0A 4XORA 4ASUA 4XTPA 1JUIA 2K2SB 2OQ7A 3VBHC 3KCXA 1LU1A 3OTFA 4X05A 1B2RA 4PHZA 1GNZA 3FN9A 2ZEYA 2DERA 1KXGA 4HXCA 1ASJ3 4J1XA 3N9MA 5FAXA 5I8SA 2OW4A 2JE9A 4OQ9A 4COZA 3PUHA 4ISQA 1V5VA 4DINB 1G2MB 1W2TA 5FY5A 3WW1A 2GNMA 2NPRA 3THPA 2EI8B 4KGQA 4XJZA 3WDUA 3UGHA 5FDBA 3RZKA 4C0BA 4CU7A 1BMV2 1KEXA 1LHUA 3PUIA 2GD4A 4XOPA 4S2GA 4XL9A 4MX3A 2XZLA 2AZ5A 5F3CA 2QQWA 3KQRA 3KEWA 4RGGA 4LBQD 2X3UA 5JWPA 5LATA 3OZVA 3MIFA 4AEJA 4M10A 1V6OA 3RJRA 3K48A 3VDAA 2AEZA 1SCRA 1V6JA 2DTWA 2WZPP 1R1ZA 4IV1B 3VDCA 3AKQA 1K12A 1QH0A 2Y80B 4X7FA 1X9PA 2WN3A 5C6CA 2BGJA 3QFSA 2X8KA 2SLIA 3NTGA 2XPJA 2RVAA 3P27A 3PJQA 1AYN1 1N3OA 2IVJA 5JBCE 1GJRA 2JG9C 4R9AA 4W50A 4FO9A 3WR0A 3VO1A 2ZZGA 1EV13 1RUH1 3BN6A 4NGAL 5ABJB 1SBEA 2VE1A 2ZKNA 5FO7B 2P17A 1GQHA 4Y22B 4DOUA 1O3QA 3VD9A 2AYHA 2JD4A 5E8DA 4ZCLA 3B00A 3B5LB 4RLZA 2RR12 1MOXC 4MGQA 4JQRA 3LIWB 3KV4A 3PTYA 4QGNA 1N1YA 1FAKL 1SFPA 2X5IC 3SKBA 3WG2A 3ZFFC 2D3NA 1EGFA 2WNUA 4H3WA 1E79A 2ZACA 4I3GA 1Q43A 1ZZ8A 4E9KA 1IPJA 4XF9A 4BIFA 4E8DA 1EPZA 1KFUL 5LW9A 4IV3A 4DNRB 1W8WA 2QE7A 1WPCA 3PUNA 4AVZA 1H6XA 1ZZCA 4MXVA 2WYFA 2GZWA 2VPVA 5L30L 1BEV3 2ZXIA 1O6UA 4X6QB 5A6YA 5E89A 3MW2A 2WFF1 1I8DA 3UV9A 4ZV4A 3VDDA 1NCQC 4AEMA 3PVDA 2VTXJ 3OW7A 1RUD3 5KHGA 2R1DA 1PVC1 2FDFA 2BF4A 1I3HA 5FPVA 3TOJA 4AVAA 3JBG2 4LLOA 3HBZA 5C4WC 4B44A 2B8MA 4Y5Z0 5F3IA 3D26A 3BB6A 1TME3 4D7YA 4NHKA 3LA7A 4LT5A 2VQAA 5FYSA 3HS5A 4IW3B 3OLTA 4WZKA 1GOFA 2QFEA 4LBWA 3N36A 3OPTA 1HJ7A 2AREA 4Z8BA 3Q8BA 2XC4L 3NAPC 3I2GA 3CMEB 3NNFA 5DXDA 2O0OA 3P6BA 2Y5HL 3ZFEA 1D4M2 3NRUA 2J22A 2GMMA 2XHNA 3CA7A 4Z4UA 5FPBA 4BE3A 1V3XB 1EYBA 5I93A 1RHI3 1Y9QA 1LOEA 3CCQB 2HWD3 1C57A 2VZVA 1F60A 3A8IA 3MIBA 3U37A 5FY4A 4AI3A 4LR4A 3WQ1A 3FX3A 1UD8A 2BTVC 4CEWB 4GA9A 5CG9A 4CXWA 2A6WA 2VNGA 1RHI2 4IEUA 3DXUA 2Q6OA 5C3SA 3NJPC 3LN1A 3VD7A 4PIXA 2XH6A 5LY2A 2C4TA 1QIQA 2XVKA 3QOPA 3ZYIB 1QJX2 1UD5A 3LQCA 2Y8KA 1Z6EL 4XNFA 4B7KA 3ACIA 2JB8A 2B46X 2JG9A 2V73A 4QB1A 1UMKA 2VVVL 2WSSA 3G05A 1UPIA 1APNA 4BPRA 2BGPA 4YZUB 4QHBA 5SV5A 1UWWA 3BPSA 4ACBA 2QQMA 2C5DA 2VJXA 2ZGPA 5BSXA 4W65A 3FHAA 1CNFA 1RUI3 1TME2 2E26A 1IQML 1EFTA 4P9IA 3TN93 3ZO0B 1DBNA 4XZPA 3VBUA 5HXMA 2VD7A 1KLJL 4TMTA 5JVVA 5LBCA 3LEIA 2VWOL 3K2OA 1L7QA 4P3YA 4LA3A 4TYSA 1LESA 2BQ7A 1ENRA 2FDJA 4ZY9A 3VB9A 2RM21 5FUIA 1TNFA 4A7IA 4XIKA 2Z6BD 2W2OE 5IKRA 4B4DA 1WA6X 1ENQA 2PXJA 1OH4A 1Q9SA 2BV4A 2ZCWA 3GJAA 3PHMA 1GNHA 1ZVFA 5F5IA 5CFDA 2VCCA 4HIZA 5FYTA 4YFZA 2W0XA 4F3JA 1TMF2 3VL8A 2CGOA 2J95B 3NV4A 4Y7BB 1S0DA 2WWSA 3ETPA 1XJAA 4XVHA 3UGFA 2X85A 2QDXA 1IZ3A 4D0FA 2RS13 5AC93 2E32A 1CCVA 5EJZB 4AHZA 4LHKA 3CKHA 3ZN5A 4FQZA 4WVVA 1W0OA 1YO8A 2ADXA 2VU9A 2BZ6L 1F5FA 1W34A 2GK7A 2NN8A 1NCRC 2BGOA 2PN5A 4MGIE 3T30A 3ZSEA 2B7DL 3GM8A 1OOPC 3AGQA 1XE7A 4LO7A 3UNPA 5JZGA 2NPFA 4LBVA 4K9SA 4BQYA 2XJPA 5A8AA 4CUDA 5FXWA 2RJKA 2YU1A 4JGYC 4LBOA 3W5MA 4FAGA 2P5BA 2R062 5JOZA 4XFFA 3M37L 2HCJB 4GH4C 1RUC1 4IEVA 4BMEA 1PGL1 1UQXA 4LPLA 1H4HA 4Y20A 5A3OA 1H9WA 1EFRA 2VJ3A 4GMP0 1H8EA 3ASQA 1U5YA 4AHXA 1VRBA 1ZNPA 1POQA 1YFXA 2PLV1 1UD6A 1UZWA 1B9WA 1WW4A 4GB31 4MO3M 5BNNC 1RUH3 4RD3A 4OFGA 3RRDA 2OYEP 1KQSB 3SLDA 3PU8A 3ROUA 1FMD3 5GKAC 5I0SA 4HK8A 1K5MC 5AVAA 2N7GA 5BNOC 3I49A 2HWB2 3HO3A 1D0HA 3NO8A 2VOWA 1QVGB 1BMFA 1HQWA 1QU0A 1ULCA 4FOVA 2HOXA 1JH5A 5DDJ2 4A7KA 4ASKA 5LB6A 3BU0A 1T6XA 4RD6A 4A41A 1C4RA 1K28D 4CP1A 1MS4A 2ARBA 3LA3A 5JUVA 3WY6A 3A3GA 4FPFA 4GALA 2BWCA 3D0JA 1SHWB 3LSEA 1NQLB 4ITCA 3R6KA 4XUNA 2YBSA 3ETQA 1JU3A 4LIVA 5IJRA 2K2TA 4LOTA 1QGYA 2GQFA 2Z42A 4L11A 4N7IA 5KC5A 4RHV1 4ZS2A 2DOGA 3ZDSA 4WVWA 2ZABA 1ADXA 1PMHX 2A6XA 2ZOEB 4QPGA 1KK1A 2HWC1 1XNBA 1VMFA 3N9QA 1PKVA 4R9CA 4CZSA 5FYZA 5D21A 1DG6A 4XJAA 3U6BA 5EHDA 4FPKA 4YM1A 1DIWA 5FZ8A 5FMOS 2FMYA 3SQOA 5CFDB 4XUPA 1J3QA 1PGEA 4FP3A 4K1YA 5FXXA 5LASA 2Q8OA 4CUAA 1W05A 4NIGA 1YQ2A 2O14A 3LWCA 5EJ3A 5GLWA 2E7QA 2OQ6A 1ZM3A 4COWA 4DMIA 3E1YE 2A75A 3VKMA 5K0UC 3KGLA 3HQRA 2VYQA 2ZGRA 1BKZA 2JDAA 2JXAA 1LHOA 1S2EA 4CSWA 4AGRA 5A88A 2E63A 1YIJB 1JTZX 4Y1YA 3QH6A 3OJBA 2AGSA 2VM9A 4UFHA 5EYXA 4BQ5A 4F7ZA 2I74A 2KNIA 2BPA2 1OVPA 5L7OB 4QU2A 4WVZA 2OT7A 4ZPIA 1LEMA 1J58A 1DQ5A 1VPHA 3AKTA 4XOTA 2W2PE 2V7TA 1QJU3 1QMJA 2QVSB 3POJA 4YGBA 3NJZA 5FUNA 2XJVA 4PQ9A 2KB9A 1QJX3 4Y20B 5F5AA 4BWOA 3TEXA 1JA0A 5KSWB 1XC6A 2ZGKA 5J48A 3A8JA 1RUJ3 3QMOA 2BNNA 4CVUA 5DS0A 4QV2A 1AUTL 3CP2A 1N05A 4G7XA 1AZDA 1C8M2 1MZFA 2MEV2 2JDZA 3H3UA 4DQLA 4NHYA 4C0SA 1W7XL 3TK6B 1PXXA 1AHSA 2WT2A 1I5PA 4ARYA 5I0DA 3OGSA 4Z4ZA 4Z4TA 1AR83 2UWCA 3OY8A 1BQPA 1PK6B 4JDMA 3VBUC 2E7AA 2XBXL 1VRH3 1W2NA 2ADEA 1H30A 2WO2A 2PQQA 4ISIL 2RDNA 3MDPA 4AW7A 2G19A 3WDYA 5D2AA 4XFCA 4XQWA 2VQUA 4UFLA 2W1UA 2R16A 4QB2A 3NL1A 4IEOA 2W91A 3ZZTA 3MGUA 5T5LA 4GJYA 3ZFGA 3WUCA 5F6KA 4AF9A 3OAAA 3C2UA 3WP4A 1N08A 4WQMA 2QQLA 2LRPA 2W86A 3ISXA 1GWLA 4RSUA 4D6QA 2J7KA 3I56B 1COWA 2RS31 4XACA 4DEQA 2BQWA 1S0FA 3VHNA 1SZBA 2A73B 4WM8C 1RINA 4YG6A 4XBMA 1OGIA 3ZN6B 4R71A 3AYEA 2IVIB 2WZ8A 1OQEA 5GLTA 1VBB1 1D8TA 5EP9A 3NSTA 3NTBA 4ZXEA 5FQ0B 3MHZA 2XBYL 4Q7JB 1QJEA 4MGZE 3HMYA 5FXZA 5F1RA 4XCBA 3MZHA 3IM0A 5TV2A 1IB0A 1XFOA 2GN3A 2VULA 3AMHA 1VQNB 4JC1A 5DUXA 1UPSA 2YFUA 3SEPA 2OZJA 1CPNA 2GH2A 3T1LA 1EMOA 1NFXB 4IE7A 3VHRA 3VZOA 3WVJA 5IK7A 3I2DA 3VBOB 4RN5A 1VBB2 1DDGA 1AR72 1CEJA 4N3NA 1JZ5A 5FYIA 3T2QA 2XJRA 1PZ8A 5C4WB 4MV2A 4OI0A 3LDBA 3OGGA 1WHFA 3S6XA 3OGRA 4UT5A 2W47A 3TYJA 1UO9A 5A6ZA 2RR13 5ACA1 5C9AB 1JUHA 2D9RA 5FZ0A 5FDQA 1D2SA 3AVRA 2VECA 3T0AA 4LJHA 1G2LB 3VDBA 2HH9A 4OOVA 5C8CC 3CENL 1V6LA 3KVAA 3ELAL 1WORA 4YG0A 5DQ0A 3GZUC 4YZ3A 3ZFFA 3H3LA 5HV4A 3FFQA 3JB8A 3WDVA 3ZBTA 1JS9A 5FZ1A 1N1TA 4AR2A 5ACA2 1HKDA 1AIPA 1U5IA 2GC2A 5CISA 2VTXA 2J1TA 1S0BA 2XNJA 3B02A 1BX1A 4XTMA 3WUDA 1RC6A 3MICA 1URXA 3SOBB 1A6CA 3V64C 3WOGA 1AUYA 2VMEA 1IKPA 4X8VL 4AGVA 1IKQA 2JWPA 3ASPA 1OHFA 4CXXA 5DABA 1NCQA 1WLCA 4RPDA 4E4DX 4FCAA 4ES9A 4ET7A 4FBFA 5HI0A 1YQ8A 1RUF1 4M0HA 5LA2A 4F8AA 4WWVA 3MI8A 3BOPA 5FLIA 1E3XA 3ASSA 3CCEB 2R1BA 3EBRA 3JB4C 4Z4RA 1FNBA 5C3OA 1A3PA 1AX2A 1AXKA 3N3HA 4Z6AL 5DUWA 1UMIA 4DO0A 1XYOA 4PF1A 2M5SA 2VOTA 2ZGSA 1MABA 5E16A 1DQ0A 2XMLA 3BUCA 4NHXA 5FNZA 5C8CA 2FMDA 4LK6A 3A7QA 1JI6A 2ZGUA 4XJ9A 3HQXA 1XXNA 5L9BA 2YC0A 3AVWA 4A3ZA 4B1MA 2PHXA 5J09A 3FJOA 2QZ3A 2VNHA 5FOJB 2P94L 1KDKA 1B35A 3LO8A 1MQ6L 2BOUA 4XN3A 1POV1 4XQFA 3RR3A 2Y6LA 3HT1A 3B78A 2RS32 3LPGA 1LHVA 5D8AB 5JIUA 3AKSA 5JBBE 2TEPA 2BU9A 5A3LA 3UKTA 3MIHA 3UKNA 2VZQA 3QFRA 2D6NA 4LBYA 2XLFA 4KKUA 3J26N 3GVLA 4MG2A 1FNDA 2VZUA 1LECA 3RI8A 2WA3A 4KGGA 2R041 2HMAA 4FWTA 2ZGNA 4UW5A 5GLVA 5LEJA 3UK9A 2B5HA 2VY0A 4D94A 4LBQA 5AN9A 2UWLB 3W2EA 4NUBA 5KXBA 3BH4A 1H8TC 4II3A 1S72B 4FPYA 5HXVA 3VKFC 1HT5A 1VQLB 3KGZA 1J3PA 4AG4A 1W39A 2Y38A 4MYUA 3CFWA 4EROA 4IE5A 4Q4V3 1MQTA 3Q6RA 1DZQA 1JZ3A 5KC6A 2G4IA 5LCWL 3BVCA 2PAMA 4PC2A 2F6BA 3W21A 2YGOA 1YX2A 2YWEA 2V31A 4TMZA 1PO21 3LOIA 4META 5A3WA 1C3HA 3WNKA 2XBWL 2YWFA 4BTUA 2CY6A 1UL9A 1EBVA 3LFIA 1VBE1 2BQ6A 3O1MA 3RZGA 4C0HA 4M3CE 5IWFA 2ZL7A 3IT8A 4BISA 1Q56A 4OOSA 3CCJB 4AI9A 3JXSA 1QGLA 1BBT2 3BIWE 4Y1VA 1ZRCA 4Q8LA 4XABA 2OBSA 1DG1G 1MS8A 2PAKA 3G71B 2VMHA 5FPAA 3H0OA 3ZXAC 2Y60A 1YUKB 4PLOA 3PUMA 4N53C 3RVHA 4CA9A 3FE5A 4WZLA 3L2YA 4L92A 4YHBA 1C5IA 3PMEA 3PA2A 5LMZA 2HEYF 5FZCA 3C7EA 2BGIA 1OB2A 2ZA9A 1HXS1 5A80A 1G7TA 3ACHA 3A1PA 1RMU1 1VR3A 4N3GA 4ONUA 5CU1A 5IFTA 5LA0A 2EI6B 1GP6A 1AR91 4Y79B 1CX4A 1REEA 3SKJE 3OOCA 2KVOA 2ZS6B 4FVVA 1HAEA 3J7LA 2H9EC 4Q1RA 1LMMA 5FBZA 3LN0A 4L97A 1LPZA 2D6PA 2PQSA 2XGXA 4GKYA 4P5YA 1MEC3 3T56B 4F7DA 1H2KA 1FOD3 2ETEA 2D40A 2JDHA 2ZL5A 2IXCA 5D8AA 4NPMA 2P1BA 3LDKA 1SLTA 3DN7A 4W4ZA 1AR71 3OW2B 3AKRA 2DCTA 5IFPA 1PO11 4XKVA 2EF6A 3TGFA 2O1QA 2WAOA 4BOWA 2I9AA 2EIBA 3K3NA 3NJXA 2ES3A 1S0CA 3OUIA 1PVC2 2D43A 2BSAA 1ZRRA 2HWF1 2W92A 3IAQA 5AVPA 1IQJL 1KD7A 4P12A 4B3GA 3C8XA 3T0BA 5IT6A 4P5HA 3S7IA 4OCTA 1DQ4A 2CC2A 1W8HA 1D1NA 4AHWA 3IDAA 2I1LA 1XOYA 4LBQB 3ST7A 3POFA 1UIKA 2WQ8A 3UKVA 1W28A 2E7TA 1IP0A 1NXD1 2P34A 1YQ6A 3DL3A 4LHNA 4NRQA 4A2UA 3FUOA 2WNVC 4BQ3A 5FA6A 1MQTB 1T2XA 3O7OA 2J42A 1DHKB 1QNYA 2WZEA 3OGJA 4Q27A 5FZ6A 3A35A 1UU5A 2ZX0A 3ZXGA 1SLBA 1CX1A 2YROA 1G1TA 4Y1ZA 5FREA 1ZRFA 2ZAHA 3W5NA 1DYKA 1VQPB 2Q5TA 2A7AA 2YMZA 1WLWA 2IXHA 1FAYA 3R4UA 4U36A 4RRYA 5LWBA 3ZSKA 3OGVA 4FSJA 2VMGA 4S2FA 1H85A 1WLDA 2RJ2A 3GYDA 5EGMB 1KZLA 2D3PA 2G1MA 4K7JA 4YFWA 3RNSA 4BMBA 2WINB 3HS7A 5A3MA 4TKOB 1OLMA 2PFWA 3I3EA 1TVCA 4Y3OA 3EQEA 4A3XA 4BDVB 4TTGA 2FCTA 2FBEA 2Z4FA 2CWMA 1BBT1 2V5DA 3MLJA 1Y43B 4P2NA 1W6OB 2CAUA 4LK7A 4CDXA 2VWNL 3OZWA 1ZBA3 2A3XA 2ZPXA 4HN1A 4OI4A 1W8BL 3WNCA 1ZBE1 3AVSA 4FI9A 4OZOA 4P9JA 4JYVL 4QHZA 5FBJA 3V65B 1Z7S2 5BYNA 1PJ6A 4JMQA 2VZSA 3FJSA 1VQ9B 4YAFA 5LBFA 3LCPA 1AL21 3H8XA 2X0KA 1DQBA 1SLAA 1RTVA 4BYYA 3CHXA 1JA1A 1E5HA 3DPRA 1CAWB 3NNMA 4PDWC 5FP9A 4YM2A 4RRWA 4X8SL 4QX5A 2AH2A 3JBG3 3QD6A 2WNEA 3O1TA 1UNBA 4I3PA 1JJ2B 1FOD2 4QKFA 3FMGA 3W20A 3NE5B 1NA1C 2WLQA 5E1RA 1YNAA 1V9U1 3J7MA 3KS7A 4NPLA 2OK8A 3I3DA 4UFJA 4EZHA 1WD4A 4ZXKA 4HOOA 1V9U3 2W2NE 1PFXL 2PE3A 1AX0A 2XC5L 2BOXA 4Q29A 4QMAA 3VN4A 4DQAA 3WG3A 1T6ZA 4MSVA 1W3XA 2VBUA 2QQKA 4COVA 4JRAA 4A44A 4XR6A 2VZ3A 4QU1A 5J96B 3CW2A 4KG0A 1G86A 1G9BA 1AL23 3RZMA 4DXZA 4G1MB 3PIGA 1CJPA 3VBRB 1XRUA 1S0IA 2RMU3 1JN2P 4MVTA 3UGGA 3WF4A 1ZBE3 4RRXA 1QIUA 1F15A 1GWKA 2P95L 3EB7A 3T1MA 4BH9A 1CZVA 2J38B 1OT5A 1VBE2 2RHPA 1IGZA 1EXMA 1BBT3 2A1XA 3N9LA 3MV01 4XLWA 2RA0L 4RM0A 1JW6A 3Q8CA 4Z07A 3ZM8A 2BFUL 4N9HA 4QAWA 3SJPA 3OP1A 1RVF2 4QX8A 3WW4A 1SPPB 4IGQA 4AXOA 4V2VA 3MW4A 3TEWA 5HZAA 3POGA 1GOHA 1PTHA 4W6XA 2VVDA 5K4LA 3RZZA 5FP7A 5KHKA 1EAH1 4Q4X2 1N06A 1AJOA 4UW3A 3BTXA 4PC6A 1WA4A 2XVLA 1NE4A 5JAXA 2RMU1 1RQPA 5FYMA 1VJSA 4CUEA 4II2A 4XDPA 2DV9A 5L73A 5KXEA 2E1BA 2C5HA 2JG8C 3T4HB 2ZMKA 4LKSA 3IZOA 3VBHA 3V56A 4E1GA 3Q38A 5I91A 5ABJC 2X6XA 2ORXA 5DUUA 5SV8A 1FATA 1MS0A 3SLIA 4HZFA 1M90D 2W68A 1V0AA 2JJ2A 1EAH2 2ZKLA 4Q4X1 5CKQA 4GZ9A 5FK8A 5IUQA 4FOWA 1ENXA 4UZFA 4FM5A 4JAAA 4S2DA 5DAWA 3WDWA 3BKZA 5HKKA 5JB8E 1QH6A 3I3MA 5FY9A 3ZPYA 4PBPA 4L8JA 1VBD3 3KT4A 3S6PA 3ZFFB 5AFEA 4ZHNA 3LA2A 3LOBA 3AJYA 3WP3A 2P28B 1ASJ2 4LIUA 1EPWA 3ZYGA 5HZBA 1C5MF 3G6EB 1CGPA 2BQPA 3JBG1 4N43B 1HJGA 2Q0AA 2HWF3 2E51A 1UCXA 3AM2A 5B4NA 1QH7A 5F4JA 4BK5A 5J1XA 2VC9A 3R05A 4FFGA 5FZBA 4A6OA 5AFBA 4XLAA 2P3UA 4X7CA 3SOVA 1YJNB 1CZTA 1UZJA 5E6HA 2OK7A 1NCQB 2D3SA 4URTA 4P08A 3VKNA 4OTYA 2WFXB 5A32B 4PT6A 5EWSA 4GAZA 3U78A 4LC0A 4NR1A 1H1IA 4UAJA 1WZXA 4R9BA 1DYPA 5FLHA 5FRAA 3SH3A 1TTTA 4BIOA 4AVCA 1R082 2FDGA 1DP0A 5F7UA 1ELOA 2ADDA 2CGPA 3JQRA 1ND3A 2PHTA 3BTYA 1G1QA 1IS4A 1DIYA 2WNOA 4AI2A 5F4MA 3KD4A 5FYUA 4D8MA 1GQGA 2NP0A 4CEYB 1AR93 2NMNA 2GH8A 1GZ9A 5H9RA 1XNCA 5GALA 2KA3A 4E4HA 2VOVA 4M3CB 1RMU3 4XFHA 3VBRA 1CVNA 4NWVA 4HKWA 4Q4Y2 5FZLA 2AR6A 2QKDA 1KLOA 1F7MA 3O14A 2FX3A 1B35C 1H4GA 2CNAA 5CAZA 1ENSA 2WJYA 3BI3A 4XONA 5F5QA 4CDQC 4D6SA 1F0RB 2BMWA 2BSFA 1RUE3 2IXIA 1NB0A 3KLSA 4NE9A 3QSYA 4XYXA 3PL0A 5DN2A 3WBKA 1IQAA 1SPPA 4HONA 5A7PA 5F1AA 2EXIA 3LZZA 3OD0A 4FFFA 1ZZ7A 3CU7A 4AQTA 5T5PA 4PI2A 1H2LA 1R1A3 3CBNA 4K8RB 1Y0YA 1R5BA 4M0LA 2W3IB 2XDVA 2XLGA 3AFGA 5GJ6A 3CQOA 3WF2A 3NWKA 4CCCA 1CWPA 4NMIA 1YRZA 4EYUA 1YI2B 4DY5A 1FPN2 4TMXA 1GANA 1YCIA 5T54A 3TEZA 3U10A 4EWEA 1ALYA 5K7PA 3OJWA 1H8TA 1PGSA 3CLPA 2XBO1 4OI2A 4PF5A 4LO8A 1AYN2 3MDLA 4XD7A 2QEXB 1PO13 3ZYBA 4CCEA 1AR73 2ZTNA 4YVWC 1AL0G 3ZFEB 5A33B 4P9LA 3N9PA 3H42B 5COXA 3JU9A 4NOTA 3RWKX 1M1XB 1WUVA 1K37A 3MHPA 3D3AA 3WEZA 1FOD1 1GICA 4XHXA 2CAVA 3O1VA 4XCAA 4XBQA 3H9NA 1V9U2 1XPWA 5EJ1B 2LM3A 2TNFA 2OYUP 3WCSA 4CUGA 2BM1A 5IHRA 2FD8A 4MXWA 4MYTA 4V1PA 4DZGA 2DCZA 2ZX1A 3OBZA 1YLLA 1PZ9A 1EUUA 2W1QA 5FKBA 3VNVA 4H7MA 1TNRA 3SEJA 2BPOA 1PVXA 4XQ4A 5FZGA 1HXS3 1GO2A 1MVQA 4XE9A 4P02B 1PRHA 4YXWA 4CCKA 1W8ZA 2V5YA 3FCSB 4JV4A 5IK8A 1K8AD 1HB2A 2KXLA 2P26A 1OF3A 4E8CA 2VUJA 4K21A 1YFUA 5FJKA 1F31A 1T6BX 3U1XA 4GQNA 1OOPB 2CRVA 5GLUA 4ZKTB 1ZBA2 4B43A 4XFGA 4FFHA 1EFCA 1K9MD 3RPQA 3ENRA 1KGYA 3QFTA 3H1MA 1J84A 2IWGB 4Y7CA 3M7AA 3PVEA 4OPVA 3JZVA 1ULEA 1JV2B 4TMVA 1VBC2 1WMDA 4CDUC 5APAA 4P14A 2I2SA 1OKQA 3DKWA 4QDSA 3Q3KB 4YW4A 3TWIA 5C3PA 4LMFA 1SLIA 4YGCA 3UJOA 4X0CA 4BM8A 3BY2A 1CX2A 1PO23 2WN2A 5BNNB 4O61A 1CCFA 3OE7A 1KITA 1UZYA 1E43A 1IS6A 5JMOA 3FHIB 1ZRDA 1OLQA 1RUJ2 5AC91 3LDRA 3LIHA 4LEJA 3BY1A 1VLYA 1XU2A 3DV8A 2W26B 4GD4A 4LBNA 4NHMA 2VVCK 3V7AA 3CCMB 1DGLA 1O4TA 2WUHA 3DECA 3CJXA 4K1ZA 4K40A 3RI9A 3CCLB 2WJSA 2HEVF 1LK9A 1OBNA 4OMCA 1MZ5A 1Q8OA 2P37A 1WSRA 2JDYA 4P3IA 1GZCA 3WCRA 5FY8A 3CP8A 1DZRA 1XNTA 5DN6A 3FC0A 4PIYA 1ZUNB 4AF7A 1NUKA 4QQ2A 5EZWA 3SEEA 3M70A 1UU6A 4YSFA 5F2WA 2HYKA 4ORFA 5J37A 4QVJA 4TMWA 2GNTA 5JZGB 4ZU5A 1Q7YD 1O8SA 1UX6A 1JNYA 1KDMA 2ZGMA 4DEVA 1VQ8B 1UYZA 2XL9A 1OXCA 3AP7A 2VNJA 1LTEA 5JSOA 4OPSA 1DQ1A 4RGAA 2P6HA 2QJVA 2Y6HA 4MLOA 4JDOA 3Q39A 1JMUB 4CP2A 4DNYA 2E53A 3AKPA 2D7FA 2BWAA 2JDPA 2V4VA 1HQNA 5A3TA 5FPUA 1ODNA 4RD1A 2GMEA 2HKXA 3KQBL 2OX0A 2VBVA 2Y6KA 2ZX4A 2R7EB 2LROA 5FUPA 1GBGA 1O91A 3H7YA 2Y6GA 3U0ZA 4DUWA 4JRLA 4MXWB 4RR3A 1SKYB 1POV0 1H6YA 3ES1A 3GHMA 4A6SA 2V7VA 4E4SA 3K51A 2MNGA 5J3UA 2ZXQA 2R071 1AF9A 3AYAA 2WG4B 1IQDC 3CC2B 5H9QA 5K0UB 5KXDA 3NV3A 3G7DA 3U14A 2FDHA 1UD4A 3M3OA 2VRSA 1BMV1 2CYFA 2QQOA 2C9AA 3WNDA 1HREA 5FWEA 1R5NA 1XB2A 3D0SA 2IUWA 1F2NA 1QQP3 2UWBA 4D3WA 1W2AX 3IAPA 2XZPA 4CDXB 3AFKA 2B42B 2IFRA 4DXTA 5BV6A 3B9IA 1RUF3 3LEMA 3ALQA 4FAHA 5C7GA 2VUCA 3P3NA 4Y1UA 4ZAEB 1LOAA 3F6UL 5JLVA 5L7OC 3OB8A 3ATGA 4ZZ8A 1NLSA 4R4XA 4Q4W3 5I8YA 3B82A 4HLTA 2BBVA 2WS93 1V0EA 1DDXA 2OBRA 3JD73 4NPRA 3DXTA 4P9SA 1J3RA 3B93A 2VH0B 1EQGA 3KZ4C 1HAFA 3ME2A 1YQ5A 3WLUA 3P26A 4AFDA 3GBWA 4Y5SA 5FFOC 1AX1A 3VZKA 4AI8A 3OKXA 4B4PA 2JDUA 5A7SA 1RUC2 1CJDA 2EICA 4XIOA 3USUA 4AFMA 4BB3A 2OS2A 1UZVA 3IPVA 3CPXA 5JI9A 3BTZA 1TOZA 1IS5A 4NAMA 4OLLA 1G7CA 3SLNA 4JZFL 2PLV2 2D5FA 4COXA 3F95A 3RGBA 1Q81D 3H7JA 5ABJA 2JIGA 1W3VA 4DS0A 1MZ6A 2RV9A 3E5XA 1RUF2 4MMXB 1HW5A 3LKJA 4Y22A 2ZX2A 2HLDA 3O1RA 3SJZA 3SOQA 1RUJ1 4ZHAB 4RRZA 3KQDL 1UYPA 2Y6JA 1L7LA 4KWKA 1UZ0A 2VMDA 4YVSC 5FYVA 3IMMA 2GP5A 4HVRA 1XE1A 1X36A 5BNQA 4I01A 4NIIA 4LKFA 2B45X 2VMFA 4KU8A 1AR61 2QQNA 3GCWA 4OUMA 1RUNA 1VE0A 4U2AA 2C78A 5FPLA 5FO8B 1WSVA 1NT0A 3NKGA 3THTA 2E9QA 4TLFA 2NYYA 2H0VA 4KH9A 2XLAA 5L2ZL 3H94A 1PHMA 1RGSA 1S1AA 1V1IA 4B3FX 3ZXKA 4AFBA 5CB7A 1BX0A 1ACCA 3O0VA 1DF0A 4DUVA 2JICA 4WM7B 1AYM2 4QX2A 3AGPA 3M4FA 3OY8B 2KR2A 1APQA 4LBJA 2RS33 4G1BA 3IJEB 2PHWA 4RR3B 4OTJA 1OURA 3VBHB 4B3XA 3CO2A 3U7UG 1SDWA 5TRDA 3MIGA 5A3PA 3L2HA 2DETA 3VNUA 3KL6B 1OUSA 4RJLA 1WWYA 3A0NA 3OOXA 1R64A 1TE1B 4YM0A 2HWC3 5A7WA 4PC3A 1RUI2 3OLUA 2UU8A 3SXWA 4EN8B 5FYYA 5C9AC 4RCYA 3W9AA 4NIHA 5FPXA 1E64A 2X10A 1R091 3HBKA 3PMSA 5E8AA 3WNOA 2F17A 1OMIA 2TBVA 3I2FA 2TGFA 1S4MA 2C5BA 1OA4A 3VD3A 3WNXA 5LEKA 5FIUA 1IQKL 3MCAA 3PNAA 5IYNA 2ZBVA 1AR81 2W2ME 2VVFA 1QX4A 1I18A 3EXUA 1J9CL 2F9BL 4WM8A 4WVMB 2YGPA 5I0TA 3AZVA 3PVNA 2ET7A 1PO22 4IV1C 2EAAA 3SHRA 1DQ6A 1KK3A 2WDBA 1QJX1 1QJFA 3LSDA 4URAA 4AFAA 1E62A 5IK2A 1QJU1 2R30A 3E5QA 3D5OA 4M01A 2XOMA
chains in the Genus database with same CATH topology
1FMD1 1HRV1 2KM2A 2O8QA 2JG9B 2D6OX 1ND2C 2H6CA 3R0RA 3CJIA 1CESA 2XWJB 4GMP1 5JSPA 3WINE 3LAGA 3IKWA 1IOAA 3O12A 2CJIB 3ES4A 4QQLA 1EPGA 1GR3A 4CEYA 4YVSA 3LNNA 2PHLA 2RM22 2XKPA 2KL7A 1HRV2 1REDA 4Y7AB 1LJ7A 2X5IB 1B09A 2QUOA 1ULFA 3H5CB 1YJKA 2BVBA 1TMF1 2HWE3 4LO4B 2NLRA 1H2NA 2PAEA 2GNBA 2CL2A 4O9EA 2JJ1A 1GKBA 4YRDA 5KN5C 2I07B 3DPRC 1N1VA 2R072 2BVVA 5JMCA 1YFWA 2WPLE 3ZIWA 2GC0A 1S0JA 2LTNA 3MFAA 4S2HA 2WPHE 4WM7A 1CPMA 3HN1A 4D7SA 3SH5A 2B39A 4FOQA 3T53B 1NRKA 2QE3A 3POWA 3D6EA 1K36A 2PHRA 3U4XA 2WQ4A 4MGKE 2YY1A 3RDIA 1WGPA 4GQ7A 5KHJA 2RM23 2ZXHA 3NAPB 2WNUC 4JTOA 3GCWE 5FLJA 2XVGA 5T5JA 2E6VA 1VBA2 3L9JT 1ATAA 1AXYA 4BHPA 5T50A 1CVUA 1FJSL 1OSGA 3GF6A 3TN91 4FPHA 2WT1A 4IV3C 4Z1MA 3SITA 2OUJA 2G9FA 4CEWC 1VJ2A 2AUYA 3GQBA 3AYCA 1LPGA 1K5MA 1LOGA 5BNOA 3PVBB 4YNIA 5KWRA 2GJKA 4HBNA 3LTFB 5HCBA 1X8MA 4ISHL 1IQEL 1SQ4A 5CFCC 4FPGA 3VGIA 2WPIE 4ASLA 1UW8A 3AYDA 3GVKA 4G6IA 3J4UH 3PJYA 4XXAA 2PHUA 1OFNA 4LORA 3ECQA 5CKNA 1FX0A 3VLBB 1CVWL 1OOPA 3P5BL 3WW3A 2GSYA 5JOWA 3KQCL 2RS11 1OQDA 3I7DA 4ATEA 5AC91 1DVAL 2VXRA 2X5IA 2GC3A 3I54A 5CDFA 4OHXA 4QPGB 1SLLA 2WA4A 2QCSB 3LAQA 3P3PA 3FLPA 4A7ZA 5BNNA 1C8NA 3N8ZA 1Y7BA 4Z0KB 1S0GA 1LENA 3E6CC 2YXSA 1RUD1 2PHFA 5JB9E 1M06G 3NW4A 2MGPA 1Y3TA 4BCUA 1W0JA 4K3UA 3NT1A 4L99A 4Q0VA 1UN1A 1V70A 4HSLA 4CDWC 4N53A 1AXZA 2WIIB 3C9AC 1UD3A 3VBUC 3M3IA 2NZ9A 5F6LB 5LRRA 4YG3A 1CQ9A 4QPIB 1QJZA 1UIJA 2OA2A 1IGXA 1ZREA 3WG1A 1UKRA 4B8EA 1YUFA 2ATFA 2P3FL 4GH4B 4XL1A 5LRSA 2KV4A 1DX5I 1DGRN 2Y7ZB 2MGRA 2CGNA 4Q4Y1 3TH3L 3FBYA 3RMXA 5J7MA 3ZX7A 4HMZA 2WPDA 1OI6A 3FFZA 3WT3A 2HWD1 2P16L 4HKLA 4LO5B 2A6ZA 1FMD2 1K5MB 4XBLA 5BNOB 1PGL2 2VJIA 1VIWB 3I8TA 3KRKA 1ZX5A 2Y5FL 4AVSA 4A94C 4RL7A 3JD72 4WZCA 2IC1A 4X6RB 4X8PA 4OZXA 4IEYA 1W6MB 3ZFGB 1CIWA 1YWKA 4DRRA 2AYLA 1I6XA 2DIEA 1JXNA 1QF3A 2ZZJA 3M3QA 3TB0A 3KK6A 1WW6A 4FVVA 1FPN1 3HWJA 1VLNA 4YELA 1BCXA 1FF7A 5IKQA 1ZZ9A 2WFF3 4RQPC 5T55A 4FPEA 1BEV1 2XWBB 3C3VA 2W6IA 4KNCA 4PDWB 2PYTA 4YT6L 2DU1A 1GLHA 2D44A 3N8WB 1BJQA 1WW5A 4XJWA 4XW3A 4RA0A 2P3FN 1NA1B 1RJ7A 4Q2FA 4LBLA 1TMF3 2WL1A 4JGZB 4QPYA 3RYKA 4JZDL 3MIDA 3NVCA 1LOFC 4Z0LA 1DGRA 4AK3A 1Q5OA 3TRSB 1C1LA 3OBTA 4LTAA 4XLHA 2A5ZA 3SISA 4J1WA 3V0AB 1I1EA 4HANA 2YDEA 3QH7A 5A33B 4GXLA 3VKOA 5JPMB 4DK1A 1KSNB 1CAUB 1HRV3 1EPHA 2P3JA 3D82A 1UF2C 4QGMA 3TN92 3HO5A 3EO6A 4I02A 5EXOA 4JZEL 1D4VB 4Y76B 3VHPA 4CDQA 1CAWA 2XHKA 5EV7A 3VBSC 2JJ6A 3IDBB 1HX2A 3GNEA 1EPIA 1MR5A 1W2UA 1O4YA 3S7EA 2UURA 1DDLA 3N35A 1TLEA 4E4ZA 4TSVA 2HWD2 4XMAA 2OVUA 1WU1B 4MMYB 4KKSA 2R0HA 4I30A 4KG8A 5H9PA 1ASJ1 3VBFB 1JYCA 3AXEA 1EY2A 5IKTA 4HKOA 2OUHA 3EJKA 2YPJA 1FE2A 1N3QA 4CRQA 2PELA 4LNVA 3FWEA 3ZPNA 5JIAA 4TSFA 1I0UA 3A3BA 4WM8B 1HCGB 5JVYA 4WVMA 3EGFA 1IHMA 3VR6A 3WQ0A 4R9DA 2VGDA 3T51B 2DFCA 4MGYE 1XYNA 1IVOC 4Q0SA 2DVDA 1MEC2 4E27A 2D6KA 3GVJA 3V64A 3IBMA 2ZGLA 1JYIA 4O9GA 2MHPA 1BEV2 2XBVL 2IXLA 4IEQA 2H6BA 2ZHNA 1S2BA 1AR63 3T1LA 3CJIB 3AMNA 3BU7A 2VVUL 2I45A 2EXHA 3VBOC 3M8LA 4AFCA 3V0BB 2JG8A 3IN9A 4NVPA 1FNYA 1UD1A 4XDQA 4Y24A 1IQLL 4YT7L 2DU0A 2VWMK 2ZMLA 1Q3EA 3H3ZA 3EHKA 3MYXA 5FO9B 1VALA 1RIRA 4SBVA 4CEYC 1HV0A 1FPN3 4L9BA 4E0FA 1J1TA 1RL3A 1NYWA 5DUVA 5HCFA 1BVP1 3ILRA 3AB0A 2WSUA 2VH6B 4Q8KA 2YGQA 1U67A 2WNVA 1TEIA 3AJZA 3INAA 3VZNA 4ISRA 1KLIL 2DUPA 1LOCA 4CDQB 1DQ2A 4Q0PA 1E57A 4ZXXL 4HL0A 5H9SA 2ERFA 2R9VA 1W6QA 2PA7A 3USSA 2W39A 2WS91 3KCCA 2VUAA 1W6PA 4ZU7A 5CG8A 5CBLA 3AK0A 1O3SA 1Q8QA 4MYEA 4P9WA 4IERA 4Q4Y3 2BOKL 1GV9A 5J98B 2ILMA 4EJRA 2Y7XB 4B3NA 1V6MA 3OD4A 4H7LA 1QHDA 1CN1A 2HEWF 3B3QE 1WTHD 1AVBA 1EP0A 3KSCA 2Y26A 1V6IA 1Z0HA 2MHFA 3WZ1A 5JR7B 1W0PA 1WD3A 2ZZFA 5T5OA 1R083 4FXUA 4M3CA 5T52A 3ZYRA 1QKQA 1QQP2 5I0UA 2VVEA 1NFWB 1DGWX 2X53S 1UMZA 1Z7S1 1FAXL 3D4KA 3URFA 2C1FA 1X7AL 2VOKA 4LE3A 4QXKA 4YGEA 1PNFA 1UZKA 1O3TA 1U8CB 2ZHKA 2LALA 3KCYA 2GMPA 4AI0A 3T2TA 2YGLA 1A3KA 4QQPA 2EA7A 3B9CA 2IXKA 2D3RA 5CA6A 1UKGA 4PJYA 1SFNA 4INDA 5BXXA 1DFQA 2WSVA 2H0BA 1CONA 2W08A 4QGLA 2C0ZA 3H1WA 1BK1A 1H8TB 1HDKA 1WW7A 1QJY3 4OHYA 4QT6A 5JDBA 4FPOB 4NWWA 5T3NA 1XKAL 4AE2A 2FQPA 2PUQL 4CDUB 1H8HA 1KS5A 1YUGA 3J8F3 5JOYA 1H1AA 2W6JA 4X8UL 2UWOB 2CK3A 5DG1A 4FTSA 2GDFA 1G6NA 4BDWA 3ILFA 1W9XA 3JQXA 3HR9A 5BNPA 1VBA3 2DUOA 2K9ZA 2XOKA 1FI2A 1QNWA 2PR3B 2J4IB 2WYGB 2NMOA 4YZ5A 4EV0A 4N53B 4MMZB 5FOBB 3MPPG 2XJSA 3AZYA 3SW2A 2JECA 4EN0A 3ZIAA 2RMU2 4CDWA 4XETA 4COUA 2R32A 1OFSA 4R52A 4N90A 4LLFA 4XEZA 3V65A 1I5ZA 4GH4A 1COV2 1X50A 1CQEA 3BOWA 1LOBA 4PCRA 1HT8A 2GJRA 3JU4A 1LQDA 2GN7A 1QY4A 2DURA 3R4SA 1F7EA 3M3EA 4K20A 4AEDC 1SEFA 4GULA 3W58A 2XBO2 1EMNA 2XNDA 3S0MA 2ZGQA 3PGHA 2GK6A 4LUMA 1YYNA 4AEKA 1VF7A 2BOHA 2J94B 3VDDB 3ZSLA 4AVVA 2R061 4AWDA 4DRVA 2XBO3 4YW5A 4CSYA 3WD5A 4G4FA 1WMEA 1LEDA 2VMIA 1NCRB 1ND3C 2NQYA 4CDXC 4PBOA 2HWE1 2WKKA 4HFSA 3FZ3A 1GSLA 3OFNA 4RS5C 4XOGA 1S0EA 1PO12 4QM8A 3BT2A 1V00A 1CGPA 2WPME 4XM3A 3DF0A 3O0WA 2FZ1A 1PM7A 3GISX 4K6BA 5DDJ1 2ZZQA 1Q8SA 2CWSA 2D1JB 3J9SA 3D8CA 3WDTA 4YZ1A 4TT3A 1L3YA 1RJ8A 2MEV3 3RWNA 4GMP3 2HJIA 4CEWA 4MZUA 1HVXA 2DCYA 1GFF2 4K8FA 4P9YA 1KFXL 4XFAA 4EWAA 3ASIA 4HK9A 3G6JB 4UXAA 4XKWA 1FT9A 1IQFL 2NM1A 5BNPB 2DTYA 3TNQA 3S30A 1RUE2 1HRI3 5K0UA 1PIV1 1V6NA 2Y0IA 4KBBA 1DLLA 2Z2SB 3TAYA 1OB1C 4KKTA 1XNKA 2WPKE 4Q1PA 1A78A 1QJY2 3OBRA 4OHVA 1R093 3MLKA 1ATBA 1M4WA 1AYM1 4Z1VA 3TBDA 2WQZC 5B2GB 1NFYB 1CD3G 1NZCA 4Z92B 4C16A 2XL7A 1U12A 2GNDA 4YEJA 1PZ7A 2A3WA 2PTMA 4NA9L 1H0BA 3B94A 1COV1 5CFDC 2Z69A 1FV3A 1CAXB 3GZAA 1RUG1 1UZQA 1QXJA 3VBSA 3WG4A 3AP6A 4AVBA 5LK7B 4FOYA 1IQIL 3FUQA 5A32A 1FX5A 3HT2A 2JEMA 4I0AA 2XZOA 4P9XA 1WP6A 2HWF2 1TPGA 4H14A 4FXGB 4IEZA 4PLN<