2WZR1

The structure of foot and mouth disease virus serotype sat1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
217
structure length
192
Chain Sequence
TTSAGEGADPVTTDASAHGGDTRTTRRAHTDVTFLLDRFTLVGKTNDNKLVLDLLSTKEKSLVGALLRAATYYFSDLEVACVGTNAWVGWTPNGSPVLTEVGDNPVVFSRRGTTRFALPYTAPHRVLATVYNGDCKYKPIPTTFNYGMIYTQAEVDVYLRMKRAELYCPRPVLTHYDHNGRDRYKTTLVKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Foot-and-Mouth Disease Virus Serotype Sat1.
rcsb
molecule tags Virus
molecule keywords POLYPROTEIN
total genus 37
structure length 192
sequence length 217
ec nomenclature
pdb deposition date 2009-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wzr100
4GMP1 5K0UA 1DDLA 1PIV1 4PDWB 4WM7C 1E57A 1VBA2 4QPGB 1RUD2 2RR11 5CFDA 1RUI1 2WZR3 1VBA3 4CEYA 2RS32 1RB8G 1ND3C 5FMOS 1AL23 1RUD1 1COV3 2RR12 1AUYA 4RHV1 1MEC3 3VBRA 3VBFC 2RR13 4CDWB 1ZBE2 4CDXB 1RMU2 1K5MC 2BPA2 1VBC1 1RMU1 4CDQB 5C9AB 1HRV1 4CDUA 2R071 4CDWC 4CDXC 1BMV1 1VAKA 1ZBA3 1PO23 1EV13 1Z7S1 1FOD1 1ND2B 1RVF1 4CDQC 5CFCB 1OOPA 1NA1C 5FMOL 2R073 5JZGB 1GFF2 1RUJ1 1EV11 1AR91 3TN92 5BNPC 3JD71 3ZXAC 1ZBE3 2ZTNA 1POV1 5GKAC 3ZFEA 5C8CA 2PLV2 4Z92B 4IV1A 1C8M3 1AL0G 2PLV3 5K0UC 2BBVA 2WS91 1ZBE1 3VDDB 1RUJ2 1AR92 3TN91 5ACA2 1FMD2 5CFDC 1TMF1 2HWB1 4CEYC 1ND3A 1AYM1 2WLPA 5AC92 1RUC1 4SBVA 4FTBA 4Q4X3 1VBC2 1R1A2 1COV2 2WFF3 2XBO2 1R1A3 1AYN3 1AR62 1W39A 4FTEA 2R042 2X5IA 1M06G 1NY72 4RQPC 1MEC2 4RR3B 4AEDB 2RS51 1AL21 2TBVA 1SMVA 1B35B 4GH4B 1QJZA 1OOPC 1VBE1 2HWB2 2ZZQA 3JBG3 5J98B 1POV0 1PVC3 1PIV2 2HWF3 5AC93 5BNPA 2R061 5L7OB 4Q4Y3 1PGL1 3JBG1 1VBC3 4YVWB 5C8CC 1HRV3 1RUE1 5D8AA 2R043 3VBRB 4Q4X2 1RUD3 1NCRB 2RS13 4Q4W1 1RVF3 2RS52 1BEV2 1RVF2 1AR73 4JGZC 1BEV3 5ACA3 2WWSA 1RMU3 1FMD3 1C8M2 3S6PA 4N43A 1POV3 2FZ2A 1AR61 2HWE3 4YVSA 2RM21 1OOPB 5A33B 2PLV1 4QPIA 1D4M3 1FPN1 1RUH2 1VBB2 5ABJB 4N43B 2X5IC 1MQTB 5A32A 4RQPA 1QJY1 3ZFEB 1RHI1 2BFUL 2HWD3 5L7OA 1K5MB 2IZWA 1PO12 2WS92 1HX6A 4RQPB 4JGYA 1QQP2 1NOVA 5D8AB 1RHI3 2WS93 1VB4A 1EAH1 1VBD3 4CEWA 1AYN1 2HWE2 4CEYB 2R062 3ZFFA 1EAH2 1AR83 5D8AC 5FOJB 1RUH3 1V9U3 3CJIC 2HWB3 3JBG2 5BNNA 4GMP0 3VBSA 4YVWC 1EAH3 1NA1B 5C8CB 1VBD1 4BCUA 1EV12 2GH8A 4IV1B 4Q4Y2 1V9U1 2HWC2 1NCQB 4JGZA 2HWF1 1RUI3 3JB4C 5C9AC 1VBA1 4QPGA 4Q4V2 4N43C 2VQ0A 4IV3C 1NY71 3M8LA 1ASJ1 4RR3C 5J96B 1OPOA 4GB32 1ND2A 2HWD2 4Y5Z0 2GSYA 1RUE3 2BUKA 4YVSC 1A6CA 1VRH3 4WM7B 4QPIC 2Y26A 5CFCC 2RS53 1HXS1 2MEV1 4IV3B 5JZGA 4FTSA 1ASJ3 2RMU1 3LOBA 3IDEA 4JGYB 5AC91 3VBOB 1RUF2 2R063 1PO21 5ABJC 1CJDA 1FOD3 4Q4Y1 5C4WB 1BEV1 4CEWB 5L7OC 1ZBA2 4PDWC 1MEC1 4RS5C 4AEDA 3VBHA 4JGYC 3VBUC 4EJRA 1CD3G 3VBOA 2R041 1HRV2 1R093 3VDDC 2RM23 2RS11 4CEWC 1PO13 1FPN3 1NCRA 2RM22 3ZFFC 3JD72 2RS12 3CJIA 5BNNC 1PGL2 1NCQA 1R091 3VBSC 1ASJ2 4YVWA 3ZFGA 1WCDJ 1PO11 1R081 3J8F1 1QJU3 3DPRA 4QPIB 3HAGA 2XPJA 1RUJ3 1AL22 1TME3 4Q4W2 4YVSB 1AR93 5C9AA 4QPGC 4IV3A 1BMV2 2HWC3 4RR3A 1ND2C 3NAPA 1ND3B 1HXS2 2MEV2 1VBB1 2XBO1 1TME1 4Q4V3 5CFCA 5JZGC 1QJX3 1B35C 4GH4C 4FSJA 2HWD1 2WFF1 5C4WC 1R1A1 1QQP1 4WM8C 1VRH2 2XBO3 1TMF3 1BBT1 1HRI2 4Q4V1 1AYM2 3VBHB 1QJX1 5ABJA 1MQTA 1AYM3 1QQP3 5BNOC 4PDWA 1AR72 1RUF1 4RS5A 1QJY2 1Z7S2 4AEDC 3VBHC 1PVC1 5K0UB 4Q4X1 3VBUA 1VBD2 3VBOC 3CJIB 4Y4YA 5BNNB 1VRH1 3VDDA 4CDUB 1VB2A 1IHMA 2WZR1 1X33A 1NCRC 1HXS3 2MEV3 1TME2 1RUF3 1COV1 5DDJ1 4RHV3 3VBUB 1NCQC 5LK7B 4RHV2 3ZFGC 4GB31 1PVC2 1H8TB 1VBE3 4N53C 1RUI2 3DPRC 2HWF2 1PO22 1HQNA 4GB33 1X36A 3J8F2 1QJU2 5A32B 1Z7S3 2R072 1H8TA 2RMU3 2ZAHA 3NAPC 2WFF2 2RS33 1C8NA 1AR63 1AYN2 1PGW1 2HWE1 4NWWA 1B35A 4GH4A 1RUC2 5C4WA 1D4M1 2DF7A 4Q4W3 4WM8A 1R083 4WM7A 1QJU1 2RS31 5BNPB 1OHFA 4LLFA 1AR71 1ZBA1 1VBE2 1MQTC 5ACA1 1FMD1 5BNOA 1BBT2 1HRI1 3JB8A 1TMF2 4WM8B 1F2NA 1QJX2 3ZFGB 3VBRC 3FBMA 1D4M2 1VBB3 3VBFA 5CFDB 2RMU2 5DDJ2 1K5MA 3JD73 1HRI3 1RUE2 5BNOB 3J8F3 4JGZB 4RFT0 2FZ1A 2WZR2 1RUC3 4CDUC 3VBFB 1C8M1 1AR81 4CDWA 1QJY3 4CDXA 3NAPB 1F8VA 1V9U2 2HWC1 4N53A 1RUG1 3TN93 4CDQA 3VBSB 1FOD2 1RHI2 5A33A 1NA1A 4NWVA 1R082 1RUG2 2X5IB 3ZFFB 1H8TC 3DPRB 4GMP3 1RUG3 4N53B 1AR82 1PIV3 1R092 1PGW2 5DDJ3 2QQPA 1BBT3 3ZFEC 1FPN2 1RUH1 2BFUS 4RS5B 4IV1C 1NG0A
chains in the Genus database with same CATH superfamily
4GMP1 1HN0A 2MPFA 1DGRA 4MVTA 5KXDA 4PDWB 1YO8A 4WM7C 4IE0A 2EIGA 1LHVA 5FPXA 1APNA 2K0GA 2VVDA 3CEWA 1RUD2 2RR11 4HONA 4YPJA 2PHUA 5T5JA 4LBNA 1VBA3 3A0KA 1ND3C 2VOXA 2P17A 3I2OA 5FMOS 3A4UA 1RUD1 2RR12 5IAVA 1LRHA 1CJPA 3U78A 3WW2A 4OUSA 5F5QA 1O4TA 2WRAA 2LM3A 4YG6A 4DZGA 3TEWA 1JZ4A 5GZFA 4F3JA 1CQ9A 5J7MA 3QOPA 4JZRA 1RMU2 4CU7A 3WNMA 3BOPA 5E1RA 1YFXA 3IIIA 2RJKA 1RMU1 3L2HA 2C26A 4GALA 2DYCA 4CDQB 2VTXJ 2X29A 2Y64A 3H9AA 1GZ9A 3EB7A 1SLLA 4CDUA 3K48A 1LHUA 1F5JA 1BMV1 1CONA 2EIDA 1SFYA 5KR7A 1L7LA 4OUMA 5LATA 5ISLA 1HW5A 3WF3A 4M4PA 1WBFA 4NPMA 4FP2A 1DZQA 1KD7A 1RVF1 1X9TA 4LBQA 5CFCB 4ZZ5A 2QZ2A 2QDNA 3J9SA 4QHZA 3WF2A 2VNOA 4QHBA 3AYEA 3NSTA 4BXFA 5LA2A 5JZGB 5F5IA 2PTMA 3RYKA 3UGHA 1O7FA 1YQ8A 4NRMA 3TN92 2P4EA 5BNPC 1IS5A 1V6MA 1YLLA 3POEA 2UY9A 4R9CA 5C6CA 4O61A 5D2AA 1UKGA 3CO2A 1F31A 3OEBA 5LY1A 2P2KA 4XJ8A 1OQEA 4YGEA 5KHHA 3S57A 4DXRA 3I59B 5FPVA 5GZGA 3LSEA 1AXZA 2X10A 1AL0G 1C57A 2VMEA 5GZCA 2BBVA 4IESA 1LOCA 2YROA 5HCBA 2YB7A 3K2OA 4H7LA 4ZU4A 4XIOA 1BKZA 5EJ1B 5ACA2 3A21A 5L19A 3TBDA 1FMD2 3M3CA 1LULA 1RC6A 2B7YA 5FYHA 1DQ4A 4BZ4A 4CEYC 1ND3A 5IFTA 1VLNA 4QPYA 5FZDA 5CZKA 4ET7A 5DZEA 2DVBA 4BM8A 3EBRA 1WUVA 1XXNA 2WLPA 4AVSA 5FZKA 4PLMA 2VVFA 4MGSA 2ZZJA 3E97A 4GAZA 2LS6A 2Q30A 4JX0A 4SBVA 3BKZA 4LXLA 5A7OA 4FTBA 3THPA 1W06A 5EJZB 2GN7A 4HZFA 2FBEA 2IXLA 1P8JA 3B7MA 2FCVA 2Y8KA 4JRAA 4OMDA 4AR2A 2E33A 3AKPA 1C28A 2VUCA 1AYN3 2GMEA 3EHKA 4XHXA 2FDKA 4QDRA 3POSA 4UI9L 3WD5A 3ON7A 4LO4B 1G9AA 3TWIA 5A7WA 3ZYFA 5JPMB 1JYWA 5JSOA 1R1ZA 2MHFA 2VCMA 5FYSA 5L9RA 3WV6A 4XQ4A 5BUVA 1QOOA 4QKFA 1A8MA 3IMNA 4TLGA 2D5HA 2TBVA 4XURA 1B35B 4RL7A 1QJZA 1CR7A 2HWB2 2DUPA 2ZZQA 4EWEA 1POV0 3AMPA 3RJ2X 4S2GA 2HKXA 2WA3A 4IXLA 4AG4A 5A7WB 1PIV2 1VP6A 4Y33A 3POJA 1OF3A 1F15A 4Q0UA 5AC93 5BNPA 3WQ0A 3D6EA 3VB9A 2VVEA 1VALA 3WINE 4ZPIA 1E5SA 2R16A 3ZM8A 5JI9A 3CBNA 1XNTA 3IDAA 2D6KA 2JG9A 3JBG1 1PGL1 3HEIA 5IFPA 2CHHA 2XKOA 3AZXA 1T6GC 1HRV3 4NHKA 3LFIA 4XUTA 1S0IA 2RDNA 5GM0A 5IVCA 1JYVA 1UWWA 3HOBA 2R043 5F3IA 3VBRB 4P9XA 1QH6A 1OBNA 1UL9A 1W8HA 4KG0A 1NCRB 3VZMA 1JS9A 3PHMA 3K3OA 4UFJA 1W6MB 1W6OA 1WCQA 5GLUA 4AEJA 4RFRB 2BOJA 3BU7A 2PYTA 3GF6A 2RS52 4QDQA 4Y1VA 5IVJA 4TWTA 3ZYHA 4GA9A 4AI8A 5A7NA 4JGZC 4M00A 3OD0A 2I45A 3L2YA 1A78A 4AGVA 4D6RA 4UW5A 3S6PA 1BCXA 3ZYRA 5F1RA 4IERA 1UZ0A 3LA3A 3RMYA 4GJYA 4D7YA 4M3CF 1S2BA 1LESA 2HWE3 2FZ2A 2W47A 4YVSA 1OFNA 3WX5A 2YXSA 1UQXA 1OOPB 2P5BA 3HNMA 3LDBA 3KD4A 4HL0A 1H1MA 3D5OA 1FPN1 5C5UA 1G6NA 5F6KA 2BU9A 5T54A 4JKMA 4MX3A 4V1PA 5ABJB 1H1AA 3PUQA 3BUCA 3ZN6A 2XL7A 3IN9A 4YM1A 4Z2AA 2YBPA 5T3NA 4Q8KA 2O0OA 3VL9A 2CAVA 1RHI1 3DECA 1MR5A 2BFUL 4YM2A 1PVXA 2ID4A 4WVVA 5F9TA 1GMMA 1CPMA 4P00B 5L7OA 3ETQA 1AZDA 4CP0A 1WGPA 2EAAA 3FFQA 5F37A 2IZWA 3THDA 2ZX1A 3BALA 4YW1A 4UW6A 5D8AB 5DAVA 1QXJA 4IEPA 2GMPA 4OZXA 4CXWA 1EAH1 1Q8VA 4E2GA 3ZN4A 2A5ZA 2Q5TA 1VBD3 2B9VA 3NJZA 3PJQA 3SH4A 2ZACA 4YZ5A 4RGAA 4Y22A 3QBQA 3UKNA 3DXTA 4QGMA 2WIIB 4LPLA 4MH0E 4QX7A 1RUH3 1I9RA 5D8AC 4E4ZA 3CJIC 5FOJB 3OEAA 2J7MA 1UIJA 2CY6A 3FBYA 3MIFA 4CCDA 3W20A 2VGDA 4ZHNA 4XCAA 1TNRA 1SBDA 2WR9A 3E6BA 1NXD1 4XDQA 1H2MA 5FLJA 3H0OA 5FY7A 5A6ZA 3LPFA 5B4XA 1XU1A 5FP7A 3LE0A 1AVBA 2CTVA 5FUPA 1IG0A 4IV1B 3KVBA 4CCKA 2HWC2 4UF0A 4GIQA 5FJKA 3T2QA 3AL5A 2HWF1 5FAXA 3WDWA 3JB4C 4EN0A 1VBA1 4L11A 1XC6A 3UETA 3POBA 1KDKA 1ASJ1 1EYBA 2EALA 3WCSA 1IZ3A 1OPOA 4QB6A 4Y5Z0 3UYJA 2GSYA 5A70A 4UF0B 2Y38A 4HVOA 1SDDB 1A6CA 2JDPA 2NQYA 4NPRA 3LB9A 5JXIA 2Y26A 4HVRA 2VOWA 3GZAA 3TYJA 1PZ8A 1RIRA 2BTVC 4HLTA 4ZU5A 4AHZA 4FPEA 2AYHA 3N7JA 2RMU1 3VZKA 3LOBA 5J1XA 1RTVA 4JGYB 2WZEA 2NZ9A 4IEUA 5T5PA 4A4AA 1QY4A 2D3RA 5AC91 3VBOB 1ULFA 1PO21 3MLKA 4QM9A 5FZFA 5LRRA 5C4WB 4HBNA 1BEV1 5JUVA 2XJRA 2Y0OA 5L7OC 1KS4A 2KR2A 2JDYA 3WHUA 2ZKLA 4BK4A 4OI1A 2C1FA 3SKJE 3NNMA 1EPWA 1WMDA 1JHNA 1CZTA 5FQ0B 3NJVA 4KU7A 1H0BA 5DG2A 5EXOA 3N9LA 1XNCA 3VBOA 3WNOA 3WSOA 2QTWB 1CPNA 1W8TA 3FFZA 3M3IA 1V6KA 4YW5A 4NHXA 4URAA 1UOFA 2A6YA 1QJFA 3NW4A 5FZ0A 4AAXA 4TZDA 1N47A 3V0BA 1JBCA 4ZS3A 5FY4A 4Q27A 4DFSA 3PURA 5A6YA 4Y24A 4NJ4A 1NXMA 4RN5A 2OPWA 3PVNA 3VBSC 2PA7A 3SCGA 3O5SA 3RDIA 2DURA 2AH2A 3R4SA 4AVAA 4JHTA 1W8UA 4LBJA 5FYZA 4EWAA 2E7QA 1WLCA 4BMBA 3RZHA 1TME3 3UGGA 3D82A 5CBLA 4LA3A 1CAXB 3G6JB 1C1LA 1BMV2 4LOSA 3N7LA 4RR3A 5FP4A 1ND2C 1WD4A 2XLGA 2XH6A 3NAPA 1O3RA 2WO7A 1VBB1 2DVGA 1CX4A 5LWBA 2WBKA 1UPSA 2W1WA 4P5HA 1JOJA 1PHMA 4Q4V3 5FTTC 5IK7A 2P1BA 2RE9A 3WP4A 5CFCA 1XB9A 1B35C 2WO2A 1NZIA 1LEMA 1Q56A 1U5XA 4P08A 2DVAA 1R1A1 3K77A 3DCQA 3PMSA 4MG2A 4ZONA 5C33A 1BBT1 3KT4A 4SLIA 1DGLA 1AYM2 2PHRA 3NJXA 4WBBA 1QJX1 2CAUA 1N1YA 1OD3A 5DG1A 3B01A 1E5HA 5I0UA 1MQTA 3CL1A 3D8CA 4RYDA 5JSRA 4LHKA 2ES3A 4PDWA 1JOBA 1G9DA 4RS5A 4AI1A 1F35A 1PM7A 3MI8A 1M4WA 1XYOA 1Z7S2 3TAYA 4AEKA 5K0UB 1TG7A 1S4CA 4ISRA 2D6PA 1WLDA 3VBOC 3CJIB 4Y4YA 5BNNB 3OSDA 1CIWA 1NQDA 2FQPA 3OYWB 1ZREA 2YGLA 3IAPA 1HXS3 1TME2 2Q1MA 3G7DA 2XJSA 1RUF3 2XJUA 1BYHA 4IE5A 4LNVA 4XUQA 4YG0A 5DDJ1 2Y60A 1YIPA 3IAQA 5T50A 2EA7A 3FMGA 5T5OA 2ZHMA 1O59A 4LE4A 1NCQC 2QQNA 4QXKA 1IS6A 1LENA 4MGQA 4ZKTB 1GNZA 1NX9A 4GB31 1WKYA 3CU7A 1ENXA 3SHRA 2D6MA 2DBIA 2ZGPA 4XDPA 4JHZA 1VBE3 3RQ0A 1H4GA 1DU3D 4P9GA 3DPRC 2FDGA 1ZX5A 5FY9A 3GDBA 3VZJA 4AVCA 1HQNA 2YPDA 5FYUA 4GD4A 4N90A 2R072 3N7MA 2PQQA 4FPLA 2K9ZA 3Q8CA 5A3OA 2IXKA 2RMU3 4XETA 3NAPC 3ACHA 1N1VA 2ZX3A 1GZWB 2V09A 3POYA 2G9FA 1ZZBA 5FZLA 3URFA 2IFWA 1WMEA 3R0RA 1OMIA 4OZOA 4HN0A 2WNEA 4NWWA 3ZMNA 1B35A 4DXSA 1RUC2 3WDUA 4HKOA 3SEPA 3N9QA 2LUWA 1PX4A 1WCKA 2G19A 3H3UA 1R64A 2EVXA 4PQQA 1LJ7A 5CG9A 1QJU1 2RS31 5BNPB 1U12A 1OHFA 2W08A 4LLFA 3ITQA 4A7ZA 1G9BA 2CL2A 1AR71 1ZBA1 2V5DA 1VPHA 2C9KA 2XJQA 1SLBA 4YFWA 5FY0A 2DU0A 5A7PA 4HSJA 5DZFA 3BIWE 3M2MA 4UW4A 5FUNA 1F5FA 1QHDA 4NIGA 1QJX2 1QNWA 3O0WA 1LEDA 3ZYPA 2Q8OA 3GXUA 3LPGA 4FT8A 1MVQA 4UFLA 4XXAA 1S0EA 2VG9A 3UT0A 1JODA 1SBEA 3VBFA 3ZYBA 3H7JA 5HBAA 1K5MA 4IQPA 1N3PA 3K4AA 3PIJA 4Z8BA 1YQ5A 5A3LA 1KXGA 5DN2A 2PN5A 1CAVA 5F6LB 2FZ1A 3LQCA 5A6QA 5JWPA 1N3OA 3MPPG 2Y6LA 4XE9A 4EE2A 3VBFB 1AR81 3LDRA 4CDXA 4H14A 1ULDA 5J36A 3ZSJA 1UZWA 2D6LX 4QX8A 1UO9A 4Z82A 3VDBA 3WW1A 5FOBB 1CAVB 1VRBA 3EXUA 3GHMA 1QKQA 1CVNA 3VBSB 2YV8A 1RHI2 5KBFA 3O0VA 1GR3A 3D4KA 1UYZA 3MDPA 2A6WA 2WT1A 3GBFA 5FO7B 5IAXA 5IVEA 4XF0A 5A80A 1BZWA 3FC0A 3V56A 3ZFFB 1LECA 3S5AA 4EV0A 5FXWA 2VC9A 3ZYGA 2RDSA 5EHDA 4BU2A 4KH9A 3VGIA 1RJ8A 5FZ1A 3FHIB 4IGOA 2VZOA 1E5IA 3LOIA 3ZFEC 1BLZA 1RUH1 4A42A 2EXIA 3T4VA 4N7IA 2FCTA 3VZLA 1HDKA 3IPVB 1UMHA 4IV1C 4JQRA 4LBQD 3RZMA 4MHRA 3ROUA 1SFPA 4QAWA 3VLBB 3OGVA 4XFHA 1O8PA 2GN3A 5FMCA 1PIV1 2EICA 4XTMA 4LHSA 4LKEA 3VZOA 3OGRA 2G9ZA 4XJUA 4QPGB 3MZHA 2QQKA 2ZA9A 4AFBA 5CU1A 5JLVA 4DUXA 4K6BA 3DV8A 1W2TA 1CIYA 4NE9A 4UFMA 2RS32 5CIRA 2XWBB 4MGKE 2D93A 1AL23 1UIKA 1Q43A 2B4KA 1COV3 2UWCA 3ACIA 4JTOA 3PDQA 4BLJA 1AUYA 3O14A 4TYSA 1MVEA 1MEC3 5C3PA 3M3OA 4LK7A 2JECA 2RR13 2NMOA 1IPKA 1BVVA 3PIGA 4CDWB 2VZ1A 4FCAA 3S30A 2KM2A 5C3RA 2XVKA 2BPA2 1KITA 4EN7B 2QQWA 4XFBA 4HPKB 1VMHA 1JYIA 1VBC1 3AMQA 1DLLA 2ZABA 4NIDA 1ULGA 2QQVA 4Y1UA 2R49A 1QEXA 3USUA 2BRTA 3SH5A 2ZAAA 2W3JA 4CDXC 4CU9A 5K7PA 4XUPA 3HQXA 4FQ4A 5FZGA 4CP1A 5C3OA 1EV13 1Z7S1 3H3ZA 3CMGA 4M0NA 3H8OA 1XPWA 5EIYB 4QQHA 1PZ7A 2ZX4A 2JG8A 3RGBA 3ST7A 4DEVA 5DUVA 3C8XA 3CJXA 5FKBA 5DPNA 1GFF2 4ARYA 3W21A 4IGPA 4L8QA 2XUEA 1MS9A 1AR91 4LHNA 5FK7A 4YGBA 1Y9GA 1KFUL 1YXWA 3ZXAC 4AQTA 3ZX7A 1NE4A 3AKSA 2ZTNA 3ZXEA 4DS0A 3WEZA 4E27A 1V6NA 1LHWA 3CKHA 5HCHA 4YW6A 1IKPA 1UY1A 3C7OA 3ZFEA 5C8CA 2PLV2 5FZEA 3AP4A 1ZYBA 4R8HA 4ISQA 4HSLA 5K0UC 3HJRA 4W50A 4LK6A 1TQ5A 3VDDB 1O8SA 2HYXA 3P1IA 2V4AA 4Y20A 2H6CA 3O1MA 1ULEA 2WNVA 2B9UA 3AZVA 4CP2A 3NKGA 5FPAA 5CFDC 1TMF1 3EJKA 3EYPA 4CTEA 5L9VA 2ZGKA 1J3RA 5E88A 3BTAA 1H6XA 4IE7A 4BB3A 4XF1A 1YCIA 1CN1A 2WL1A 4P5YA 4CP9A 4LULA 2D3PA 4AQ2A 3IIAA 4QT6A 1RUC1 4GWIA 5CISA 4NUBA 1JZ8A 2P34A 3MO4A 5I8SA 4DUVA 2J42A 3KQRA 4IEYA 3SC7X 4BQYA 2A6VA 4XDOA 4FPKA 2DCTA 2C6SA 1AR62 2Z42A 4IUGA 2R042 1UPIA 4OHZA 2X5IA 2WN2A 3P6BA 3T30A 3PUSA 1FT9A 1UNBA 1UZVA 1S0DA 2YU1A 4QPWA 5DUXA 1M06G 5EP9A 4G3YC 1W2AX 4K1ZA 2P3YA 1EPZA 1FATA 2XWJB 3I2HA 4RR3B 1OQDA 2A3XA 4AEDB 2IXCA 3ECQA 2XLAA 2SLIA 4M3CA 2BNMA 2E32A 5A3PA 1VBE1 2VNRA 1PVC3 2J1RA 4G4FA 3I59A 4HKWA 4KL1A 3ZXKA 1OVPA 1VMJA 4AEMA 1FNYA 2ZGOA 3S0MA 2R061 1JYTA 3EMRA 2BYVE 4X6RB 2W68A 2F6BA 4K1YA 2H0BA 4MLOA 4YVWB 1YQCA 5C8CC 5FKCA 3VHOA 5A1LA 3D3AA 2B45X 1POQA 4XF4A 2FDHA 2QFEA 2DCZA 2V5YA 2LRPA 3WDXA 4FPCA 4JTNA 3OBTA 3VKOA 2UWBA 5EFUA 4CXXA 1WMXA 1JI6A 1W8WA 2VULA 4KNCA 4Q26A 2EXJA 4YRDA 2WNVC 4Q2FA 1ENSA 3ZSLA 1BEV2 1X9PA 5A1FA 2QE3A 4AK3A 4Q0QA 3GCXA 2QBXA 2C4XA 2ARAA 1DGWA 5ACA3 1GV9A 3WNNA 4COWA 1RMU3 2P3KA 2PHTA 1C8M2 2E31A 3RVHA 2Y6FA 1LU2A 1K12A 3CF6E 4N43A 5FZBA 2R0HA 2Y34A 2WQ4A 4A6SA 5IK8A 2FDIA 2VOVA 5HPOA 1I3HA 1US3A 4LEJA 1LOAA 1GOFA 4LBKA 3U07A 4FFIA 5I0SA 3U37A 1KDMA 2W2IA 2RM21 3LAGA 4E2SA 2GC2A 2ORXA 3AMHA 1RUH2 3OTFA 3FL7A 1PGSA 4XZPA 1KJRA 1H6YA 4HG6B 4XPVA 4N7UA 4N43B 2X5IC 1ZRIA 5CNAA 4NHYA 5FUIA 5G04L 4LO5B 2Z69A 5FZ9A 2WT2A 1UYPA 3UKTA 1GLHA 5FZOA 4RQPA 3HT1A 5I0RA 1AXKA 4ES8A 4W6YA 5DUUA 3WOGA 2IVJA 2PHDA 3SITA 5IJRA 4MGIE 4EROA 2WSUA 1CGPA 3DXUA 1JZ3A 4TXWA 4I02A 4NIAA 5IVBA 1WMFA 2UWAA 1PO12 1SFNA 2WS92 1HX6A 3AX4A 4OVEA 4RQPB 5HXMA 1NOVA 4YW2A 4FI9A 1RHI3 2ZX0A 5LBBA 2WS93 3JZVA 3O0XA 1TEIA 3U75A 2XHKA 2AENA 4DY5A 2D3SA 4LT5A 3MW2A 4OHYA 4AXOA 4CEYB 3ZYIB 4YW7A 3TNQA 4GKXA 1WW7A 3M7AA 4L2NA 3D0JA 3OOXA 3T1MA 1EUTA 1LHOA 2R6QA 5H9SA 5BNNA 1NLSA 3PVOA 3MIGA 4NRQA 5CVRA 3GYDA 1X8MA 3KZ4C 1F4AA 5FLIA 5FYIA 1G9FA 3JQWA 4K40A 3INAA 3S7IA 2VCBA 1DCSA 2ZHNA 1EV12 2GC0A 1GBGA 3JUUA 1VR3A 3U14A 4EYUA 4OHXA 4PF5A 1HQLA 5JAXA 4Q4Y2 2OX0A 4M3CE 2ZEYA 1NCQB 3NL1A 4YGDA 3QLQA 1Y7BA 1RUI3 3ZIXA 4ZXKA 1V6IA 4FO9A 4IV3C 2J1EA 3CIHA 1QDOA 2YU2A 4GB32 4NRPA 4S2DA 4CUAA 2W0XA 3FUQA 5JR7B 2RVAA 5FR3A 3MPBA 1HB3A 1RUE3 3IM0A 3QH7A 4LOTA 3RFRA 2G1MA 3J7HA 1GQGA 4QPIC 1YEWA 4MUVA 2MEV1 4PQ9A 4LBLA 4B4RA 3OY8A 1W9SA 2ZGUA 1ASJ3 4P9YA 4P9JA 3WHTA 3WF4A 1UF2C 5LK5A 2JX9A 2QDRA 2VTXA 3I2JA 2EXHA 4QX2A 2DUOA 4FQZA 3I49A 3OPWA 4ZS2A 5EV7A 2Y6HA 5D1IA 1RUF2 4FPHA 3ACGA 4DXZA 5ABJC 5DUWA 2QQOA 1LOBA 1ZBA2 4XILA 3SH3A 2OIIA 5CG8A 1MEC1 4QX0A 3OBRA 3RZKA 1W99A 3F2ZA 3KGZA 4DRVA 3VBHA 3M1HA 1LNSA 3K75B 4B3NA 1KJLA 3ALQA 4YNIA 3LKJA 4AVVA 1R093 3VDDC 2RM23 1XE8A 3M70A 5FZ8A 1UY3A 2RS11 2W95A 1FPN3 1DQ5A 1SPPA 4XZUG 5J09A 4IL7A 4J6GA 2QQJA 2ET7A 2W52A 3ZFFC 3BU0A 3JD72 3LZZA 3OPZA 2A6ZA 5DAQA 5IVYA 2Y33A 1EUUA 1DF0A 2DVFA 1UW8A 3HR9A 3ZFGA 2WNUC 2VECA 5EYYA 4A3XA 1PO11 2JDHA 4HOOA 4OI4A 3N9PA 1JYXA 1R081 1W0PA 1W8ZA 4LQRA 1W28A 1VAVA 5H9RA 1HLCA 2AREA 4QPIB 5IWFA 2XONA 1SQ4A 4Z07A 1TE1B 2ZPXA 1AR93 4JKKA 1RXFA 4WVWA 3J26N 5DZGA 4AFMA 1XJAA 1J3PA 4ATEA 3JQXA 4IV3A 1OPMA 1XQNA 4XABA 1A34A 2HWC3 2KXLA 3KM5A 1X50A 3O12A 4F8AA 1OD5A 3GJAA 3O1UA 2XLFA 1YIFA 1TME1 3WG1A 4XACA 3A23A 5LCWL 1O5UA 4BISA 1GNYA 4IEQA 4C0BA 1QJX3 5JZGC 4GH4C 2JD4A 2HWD1 2WFF1 1WA6X 4HANA 1OA2A 4XIKA 3B02A 1QNYA 4C8DA 1WCSA 1XBFA 5C4WC 1QQP1 2JKBA 1SLAA 1YJLA 4LA2A 2ARCA 4DQAA 1VRH2 4XCBA 3K46A 4QGNA 1W2OA 3T2TA 4P02B 3WP3A 1Y9QA 5A3WA 4M01A 2BWAA 2B39A 3AXDA 1TMF3 1BQPA 5FQ0A 3VKNA 2ZMKA 1BK1A 4LE3A 3IDCB 3C7EA 4QX3A 3FE5A 5ABJA 2VUDA 4C0HA 5A6XA 1AYM3 3A0NA 4CUGA 4YWAA 5TSWA 4DO0A 2WAAA 1QJY2 3V64A 4Q4X1 3VBUA 1D0GA 2VCCA 2PAEA 4YARA 3P3NA 3VDDA 5JIUA 5L73A 1ODMA 3T0BA 2IXIA 2WZR1 4O65A 2QQLA 2PMWB 1KFXL 2MEV3 3N9OA 5F8PA 3RI9A 2XJTA 4H55A 4URTA 1LOFC 2R32A 4HXCA 3KS7A 5JDBA 1UY2A 2Z79A 3TRSB 3VBUB 4FOYA 4GQ7A 2W46A 2VMDA 2VZRA 1V70A 3GNEA 4DY3A 2WNUA 5B4NA 1J59A 2VXJA 1PVC2 2OA2A 3P5BA 5JR2A 1H8TB 2ZGNA 3FX3A 1W6QA 4N53C 1Q8OA 1ZM1A 1UMIA 4JC1A 2HWF2 4P9WA 1PO22 1YFUA 4WV8A 3I3MA 5FMBA 1MS0A 5FO9B 5DAXA 2NPIA 1W0OA 2ZGRA 2RV9A 4D6QA 2JWPA 3KV4A 3RPQA 2IWGB 2D97A 5A32B 3KHCA 3MUZ1 4H2AA 1LOEA 1H8TA 1H30A 2I74A 1W2UA 5K4LA 3T2OA 4OLLA 4EQVA 4AHXA 5LBFA 3RZGA 2WFF2 2RS33 5F7UA 3WDVA 2V4VA 3HBKA 1O91A 3MFCA 1PGW1 2IC1A 4GWNA 2AUYA 5GLWA 2Y6JA 3UGFA 4K7JA 3FUOA 4E9KA 4XBLA 3RRDA 3CQOA 4L92A 4Q4W3 4WM8A 3ZDVA 2UU8A 3NO8A 5SV8A 2FDFA 1D4VB 1H2LA 2GMMA 1IPSA 2UYBA 3ZIWA 1UMZA 4IEWA 4QWNA 2VZPA 5I0DA 4IE6A 3ZMOA 4CXYA 2WQZC 4G9SB 2XDVA 4B4PA 2Z4FA 1QGLA 1HJFA 3WQ7A 4JKLA 4UBGA 1UN1A 2AGSA 4IEVA 3I3EA 5FXZA 5BNOA 3SCFA 4WM8B 1F2NA 4QU2A 5KC6A 4ONUA 1S55A 3I3DA 1Y3TA 3IZOA 1IS4A 3E6CC 1LU1A 2YC2A 4BQ3A 3DGTA 4HN1A 1BHGA 4Q8LA 3MGUA 3RWKX 3VBRC 4CU6A 5JCTA 1D4M2 1Y9MA 1NLQA 5KHIA 2IFRA 3VKLA 4DOUA 5CFDB 2WLQA 2JB8A 1SLIA 1W04A 1HRI3 1RUE2 3OBZA 5JOZA 5BNOB 2PAMA 5F3EA 4PIYA 1PK6A 4JGZB 3MYXA 2VZSA 1OH3A 1OURA 5LEKA 4QKNA 4OQ9A 5JXGA 4I2OA 1YI7A 4CDUC 3PUAA 2EAKA 3FN9A 4RA0A 1A3KA 1AX2A 1RITA 1ULPA 3UKVA 3TEXA 3MBWA 2R1DA 4XJAA 1UOJA 5C71A 3USSA 5CAZA 1NT0A 1OA4A 1F8VA 5F3GA 2YGMA 1H9PA 2HWC1 4MXWB 3KCCA 4N53A 1YFWA 1RUG1 2VW1A 4XAAA 5LA1A 4EN9B 3TN93 2BWCA 3EO6A 4FXKB 3ZR6A 3MLLA 1HQWA 1NA1A 1PM4A 1JOPA 1S0GA 1YJKA 3DF0A 4JDOA 3JCIA 2XVLA 1R082 1RUG2 4KU8A 4BQ2A 2QZ3A 1Z78A 2ARXA 4FP3A 3C7HA 4KGQA 3V0AA 4C1WA 1S2KA 1XNKA 5AVPA 2BGPA 1H8TC 2EXKA 3ACFA 1RUG3 3LA2A 4GJZA 4MXWA 4M3CB 4N53B 1AR82 5IW0A 3T0AA 3MHZA 1PIV3 4XVHA 3F95A 2XMLA 5DDJ3 1BBT3 2PHXA 1FPN2 1CAXA 2BFUS 2P3JA 3MIHA 3K3NA 3N35A 4E4DX 2A75A 2BGOA 2HEVF 5ANQA 4BQ5A 1XOYA 1QIQA 1RXGA 4XJWA 4FXGB 5FPLA 3NJYA 4Y5TA 3N4MA 2XL9A 1DDLA 1OLRA 2ZXQA 1MS1A 2VE1A 3LWCA 4K21A 2O8OA 3AYAA 1NZCA 2WZ8A 3CZUA 2WNOA 5KC5A 4I0BA 1YRZA 3NNJA 2ZHKA 2A6XA 3H1MA 3PVBB 4LHLA 3T08A 1RUI1 3WCRA 4CEYA 2ZMNA 1UU6A 4CVUA 2HBTA 4AWDA 4RHV1 2E51A 2WSVA 4RGKA 4XUOA 3WLUA 1Q8PA 3VBRA 3ZXFA 4D8MA 1ZZ9A 3WDTA 5ERLA 4DB5A 1JYNA 5E16A 4CDXB 5T5LA 1ZRFA 1ST8A 4DNYA 1DYPA 5LY2A 1W6OB 1W6MA 2JDAA 3HT2A 4OMCA 5B2GB 2JDZA 3PUHA 2WABA 4NN0A 5HXVA 2PAKA 3E5QA 4B1MA 2O8QA 5C9AB 1HRV1 2WDBA 3KQ4B 1IQAA 5EPAA 3POWA 2D98A 2VD7A 3OYWA 2R071 4LLOA 3QACA 5FYVA 3BCWA 5JIAA 4CDWC 3HMYA 1DBNA 1VAKA 3L9JT 5FZAA 1ENQA 3WNLA 1ZBA3 3QCWA 4RGGA 3ZSKA 4QXCA 1JXNA 2GP5A 1UXZA 4X8NA 3VUOA 5A3UA 1ZZ6A 4O9EA 5JMOA 1N1TA 3Q9OA 3WR0A 3J7MA 2W1QA 1OOPA 1NA1C 5FMOL 2AR6A 3U0ZA 2R073 1VJ2A 4UW3A 1DG6A 5FZOB 3O1VA 3FLTA 4O9GA 4INDA 2BP6A 3VD7A 1W3XA 3WNKA 2CDOA 3V0BB 2WYFA 3DYOA 3N36A 4ES9A 3JD71 1KEXA 3AL6A 5JSPA 4KWUA 3IBMA 1ZBE3 4PLNA 3LF7A 1IKQA 4PIZA 2JG9C 2DCYA 2RDRA 3B94A 4D94A 2NP0A 1RGSA 5FBZA 1C8M3 4BQ1A 3I97A 4C90A 3PMEA 2PLV3 2E63A 4UWDA 4BMEA 1AXYA 2QCSB 2NM1A 2W87A 1ZBE1 2JG9B 2TUNA 2VOTA 2WT0A 2WS91 2ZGQA 2ZS6B 3SNMA 3VDCA 4CYDA 1RUJ2 3MLJA 3O1TA 5GZEA 1AR92 2H6BA 2OUHA 3KVAA 4R9DA 4V2WA 4D3WA 3NQHA 4CCMA 3R05A 4XQWA 1GNHA 4Q5OA 1ALYA 2QQIA 1SHWB 2PHLA 2CGPA 2RJ2A 2WINB 4Y22B 1FI2A 3SISA 1KS5A 3LEGA 3ZPYA 2VQTA 5GLZA 3WF0A 1AYM1 1WWYA 4Y1XA 4ASKA 5AC92 4JDMA 2NN8A 3HWJA 1LR5A 5CKQA 4JV4A 4CCJA 1B09A 5EJ3A 2WWJA 4Q4X3 2Q8DA 3VHNA 2UY8A 5E8AA 4AVTA 3SQOA 1W9FA 1ZRCA 4UFKA 2FCUA 4LUKA 1W39A 4A41A 4FTEA 4LBQB 5F32A 4UT5A 1OH4A 4XFCA 1OUSA 3ASIA 3POFA 4GZ9A 4CCEA 4BXSV 3SXWA 1IG3A 1W6NA 2XG3A 3WVJA 5KHJA 3LEIA 3HN1A 1SLTA 3WW3A 1CWPA 1SMVA 5KWRA 4YLZA 1OOPC 5LASA 2PHFA 2OKXA 2AACA 4CRQA 4FBFA 5FMDA 2YC0A 2YFZA 1I5ZA 3FZ3A 4FFHA 2ZBJA 2HWF3 2VW2A 4Q0PA 4WVZA 3ZVXA 5FBJA 2CSGA 3BGAA 4UYBA 5FFOC 1ACCA 5GLTA 4XMAA 5L7OB 5K8SA 4Q4Y3 4J1WA 2J1SA 4TN7A 3WZ1A 5J48A 1VBC3 1LKNA 1GICA 5A1AA 2D5FA 5IATA 1OFSA 1W8OA 1RUE1 3OGSA 4XEZA 1W3VA 4HMZA 3SMHA 2D44A 5D8AA 4QX1A 4PJYA 4B8EA 3CZJA 3M3QA 4KG8A 4A3ZA 1QF3A 4P14A 1GOHA 1RUD3 4Q4X2 4XFFA 2VR4A 2RS13 5IVFA 3VHPA 1K5JA 2C5DA 2DBNA 2DTWA 1RVF3 3IB3A 4E8CA 5FZ4A 4I3PA 4Z2WA 3WW4A 3WDYA 2WAOA 1EY2A 2CWSA 1NUKA 1G9CA 1UAIA 5JOXA 3WNPA 4H3WA 1UY0A 1AR73 2DUQA 2ERFA 2I2SA 1UOGA 4K9SA 2VBBA 1HB1A 1STMA 1BEV3 2WWSA 3H50A 5LZ6A 4YG3A 5FZIA 1FMD3 3BYWA 1K3IA 5BYNA 1POV3 1WW4A 2WNUB 3ZKUA 1V6LA 2OXBA 5FREA 1UXXX 5FV3A 5A33B 2A71A 4PI0A 2PLV1 1D4M3 1J3QA 2Q1FA 3HD8B 1ZA4A 4QKDA 5JOYA 2GNMA 3BN6A 2VNGA 4PI2A 4DXTA 2DVDA 4E4HA 2Q1ZB 5LW9A 2BNOA 3RSJA 1ZA7A 3W5NA 5A32A 4BJ0A 4ITCA 1DQ1A 4XFIA 1MS5A 1YUDA 2ZKNA 2J1UA 2I07B 4C1XA 1NQJA 4AVBA 1XRUA 1CAWB 3CDZB 4XMIA 5H9QA 1WA4A 4GXLA 5BPXA 1OT5A 4H7MA 3SLIA 1K5MB 3DUIA 1D2QA 3B93A 1SCSA 2CWMA 1CAUA 1QQP2 3GM8A 4PBOA 5JOWA 4CZSA 4JRLA 4FVVA 1DYKA 1TNFA 4LIUA 3DKQA 1VB4A 2F17A 5FWEA 3AZWA 2Q8CA 4CEWA 4OULA 2BV4A 1AYN1 2HWE2 2TEPA 1W8FA 3KF3A 4FOWA 3UV9A 4A7KA 4W6XA 1KQRA 4BWOA 1EAH2 1AR83 4WZFA 1CAUB 3GHNA 3JBG2 1Q8SA 2QQUA 4FPYA 4GMP0 3VBSA 3GBGA 4YVWC 2ZGMA 4QDSA 1EAH3 3DN7A 3MIBA 1WW6A 2VZTA 5C8CB 4Y3OA 4BCUA 4AFDA 4COYA 4XAEA 3VKMA 4LIVA 2G4IA 1V9U1 4R4ZA 5EQUA 3SEEA 2R7EB 1US2A 1LHNA 3TB0A 2JIJA 3AKRA 1E5RA 4JGZA 4B7EA 1YI9A 5C9AC 3KSCA 4AHYA 4UFIA 2G9GA 2VU9A 3ENRA 4Q4V2 4ZY9A 4FOVA 2VQ0A 2XXZA 3ILFA 1NY71 2WQ8A 3KB5A 1OUXA 3IPVA 3M8LA 3KLSA 4RR3C 3Q8BA 1ZVFA 3TOJA 1ND2A 3MIDA 2YUEA 1WD3A 2BUKA 2YDEA 4GWMA 4YVSC 4QU1A 4DRRA 2DFBA 5SV5A 3RJRA 5HV0A 2NLRA 4WM7B 4XOGA 5I91A 5CFCC 3BPZA 2RS53 1HXS1 2ZGLA 2V72A 2XKPA 1XSQA 3GZUC 4I01A 3I2FA 1PMHX 4FTSA 4BK5A 5KXCA 1IOAA 3AP9A 4R9BA 2YBSA 3FWEA 4ARXA 3V0AB 4BQXA 2OQ6A 4AW7A 1ODNA 5LB6A 2R063 2AZ5A 1CJDA 5FLHA 1OKQA 1FOD3 3PUIA 1VE0A 4MZUA 4Q4Y1 5F2WA 3T3YA 3VDAA 4BLIA 2XHNA 4PDWC 1ZZ7A 4LMFA 4RS5C 3VL8A 3IKWA 1DFQA 5IYYA 4AEDA 3OUJA 2E7TA 4EJRA 3RS6A 3OUHA 1CD3G 5CB7A 3POIA 2HEYF 3OB8A 1HRV2 1V6JA 4QB2A 4YZ4A 4MGZE 5LBCA 4DPNA 5BNQA 4YGCA 3BIEA 3KMHA 1S1AA 4CEWC 4AQ6A 1AJKA 3ZXGA 4AOCA 4HVQA 1O4YA 2RM22 1YC61 5GALA 4AQSA 3CJIA 5A3NA 5FP8A 1FV2A 2BBAA 1NCQA 1XSRA 2Q8EA 1PGL2 1R091 2UYAA 4XBNA 4YVWA 1H4HA 4N8MA 2PHWA 4J25A 5JVVA 1WCDJ 4KGGA 3UESA 4D7TA 4E4SA 3FLRA 1GZCA 3AYDA 5ANNA 2CNAA 5E6HA 1F9KA 1QJU3 4DMIA 3DPRA 3NNGA 2ARBA 4XBQA 3J4UH 1GWLA 3HAGA 3ZOIA 1RUJ3 3OF1A 2A7AA 1FXZA 5C9AA 3KT1A 3LDKA 3DKWA 1Y43B 3B5LB 3AVSA 2OVUA 4LUMA 4QMAA 4AAPA 2VBPA 5JI7A 1ND3B 1V6OA 3AP7A 1HXS2 3AZZA 3PLQA 2XBO1 1W8NA 1GU3A 3B9IA 3ZPOA 1W9TA 1J1TA 2A3YA 2VO5A 4OHWA 4W6WA 3WG3A 2VZVA 3AXEA 1PMIA 2XUMA 3M3EA 4CE8A 4KWLA 2K46A 2JB4A 1T6BX 1V0AA 4P9IA 2VJXA 4E8DA 1AX0A 2WZPP 1UD1A 5HCFA 2W39A 4CA9A 3S7EA 2BOIA 2VUAA 3C7FA 5JXHA 2RHPA 2H0VA 4I30A 4QQ2A 3MV01 4Q4V1 3THCA 5I93A 2JICA 3I3QA 5CEHA 2D43A 2XJPA 2BEOA 3NRUA 2GNBA 1MS8A 1T2XA 2ZHLA 1J84A 5FZ6A 3N9MA 1QMJA 1AR72 4PF1A 4WZCA 1U5IA 4Q0VA 4AEDC 4Y26A 1PVC1 5IK4A 1UY4A 2XR4A 3GZTB 4J1XA 1VBD2 2QJVA 1C5HA 3D0SA 3ILRA 4NHLA 4ZXEA 5I8TA 2E26A 1JZ6A 3WUCA 1VRH1 4CDUB 1VB2A 1DZTA 1IHMA 2C9AA 4NIHA 1X33A 3UJQA 5IHRA 2C0ZA 2FHRA 3LSDA 3SKVA 5CYYA 1A8DA 4RHV3 4OFGA 5C7GA 4BDVB 2D6OX 4BH9A 4CCNA 1DP0A 3LEKA 4KI5M 4RHV2 2DDUA 1PMJX 5BXXA 4XXPA 2O1QA 4JDNA 3OG2A 1GQPA 4V2VA 4COUA 1XU2A 5K9YA 3BPSA 1RUI2 2HLEA 1YQ2A 1HN1A 1DQ0A 1FNZA 2W9XA 3MW4A 1X8EA 1NYWA 2JE9A 3HQRA 4YM0A 1U5YA 3TNPB 3AVRA 4QX5A 3KCYA 4NPLA 1YHFA 4YZ2A 5L9BA 1D0HA 4O7XA 1JN2P 5EWSA 2WYSA 1C5IA 3B69A 3C3VA 4XJZA 3PVEA 3J7NA 3A22A 1UX6A 1YWKA 1HKDA 4L9BA 3LCPA 5FZHA 4QXBA 4YSFA 5C3QA 1AYN2 2HWE1 3B3QE 1BXHA 2ETEA 4BIFA 3QD6A 3MICA 4NVPA 4XF3A 1C3HA 1D4M1 2ZMLA 1REEA 1S0BA 1R083 4LITA 4A6OA 1XNAA 1NE6A 3Q8EA 4L99A 2XGXA 2VMGA 4N9HA 1OVSA 1VBE2 1ZRDA 1GQHA 1MQTC 3UL2A 3I2IA 5ACA1 2OZ6A 1FMD1 5C3SA 1BBT2 1YYNA 3JB8A 2OPKA 1GP4A 3W58A 1XYPA 4BOWA 4CCCA 4XC9A 4Q1PA 3WY6A 4Z1VA 2JD9A 1VBB3 2N7GA 4JAAA 2VZQA 4Y4RA 2XQRA 2D40A 4D69A 2A70A 2JENA 4ORFA 2LALA 2RMU2 5DDJ2 3BOWA 4NIIA 2ADDA 2O14A 3R4DB 1QU0A 3WF1A 2J1VA 4EWDA 2VM9A 5T52A 4DIQA 1S2EA 4EN8B 1LTEA 2VXRA 3ZXLA 1SCRA 4CU8A 2J22A 3PTRB 2X09A 3VZNA 4BE3A 5JMCA 1J83A 2LW8A 3C2UA 5FXVA 2WO3A 3RYRA 3NAPB 5FYMA 4MXVA 2VQUA 3HNBM 2PXJA 3KGLA 4CUBA 1ONAA 4BPZA 2FMYA 4NAOA 4QM8A 4CDQA 3B9CA 1FOD2 3ZXDA 4EZHA 5A33A 5F5CA 3H3LA 4NWVA 4HFSA 2YG0A 3OGGA 2B8MA 3OD4A 3ME2A 5C8WA 1IPJA 3RG0A 3ZSMA 1RUNA 2X5IB 2A1XA 2W1UA 2EF6A 4NO4A 2VW0A 1DGRN 3KV6A 1Z0HA 3AMMA 2EIEA 1R092 2ZGTA 1UU5A 3LFMA 2VQAA 4CCLA 2WFPA 2VL4A 4LO8A 3O1OA 4NR1A 4XW3A 3WG4A 3I54A 4RS5B 3MIEA 3ZYJB 1AJOA 1OF4A 1MZEA 2JXAA 5K0UA 3MW3A 4XFGA 1UZZA 1YFYA 5AFBA 5KHKA 1E57A 1G86A 1ZNPA 1VBA2 2BGCA 2HYKA 3PU8A 4FPJA 4LTAA 1QOSA 3OUIA 4R9AA 2PQSA 4TSVA 2OW4A 5FCCA 5CFDA 5AFEA 4CCOA 2WZR3 3T4HB 3W59A 1W9WA 3NMBA 5FPBA 4KWJA 3V65A 1RB8G 1G8WA 2CV6A 2RDQA 3I3BA 4B1LA 1PK6B 5JPNB 2ZEWA 1JZ2A 3HNYM 5FY1A 2JIGA 4LKSA 3VBFC 4BQWA 1JZ5A 1ZBE2 2VCAA 1N1SA 5FDBA 1K5MC 3AFGA 4XHBA 4BHPA 3AYCA 3GCWA 2ADEA 2P3IA 3ETPA 4A44A 3RZLA 2HEWF 3KHBA 1GOGA 5I8YA 5FYTA 4MHUA 2JDNA 4NOTA 2QVSB 3PL0A 4K8RB 4UXAA 1HV1A 1PO23 1GYKA 2WA4A 3E5XA 3N7KA 1FOD1 2WO1A 1H8VA 4DINB 5FP9A 1ND2B 2QKDA 4WVMB 3ZO0B 4CDQC 3DL3A 2Y0IA 1V00A 3LGRA 3TEZA 5LBEA 3J7LA 4B29A 5KXEA 4R4XA 3OBAA 4AL9A 1RUJ1 1EV11 4LJHA 3WG2A 1W6QB 2E6VA 3RZZA 4XYXA 1OI6A 1UYYA 1JHJA 5CA6A 3R6SA 1CAWA 1WW5A 1O4ZA 1ZZ8A 3BB6A 3ZSEA 1O3TA 1W03A 1POV1 5GKAC 2D7FA 1J1LA 3NV4A 4F83A 3FLPA 2VTFA 2X53S 1Q8QA 1SLCA 4Z92B 3PJYA 4IV1A 1I5PA 2JDUA 3UNPA 2DCJA 3ACLA 1KRIA 1UOBA 3WQBA 1OLMA 1LGCA 2WC2A 2XB6C 4YM3A 3QH6A 3T09A 4D6SA 2IXHA 2WN3A 3TN91 1OQ1A 5E89A 3VD5A 3OPTA 1H2KA 1DQ2A 1JMUB 2Q0AA 3LIGA 4FPFA 2HWB1 3GALA 4IGQA 3CLPA 5F39A 4QXHA 1MACA 4BA6A 3AKTA 1CZVA 5AVAA 4W65A 4AGGA 2BZDA 1JUHA 1L3JA 4AI2A 3H42B 2BNNA 2P6CA 5IK5A 1UZYA 4JCKA 4LKFA 2VBDA 1VBC2 1QXRA 1R1A2 1COV2 3ELNA 5DMYA 4FPGA 4OYUA 4RD7A 2WFF3 4I0AA 2K2SA 4S2HA 2TNFA 1RUOA 2D6NA 1H1IA 1BK0A 1R1A3 2XBO2 2CGOA 4HKLA 4JQTA 2GNTA 5CKMA 4KWKA 3IDBB 3WT3A 3HBZA 5GJ6A 2GALA 3LIHA 1NY72 4IEXA 4RQPC 1MEC2 1WLWA 4TLFA 2XVGA 5IUQA 4AE2A 1I1EA 2RS51 4Y5SA 5D21A 1GWKA 1JW6A 3AZYA 3CHXA 4IE4A 1AL21 5FZCA 4ATFA 4GH4B 5A3MA 2WKKA 3BTYA 1RINA 2JG8C 3JBG3 4OUEA 3UK9A 3A7QA 5FZMA 5J98B 1DHKB 4LORA 1QDCA 3AJYA 1XE0A 2YMZA 3NV1A 3THTA 5L36A 3ATGA 2FDJA 3E5UA 4AGRA 5BY5A 3VN4A 1MS4A 4QKBA 3WUDA 3HPNA 4PLOA 1S0CA 2BVVA 4GULA 3ABZA 1W0NA 4AHWA 2AEYA 2DU1A 5DAWA 2Z2SB 1WLTA 1L7RA 3W9AA 3H1YA 1PX3A 3LA7A 2BVBA 3VD4A 2XJVA 4BQ4A 2BQPA 5LRSA 2GDFA 4F7ZA 2B42B 2OT7A 3IMMA 4YW3A 3O1RA 4FOQA 3LD8A 4Q4W1 2VOKA 4QQOA 1URXA 4CP9B 4C91A 3ZR5A 2ZOEB 2ET1A 2YYOA 2WWUA 1CESA 4NMIA 1I6XA 3HIFA 2GZWA 1RVF2 5APAA 2JDMA 3UJOA 1C4RA 4N9IA 4DUWA 2YFUA 4XJ9A 3LEMA 5FO8B 4OI0A 2JJ6A 4D0QA 1WCUA 3R4UA 1DIWA 4KQ7A 4L0PA 2C24A 2OUJA 1UYXA 3RNSA 1WZXA 5KHGA 2DWRA 2KD7A 4L97A 1AR61 1W6NB 4K8FA 1XNDA 2JG8B 1ULOA 5F2SA 4HK9A 4QPIA 1VBB2 1OSGA 4CSWA 3NVCA 2CDPA 5FPZA 1MQTB 3MF9A 3WP5A 4AFCA 1K42A 3OJBA 3RMXA 1FAYA 1OLME 3U11A 1QJY1 1H9WA 1W6PB 2Q4SA 4MGYE 3WXPA 3ZFEB 3ZXJA 4XF9A 2J1TA 2LTNA 2VPVA 2HWD3 1XNBA 1CX1A 4FAHA 5LA0A 5J37A 1VAMA 4MADA 4Q29A 4GWJA 3RYPA 2JEMA 4U36A 4JGYA 1RL3A 3HN3A 3I2DA 3BODA 4JVAA 4COVA 4E2QA 4KBBA 4Y20B 1TZOA 4IDZA 2CU5A 1RJ7A 2WNVB 5LEJA 2JKXA 4QQPA 1O5LA 1HB2A 3ZN5A 2GC3A 1O3SA 1S0FA 3VD3A 3O7OA 5CKNA 2AC1A 4AZZA 5IVVA 3AC0A 2VUJA 5FY8A 2R062 1GUIA 3NWKA 2ZEXA 3VHRA 3ZFFA 1GP5A 1V9U3 2RJLA 2HWB3 2VMCA 2DTYA 3AM2A 4PBPA 5FZ7A 3RZJA 1G7YA 2R30A 1D7PM 2HBUA 1NA1B 3JU9A 4HK8A 1VBD1 1VMFA 3GZEA 1XE7A 5G05L 1SACA 1ZZCA 2GH8A 2ORZA 3VKFC 5C5TA 1UCXA 2QUOA 1REFA 1ZRRA 4QB1A 1O3QA 3Q8AA 4OQ8A 1OXCA 4LO6B 1GZWA 1PNFA 2XOMA 2Y6KA 2BERA 1JU4A 4QPGA 4EZ4A 3ORJA 2W94A 2P6HA 1ENRA 3ES1A 1JTZX 3FJSA 4N43C 2ZCWA 1C1FA 5J96B 2GP3A 1F4HA 1H2NA 2AEZA 2E53A 2HWD2 3MFAA 3U1XA 4M4RA 3H8RA 1VRH3 1JYCA 4XQDA 1LOGA 1QWRA 1Q3EA 3KV9A 3U4XA 1IQDC 4PHZA 3BTZA 5JZGA 4IV3B 5F5AA 5IT6A 1MS3A 3AP6A 2YZ4A 3H7YA 2ZGSA 3OGJA 2QNKA 3E6DA 4AFAA 1S0JA 5A3TA 1LGNA 4IW3A 4AI9A 3GJBA 1FX5A 3I2GA 3IDEA 1WBLA 5HCAA 2HJIA 4HPKA 1SEFA 2Y6GA 2W92A 5I0TA 3VD9A 3H1WA 4A45A 3O1PA 3O1SA 3FHQA 4I09A 4W8JA 4QGLA 1OA3A 5DABA 3USUB 4ZU7A 4CEWB 1GANA 1HJGA 2ATFA 1OKOA 3HQUA 3WQ1A 4DEQA 2YBKA 1OLQA 1Q5OA 4BIOA 1YQ6A 2E7AA 5EYXA 2QQMA 3KV5A 4JGYC 3T2PA 1EP0A 3VBUC 5H9PA 4KMQA 1HIXA 2OQ7A 2R041 4ASLA 5M0TA 3DYPA 2VAUA 1JU3A 3ILNA 4AI0A 2VMHA 3IWZA 5FJHA 4P9LA 1PO13 1NCRA 4LR4A 5FIXA 2OS2A 4EN6B 5FPUA 3T0DA 3OCPA 4AYUA 1LOFA 4B4QA 3BTXA 1HV0A 2OZJA 2CYFA 2RS12 4M0HA 4Y1YA 5BNNC 1SZBA 4QQLA 3MEPA 3MF6A 1ASJ2 1IGOA 4CUCA 2NYYA 3H8UA 2J1AA 5FXXA 1QOTA 5A7SA 4D7SA 3E1F1 5T55A 5LA9A 2NMNA 2BW8A 2A73B 2ZEZA 1SBFA 3J8F1 3NV2A 2VY0A 3NV3A 1ULCA 1W2NA 3GBWA 1LAJA 2XPJA 3BI3A 1AL22 1X82A 1FV3A 3RI8A 4Q4W2 4IEOA 2CGNA 2W91A 4YVSB 3T1LA 5C70A 4XUNA 2VMFA 4QPGC 5BV6A 1L7QA 3I2KA 1W90A 1JZ7A 3PTYA 3OY8B 1LB2A 1NLRA 1U5ZA 4PCRA 2Z5WA 1DZRA 1UU4A 2MEV2 4XTPA 3X29B 1AX1A 1DYOA 3ZLIA 1Y4WA 4FSJA 2LROA 3NNLA 3AKQA 1NKGA 3N3HA 4WM8C 5FYBA 1PNGA 4UAPA 4X6QB 4FFFA 1MPXA 2E9QA 3KCXA 3PNAA 2XBO3 1REDA 4Y1ZA 1HRI2 2F4PA 2IUWA 5FK8A 5GLVA 5KXBA 2W5FA 3VBHB 5HI0A 2GC1A 2ZX2A 2WJSA 4YZ1A 2VH9A 1QQP3 4FPOB 5BNOC 3N9NA 1RUF1 1SPPB 3AK0A 3VBHC 1QH7A 4XFAA 2MNGA 4UBHA 5FWJA 2W1SA 1GKBA 3C7GA 4IETA 4YYOA 4AF9A 3I7DA 3Q8FA 2FMDA 1NCRC 2VNVA 4ZZ8A 1OC1A 1MZ6A 3EQEA 3U4SA 1COV1 5GZDA 1IS3A 4FFGA 1PK6C 1W9YA 2DFCA 5FZ3A 3RWNA 4A7YA 2UURA 4QD2A 4PIXA 2L9LA 5LK7B 2YHJA 3ZFGC 3IT8A 3AP5A 2BDRA 4RSUA 3S5QA 4FAGA 2FD8A 1BVP1 4YW4A 4YFZA 4CPBA 2EIBA 5FRAA 5F3CA 4OHVA 3APBA 2DV9A 3P3PA 4IEZA 3I8TA 4I3GA 3NNFA 1U0AA 1VIWB 5HV4A 3H8XA 4K20A 4MSVA 2VZ3A 4GB33 1X36A 4COZA 3J8F2 3ZN6B 4LBOA 3PU3A 4MYEA 4META 1QJU2 5JXJA 1LODA 1Z7S3 4BYYA 3CNAA 4WVMA 2X8KA 1RYYA 5DXDA 3HVDA 2YC4A 2ZAHA 3KF5A 4Q0SA 2SBAA 4OCTA 4ASMB 3DEMA 1D2SA 5CADA 3TEYA 1UX7A 2GNDA 4GKYA 1CZSA 1C8NA 4CPBD 1JUIA 1AR63 4W4ZA 2VZUA 1SDWA 4GH4A 4LBMA 3M4FA 2KA3A 4NROA 2XQXA 5C4WA 1MZ5A 2DF7A 3K4DA 4A2UA 5DQ0A 4S2FA 3ZDSA 5DAPA 3AMNA 2YY1A 1NAEA 1W05A 2IXJA 4U2AA 4WM7A 1MZFA 3BVCA 3FHAA 4AI3A 1J58A 2DCKA 5A7QA 3POGA 1K45A 2JDKA 1UKRA 5FYCA 2R1BA 2ILMA 3MV11 5FY5A 1HRI1 3ES4A 4LKDA 4QHOA 1BJQA 1TMF2 1LGBA 2WUHA 1XYNA 4UFHA 5J3UA 2GH2A 1JH5A 2PELA 3AB0A 4B7KA 1LCLA 4PT6A 1N3QA 4UOJA 3KWVA 3SCHA 3WNXA 3ZFGB 1AHSA 1SG3A 1HB4A 3FBMA 4K3UA 2JE8A 3U10A 2BJSA 2OYZA 3JD73 2A3WA 3K51A 2F4LA 2YPJA 4MV2A 4NAMA 4Q1RA 3J8F3 4RFT0 2RG4A 1GWMA 1GSLA 3K4ZA 3W5MA 1KGYA 2WZR2 1DQ6A 1DLCA 1RUC3 1PZ9A 1GP6A 1C8M1 4CDWA 1QJY3 3AFKA 4TTGA 3KT7A 3ZKYA 1X7NA 2HH9A 2B46X 1TVGA 1V9U2 2PFWA 5FYYA 3VV1A 3WP6A 3AJZA 2JE7A 4LO7A 2IVIB 1AF9A 4HT1T 1O6UA 3GGLA 4OI2A 4MOAA 2B5HA 1QXPA 3DYMA 4YZ3A 1QJEA 3NKTA 5FP3A 2X05A 1GZTA 3DPRB 4GMP3 4KBZA 4MGTA 3MUY1 1FYUA 4NHMA 1YNAA 2VMIA 4R52A 1PGW2 4X8PA 2GU9A 1W6PA 2GAUA 2QQPA 2ZJCA 4HETA 4MO3M 2V73A 4I0WB 2ENRA 2P37A 3B00A 5EZWA 3JXSA 3I4IA 2R0FA 1DGWX 1NG0A
chains in the Genus database with same CATH topology
4GMP1 2MPFA 1DGRA 4MVTA 5KXDA 4PDWB 1YO8A 4WM7C 2EIGA 1LHVA 5FPXA 1APNA 2K0GA 2VVDA 3CEWA 1RUD2 2RR11 2PHUA 5T5JA 4LBNA 1VBA3 3A0KA 1ND3C 2VOXA 2P17A 5FMOS 3A4UA 1RUD1 2RR12 1LRHA 1CJPA 3WW2A 4OUSA 5F5QA 1O4TA 2LM3A 4YG6A 4DZGA 5GZFA 4F3JA 1CQ9A 5J7MA 3QOPA 1RMU2 3BOPA 5E1RA 1YFXA 2RJKA 1RMU1 3L2HA 4CDQB 4GALA 2DYCA 2X29A 3H9AA 1GZ9A 1SLLA 4CDUA 3K48A 1LHUA 1F5JA 1BMV1 1CONA 1SFYA 4OUMA 1HW5A 1WBFA 4FP2A 1DZQA 1KD7A 1RVF1 4LBQA 5CFCB 2QZ2A 2QDNA 3J9SA 2VNOA 4QHBA 3AYEA 3NSTA 5JZGB 2PTMA 3RYKA 1O7FA 3TN92 5BNPC 1IS5A 1V6MA 1YLLA 5C6CA 2UY9A 4R9CA 1UKGA 3CO2A 1F31A 2P2KA 4XJ8A 1OQEA 4YGEA 5KHHA 3I59B 5GZGA 3LSEA 1AXZA 1AL0G 1C57A 5GZCA 2BBVA 4IESA 1LOCA 2YROA 5HCBA 4H7LA 4ZU4A 4XIOA 1BKZA 5ACA2 3TBDA 1FMD2 3M3CA 1LULA 1RC6A 2B7YA 1DQ4A 4BZ4A 4CEYC 1ND3A 1VLNA 4QPYA 5DZEA 2DVBA 4BM8A 3EBRA 1WUVA 1XXNA 2WLPA 4AVSA 4PLMA 2VVFA 2ZZJA 3E97A 2Q30A 4SBVA 4FTBA 3THPA 2GN7A 4HZFA 2FBEA 2IXLA 3B7MA 4JRAA 3AKPA 1C28A 4XHXA 1AYN3 2GMEA 3EHKA 3POSA 3WD5A 4LO4B 1G9AA 3TWIA 5JPMB 5JSOA 1R1ZA 2MHFA 3WV6A 4XQ4A 1QOOA 1A8MA 3IMNA 2D5HA 2TBVA 1B35B 4RL7A 1QJZA 1CR7A 2HWB2 2DUPA 2ZZQA 4EWEA 1POV0 3AMPA 3RJ2X 4S2GA 2HKXA 2WA3A 4IXLA 4AG4A 1PIV2 1VP6A 4Q0UA 5AC93 5BNPA 3WQ0A 3D6EA 3WINE 2VVEA 1VALA 2R16A 5JI9A 1PGL1 2D6KA 2JG9A 3JBG1 2XKOA 3AZXA 1T6GC 1HRV3 4NHKA 1S0IA 5GM0A 2R043 3VBRB 4P9XA 1QH6A 1UL9A 4KG0A 1NCRB 3VZMA 3PHMA 5GLUA 1W6MB 1W6OA 4AEJA 4Y1VA 3BU7A 3GF6A 2PYTA 2RS52 4TWTA 4GA9A 4AI8A 4JGZC 4M00A 3OD0A 2I45A 3L2YA 1A78A 4AGVA 4UW5A 3S6PA 1BCXA 3ZYRA 5F1RA 4IERA 3LA3A 3RMYA 2FZ2A 4D7YA 4M3CF 1S2BA 1LESA 2HWE3 4YVSA 1OFNA 2YXSA 1OOPB 3KD4A 4HL0A 1H1MA 3D5OA 1FPN1 1G6NA 5F6KA 5T54A 5ABJB 4V1PA 4MX3A 1H1AA 3ZN6A 2XL7A 3IN9A 4YM1A 5T3NA 4Q8KA 2O0OA 3VL9A 2CAVA 1RHI1 1MR5A 2BFUL 4YM2A 1PVXA 4WVVA 5F9TA 1CPMA 5L7OA 3ETQA 1AZDA 4CP0A 1WGPA 2EAAA 3FFQA 2IZWA 2ZX1A 3BALA 4YW1A 4UW6A 5D8AB 1QXJA 4IEPA 2GMPA 4OZXA 1EAH1 1Q8VA 4E2GA 3ZN4A 2A5ZA 2Q5TA 1VBD3 3NJZA 3PJQA 3SH4A 2ZACA 4YZ5A 4RGAA 4Y22A 3QBQA 3UKNA 4E4ZA 4QGMA 2WIIB 5FOJB 4MH0E 5D8AC 1RUH3 1I9RA 3CJIC 3FBYA 1UIJA 2CY6A 3MIFA 2VGDA 1TNRA 1SBDA 3E6BA 1NXD1 4XDQA 1H2MA 5FLJA 3H0OA 1XU1A 1AVBA 2CTVA 4IV1B 2HWC2 4GIQA 2HWF1 5FAXA 3WDWA 3JB4C 4EN0A 1VBA1 4L11A 1KDKA 1ASJ1 1EYBA 2EALA 3WCSA 1IZ3A 1OPOA 4Y5Z0 2GSYA 2Y38A 4HVOA 4NPRA 1A6CA 2NQYA 3LB9A 2Y26A 4HVRA 2VOWA 3GZAA 3TYJA 1PZ8A 1RIRA 2BTVC 4HLTA 4ZU5A 4AHZA 4FPEA 2AYHA 3N7JA 2RMU1 3VZKA 3LOBA 1RTVA 4JGYB 4IEUA 2NZ9A 5T5PA 1QY4A 2D3RA 5AC91 3VBOB 1ULFA 1PO21 3MLKA 4QM9A 5LRRA 5C4WB 4HBNA 1BEV1 5L7OC 2XJRA 2Y0OA 1KS4A 3WHUA 2ZKLA 4OI1A 2C1FA 1EPWA 1WMDA 1JHNA 5FQ0B 4KU7A 1H0BA 5DG2A 5EXOA 3VBOA 1XNCA 1CPNA 3FFZA 4YW5A 3M3IA 1V6KA 2A6YA 3NW4A 4TZDA 1N47A 3V0BA 1JBCA 4Q27A 4DFSA 4Y24A 1NXMA 3PVNA 3VBSC 2PA7A 3SCGA 3O5SA 3RDIA 2DURA 2AH2A 3R4SA 4LBJA 4EWAA 2E7QA 1WLCA 4BMBA 1TME3 3D82A 5CBLA 4LA3A 1CAXB 3G6JB 1C1LA 1BMV2 3N7LA 4RR3A 1ND2C 1WD4A 2XLGA 2XH6A 3NAPA 1O3RA 1VBB1 2DVGA 1CX4A 1UPSA 4P5HA 1JOJA 1PHMA 4Q4V3 5FTTC 5IK7A 2RE9A 3WP4A 5CFCA 1B35C 1U5XA 1LEMA 1Q56A 2DVAA 1R1A1 3PMSA 5C33A 1BBT1 3KT4A 4SLIA 1DGLA 1AYM2 2PHRA 4WBBA 1QJX1 2CAUA 1N1YA 5DG1A 5I0UA 3B01A 1MQTA 3CL1A 3D8CA 5JSRA 4LHKA 2ES3A 4PDWA 4RS5A 4AI1A 3MI8A 1PM7A 1M4WA 1XYOA 1Z7S2 3TAYA 4AEKA 5K0UB 4ISRA 2D6PA 1WLDA 3VBOC 3CJIB 4Y4YA 5BNNB 1CIWA 1NQDA 2FQPA 3OYWB 2YGLA 1HXS3 1TME2 2Q1MA 3G7DA 2XJSA 1RUF3 2XJUA 1BYHA 4LNVA 4YG0A 5DDJ1 1YIPA 5T50A 2EA7A 3FMGA 5T5OA 2ZHMA 4LE4A 1NCQC 4QXKA 1IS6A 1LENA 4ZKTB 1GNZA 4GB31 3CU7A 1ENXA 3SHRA 2D6MA 2ZGPA 1VBE3 3RQ0A 1H4GA 1DU3D 4P9GA 3DPRC 1ZX5A 3VZJA 4AVCA 1HQNA 4N90A 2R072 3N7MA 2PQQA 4FPLA 2K9ZA 2IXKA 2RMU3 4XETA 3NAPC 1N1VA 2ZX3A 1GZWB 2V09A 3POYA 2G9FA 1ZZBA 3URFA 2IFWA 1WMEA 3R0RA 1OMIA 4HN0A 2WNEA 4NWWA 3ZMNA 1B35A 1RUC2 3WDUA 4HKOA 2LUWA 1WCKA 3H3UA 2EVXA 1LJ7A 5CG9A 1QJU1 2RS31 5BNPB 1U12A 1OHFA 2W08A 4LLFA 4A7ZA 1G9BA 2CL2A 1AR71 1ZBA1 4YFWA 2XJQA 1SLBA 2DU0A 4HSJA 5DZFA 3BIWE 3M2MA 4UW4A 1F5FA 1QHDA 1QJX2 1QNWA 3O0WA 1LEDA 3ZYPA 2Q8OA 4FT8A 3WX5A 1MVQA 4XXAA 1S0EA 2VG9A 3VBFA 1SBEA 3H7JA 5HBAA 1K5MA 4IQPA 1N3PA 5A3LA 1KXGA 2PN5A 1CAVA 5F6LB 2FZ1A 5JWPA 1N3OA 3MPPG 4XE9A 3VBFB 1AR81 4CDXA 4H14A 1ULDA 5J36A 3ZSJA 2D6LX 4Z82A 3WW1A 5FOBB 1CAVB 3EXUA 3GHMA 1QKQA 1CVNA 3VBSB 2YV8A 1RHI2 5KBFA 3O0VA 1GR3A 3D4KA 3MDPA 2A6WA 2WT1A 3GBFA 5FO7B 4XF0A 1BZWA 3FC0A 3V56A 3ZFFB 1LECA 4EV0A 3ZYGA 4KH9A 3VGIA 1RJ8A 3FHIB 3LOIA 3ZFEC 1RUH1 2EXIA 4N7IA 3VZLA 1HDKA 3IPVB 4IV1C 4JQRA 4LBQD 3ROUA 3VLBB 4XFHA 2GN3A 1PIV1 4XTMA 3VZOA 4XJUA 4QPGB 3MZHA 2ZA9A 4AFBA 5CU1A 5JLVA 4K6BA 3DV8A 2RS32 5CIRA 2XWBB 4MGKE 2D93A 1AL23 1UIKA 1Q43A 1COV3 2UWCA 4JTOA 4BLJA 1AUYA 3O14A 4TYSA 1MVEA 1MEC3 3M3OA 2JECA 2RR13 2NMOA 1IPKA 1BVVA 4CDWB 4FCAA 3S30A 2KM2A 2XVKA 2BPA2 1KITA 4EN7B 4XFBA 4HPKB 1JYIA 1VBC1 3AMQA 1DLLA 2ZABA 1ULGA 4Y1UA 2R49A 3USUA 3SH5A 2ZAAA 4CDXC 5K7PA 3HQXA 4FQ4A 4CP1A 1EV13 1Z7S1 3H3ZA 4M0NA 4QQHA 1PZ7A 2ZX4A 2JG8A 3ST7A 5DUVA 3CJXA 1GFF2 4L8QA 1MS9A 1AR91 4LHNA 4YGBA 1KFUL 1YXWA 3ZXAC 4AQTA 3ZX7A 1NE4A 3AKSA 2ZTNA 3ZXEA 4DS0A 4E27A 1V6NA 1LHWA 1IKPA 3ZFEA 5C8CA 2PLV2 3AP4A 1ZYBA 4R8HA 4ISQA 4HSLA 5K0UC 1TQ5A 3VDDB 4Y20A 2H6CA 1ULEA 2WNVA 2B9UA 3AZVA 4CP2A 3NKGA 5CFDC 1TMF1 3EJKA 4CTEA 2ZGKA 1J3RA 5E88A 3BTAA 4XF1A 1YCIA 1CN1A 2WL1A 4LULA 2D3PA 4AQ2A 3IIAA 4QT6A 1RUC1 2P34A 5I8SA 3KQRA 4IEYA 2A6VA 4FPKA 2DCTA 1AR62 2Z42A 2R042 1UPIA 4OHZA 2X5IA 1FT9A 1S0DA 1M06G 5DUXA 4G3YC 4K1ZA 1EPZA 1FATA 2XWJB 4RR3B 1OQDA 2A3XA 4AEDB 2IXCA 3ECQA 2XLAA 2SLIA 4M3CA 2BNMA 1VBE1 2VNRA 1PVC3 4G4FA 3I59A 4HKWA 4KL1A 3ZXKA 4AEMA 1FNYA 2ZGOA 3S0MA 2R061 2BYVE 4X6RB 2W68A 2F6BA 4K1YA 2H0BA 4MLOA 4YVWB 5C8CC 3VHOA 2B45X 4XF4A 2QFEA 2DCZA 2V5YA 3WDXA 4FPCA 4JTNA 3OBTA 3VKOA 2UWBA 5EFUA 2VULA 4KNCA 4Q26A 2EXJA 4YRDA 2WNVC 4Q2FA 1ENSA 3ZSLA 1BEV2 2QE3A 4AK3A 4Q0QA 1DGWA 5ACA3 1GV9A 4COWA 1RMU3 2P3KA 2PHTA 1C8M2 3CF6E 1LU2A 4N43A 2R0HA 5IK8A 2WQ4A 2VOVA 1I3HA 4LEJA 1LOAA 4LBKA 3U07A 5I0SA 1KDMA 2RM21 3LAGA 4E2SA 2GC2A 3AMHA 1RUH2 3OTFA 1PGSA 4XZPA 1KJRA 4XPVA 4N7UA 4N43B 2X5IC 5CNAA 4LO5B 2Z69A 2WT2A 3UKTA 1GLHA 4RQPA 3HT1A 5I0RA 1AXKA 4ES8A 4W6YA 5DUUA 3WOGA 2PHDA 3SITA 4MGIE 4EROA 2WSUA 1CGPA 4I02A 1WMFA 2UWAA 1PO12 1SFNA 2WS92 1HX6A 3AX4A 4OVEA 4RQPB 1NOVA 4YW2A 1RHI3 2ZX0A 2WS93 3JZVA 3O0XA 1TEIA 4DY5A 2XHKA 2AENA 2D3SA 4LT5A 3MW2A 4OHYA 4AXOA 4CEYB 3ZYIB 3TNQA 4GKXA 1WW7A 3M7AA 4L2NA 3D0JA 3T1MA 1LHOA 2R6QA 5H9SA 5BNNA 1NLSA 3PVOA 3MIGA 5CVRA 3GYDA 1X8MA 3KZ4C 5FLIA 1G9FA 3JQWA 4K40A 3INAA 3S7IA 2ZHNA 1EV12 2GC0A 1GBGA 3JUUA 1VR3A 4OHXA 4PF5A 1HQLA 5JAXA 4Q4Y2 4M3CE 1NCQB 3NL1A 4YGDA 3QLQA 1Y7BA 1RUI3 3ZIXA 4ZXKA 1V6IA 4FO9A 4IV3C 1QDOA 4GB32 4S2DA 2W0XA 3FUQA 5JR7B 3MPBA 1RUE3 3IM0A 3QH7A 1GQGA 4QPIC 4MUVA 2MEV1 4PQ9A 4LBLA 4B4RA 3OY8A 2ZGUA 1ASJ3 4P9YA 4P9JA 3WHTA 1UF2C 5LK5A 2JX9A 2QDRA 2EXHA 2DUOA 4FQZA 5EV7A 5D1IA 1RUF2 4FPHA 4DXZA 5ABJC 5DUWA 1LOBA 1ZBA2 4XILA 3SH3A 2OIIA 5CG8A 1MEC1 3OBRA 3KGZA 4DRVA 3VBHA 3M1HA 4B3NA 1KJLA 3ALQA 4YNIA 3LKJA 4AVVA 1R093 3VDDC 2RM23 1XE8A 3M70A 2RS11 1FPN3 1DQ5A 5J09A 4IL7A 4J6GA 2ET7A 2W52A 3ZFFC 3JD72 3LZZA 3OPZA 2A6ZA 1DF0A 2DVFA 1UW8A 3HR9A 3ZFGA 2WNUC 2VECA 5EYYA 4A3XA 1PO11 4OI4A 1R081 1W0PA 1VAVA 5H9RA 1HLCA 2AREA 4QPIB 1SQ4A 4Z07A 1TE1B 2ZPXA 1AR93 4WVWA 3J26N 5DZGA 4AFMA 1J3PA 4ATEA 3JQXA 4IV3A 1OPMA 1XQNA 2HWC3 2KXLA 3KM5A 1X50A 3O12A 4F8AA 1OD5A 2XLFA 1YIFA 1TME1 3WG1A 1O5UA 4IEQA 4C0BA 1QJX3 5JZGC 4GH4C 2JD4A 2HWD1 2WFF1 4HANA 1OA2A 4XIKA 3B02A 1QNYA 5C4WC 1WCSA 1QQP1 1SLAA 2JKBA 1YJLA 4LA2A 4DQAA 1VRH2 5L19A 4QGNA 3T2TA 3WP3A 1Y9QA 4M01A 2BWAA 2B39A 3AXDA 1TMF3 1BQPA 5FQ0A 3VKNA 2ZMKA 1BK1A 4LE3A 3IDCB 3FE5A 5ABJA 4C0HA 1AYM3 3A0NA 5TSWA 1QJY2 3V64A 4Q4X1 3VBUA 1D0GA 2PAEA 4YARA 3P3NA 3VDDA 5JIUA 5L73A 2IXIA 2WZR1 1KFXL 2MEV3 3RI9A 2XJTA 4H55A 4URTA 1LOFC 2R32A 3KS7A 5JDBA 2Z79A 3TRSB 3VBUB 4FOYA 4GQ7A 1V70A 3GNEA 4DY3A 2WNUA 1J59A 1PVC2 2OA2A 1H8TB 2ZGNA 3FX3A 1W6QA 4N53C 1Q8OA 1ZM1A 4JC1A 2HWF2 4P9WA 1PO22 1YFUA 4WV8A 1MS0A 5FO9B 2NPIA 1W0OA 2ZGRA 3RPQA 2IWGB 2D97A 5A32B 1LOEA 1H8TA 1H30A 2I74A 1W2UA 4OLLA 4AHXA 2WFF2 2RS33 3WDVA 1O91A 3MFCA 1PGW1 2IC1A 4GWNA 2AUYA 5GLWA 4K7JA 3FUOA 4E9KA 4XBLA 3RRDA 4L92A 5J37A 4Q4W3 4WM8A 2UU8A 3NO8A 5SV8A 1D4VB 1H2LA 2GMMA 2UYBA 3ZIWA 1UMZA 4IEWA 3ZMOA 2WQZC 4G9SB 4B4PA 1QGLA 4UBGA 1UN1A 2AGSA 4IEVA 5BNOA 3SCFA 4WM8B 1F2NA 4QU2A 5KC6A 4ONUA 1S55A 3E6CC 1Y3TA 1IS4A 1LU1A 4FBFA 3DGTA 4HN1A 3VBRC 4Q8LA 3MGUA 5JCTA 1D4M2 5KHIA 2IFRA 3VKLA 4DOUA 5CFDB 2WLQA 1SLIA 1HRI3 1RUE2 5JOZA 5BNOB 2PAMA 4PIYA 1PK6A 4JGZB 3MYXA 5LEKA 4I2OA 1YI7A 4CDUC 2EAKA 4RA0A 1A3KA 1AX2A 1RITA 3UKVA 2R1DA 4XJAA 5CAZA 1F8VA 3USSA 1OA4A 2YGMA 1H9PA 2HWC1 4MXWB 3KCCA 4N53A 1YFWA 1RUG1 2VW1A 4EN9B 3TN93 2BWCA 3EO6A 4FXKB 3MLLA 1HQWA 1NA1A 1S0GA 3DF0A 4JDOA 1YJKA 3VHNA 4KU8A 3JCIA 2XVLA 1R082 1RUG2 2QZ3A 1Z78A 2ARXA 4FP3A 4KGQA 3V0AA 4C1WA 1S2KA 1XNKA 5AVPA 1H8TC 2EXKA 1RUG3 3LA2A 4MXWA 4M3CB 4N53B 1AR82 1PIV3 5DDJ3 1BBT3 2PHXA 1FPN2 1CAXA 2BFUS 2P3JA 3MIHA 3N35A 5JSPA 4E4DX 2A75A 2HEVF 4XJWA 4FXGB 3N4MA 2XL9A 1DDLA 1OLRA 1MS1A 3LWCA 4K21A 2O8OA 3AYAA 1NZCA 5KC5A 4I0BA 1YRZA 2ZHKA 2A6XA 3H1MA 3PVBB 4LHLA 3WCRA 1RUI1 4CEYA 2ZMNA 1UU6A 4AWDA 4RHV1 2E51A 2WSVA 5K8SA 3WLUA 3ZXFA 1Q8PA 3VBRA 1ZZ9A 3WDTA 4DB5A 5E16A 4CDXB 5T5LA 1ZRFA 4DNYA 1DYPA 1W6OB 1W6MA 3HT2A 5B2GB 2JDZA 5HXVA 4NN0A 2PAKA 3E5QA 5C9AB 2O8QA 1HRV1 1IQAA 3POWA 2D98A 3OYWA 2R071 4LLOA 3QACA 5JIAA 3BCWA 4CDWC 3HMYA 1DBNA 1VAKA 3L9JT 1ENQA 1ZBA3 3QCWA 4RGGA 3ZSKA 1JXNA 3VUOA 4X8NA 1ZZ6A 4O9EA 1N1TA 3Q9OA 3WR0A 1OOPA 1NA1C 5FMOL 2AR6A 3U0ZA 2R073 1VJ2A 4UW3A 1DG6A 3FLTA 4O9GA 4INDA 3V0BB 3N36A 4ES9A 3JD71 3IBMA 1ZBE3 4PLNA 1IKQA 4PIZA 2JG9C 2DCYA 3B94A 4D94A 2NP0A 1RGSA 5FBZA 1C8M3 4BQ1A 4C90A 3PMEA 2PLV3 2E63A 4BMEA 1AXYA 2QCSB 2NM1A 2WS91 1ZBE1 2JG9B 2TUNA 2WT0A 2ZS6B 2ZGQA 3SNMA 3ZYJB 4CYDA 5BUVA 1RUJ2 3MLJA 5GZEA 1AR92 2H6BA 2OUHA 4R9DA 4D3WA 3R05A 4XQWA 1GNHA 2CGPA 1ALYA 2PHLA 2WINB 4Y22B 1FI2A 3SISA 1KS5A 3ZPYA 5GLZA 1AYM1 5AC92 4Y1XA 4JDMA 2NN8A 3HWJA 1LR5A 4JV4A 1B09A 5EJ3A 4Q4X3 2UY8A 5E8AA 4AVTA 1ZRCA 4LUKA 1W39A 4FTEA 4LBQB 4XFCA 3ASIA 3SXWA 1W6NA 2XG3A 3WVJA 5KHJA 3HN1A 1SLTA 3WW3A 1SMVA 5KWRA 4YLZA 1OOPC 2PHFA 4CRQA 2YC0A 1I5ZA 3FZ3A 2ZBJA 2HWF3 2VW2A 4Q0PA 4WVZA 3ZVXA 5FFOC 5GLTA 4XMAA 5L7OB 4Q4Y3 4J1WA 3WZ1A 5J48A 1VBC3 1LKNA 1GICA 2D5FA 1OFSA 1RUE1 4XEZA 4HMZA 3SMHA 2D44A 5D8AA 4PJYA 4B8EA 3M3QA 4KG8A 1QF3A 4P14A 1RUD3 4Q4X2 4XFFA 2RS13