2WZR2

The structure of foot and mouth disease virus serotype sat1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
207
structure length
207
Chain Sequence
RIVTTSHGTTTSTTQSSVGVTYGYALTDKFLPGPNTNGLETRVEQAERFFKHKLFDWTLDQQFGTTYVLELPTDHKGIYGQLVDSHAYIRNGWDVQVSATATQFNGGCLLVAMVPELCKLDDREKYQLTLFPHQFLNPRTNTTAHIQVPYLGVDRHDQGTRHKAWTLVVMVLAPYTNDQTIGSTKAEVYVNIAPTNVYVAGEKPVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Foot-and-Mouth Disease Virus Serotype Sat1.
rcsb
molecule tags Virus
molecule keywords POLYPROTEIN
total genus 42
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wzr200
5GKAC 4CEWB 4PDWA 1FMD1 2XBO2 5L7OC 1RHI2 3HAGA 1K5MB 1AR61 1FOD1 4CDXC 5C4WA 1QJX2 1AL22 4RS5C 4GMP3 2WS93 3VBHB 3VBRB 4FTBA 5FMOL 2PLV1 1RUI2 1RUE1 1HXS3 2R041 2RS52 1BEV1 1RUC3 2R043 5BNNA 1EV11 1MEC2 1Z7S1 1SMVA 3JD73 2X5IA 1RVF1 2ZAHA 2RS33 1QJX3 2GSYA 4GMP1 3DPRA 3JB4C 1MQTC 4JGZA 4Q4V3 4Z92B 4RQPA 1QJY3 4CDQA 4JGYA 5A32B 1RVF2 5C9AB 3ZFGA 3S6PA 2FZ2A 1NG0A 5D8AA 4GB32 3LOBA 1EV12 1D4M1 2RS51 2R042 1COV1 1PVC2 2BBVA 5FMOS 5CFDA 1OOPC 1R082 5L7OB 2X5IB 1POV0 1VBB1 1PO21 2GH8A 4GB33 1NOVA 4RR3A 5ACA2 2HWF1 2RM23 3VBHC 1B35A 2HWE1 1C8M3 3NAPC 1VRH1 5C8CA 3TN93 1NCQB 4GH4A 5C8CB 1RUC2 1AR71 1NA1A 1A6CA 1ZBA1 4FTSA 2HWC3 4NWVA 4YVSC 1NY71 2RS32 4FSJA 4AEDB 2XPJA 2RS13 4CDWC 5J96B 1AR91 1IHMA 1AYN2 3VDDC 1MQTA 1HXS1 1H8TA 1AYN1 1RHI3 1RUJ3 4RQPC 1VB4A 2RS12 2BPA2 2RR11 2WS92 4GH4B 2X5IC 2WZR1 3J8F2 1ZBA3 1AR81 4NWWA 4YVWC 5CFCC 1NY72 2R071 2R073 5ACA3 4LLFA 1V9U1 4GMP0 3CJIA 5FOJB 1R1A1 4RQPB 1RMU1 4QPGB 1RUD3 1TMF3 4N43C 1ZBE2 2RR13 3VBUA 3NAPA 1VBD1 2HWE2 3ZFFB 2HWB1 1B35C 1C8NA 1AR73 5A33B 1ND3B 1EAH3 2BFUS 1AR92 1FMD3 1EAH1 5ACA1 4Q4V2 4Q4W2 1NCRC 2RMU2 4N43B 5BNPC 1BMV1 1RUE2 5BNPA 1D4M2 1ND2C 2R063 4YVWB 4FTEA 1ND2A 1PIV1 1RUG3 4CDUB 5K0UB 1F8VA 1BEV3 1RUC1 3JB8A 4YVWA 1POV3 1HRV1 5CFCB 4Q4W3 4CDWA 1HXS2 1QJZA 1H8TC 3VDDA 4JGZC 1W39A 3CJIB 4JGYB 4Q4X3 4EJRA 4WM8B 1AYM3 1TME3 1NCQA 4QPGC 2WFF1 4N53C 1RMU2 2R061 1VBB2 4WM7B 1BEV2 2HWC2 4BCUA 1BBT1 3VBFC 1BBT2 4PDWB 1RVF3 1QJU3 1PGW1 4Y4YA 1QJU1 2WFF2 2WZR3 1RUH3 3CJIC 1PO13 1M06G 4RR3B 1OPOA 3ZFEB 5C9AC 1AR62 1NCQC 1VBC3 5CFCA 2HWF3 3VBHA 3VBSA 2ZTNA 2HWB2 5ABJB 1FPN1 1AR93 1FMD2 1PGL2 3M8LA 1HRV2 1BBT3 1OOPA 3ZFGB 1VRH3 5DDJ2 1AYN3 2RM22 1R093 2IZWA 3JBG2 5D8AC 1V9U2 1AL0G 1MEC1 1VB2A 1Z7S3 1CD3G 3DPRB 3VDDB 5LK7B 2R062 4GB31 1AR83 4YVSA 1ASJ2 4CDXB 2DF7A 5BNOB 4Q4W1 1VBE1 3JBG1 5A33A 4AEDA 3JBG3 2RM21 5BNOA 4RS5B 4N53A 4GH4C 4CEYB 1RUF2 1TMF1 1PGL1 2BFUL 4IV3A 4RHV2 2HWD2 1OOPB 1VBD2 1R092 1RUG1 2ZZQA 1COV3 2RS31 1Z7S2 1RB8G 1CJDA 1VBB3 1X33A 5BNOC 1PGW2 1RUH2 4RFT0 5ABJA 1HRI1 5AC92 2HWC1 1QJY1 1VBE3 3VBFA 3ZFFC 1PVC1 5AC91 1AYM1 1AR72 1K5MC 1VBC2 2WS91 2WZR2 3J8F1 3ZFGC 5JZGA 2MEV3 1R091 1RUG2 4WM7A 1VBD3 1HRV3 3VBSC 5BNPB 3JD72 5BNNB 1ND3A 1QQP3 4Q4Y1 1K5MA 1FOD3 1HQNA 1WCDJ 2MEV2 4IV1B 3VBRA 1PIV2 1PO23 1VBE2 4N43A 2VQ0A 4CDWB 4IV1A 4Y5Z0 3VBOC 1RMU3 3VBOA 1H8TB 1RUI1 2TBVA 2MEV1 1GFF2 4WM8C 5C8CC 5DDJ1 1POV1 1AL21 2FZ1A 4QPIB 2WLPA 3VBRC 4Q4Y2 5JZGB 1NCRB 4IV1C 3VBUC 4IV3C 1NA1B 3VBFB 4Q4X1 3ZXAC 5CFDB 1AR63 5L7OA 1FPN3 4CDXA 2HWF2 4AEDC 2WFF3 4CDUC 5K0UC 5C4WB 1RUE3 3J8F3 1RUD2 2PLV3 3TN91 3ZFFA 3NAPB 3TN92 1QJY2 5ABJC 1HRI2 1ZBE3 2R072 4IV3B 5DDJ3 1QQP1 4Q4Y3 1AR82 2RR12 5K0UA 4CDUA 4QPIA 1VRH2 1TME2 4SBVA 4WM7C 4Q4X2 1DDLA 2HWD1 2Y26A 1E57A 1RUI3 4CDQB 1PO22 4WM8A 1TME1 3VBUB 3ZFEC 1ASJ1 1NA1C 5C9AA 4RHV3 4CEYC 5J98B 2RS53 1PIV3 1MQTB 1D4M3 1BMV2 2HWB3 3FBMA 1ZBA2 4RS5A 1AUYA 1RUH1 5C4WC 5CFDC 1QJX1 4Q4V1 3ZFEA 1C8M1 5AC93 1R1A3 1X36A 1V9U3 4PDWC 2XBO1 1OHFA 1ND2B 1ZBE1 5D8AB 1RUJ1 1EV13 1QQP2 1QJU2 1R1A2 1AYM2 4CEWC 1VBC1 4CEWA 1R081 1PO11 1R083 2WWSA 1RUF3 1B35B 4JGZB 4CDQC 5A32A 1COV2 5BNNC 4JGYC 2HWD3 2RMU3 4QPGA 2RS11 1RHI1 4CEYA 4N53B 2QQPA 4RHV1 1VBA1 1MEC3 3VBOB 3DPRC 1VBA2 1FPN2 4YVSB 1C8M2 1TMF2 1RUF1 4RR3C 4QPIC 1PVC3 5JZGC 1HRI3 3VBSB 3IDEA 2RMU1 1HX6A 1ND3C 2HWE3 2PLV2 1PO12 2XBO3 1VBA3 1RUD1 1ASJ3 1EAH2 1F2NA 1FOD2 2BUKA 1NCRA 1AL23 1VAKA 1RUJ2 3JD71
chains in the Genus database with same CATH superfamily
5BV6A 4CEWB 4XFHA 1OVPA 4AHZA 1FMD1 4XQWA 4CA9A 2XBO2 3SQOA 4YARA 5LY1A 1GV9A 3TYJA 1ULGA 4QQHA 4KWUA 3INAA 1JW6A 1QNWA 1S2BA 2JECA 1QJX2 3BIEA 4FBFA 1UX7A 3LA7A 2YC0A 1P8JA 3UV9A 3PTRB 3H7JA 1BKZA 3VN4A 1J59A 2A3WA 2PLV1 2FMYA 3J9SA 3DYOA 4MGTA 3H8OA 1HXS3 3GCWA 1BEV1 5E16A 2WZEA 3MDPA 1W6PA 3RNSA 3E5QA 5EPAA 3VDBA 1ZRCA 1G8WA 5L9BA 1SMVA 2YXSA 2J1AA 4IERA 2DVBA 4ZU7A 4LKEA 1QXPA 2J42A 1H9PA 4XJAA 4XFGA 5A6ZA 3B93A 1QJX3 5C3RA 4NIAA 4PHZA 3DPRA 1C4RA 3PUIA 2XKPA 4C1WA 4JGZA 2JG8B 4S2GA 1L7LA 4FPCA 4LXLA 5A3TA 2VTXJ 4UOJA 3LGRA 4QGMA 4CDQA 5CAZA 1YQ8A 4JGYA 5BYNA 1DHKB 5A32B 2I45A 3QD6A 2QKDA 4AXOA 2BNMA 4CXXA 1NG0A 2VUJA 1BXHA 4XF0A 4I2OA 3LOBA 4XFCA 2IFWA 1GZWA 1MS3A 1RGSA 1JZ5A 3AJZA 3P3NA 4YLZA 4AI0A 3GZUC 3T08A 1IG0A 1PVC2 5JI7A 1LHUA 3RQ0A 4NHXA 1OOPC 4M0HA 1E5RA 1XJAA 2D93A 3AVSA 1POV0 3DXTA 1VBB1 4FFFA 4AL9A 4ZHNA 2ZGRA 2GH8A 2XHKA 3O1OA 2JDPA 2Y0OA 2BNNA 1JOBA 4RR3A 5ACA2 4BJ0A 2EXHA 3AZZA 1HJGA 1R64A 1O8PA 3C7HA 4K8FA 4FAGA 4KWLA 3D0SA 3PLQA 5FXZA 3PIGA 4ISRA 3ZDSA 2PYTA 3HQRA 3CLPA 4CE8A 2WLQA 5FZ8A 1C5HA 2A70A 1W6PB 4FFGA 3WDWA 5FYZA 1NQJA 4BK4A 1LRHA 1NLQA 2VXRA 5EJ3A 3POYA 1AX2A 3A0KA 1GANA 4E4SA 5EFUA 1NA1A 4YM3A 4QX8A 1YHFA 1A6CA 2B45X 2OQ6A 1DQ0A 1UOBA 1X7NA 1ZBA1 3GM8A 3A21A 3DKWA 4R4XA 1H0BA 3V65A 2HWC3 1U5IA 3OEBA 1OLME 1NYWA 5T5LA 1OUSA 3UL2A 1NY71 3JUUA 2XJTA 4IE5A 5F39A 3I8TA 4DNYA 1JUIA 5L73A 2XPJA 3W20A 5FUNA 4Z2WA 2JB4A 2VNVA 3AP4A 5GZFA 5LBFA 1GP6A 1GWMA 4L0PA 4C0HA 1OQEA 3KT7A 1RYYA 1AYN2 2QQIA 1FV3A 3O7OA 4PQ9A 4Y20B 5DG1A 1H8TA 2JENA 1S1AA 1DF0A 4RQPC 1VRBA 4A6OA 3RRDA 3VKFC 1XE0A 2RHPA 1WUVA 5LCWL 2RS12 4N7IA 4FVVA 4DXSA 1F9KA 1ZBA3 5IK7A 4B8EA 4CPBD 4HN0A 2FCUA 4KG0A 1JXNA 3C7OA 2JDMA 3A22A 1NY72 5T5JA 5FY9A 1UU5A 5J37A 1CAVA 4FPGA 1LR5A 1WW7A 2A73B 4WVVA 5FUIA 3DL3A 3ZYHA 1W8WA 3AFKA 5KC6A 1GZTA 4A42A 4CRQA 2K46A 5TSWA 3VD7A 4QD2A 2OUJA 1W03A 2W3JA 3KVBA 1W8ZA 2QNKA 2ZA9A 4Q26A 1EPZA 4XXAA 4CU7A 3I7DA 3LA3A 1DIWA 3ITQA 5A3UA 5LATA 2V5DA 2HWB1 5F3EA 3MICA 1C8NA 1AJKA 3NNFA 4E8DA 2RG4A 4Y1UA 2WSUA 3BOWA 3M7AA 1UF2C 1EAH3 5CADA 2ZGTA 1AR92 2W91A 1SLIA 2VM9A 5E6HA 4MGYE 2AUYA 2Q8CA 4B7EA 2JWPA 4XJWA 5CYYA 2G9GA 5FPAA 4N43B 1W8TA 2CAVA 4G9SB 5BNPC 1PNFA 3ZMNA 5KHHA 4P5HA 4BMEA 4OQ9A 2FDIA 2DTYA 3MPBA 1ND2C 1WW4A 4KU7A 3W21A 3GBGA 3K3OA 2P6HA 3BKZA 4DINB 4CDUB 2GP3A 1F5FA 2W68A 1F8VA 1BEV3 2IXCA 3L2YA 5LA9A 4UBGA 3O1UA 2EXKA 1XYNA 4KQ7A 2E7QA 3LEKA 5CFCB 1URXA 1REEA 3T4HB 4GALA 1LEMA 2K0GA 4JGZC 2D6NA 4D0QA 1C57A 4BH9A 4LPLA 5FP7A 4Q4X3 1PMJX 1O5LA 4EJRA 4CUBA 1O91A 3RYPA 2WT0A 1AYM3 1OMIA 4O65A 2XL7A 1NCQA 2VAUA 2VY0A 4M00A 2D7FA 2WL1A 4IGOA 2R061 4A3XA 5KWRA 5FKBA 1BEV2 2PMWB 2HWC2 1ZRDA 3VBFC 4DPNA 4YZ5A 1W0NA 4RFRB 4PDWB 1Z0HA 5A6YA 2GN3A 3O1VA 2B5HA 1RVF3 3TEXA 1QJU3 1IPSA 1PGW1 4XUNA 3MYXA 1RUH3 3CJIC 2XUMA 4W4ZA 4RR3B 5APAA 5C9AC 5FR3A 1LHOA 1VBC3 5GZGA 2YU1A 4RL7A 5FOBB 1YNAA 2VZPA 4AZZA 5CFCA 2CNAA 2HWF3 2VZTA 1OA2A 1LCLA 3KWVA 1POQA 3POJA 4Q5OA 1GWLA 1WCKA 5FPVA 1FPN1 4XC9A 3EJKA 3T0BA 3VZOA 2EF6A 2CGOA 4UFMA 2HBTA 1VE0A 1JHJA 4WVWA 1H30A 1OOPA 1ZZCA 1VRH3 3OSDA 2VOWA 4IE7A 3ATGA 4EWDA 3M3EA 4OULA 1UYZA 1G9BA 1MS1A 1S55A 1V9U2 1AL0G 3NV4A 2KA3A 2OA2A 3MEPA 3IIAA 3GBWA 1QU0A 5LASA 3ZSKA 1N1YA 1SZBA 3WNMA 4HVQA 5LK7B 3QOPA 1OURA 3SC7X 1XE7A 2GU9A 3SITA 2XVKA 4Q29A 1K5JA 4Q4W1 4TWTA 4H7MA 5T5OA 5EV7A 5BNOA 1JYIA 2XWJB 4RS5B 4Y33A 4N53A 3AVRA 4GH4C 3POWA 5LBCA 4AAPA 3RZHA 2ZEWA 3VDCA 2WZ8A 1SCRA 1H2MA 2QBXA 4KL1A 3BVCA 3OY8A 2K2SA 3M3CA 3V64A 1FV2A 2W1WA 1W8UA 3H9AA 3TAYA 1SQ4A 4OCTA 2EALA 3MIBA 4XDOA 1LU2A 1VBD2 3MBWA 1R092 2HLEA 1F15A 4UW3A 3S5QA 3V0BB 3DCQA 2RS31 1VBB3 3JZVA 1I1EA 1X33A 5BNOC 4X8NA 1GR3A 1DGRN 4QM9A 4LULA 5FUPA 4YRDA 3B5LB 1HQWA 3WP4A 4XFAA 3WQ7A 1XQNA 1GOFA 1YO8A 3HOBA 1CAUB 3ACLA 1FYUA 1CAXB 2UY9A 5DPNA 5DUUA 3CKHA 1VBE3 3VBFA 4E27A 5AC91 4Y24A 4PBPA 4XF9A 4BMBA 5C3SA 1OFSA 4W50A 1AR72 2E26A 2O14A 2VZSA 4NVPA 1JYCA 2WN3A 5FQ0A 1BK1A 2BOIA 1QOTA 4MLOA 2YGMA 5GLTA 2QUOA 1ZRIA 5H9PA 3VKOA 3KGLA 2XJQA 1VALA 4DFSA 2JX9A 2BTVC 4P5YA 4Q0PA 5FZ9A 1W28A 2FBEA 3FJSA 3ZXFA 3WY6A 3C7FA 4FQ4A 3VBSC 3LE0A 1LGNA 5BNPB 1EP0A 2D43A 4BQ3A 5DAPA 2D6MA 5DUVA 4IETA 1FOD3 2JG9B 1HV0A 3GBFA 3H0OA 1QGLA 2DYCA 2MEV2 3OYWB 4OHVA 5C33A 4UFJA 5JPMB 4AOCA 4CVUA 3VBRA 4BQ4A 4I0BA 4XF3A 4TTGA 4N43A 5LY2A 1Q8QA 3PUHA 4TXWA 3WP5A 3VBOC 1SBEA 4XUQA 1K12A 3BUCA 5FZDA 1F31A 4P9WA 2R7EB 2NLRA 1LULA 4BXSV 2ZAAA 3NJXA 1PK6A 3N7LA 4UW5A 5LZ6A 3IIIA 1W6NA 2IUWA 2TBVA 2WYFA 3NNMA 3OGSA 2XMLA 3EBRA 3BU7A 4YZ1A 1POV1 1PZ7A 1XNTA 2VGDA 4F3JA 1LODA 1YQ5A 3VBRC 4CZSA 4FPFA 4X6QB 2VNOA 4IV1C 3C2UA 4K9SA 3VBUC 1UU6A 2VL4A 4IE4A 3ST7A 4GKYA 3VBFB 3WG1A 1PM7A 2F6BA 3PDQA 5CFDB 3PJYA 2A7AA 4CDXA 3S7IA 5J3UA 4L8QA 2WFF3 4Z07A 4CDUC 2H0VA 3CHXA 3IB3A 3I3EA 2ARAA 3WP3A 5IVVA 1DCSA 3ZFFA 4NRQA 3NAPB 2V73A 3GZEA 1DQ2A 3P3PA 4I30A 4AFMA 4UXAA 4AHXA 4XXPA 3PVEA 4LBQB 3TEWA 5DDJ3 2OPWA 1J3RA 3ILNA 4DMIA 1JOPA 1QQP1 4JKLA 2EIBA 2SLIA 2ARBA 4RSUA 4ZU5A 1YJKA 3KB5A 5FZ7A 3OUJA 1VPHA 1TME2 3I59A 5EQUA 2W52A 1UY0A 1OC1A 4Q4X2 2R16A 4EROA 4FQZA 1H1AA 4I09A 5T5PA 3UGHA 2QQKA 5JXHA 5FY8A 2DURA 5LRRA 3BTAA 2UYAA 1FATA 1QWRA 4Z2AA 3LWCA 1WMXA 2ZKLA 3WF4A 4O61A 3GZAA 3ZSMA 4YZ2A 4ES8A 5JR7B 1SLAA 1OFNA 2KR2A 1OKQA 2R32A 5C9AA 3O14A 4JRAA 1FNZA 3WCSA 1OPMA 2YFZA 4AFBA 2RS53 3IWZA 1PIV3 4M4PA 4N7UA 2R1DA 5FPUA 3CO2A 1BMV2 4LIVA 3C8XA 1ZBA2 1UIJA 1S0CA 3U75A 1PZ8A 4JQTA 4EYUA 1CX1A 5JMOA 1BZWA 1RUH1 2JDYA 2P4EA 1QF3A 1QJX1 2XLAA 1KFXL 3JQWA 3I2OA 2QQJA 1W3XA 4Q4V1 3ZFEA 4ZPIA 3ZXDA 3K75B 4FPYA 3OY8B 1W8FA 4IEUA 2OW4A 2VMEA 4CCEA 4IEWA 3J7LA 4PDWC 3WT3A 2C0ZA 3RYKA 3SMHA 4ET7A 1OHFA 2ZMLA 2VVEA 4XDPA 1ZBE1 5FXVA 2J1EA 5FZLA 5EIYB 3RZLA 1TNRA 4NOTA 3POSA 1EV13 1OI6A 2GN7A 4LO7A 3OCPA 1OA3A 4P9YA 4S2HA 2VQAA 1VBC1 1I5PA 3GALA 3E97A 2NMNA 1QOSA 2ET7A 1BVP1 1R083 5FP8A 3LSEA 4ARXA 3N4MA 4JGZB 1OH4A 4LIUA 5ISLA 5FXWA 4CDQC 5JPNB 5A32A 1COV2 3I3MA 4PIZA 4QX2A 1IGOA 4YW5A 1NT0A 4AF9A 1ZRRA 4K3UA 4R9BA 4B4RA 4XEZA 5CKMA 4CEYA 4DY3A 1BVVA 2BQPA 2QQPA 1Y3TA 4KWKA 3O0VA 1MEC3 3VBOB 1AXKA 2W47A 3DPRC 1K45A 3NKTA 1V6KA 4E4DX 1MVQA 1ULEA 3T30A 2JD9A 4W6WA 1X9PA 3WQ1A 1GKBA 2HH9A 2PA7A 4LUMA 2FHRA 2CAUA 4A3ZA 4WZCA 4OI2A 1PVC3 5HCAA 3BTXA 3T2OA 5C5UA 1UKRA 4Y1XA 1SDDB 2W2IA 2XGXA 2BWCA 3IDEA 4ZS2A 4Q8KA 2RMU1 4F7ZA 1HX6A 3CJXA 4HK8A 4LKSA 2UWAA 4WV8A 1X8MA 4ASLA 1IPKA 1PMIA 4Y3OA 1EAH2 2W92A 4MX3A 5EXOA 1GQPA 2XL9A 5C3OA 5LEJA 1QJZA 2Q1ZB 4EZHA 5FTTC 3CF6E 3UGGA 2W1UA 5HBAA 5L7OC 2BGOA 1U0AA 3I2IA 1TQ5A 2PELA 1DZRA 5K4LA 4UAPA 3G7DA 1FOD1 4CDXC 4NN0A 2GNTA 4GMP3 1ENSA 2WS93 3Q9OA 5G04L 3VBHB 4ARYA 4F8AA 1HLCA 5A6QA 1MZEA 4FPEA 4LR4A 4Z8BA 1UZYA 2NP0A 1RUI2 5FFOC 3O0WA 4WZFA 3K4AA 4NHLA 2RS52 5FZAA 3WW1A 1UU4A 2R043 1EV11 1W6MB 3GHMA 4Y1YA 4AWDA 1GNHA 1PVXA 4GJZA 3ILFA 2X5IA 5A3LA 1RJ8A 1YFXA 2A6XA 1W6QB 5E1RA 2TEPA 1CPMA 2QQUA 3RWKX 4AAXA 3K77A 3MHZA 4GMP1 4XIKA 1LOFA 4Q2FA 3IDCB 3MIHA 5F37A 3E1F1 4L9BA 3WG3A 4Z92B 2BJSA 1QIQA 2A6WA 4GIQA 1GP4A 2P37A 1W04A 3LOIA 1RVF2 4LA3A 3ZFGA 4HXCA 4GKXA 1OD3A 1W0OA 2Z79A 5D8AA 3SH4A 4CU8A 4GB32 1CAWB 1KS5A 3KM5A 3PUQA 4IEQA 1EV12 1UY4A 5FZFA 3UNPA 2RS51 2Q1FA 3EXUA 4DY5A 1N1VA 4OUEA 1XRUA 2WO2A 1TE1B 2RVAA 4JHTA 5FMOS 1R082 1W2AX 4NPRA 1YEWA 1JHNA 1WA6X 3SHRA 1GLHA 1BJQA 3KQRA 3T3YA 1B35A 3A4UA 3NJYA 4YW7A 4GJYA 2OZJA 3NAPC 3HWJA 3ZIWA 3BTZA 3AMPA 1VRH1 4A6SA 1NLRA 1S2KA 4Q0VA 4X6RB 4NAOA 4GH4A 4LLOA 1XSRA 2J1VA 5FY5A 5A7PA 1AR71 2NM1A 2XJVA 2AR6A 2XONA 5FMBA 2DCKA 3LDKA 2LUWA 4ES9A 4W65A 1W06A 2XVGA 4OMCA 4V2VA 5JLVA 3BPSA 4K1ZA 4NHKA 4NPMA 4TN7A 2FMDA 2G4IA 3S30A 4FTSA 2Y64A 5ANQA 2WDBA 3D4KA 1KJLA 3VKLA 4ATEA 4AYUA 3ORJA 4A44A 2QQMA 2OQ7A 2RS32 2ZGOA 3ZYIB 4DEQA 1JZ2A 4O9EA 1QXRA 1RXFA 4UFIA 1S2EA 1YCIA 1L3JA 4YZ4A 4QXBA 5CIRA 1AR91 5JDBA 3Q8BA 4YW4A 4HOOA 3RZMA 1LEDA 4QQ2A 1MQTA 4KNCA 3KGZA 2LRPA 1AYN1 5HV4A 2Q8OA 4N8MA 4CP2A 2YROA 1MZ6A 3SEEA 1IZ3A 1H9WA 3H8UA 4Z82A 2WS92 5JCTA 4FOVA 2E33A 5FXXA 1NZCA 2WC2A 4YVWC 4BLJA 1LGBA 2JDUA 4E2QA 3O1MA 4R4ZA 5FYSA 3K51A 3NNJA 5EJZB 2IXKA 1UAIA 5I8SA 5ACA3 3WHUA 1SLTA 1VAMA 2P3KA 4GMP0 4META 4DOUA 4JKMA 1UY1A 3ABZA 1KFUL 1RMU1 1YC61 1TMF3 2I74A 3LKJA 2W1SA 2LW8A 4N43C 5IAVA 2OIIA 5JOZA 3B9CA 2WQZC 4GWMA 3RZZA 2WNEA 2WNUB 3KCCA 1VBD1 1SG3A 3VD3A 4UI9L 3RGBA 1CAXA 2VOVA 3I97A 5A33B 2PXJA 4QQLA 4BZ4A 5CA6A 1HB1A 2NPIA 1DYOA 3WDTA 3SISA 4E2GA 5IWFA 2B9UA 4LJHA 1CZSA 4KH9A 2AZ5A 4DUVA 4J1WA 1K42A 2VZ3A 3IDBB 1XBFA 2MPFA 2RMU2 3DYMA 1WLDA 5DAQA 3N9PA 2BGCA 3L2HA 4AFAA 4W8JA 2Y34A 1GU3A 1BMV1 1MZFA 2IXJA 2I07B 4QX1A 3LQCA 2JG9C 1D4M2 3B01A 3HN3A 4LBQA 1EY2A 4XCAA 4MG2A 4Q27A 2C1FA 1O6UA 3RI9A 1PMHX 1PIV1 5H9SA 3WW2A 3LPGA 3JB8A 4YVWA 4FXKB 1GZWB 1POV3 2ZXQA 3OGRA 3ZYPA 2V4AA 1DU3D 2VMDA 5F6KA 3R6SA 1SBDA 5A3NA 1ONAA 4CCCA 3VZKA 1LECA 1CONA 1MPXA 3MIEA 1W9FA 3AP7A 4RD7A 4BQ1A 4EN7B 1MS5A 4RYDA 3WINE 3Q8EA 1BK0A 1OQ1A 1VAVA 3ETQA 4XCBA 5FK8A 1NX9A 3PMEA 1REDA 4DUWA 2X8KA 2J1RA 2WRAA 1V6IA 2WA4A 2WFF1 3M2MA 2OXBA 5GALA 1VBB2 2KD7A 3N9QA 3ZDVA 2O8OA 2VW0A 2CYFA 5HCHA 3EMRA 3LZZA 2YG0A 1D7PM 5F8PA 3VLBB 3VHOA 2H0BA 4DUXA 2BEOA 3OEAA 3I3QA 4AQ6A 1PO13 2Q4SA 3ZFEB 1F4HA 4AR2A 2JE9A 2X05A 3NVCA 1NCQC 3X29B 3NW4A 3DV8A 3POEA 1UL9A 4XOGA 3T2TA 5JOYA 2JDAA 3VGIA 2ZTNA 3U14A 2ZHLA 5ABJB 3N9OA 3SCFA 5M0TA 1GOHA 1HDKA 1ZVFA 4B29A 1DGRA 5FKCA 4MGKE 3K4ZA 2ZJCA 1XNDA 3U78A 3O1TA 4AK3A 1AZDA 2EIDA 2ZHMA 2LS6A 1CIYA 5IW0A 2QCSB 2O0OA 3BU0A 4LO4B 2XJPA 2RM22 3DGTA 3JBG2 3LAGA 1W8NA 2IXIA 1JH5A 3LDRA 1GQGA 2CL2A 4IDZA 4YG0A 5A7NA 4ZZ5A 2VW1A 3OGVA 4XFBA 5T52A 4E4HA 3B69A 4HFSA 2YYOA 2W08A 4Q8LA 1AR83 3FHAA 3WDXA 4IEOA 2DF7A 4QT6A 2ENRA 1VBE1 3LCPA 1SHWB 1O3TA 4YPJA 4AEDA 3QLQA 4AGRA 3OBZA 3H50A 4MHRA 4YW6A 2P3IA 4CYDA 4MXWA 4CP9A 3SCHA 4FPJA 1VP6A 1ZNPA 1ZZ7A 1HIXA 2A3XA 4XYXA 3D8CA 3RG0A 4COWA 2QQLA 3DECA 1STMA 2Y38A 4IUGA 2Z69A 1QJEA 2HWD2 4PI0A 3NV1A 2L9LA 4FFHA 5FYTA 4LHLA 1E5IA 5FY7A 1RUG1 1YUDA 1COV3 2GH2A 5EYYA 1KS4A 2AREA 1FXZA 1Z7S2 3WF3A 2ZACA 3ZXGA 3HT1A 3CZJA 1SLBA 3DKQA 2FCVA 1PGW2 4AVBA 4D6RA 4OHZA 3PTYA 3DN7A 4QX0A 1RUH2 5FPLA 3PMSA 1SPPB 4LMFA 4COYA 2R0HA 3LIHA 1HRI1 5ABJA 3H3UA 5F3GA 4AEMA 4OI4A 4EN6B 1ULOA 2HWC1 5D21A 5FJHA 2WINB 2Y8KA 1WMDA 1Q5OA 2GMEA 4Y26A 4YM0A 3ZKUA 4YSFA 2XWBB 4QPWA 2TNFA 1G9FA 4IE0A 3RZKA 3D0JA 3IAQA 5FZMA 3J8F1 1CJPA 3D3AA 3KF3A 4BIOA 5DN2A 2A3YA 3T0DA 3AC0A 1R091 3FFQA 3ENRA 5FBZA 3P1IA 4QXKA 2Q30A 1I3HA 1QNYA 4TLGA 4ATFA 1W6OB 2Y33A 3I49A 3HIFA 1Q8OA 1ND3A 1W99A 1TVGA 1QQP3 3QH6A 4SLIA 1OLRA 3AZVA 3GJBA 4XDQA 4IGPA 4CCDA 3MZHA 1WCQA 1HQNA 1ZZBA 4MHUA 3AFGA 1XXNA 2VUAA 1PIV2 3HBZA 4ONUA 4BLIA 1SPPA 2VQ0A 4QWNA 5IFTA 2WUHA 3SH3A 4Y5Z0 2PHFA 4XVHA 5ANNA 2ZKNA 4JDOA 2CDOA 1UQXA 2VNRA 3FX3A 3SLIA 4IW3A 1WBFA 3Q8FA 3WDYA 1O3SA 2E7AA 3PVBB 4LBNA 4C0BA 1NQDA 1YFYA 2BOJA 1ENQA 4WM8C 1ZA7A 5EHDA 5DDJ1 2WJSA 1Q8PA 1AL21 4QPIB 4QAWA 2CHHA 2C24A 2WLPA 3MUZ1 3PUAA 3UJOA 5IK8A 1ULCA 1NA1B 4KMQA 1C3HA 1DP0A 2XH6A 3T09A 4BPZA 3O12A 4RN5A 2R30A 4XW3A 1US3A 1G9DA 1UY2A 4E9KA 4H3WA 4OLLA 1PK6C 1AR63 3FMGA 5L7OA 4AG4A 1RITA 4HN1A 3K48A 3NNGA 3WF2A 2IVJA 3K3NA 3NQHA 4HBNA 1LOCA 3NWKA 2OKXA 5C4WB 4IL7A 4NHYA 5EYXA 4AGGA 4PI2A 1OUXA 4P00B 1H6XA 5FYYA 3ZYFA 1QEXA 4QGLA 5F5CA 5F3CA 1UZVA 1HRI2 1LHNA 3HPNA 4LQRA 4Q1RA 1FI2A 4Q4Y3 3MF6A 3POGA 3VZNA 4DZGA 4NJ4A 1AR82 1MVEA 1WCUA 3VDAA 4QDQA 5J36A 1MS0A 2VVDA 2XDVA 4CDUA 1YI9A 4XZPA 1VRH2 5GM0A 2Q5TA 4U36A 3GJAA 4HL0A 5J09A 4SBVA 4Q1PA 5T54A 3OTFA 1UWWA 2HWD1 2Y6HA 3P6BA 4IEZA 1GP5A 3ZSLA 2YHJA 5F2SA 2H6CA 1E57A 3OPWA 2GMMA 2R0FA 4AFDA 2VNGA 2DFCA 2VZRA 2ZGLA 1LOAA 4XHBA 5C70A 1ST8A 1SLCA 3R4DB 2YU2A 4WM8A 1ALYA 3KV5A 4BDVB 4CDQB 3FBYA 2E31A 5CZKA 4PF1A 3VBUB 4NE9A 4RHV3 1REFA 2XOMA 4YG3A 4BK5A 2CGNA 4FCAA 1UMZA 4W6YA 3KV9A 5FLJA 3WLUA 4INDA 3WNOA 4CPBA 4JHZA 4UBHA 2HWB3 3FBMA 4Y1ZA 2XG3A 1JBCA 1GMMA 3OB8A 4NIHA 3WX5A 5C4WC 4A45A 1W0PA 3O5SA 5H9RA 2BGPA 2VMGA 1IKQA 1C8M1 4HKOA 5AC93 1HQLA 1V6NA 2VVFA 4OMDA 4KGGA 1TZOA 4BYYA 1R1A3 2IFRA 3EQEA 5B4XA 3VHNA 3WSOA 5FP9A 1YXWA 2Q8EA 4BQXA 3WNPA 2DCJA 1YI7A 1GZ9A 1BHGA 1V0AA 4CCNA 5A7QA 2O8QA 2VZOA 4ITCA 1QQP2 4AHWA 3WW3A 4AVVA 3R4UA 3LEMA 2PN5A 1AYM2 1IS5A 4CEWC 5F1RA 1V6OA 4OQ8A 5A1FA 1XYPA 4CEWA 1R081 5IVJA 4YM1A 1PO11 3IKWA 1RUF3 1B35B 2IWGB 2UYBA 3NO8A 4AI2A 1IOAA 4Y22A 2YC2A 1EUTA 4P9JA 2A6VA 2YPDA 4JGYC 5KHKA 1C1LA 3MO4A 1XPWA 2RMU3 3N35A 1UCXA 4M3CA 3SXWA 3RVHA 1UY3A 3OOXA 3PU3A 3KV6A 1YQCA 2BNOA 5FIXA 1V6MA 3WXPA 2BU9A 2WNUA 1Q56A 4FAHA 3E6CC 2WSVA 4XJZA 1KRIA 2P1BA 1UPIA 4COZA 5FO8B 3C7GA 4DXRA 1E5SA 1C8M2 3AP6A 1AXYA 2ZGQA 4JDNA 2XUEA 4MZUA 4ASMB 2FD8A 2G9ZA 4MOAA 1YFUA 2DBIA 3FLPA 3H3ZA 5F5QA 3ZN4A 5K9YA 1LJ7A 4QXHA 5KR7A 5A70A 4MGSA 3VL8A 3I2JA 5FZOA 2PFWA 3THPA 2ZMNA 1HRI3 4PJYA 1X9TA 1VLNA 2D5HA 1O4TA 2GMPA 3FLRA 3IMMA 3M3QA 5F2WA 3MFAA 4QX7A 4A41A 4IESA 4HPKB 3HNYM 1RUD1 4YM2A 5LA2A 2E6VA 4UW6A 1WA4A 5HV0A 2BUKA 3CL1A 3PURA 2EA7A 2YY1A 4M01A 1AL23 2VQUA 1VAKA 1RUJ2 2VUCA 2WNVA 3CIHA 4OUSA 5CU1A 1ZREA 5GKAC 4PDWA 2ARXA 5A7WA 4QB2A 2WNVC 5F3IA 3U4SA 3ZN6B 4CP0A 2WAAA 3AB0A 3E6BA 3NL1A 1QHDA 1UXZA 5FY4A 4QM8A 2AGSA 4KU8A 5BUVA 3HAGA 3WF1A 2JG8A 2ATFA 1AR61 3EO6A 1Q8SA 3GZTB 4KBBA 5CNAA 3IMNA 3W58A 4UF0A 3MIGA 1HV1A 3TOJA 1XC6A 1LENA 2YBSA 2ZX1A 5I0SA 1JYWA 3VBRB 1V6JA 2CWMA 2A75A 5FYHA 4EZ4A 5SV5A 3MF9A 2E9QA 3RI8A 2VMHA 1QDCA 3OPZA 3WG4A 4KG8A 4RA0A 2P5BA 1RUC3 2RDQA 3ZMOA 1IQAA 5BNNA 1MEC2 4YGDA 2A6ZA 2ARCA 1SEFA 1OBNA 4KBZA 1RVF1 2D6KA 2ZAHA 3VV1A 1XYOA 1W05A 4OFGA 1Y4WA 4OVEA 5IVYA 2RS33 5DUWA 3J7MA 3IM0A 2GSYA 4D94A 3WF0A 2B39A 1BLZA 2UWCA 1VJ2A 2OT7A 4UFLA 1DGWX 2AYHA 3AMQA 2ZX2A 3JB4C 4Y1VA 1SFYA 1W9TA 3KT1A 3OF1A 5DABA 4P9LA 2VZQA 5GLVA 5IVEA 1L7QA 5JSOA 1LESA 2VBPA 4JQRA 1QJY3 4XBNA 5T55A 4EWEA 4YGEA 5C9AB 4C8DA 3WNXA 2G19A 4XACA 3S6PA 1RUNA 4AI9A 2FZ2A 2VBBA 3VD4A 1DG6A 3ZXKA 4ZXKA 2NQYA 4I01A 1W6OA 2WQ4A 4YFZA 1DLCA 1COV1 4JV4A 2QDRA 1A3KA 5A3PA 1J3PA 2W95A 5CG9A 2D5FA 2C9AA 1OSGA 3ACGA 5L7OB 2WAOA 2DVDA 1PO21 1N1TA 4L2NA 1J1LA 4GB33 1N3QA 1NOVA 2VG9A 2I2SA 5CKQA 3PHMA 2VCAA 1WCSA 5FYUA 1IS6A 5LA1A 3VKMA 2RM23 3AXEA 2YGLA 1CAVB 4MGZE 1GUIA 1S0FA 2G9FA 2B9VA 1C8M3 3Q8AA 5IATA 2HJIA 2YZ4A 4NIDA 1O7FA 2DDUA 1NLSA 1GNZA 1UYPA 1VMFA 4IEVA 4XF1A 1U5XA 4YW3A 2VOXA 1UN1A 5C8CA 1NCQB 4B3NA 5L36A 2D98A 5FMCA 1CGPA 1SBFA 1CN1A 2AC1A 2VMIA 2QDNA 2ZBJA 2K9ZA 3AX4A 4K21A 5EP9A 3ZYJB 2W94A 3WUDA 2QZ3A 2ZX3A 3MUY1 5JSPA 5CG8A 4PF5A 5KBFA 1OLQA 3QCWA 3WW4A 3A0NA 1TG7A 4AVTA 2CGPA 2ZS6B 4I3GA 1PGSA 5T50A 3WZ1A 3CEWA 4B1LA 4ZKTB 4G4FA 4AW7A 2WKKA 3KT4A 1CVNA 5GZDA 3MFCA 2D3RA 3UESA 1O5UA 1PZ9A 3FHIB 3ZPOA 3AKPA 3VDDC 3PVOA 2R1BA 1WKYA 4ORFA 4R8HA 2WO3A 1RUJ3 4URTA 3M70A 1ULPA 2VOKA 3KQ4B 4H55A 5DZEA 5FV3A 2ERFA 3KF5A 3ZVXA 5C3PA 2NN8A 2AACA 3N9NA 1ENRA 2GC2A 5FY0A 4AI8A 2RR11 1PX3A 2V5YA 2YB7A 4GH4B 4M3CE 5KXEA 3O1PA 3WVJA 3J8F2 5FZ4A 5ERLA 2JJ6A 4NWWA 5CFCC 4DXZA 4EN0A 3ELNA 2W39A 1W6QA 2ORXA 4FPLA 5FMDA 1QXJA 2WWJA 3I59B 5KXBA 2R073 2XR4A 4TZDA 2AEYA 1ZM1A 1LOGA 4FXGB 4D8MA 5FOJB 5C71A 1R1A1 4XPVA 3E6DA 4RQPB 4D7TA 1W2OA 4QPGB 4BQYA 1NZIA 1IS3A 1SDWA 3T2PA 4QX5A 3LB9A 3ACFA 3NV3A 3ZR6A 2JEMA 1ZRFA 5HPOA 3WDUA 1VMHA 2RR13 2YFUA 4QU1A 3NAPA 4BIFA 2SBAA 2E32A 2HWE2 2YDEA 3K4DA 3UK9A 4JZRA 3ZFFB 3FHQA 1B35C 4P9IA 2XJUA 4PIXA 3WNLA 4ASKA 1RJ7A 2XLGA 4B7KA 4XBLA 5JXGA 5FY1A 5CISA 3GGLA 3ZXEA 4OZOA 5DMYA 1RUOA 4ZONA 5I0TA 4PLNA 5ACA1 2ZABA 1BCXA 2GC0A 4GQ7A 4WVMB 4Q4W2 3URFA 1JYXA 2IC1A 5KHJA 1NCRC 4K7JA 3HJRA 4N9HA 5HXVA 5FCCA 5FPBA 2ZZJA 4EQVA 1XSQA 3AKTA 1JUHA 1NKGA 2LTNA 5C3QA 1DQ6A 4LHSA 3TWIA 3IT8A 1KD7A 1XNBA 1ZZ9A 1WWYA 4IEPA 1LTEA 4YVWB 4LK6A 3W5MA 1XNKA 1RUG3 5K0UB 1RUC1 2WABA 1XB9A 5FZ3A 1ULDA 2FDFA 1UO9A 4FT8A 5CVRA 5FZOB 3UKVA 5KC5A 2EXIA 1DQ5A 1KXGA 3H7YA 3MLLA 4Q4W3 1J83A 5E8AA 4LITA 1OD5A 1DFQA 2LALA 1W39A 5GLUA 1US2A 3CJIB 4UFHA 4CP1A 2VH9A 4V1PA 4JGYB 2JG9A 1PX4A 3H42B 1KDMA 3ZX7A 5FPXA 1I6XA 1QH6A 4WVMA 2JXAA 4WM8B 1TME3 4G3YC 2YPJA 2ZMKA 3ES1A 4UFKA 5JIUA 4LORA 4PQQA 1MACA 4K20A 5FZBA 4ZZ8A 5I0RA 3I4IA 2DU1A 1G7YA 1UW8A 4MXWB 1QOOA 4WM7B 2A5ZA 2PHLA 3PUSA 4BCUA 1TNFA 1UYYA 1LOEA 2W9XA 4LO8A 3H1WA 1N47A 2YMZA 3DUIA 3J4UH 4AE2A 1QJU1 5FLHA 3MW3A 1AX1A 3FN9A 2A6YA 3LFMA 1OPOA 1UNBA 3R4SA 1M06G 4ZY9A 1XOYA 3BGAA 4QB6A 4HKWA 5FZCA 2P6CA 3AYCA 2PHWA 2JDZA 4ISQA 4L11A 4FPKA 5IHRA 3H8XA 1FMD2 1O8SA 2Q1MA 3MW4A 4EN8B 3M8LA 2OYZA 1PGL2 1Z78A 1CIWA 1H2NA 1YIPA 3B02A 2NMOA 2ZGMA 3OUHA 1W3VA 5FO7B 5JOWA 2P2KA 5FWEA 5LB6A 2P3YA 3ILRA 3HQXA 2OPKA 4R9AA 3ZFGB 3NRUA 1AYN3 4FOWA 5DDJ2 2E53A 3I2HA 1R093 3JXSA 4YNIA 5FREA 3WDVA 5D8AC 4JCKA 2ZEYA 4JDMA 1CD3G 3LSDA 4FPOB 4FPHA 4NIIA 4GULA 3T1MA 3DPRB 4HVRA 3W59A 4PBOA 4E8CA 3B9IA 1BQPA 1HW5A 1KDKA 2R062 2Y60A 4NROA 5BPXA 4QKFA 1ASJ2 2VZUA 5DQ0A 3WNKA 5A33A 2Z42A 4MVTA 3VHPA 4QKBA 2FCTA 3JBG3 2B7YA 3AKRA 2Z2SB 1V70A 3AZWA 4LHNA 4NPLA 1H1IA 3I2GA 2VQTA 5AVPA 3VL9A 3FUOA 2WT2A 3NSTA 4XE9A 1PGL1 5C7GA 3T2QA 3HBKA 1LGCA 3ON7A 5J48A 1MS8A 2EAAA 2QQNA 4HSLA 1SFPA 4QMAA 3WNNA 1OOPB 4LE3A 1OVSA 2YV8A 2VMFA 5F32A 3T4VA 1RB8G 1CJDA 1K3IA 4PLMA 2E51A 4W6XA 1XU1A 5F5IA 2HBUA 4A7YA 2EIGA 2ETEA 3FLTA 1PVC1 1D2SA 3GNEA 1S0BA 5LRSA 3N9MA 4OHXA 3WR0A 1IKPA 1Q43A 2VPVA 2EXJA 1LU1A 5BXXA 3OGJA 5SV8A 1R1ZA 3ZXJA 1LHVA 3H8RA 5LBBA 2WZR2 1AXZA 3ZFGC 2JICA 2VCMA 3AZYA 3OD0A 2P17A 1RUG2 3KD4A 2HYXA 2RDNA 3TNPB 1WW5A 1VBD3 4CCJA 3S0MA 3S57A 4OI0A 1HRV3 5FAXA 3I2KA 1M4WA 1LOFC 5JXJA 2VJXA 3B94A 2AH2A 3NV2A 4Q4Y1 1UXXX 2BYVE 5CB7A 4HZFA 3U0ZA 3SKJE 1SFNA 1JYVA 2R49A 2JKBA 4Q0SA 1NXD1 4IV1B 4D69A 1CQ9A 3CZUA 5EZWA 4AI1A 2P34A 1VBE2 1HN1A 4XILA 3WP6A 4CDWB 3CNAA 1GNYA 2BZDA 2X09A 4LOSA 3CMGA 2A71A 3RMXA 3P5BA 4QHZA 3ZYGA 1H8TB 1JU3A 4IGQA 4PCRA 3IZOA 5FZ6A 1B09A 2ORZA 5HI0A 1I9RA 2W0XA 2BP6A 1DBNA 1JTZX 4QDRA 1GFF2 5I8YA 2XJSA 2G1MA 5C8CC 2FZ1A 2HEWF 4WVZA 5JZGB 3ZKYA 1NAEA 1NCRB 4LO5B 3ACIA 3MIDA 4IV3C 4TSVA 5B2GB 4Y22B 2N7GA 2JE7A 2DUQA 3HN1A 2X53S 3DF0A 4MV2A 2DU0A 3ZXAC 5JVVA 4AQSA 4URAA 2ZX0A 4NMIA 4L99A 2HWF2 4FO9A 4AEDC 3LDBA 3JU9A 2WYSA 5K0UC 1CZTA 4UYBA 4XFFA 2X29A 4NRPA 4PIYA 1D4VB 2ADEA 2RJ2A 3JQXA 1RUD2 5AVAA 2PLV3 1W8HA 3IBMA 3W9AA 4OUMA 2VZVA 2D40A 3AXDA 5ABJC 3TBDA 1W2TA 1ZBE3 1WD3A 2RV9A 3EB7A 3TEZA 4IV3B 5K7PA 3THCA 1J3QA 4AHYA 4AEKA 1ZZ8A 3ZM8A 3BN6A 5LK5A 3GDBA 1XNAA 4XHXA 4QPIA 4BE3A 3L9JT 4X8PA 2C4XA 4K40A 2BW8A 1UZWA 2F4LA 1W9SA 4WBBA 1PM4A 4CXYA 2Y26A 2EICA 3LEGA 4I3PA 4DQAA 4LUKA 3RYRA 4B1MA 4D3WA 2YBPA 1RUI3 3DXUA 1WLWA 1PO22 3O0XA 1TME1 1AJOA 1QJFA 3HNMA 1G9AA 1NA1C 5FZ1A 2FDGA 1KITA 1OH3A 4HMZA 3PL0A 1APNA 4UT5A 3AYAA 5EJ1B 1MQTB 1D4M3 4DB5A 2IXHA 4IQPA 5FLIA 2QQOA 5F6LB 4K1YA 5FPZA 4XJUA 2ZHNA 1LHWA 1AUYA 2QTWB 2QQVA 1DQ1A 1T6BX 3N7JA 2DV9A 2RE9A 3IAPA 4QDSA 2GNDA 2J1TA 2IVIB 2V4VA 4S2FA 1LNSA 3WG2A 4AI3A 2XB6C 3THTA 2YBKA 4O9GA 1S0IA 2WIIB 3I3BA 4A2UA 3S5AA 2WR9A 3AMMA 3FFZA 3KV4A 1V9U3 4YG6A 3K2OA 4MGQA 3MW2A 2BVVA 4Z1VA 1QKQA 3FC0A 5GLZA 2OVUA 3VD5A 3AK0A 5AFEA 5A3MA 5BY5A 1Y43B 2VU9A 3CU7A 5FZEA 4IEYA 2CDPA 1R1A2 4O7XA 2B4KA 5I0UA 5L19A 2BVBA 5IVFA 3ETPA 5JIAA 2O1QA 4P9XA 3AJYA 3NKGA 4ZS3A 4EWAA 1X82A 4DO0A 1GSLA 1ZZ6A 3M4FA 1V00A 2YC4A 5BNNC 4HPKA 3D5OA 4QPGA 2OZ6A 5LWBA 2XQXA 2RS11 1D0GA 5JSRA 1UIKA 3ZN5A 1GICA 4XETA 4CUGA 4BQWA 4QB1A 2DUOA 2H6BA 5GLWA 5KXDA 1VBA1 3W5NA 4AQ2A 2WZPP 1TEIA 1VIWB 1ZA4A 2XVLA 4UWDA 4QX3A 4DEVA 3RSJA 3WQ0A 4OZXA 1TMF2 3RPQA 3HEIA 1H4GA 1RUF1 4P14A 4NIGA 4J6GA 3N36A 2JDKA 4RR3C 4F83A 5DAXA 4I02A 3TB0A 3ZO0B 2BPA2 2WQ8A 1LKNA 2ET1A 2XKOA 4BA6A 3H1MA 1RC6A 3MLKA 3PVNA 5A1AA 1LAJA 3VBSB 4HVOA 2HKXA 2HWE3 3ASIA 2PLV2 3UKNA 2XBO3 1Q3EA 2AEZA 3AYDA 2PAEA 1UZZA 3CQOA 5FYBA 4AVSA 4LT5A 1F2NA 1FOD2 3UYJA 2TUNA 1NCRA 5A7WB 4XABA 3QH7A 4XTPA 2BV4A 3JD71 2XXZA 2OS2A 2VW2A 1NXMA 2AENA 1OLMA 5E89A 1CAUA 4LE4A 4BU2A 4KI5M 4YYOA 1RHI2 1F35A 5IK4A 1S4CA 4BWOA 1K5MB 3OBRA 4LBKA 3ZLIA 3POIA 4GA9A 5C4WA 1AL22 1KGYA 4RS5C 2D6LX 2WO7A 1HKDA 2ZEXA 1S0JA 5G05L 3RFRA 2XHNA 1CZVA 2WNUC 3GF6A 4FTBA 1T2XA 5FMOL 1DGWA 1WW6A 4QPYA 5EWSA 1JZ6A 1RUE1 5FWJA 2F17A 1N1SA 2EIEA 2R041 4NUBA 3KLSA 2D6OX 2J1UA 3AP9A 1CESA 1YLLA 3R05A 1Z7S1 3GCXA 1NE6A 4PT6A 3JD73 5FZHA 4LHKA 3VZMA 1YFWA 3J26N 1U12A 3ZSEA 3ACHA 4BXFA 2J7MA 5FYIA 1ULFA 4OI1A 3VB9A 1RL3A 1SCSA 1H8VA 2DFBA 1MS9A 4XBQA 4DRRA 2VBDA 2FDJA 1JI6A 1MQTC 4XUTA 2CY6A 2ADDA 2GNBA 4Q4V3 2V72A 1WZXA 4RQPA 1H4HA 5JMCA 1GZCA 2RDSA 4QKDA 3F95A 5DZFA 5K8SA 3OUIA 2WNVB 3FL7A 5IVCA 3O1SA 2W1QA 1JYTA 1DQ4A 2ZGSA 5JI9A 2DVFA 3AYEA 1D4M1 4I0AA 1WGPA 2CV6A 3PJQA 5L9RA 2R042 4YW1A 5HCFA 4CSWA 2UWBA 4EE2A 3ES4A 2BBVA 4V2WA 4C91A 5CFDA 3MGUA 3WUCA 2YUEA 4TLFA 2X5IB 2ES3A 4AEJA 4LO6B 4IEXA 1JODA 3WOGA 4CU9A 1WD4A 3AZXA 2HWF1 5JWPA 5LEKA 4N90A 1UOGA 2PHXA 4HSJA 3VBHC 3RS6A 2PAMA 4MGIE 3N7MA 4XJ9A 1OQDA 2HWE1 5DXDA 3J7HA 4P08A 1DLLA 2GAUA 1N3OA 4LEJA 1ACCA 2VMCA 2PTMA 1W6MA 4EN9B 3TN93 2C6SA 5IVBA 1ENXA 2VULA 3AM2A 4LBMA 4MH0E 4YZ3A 5DAVA 4XMIA 5A6XA 2BERA 5BNQA 2DTWA 3UJQA 2QE3A 2W5FA 2ZGPA 1RUC2 3UETA 5C8CB 5D2AA 2QVSB 2PQSA 1YYNA 2KM2A 1VR3A 2Y0IA 4CCKA 2Y6GA 4K8RB 4H2AA 1G6NA 5CEHA 3IDAA 1A78A 5DAWA 4NWVA 2GC3A 4NHMA 1KEXA 3G6JB 3IN9A 4YVSC 4A4AA 3VZLA 2JG8C 2UURA 2GDFA 2ZEZA 3AL5A 1QMJA 3B7MA 3MPPG 4FSJA 4AEDB 1EPWA 4P02B 3ZYBA 2MHFA 2RS13 5A7SA 2NZ9A 4TYSA 5FZIA 4D7SA 1H2KA 1CAWA 2BWAA 2VE1A 2VC9A 4MSVA 4CDWC 4D7YA 5J96B 1IHMA 1A34A 3VKNA 3BTYA 1W2UA 4M4RA 1HXS1 3HQUA 1RHI3 4LBJA 4R9DA 1XE8A 2QJVA 4HK9A 3LFIA 3OPTA 3N3HA 2QZ2A 4LKFA 1VB4A 2ID4A 1W2NA 3GYDA 2J22A 2CU5A 1DYKA 3C7EA 3KCYA 2BRTA 2X5IC 1A8MA 2WZR1 2XLFA 4M0NA 3SKVA 1AR81 3T0AA 1JZ7A 3PNAA 2C9KA 5F9TA 2R071 4GZ9A 3JCIA 1FNYA 2ZX4A 4HG6B 3M3IA 4S2DA 4LLFA 5I91A 1V9U1 2DCZA 2VECA 1IS4A 2DWRA 1PK6B 4FOYA 1I5ZA 2ZGKA 3CJIA 4R9CA 4XQDA 5A1LA 5CBLA 3TRSB 2JDNA 1RUD3 1Y7BA 2ZHKA 3SH5A 1MZ5A 2JIGA 2EVXA 1MR5A 2Z4FA 1O59A 1ZYBA 1FAYA 1ZBE2 3RMYA 3VBUA 1W9YA 2VOTA 4HLTA 4L97A 4R52A 1Y9MA 3KHBA 1HB4A 3NMBA 4LK7A 1AR73 3BPZA 1V6LA 4JRLA 2VCCA 3OGGA 4L92A 3RZGA 1ND3B 3WQBA 1XU2A 1PNGA 2BFUS 3LPFA 1JZ8A 1FMD3 1EAH1 2Y6KA 2D97A 4Q4V2 4FFIA 3UT0A 2GP5A 3U1XA 4OHYA 2CTVA 3U4XA 1JMUB 1Y9GA 5FK7A 2FDHA 4CCOA 3B00A 4LA2A 1RUE2 2DUPA 2JKXA 1E5HA 3N9LA 5BNPA 1S0GA 3MI8A 2VO5A 3CBNA 4GWNA 2ZGNA 5J7MA 2R063 2ZCWA 3IPVB 4FTEA 1ND2A 4H7LA 1U5ZA 4RGGA 1PHMA 1KQRA 1YQ6A 1HRV1 3NJZA 4GAZA 1H1MA 3M3OA 3V56A 5L9VA 5A80A 4IE6A 4XIOA 4CDWA 4M3CF 1HXS2 3U10A 1H8TC 1GOGA 3RJRA 3VDDA 1JYNA 1JOJA 3ZIXA 4CXWA 4Q0UA 4RGKA 3BYWA 1HJFA 1JZ3A 3MIFA 4XAEA 5T3NA 1CPNA 2DBNA 5DZGA 5IJRA 4EV0A 5JOXA 1UX6A 1QH7A 4QPGC 1FT9A 2WFPA 4K6BA 1UMIA 1L7RA 1WBLA 2VUDA 1WLTA 3OJBA 1RMU2 4N53C 3ZPYA 4A7ZA 4BQ5A 1Q8VA 4Y4RA 2J1SA 1W90A 1BBT1 1BBT2 4QHBA 1O3RA 3VHRA 3VUOA 1UZ0A 4LTAA 4CCMA 3J7NA 4BQ2A 2PHDA 4QKNA 5FP3A 5CKNA 4Y4YA 2WFF2 2WZR3 4COUA 1CWPA 2C5DA 4XURA 3H1YA 3BOPA 1LB2A 1RIRA 4YWAA 1SACA 1AR62 3C3VA 3OBTA 4P9GA 2XJRA 3HT2A 1KJRA 3BODA 3VBHA 3E5UA 4OHWA 3VBSA 4NO4A 3B3QE 2HWB2 1OA4A 4ZU4A 4E4ZA 5LBEA 1U5YA 3FWEA 1AR93 5D1IA 4J1XA 4NRMA 5I8TA 2VR4A 4AFCA 1HRV2 1BBT3 1D2QA 4JTNA 1NE4A 4XF4A 5FZGA 3U11A 2CSGA 3LA2A 3HVDA 4BHPA 2Y6FA 1LOBA 3O1RA 5LW9A 3KS7A 2IZWA 2VZ1A 3V0AB 2D44A 1MEC1 1VB2A 1Z7S3 2D6PA 2R6QA 4Y5TA 2VD7A 2A1XA 4B4PA 4COVA 1BYHA 3VDDB 3WEZA 4GB31 4YVSA 4C1XA 1DZQA 4CDXB 4BM8A 5BNOB 4LBQD 4FP3A 3JBG1 1EYBA 3F2ZA 1WMEA 2RM21 2W46A 5A7OA 4YGCA 1HB2A 1ZX5A 4CEYB 1A8DA 1RUF2 1OF3A 3BIWE 1QY4A 5DUXA 2ZGUA 1TMF1 2DVGA 2BFUL 1J1TA 2MNGA 1RXGA 4IV3A 5H9QA 4RHV2 5IT6A 2FDKA 2PAKA 3AP5A 5C8WA 4AQTA 1UOFA 2VCBA 3EYPA 4AVCA 2ZZQA 2HYKA 2JD4A 4LBLA 3BB6A 1DGLA 4JAAA 5KHGA 3THDA 1SLLA 4H14A 4LOTA 5FZ0A 4RFT0 5FJKA 4XZUG 5IUQA 3MV11 2XQRA 5AC92 3ZN6A 1QJY1 4B4QA 4DS0A 2FQPA 3ZFFC 5KXCA 1G9CA 1UOJA 3ALQA 2VXJA 3ECQA 1AYM1 4Y5SA 1K5MC 5FYVA 4PLOA 1VBC2 3AMNA 2C26A 3AKQA 3TEYA 4JVAA 4QGNA 1YJLA 4LBOA 2WS91 3ZOIA 4CP9B 3HD8B 5FRAA 1IPJA 2GALA 1WMFA 3AKSA 2MEV3 5JZGA 4FP2A 1ODMA 3KMHA 4WM7A 2E7TA 3SEPA 2RDRA 3UGFA 2IXLA 2Y6JA 3JD72 5BNNB 4N9IA 2E63A 3LD8A 1AHSA 1T6GC 1K5MA 1WCDJ 3APBA 3V0BA 5IYYA 1C28A 1YWKA 2B8MA 3RDIA 3BI3A 4FI9A 4XFIA 2KXLA 4BOWA 4FOQA 3DEMA 1PO23 4KGQA 3AMHA 4IV1A 3HMYA 1W8OA 4HETA 1UYXA 1RMU3 4GWJA 3VBOA 1W6NB 1RUI1 1F4AA 3A7QA 3CDZB 3M1HA 4E2SA 5A3OA 2GC1A 3IPVA 1OF4A 5C5TA 4JX0A 3GHNA 1YQ2A 2WN2A 3QACA 4KWJA 2BBAA 2DCTA 2MEV1 2PHRA 3U07A 4D6SA 4HT1T 5GZCA 1UKGA 3USUA 2WNOA 1UMHA 1J84A 3LEIA 3KCXA 4Q4Y2 3I3DA 4BISA 3S7EA 4YW2A 3H3LA 1IQDC 4JC1A 4JTOA 2OUHA 2QQWA 1JZ4A 3I54A 4Q4X1 1GWKA 3RWNA 1NUKA 2CWSA 4AVAA 2PQQA 1FPN3 3POFA 2JB8A 1S0EA 3PIJA 3HR9A 5JXIA 3OYWA 1J58A 5IFPA 2B46X 4UF0B 2Y6LA 2OX0A 3FE5A 1F5JA 3ME2A 1RUE3 3J8F3 2JDHA 2WT1A 2PHUA 1S0DA 1O4ZA 1OXCA 3TN91 1XNCA 2X10A 3BCWA 3VD9A 5JR2A 4I0WB 1RINA 1QJY2 2D3SA 2PHTA 2Z5WA 3KVAA 3SNMA 3TN92 5JUVA 4GD4A 1RTVA 1IG3A 2WA3A 2R072 1JS9A 2F4PA 4QXCA 1WLCA 3FZ3A 1YIFA 2QFEA 3USUB 4D6QA 2RJKA 1H2LA 2RR12 3LF7A 5C6CA 1EUUA 1VMJA 4XJ8A 5K0UA 2P3JA 3ROUA 3E5XA 4XAAA 2ZPXA 3OG2A 4RGAA 4WM7C 4XMAA 3KHCA 1DDLA 2Q0AA 3OD4A 4AGVA 2UY8A 4MO3M 4MADA 3PU8A 4DIQA 3DYPA 1DYPA 4J25A 4XQ4A 2B42B 2HEYF 3KSCA 3USSA 4CU6A 3ZFEC 3V0AA 4HANA 3WHTA 1ASJ1 5FYMA 3MLJA 3EHKA 1D0HA 1QDOA 2RJLA 4MUVA 5J98B 1O4YA 2GNMA 2JE8A 5A3WA 3ZSJA 4CEYC 5HXMA 1UPSA 4Y20A 1AF9A 4QQOA 4QHOA 4DXTA 2D3PA 3U37A 3QBQA 2W87A 3NNLA 5FP4A 3Q8CA 4RS5A 4LNVA 2WO1A 1CX4A 4C90A 5CFDC 1HN0A 1OKOA 4OYUA 2V09A 4MYEA 1JU4A 1GBGA 3FUQA 2VTFA 4XUOA 4LKDA 5GZEA 1G86A 2DCYA 4XUPA 1X36A 3D6EA 4ZXEA 1FX5A 3A23A 2XBO1 3WD5A 3WCRA 4YGBA 1ND2B 3AL6A 5FZKA 2JIJA 1C1FA 5D8AB 4CCLA 5J1XA 1RUJ1 4CUCA 3OBAA 4QQPA 3LIGA 1QJU2 1X50A 3ZYRA 1HB3A 4CUAA 2Q8DA 3BALA 4QU2A 4DRVA 1UD1A 2WWSA 5E88A 5FBJA 3POBA 2WWUA 5FQ0B 5IK5A 1Y9QA 3SCGA 3UKTA 2DVAA 1O3QA 5AFBA 1H6YA 1AVBA 1MS4A 2GZWA 3GXUA 3I2FA 4MXVA 3WV6A 2HWD3 4BB3A 2BDRA 3T1LA 1YRZA 4Q0QA 5FYCA 1RHI1 1X8EA 1CR7A 1JN2P 4N53B 3RJ2X 3D82A 5I93A 1DZTA 1GYKA 4RHV1 5F7UA 3HNBM 1C5IA 1VBA2 4U2AA 4YFWA 3K46A 4NAMA 1FPN2 4YVSB 3VZJA 4A7KA 3KZ4C 2EAKA 2WBKA 4UW4A 5FDBA 1OT5A 2LM3A 4IXLA 5LA0A 2ILMA 2NYYA 4QPIC 4GWIA 5GJ6A 1GQHA 4XTMA 3ZXLA 4CTEA 1N3PA 5DG2A 5JZGC 2UU8A 2LROA 5HCBA 3TNQA 3N7KA 3MV01 2ZOEB 4GXLA 3ZR5A 4HONA 3RZJA 5IAXA 1ND3C 3NJVA 5KHIA 1PO12 5F5AA 4M3CB 1VBA3 3R0RA 4JKKA 1ODNA 1W9WA 1ASJ3 5FO9B 5I0DA 2VTXA 1AX0A 3I2DA 5B4NA 5JAXA 2HEVF 4NR1A 4HKLA
chains in the Genus database with same CATH topology
5BV6A 4CEWB 4XFHA 4AHZA 1FMD1 4XQWA 4YARA 2XBO2 1GV9A 3TYJA 1ULGA 4QQHA 3INAA 1JW6A 1QNWA 1S2BA 2JECA 1QJX2 4FBFA 3LA7A 2YC0A 3UV9A 3H7JA 1BKZA 2A3WA 2PLV1 2FMYA 3J9SA 1HXS3 1BEV1 5E16A 3MDPA 1W6PA 3RNSA 3E5QA 1ZRCA 1G8WA 1SMVA 2YXSA 4IERA 2DVBA 4ZU7A 4XJAA 1QXPA 1H9PA 4XFGA 3B93A 1QJX3 3DPRA 1C4RA 2XKPA 4C1WA 4JGZA 2JG8B 4S2GA 4FPCA 5CAZA 4CDQA 3LGRA 4QGMA 4JGYA 5BYNA 1DHKB 5A32B 2I45A 3QD6A 2QKDA 4AXOA 2BNMA 1NG0A 2VUJA 1BXHA 4XF0A 4I2OA 3LOBA 4XFCA 2IFWA 1GZWA 1MS3A 1RGSA 3AJZA 3P3NA 4YLZA 4AI0A 3GZUC 1PVC2 5JI7A 1LHUA 3RQ0A 1OOPC 4M0HA 2D93A 1POV0 1VBB1 2ZGRA 2GH8A 2XHKA 2Y0OA 2BNNA 4RR3A 5ACA2 2EXHA 3AZZA 4K8FA 4FAGA 4KWLA 3D0SA 3PLQA 4ISRA 3ZDSA 2PYTA 3CLPA 2WLQA 1C5HA 2A70A 1W6PB 3WDWA 1NQJA 1LRHA 2VXRA 5EJ3A 3POYA 1AX2A 3A0KA 1GANA 4E4SA 5EFUA 1NA1A 4YM3A 1YHFA 1A6CA 2B45X 1DQ0A 1ZBA1 1X7NA 3V65A 3DKWA 4R4XA 1H0BA 2HWC3 1U5IA 1NYWA 5T5LA 3UL2A 1NY71 3JUUA 2XJTA 3I8TA 4DNYA 1JUIA 5L73A 2XPJA 4Z2WA 3AP4A 5GZFA 4C0HA 1J59A 1OQEA 3KT7A 3O7OA 1AYN2 1FV3A 4Y20B 4PQ9A 5DG1A 1H8TA 2JENA 1S1AA 1DF0A 4RQPC 3RRDA 3VKFC 2RHPA 1WUVA 2RS12 4N7IA 4FVVA 1F9KA 1ZBA3 5IK7A 4B8EA 4HN0A 4KG0A 1JXNA 1NY72 5T5JA 1UU5A 5J37A 1CAVA 4FPGA 1LR5A 1WW7A 2A73B 4WVVA 3DL3A 3AFKA 4CRQA 5TSWA 4QD2A 2OUJA 2QNKA 2ZA9A 4Q26A 1EPZA 4XXAA 3I7DA 3LA3A 1DIWA 2HWB1 3MICA 1C8NA 1AJKA 4Y1UA 2WSUA 3BOWA 3M7AA 1UF2C 1EAH3 5CADA 2ZGTA 1AR92 1SLIA 4MGYE 2AUYA 4B7EA 4XJWA 2G9GA 4N43B 2CAVA 4G9SB 5BNPC 1PNFA 3ZMNA 5KHHA 4P5HA 4BMEA 2DTYA 3MPBA 1ND2C 1WW4A 4KU7A 3GBGA 4DINB 4CDUB 1F5FA 2W68A 1F8VA 1BEV3 2IXCA 3L2YA 4UBGA 2EXKA 1XYNA 4KQ7A 2E7QA 5CFCB 1URXA 1REEA 4GALA 1LEMA 2K0GA 4JGZC 2D6NA 1C57A 4BH9A 4Q4X3 1O5LA 4EJRA 1O91A 3RYPA 2WT0A 1AYM3 1OMIA 2XL7A 1NCQA 2VY0A 4M00A 2D7FA 2WL1A 2R061 4A3XA 5KWRA 1BEV2 2HWC2 1ZRDA 3VBFC 4DPNA 4YZ5A 4PDWB 1Z0HA 2GN3A 2B5HA 1RVF3 1QJU3 1PGW1 3MYXA 1RUH3 3CJIC 2XUMA 4RR3B 5C9AC 1LHOA 1VBC3 5GZGA 4RL7A 5FOBB 1YNAA 5CFCA 2CNAA 2HWF3 1OA2A 1LCLA 1WCKA 1FPN1 3EJKA 3VZOA 2EF6A 2CGOA 4WVWA 1H30A 1OOPA 1ZZCA 1VRH3 2VOWA 3ATGA 4EWDA 3M3EA 4OULA 1G9BA 1MS1A 1S55A 1V9U2 1AL0G 3NV4A 2KA3A 2OA2A 3MEPA 3IIAA 3GBWA 1QU0A 3ZSKA 4HVQA 1N1YA 5LK7B 3QOPA 1XE7A 2GU9A 3SITA 2XVKA 4Q29A 4Q4W1 4TWTA 4H7MA 5T5OA 5EV7A 5BNOA 1JYIA 2XWJB 4RS5B 4N53A 4GH4C 3POWA 1SCRA 1H2MA 4KL1A 3OY8A 3V64A 2K2SA 3M3CA 1FV2A 3H9AA 3TAYA 1SQ4A 2EALA 3MIBA 1LU2A 1VBD2 4UW3A 1R092 3V0BB 2RS31 1VBB3 3JZVA 1I1EA 1X33A 5BNOC 4X8NA 1GR3A 1DGRN 4QM9A 4LULA 4DXZA 4YRDA 3B5LB 1HQWA 3WP4A 4XFAA 3WQ7A 1XQNA 1YO8A 1CAUB 3ACLA 1FYUA 1CAXB 2UY9A 5DUUA 4E27A 1VBE3 3VBFA 5AC91 4Y24A 4PBPA 4XF9A 4BMBA 1OFSA 1AR72 4NVPA 1JYCA 5FQ0A 1BK1A 1QOTA 4MLOA 2YGMA 5GLTA 2QUOA 5H9PA 3VKOA 3KGLA 2XJQA 1VALA 4DFSA 2JX9A 2BTVC 4Q0PA 2FBEA 3FJSA 3ZXFA 3WY6A 4FQ4A 3VBSC 5BNPB 1LGNA 1EP0A 2D43A 2D6MA 5DUVA 4IETA 1FOD3 2JG9B 1HV0A 3GBFA 3H0OA 1QGLA 2DYCA 2MEV2 3OYWB 4OHVA 5C33A 5JPMB 3VBRA 4I0BA 4XF3A 4N43A 1Q8QA 3WP5A 3VBOC 1SBEA 1F31A 4P9WA 2NLRA 1LULA 2ZAAA 1PK6A 3N7LA 4UW5A 1W6NA 2TBVA 3EBRA 3BU7A 4YZ1A 1POV1 1PZ7A 2VGDA 4F3JA 1LODA 3VBRC 4CZSA 4FPFA 4X6QB 2VNOA 4IV1C 3C2UA 4K9SA 3VBUC 1UU6A 3ST7A 4GKYA 3VBFB 3WG1A 1PM7A 2F6BA 5CFDB 3PJYA 2A7AA 4CDXA 3S7IA 5J3UA 4L8QA 2WFF3 4Z07A 4CDUC 2H0VA 3WP3A 3ZFFA 3NAPB 2V73A 4I30A 1DQ2A 3P3PA 4AFMA 4UXAA 4AHXA 4XXPA 3PVEA 4LBQB 5DDJ3 1J3RA 3ILNA 4DMIA 1QQP1 2SLIA 2ARBA 4RSUA 4ZU5A 1YJKA 3KB5A 1TME2 3I59A 2W52A 4Q4X2 2R16A 4EROA 4FQZA 1H1AA 4I09A 5T5PA 2DURA 5LRRA 3BTAA 2UYAA 1FATA 1QWRA 3LWCA 2ZKLA 3GZAA 3ZSMA 4YZ2A 4ES8A 5JR7B 1SLAA 1OFNA 5C9AA 1OKQA 2R32A 3O14A 4JRAA 1FNZA 3WCSA 1OPMA 4AFBA 2RS53 3IWZA 1PIV3 4N7UA 2R1DA 3CO2A 1BMV2 1ZBA2 1UIJA 1S0CA 1PZ8A 1BZWA 1RUH1 1QF3A 1QJX1 2XLAA 1KFXL 3JQWA 4Q4V1 3ZFEA 3ZXDA 4FPYA 3OY8B 4IEUA 2OW4A 4IEWA 4PDWC 3WT3A 2C0ZA 3RYKA 3SMHA 1OHFA 2ZMLA 2VVEA 1ZBE1 1TNRA 4NOTA 3POSA 1EV13 1OI6A 2GN7A 4LO7A 3OCPA 1OA3A 4P9YA 4S2HA 2VQAA 1VBC1 3GALA 3E97A 2NMNA 1QOSA 2ET7A 1BVP1 1R083 3LSEA 3N4MA 4JGZB 4CDQC 5JPNB 5A32A 1COV2 4PIZA 1IGOA 4YW5A 4AF9A 1ZRRA 4K3UA 4R9BA 4B4RA 4XEZA 4CEYA 4DY3A 1BVVA 2BQPA 2QQPA 1Y3TA 4KWKA 3O0VA 1MEC3 3VBOB 1AXKA 3DPRC 3NKTA 1V6KA 4E4DX 1MVQA 1ULEA 4W6WA 3WQ1A 1GKBA 2PA7A 4LUMA 2FHRA 2CAUA 4WZCA 4OI2A 1PVC3 5HCAA 1UKRA 4Y1XA 2XGXA 4Q8KA 2BWCA 3IDEA 2RMU1 4F7ZA 1HX6A 3CJXA 4HK8A 2UWAA 4WV8A 1X8MA 4ASLA 1IPKA 1PMIA 1EAH2 4MX3A 5EXOA 2XL9A 5LEJA 2Q1ZB 1QJZA 5FTTC 3CF6E 5HBAA 5L7OC 1U0AA 1TQ5A 2PELA 1DZRA 3G7DA 1FOD1 4CDXC 4NN0A 2GNTA 4GMP3 1ENSA 2WS93 3Q9OA 3VBHB 4F8AA 1HLCA 1MZEA 4FPEA 4LR4A 4Z8BA 1UZYA 2NP0A 1RUI2 5FFOC 3O0WA 4WZFA 4NHLA 2RS52 3WW1A 1UU4A 2R043 1EV11 1W6MB 3GHMA 4Y1YA 4AWDA 1GNHA 1PVXA 3ILFA 2X5IA 5A3LA 1RJ8A 1YFXA 2A6XA 1W6QB 5E1RA 2TEPA 1CPMA 4GMP1 4XIKA 1LOFA 4Q2FA 3IDCB 3MIHA 4L9BA 3WG3A 4Z92B 2A6WA 4GIQA 2P37A 3LOIA 1RVF2 4LA3A 3ZFGA 4GKXA 1W0OA 2Z79A 5D8AA 3SH4A 4GB32 1CAWB 1KS5A 3KM5A 4IEQA 1EV12 2RS51 3EXUA 4DY5A 1N1VA 1XRUA 1TE1B 5FMOS 1R082 4NPRA 1JHNA 3SHRA 1GLHA 1BJQA 3KQRA 1B35A 3A4UA 2OZJA 3NAPC 3HWJA 3ZIWA 3AMPA 1VRH1 1NLRA 1S2KA 4Q0VA 4X6RB 4GH4A 4LLOA 1AR71 2NM1A 2XJVA 2AR6A 4ES9A 2DCKA 2LUWA 4W65A 2XVGA 5JLVA 4NHKA 4K1ZA 2FMDA 2G4IA 3S30A 4FTSA 3D4KA 1KJLA 3VKLA 4ATEA 4AYUA 2RS32 2ZGOA 4O9EA 1QXRA 1YCIA 1L3JA 4YZ4A 5CIRA 1AR91 5JDBA 4YW4A 1LEDA 4QQ2A 1MQTA 4KNCA 3KGZA 1AYN1 2Q8OA 4CP2A 2YROA 1MZ6A 1IZ3A 1H9WA 3H8UA 4Z82A 2WS92 5JCTA 4FOVA 1NZCA 2WC2A 4YVWC 4BLJA 1LGBA 4E2QA 4R4ZA 3K51A 2IXKA 1UAIA 5I8SA 5ACA3 3WHUA 1SLTA 1VAMA 2P3KA 4GMP0 4META 4DOUA 1KFUL 1RMU1 1TMF3 2I74A 3LKJA 4N43C 2OIIA 5JOZA 3B9CA 2WQZC 4GWMA 3RZZA 2WNEA 2WNUB 3KCCA 1VBD1 1CAXA 2VOVA 5A33B 4QQLA 4BZ4A 5CA6A 2NPIA 3WDTA 3SISA 4E2GA 2B9UA 4KH9A 2AZ5A 4J1WA 3IDBB 2MPFA 2RMU2 1WLDA 2BGCA 3L2HA 4AFAA 1BMV1 1MZFA 2IXJA 2I07B 4LBQA 2JG9C 1D4M2 3B01A 1EY2A 4Q27A 2C1FA 3RI9A 1PIV1 5H9SA 3WW2A 3JB8A 4YVWA 4FXKB 1GZWB 1POV3 3ZYPA 1DU3D 5F6KA 3R6SA 1SBDA 1ONAA 3VZKA 1LECA 1CONA 3MIEA 4RD7A 4BQ1A 3AP7A 4EN7B 1MS5A 3WINE 1OQ1A 1VAVA 3ETQA 3PMEA 1REDA 2X8KA 1V6IA 2WA4A 2WFF1 3M2MA 5GALA 1VBB2 2O8OA 2VW0A 2CYFA 3LZZA 3VLBB 3VHOA 2H0BA 2BEOA 4AQ6A 1PO13 2Q4SA 3ZFEB 2JE9A 3X29B 3NVCA 1NCQC 3NW4A 3DV8A 1UL9A 4XOGA 3T2TA 5JOYA 3VGIA 2ZTNA 2ZHLA 5ABJB 3SCFA 1ZVFA 1HDKA 4B29A 1DGRA 4MGKE 2ZJCA 1XNDA 4AK3A 1AZDA 2ZHMA 2QCSB 2O0OA 4LO4B 2XJPA 2RM22 3DGTA 3JBG2 3LAGA 2IXIA 1JH5A 4YG0A 1GQGA 2CL2A 2VW1A 4XFBA 5T52A 3B69A 4HFSA 2YYOA 2W08A 4Q8LA 1AR83 3WDXA 4IEOA 2DF7A 4QT6A 2ENRA 1VBE1 3LCPA 1O3TA 4AEDA 4AGRA 3QLQA 3H50A 2P3IA 4CYDA 4MXWA 3SCHA 4FPJA 1VP6A 1ZNPA 1ZZ7A 1HIXA 2A3XA 4XYXA 3D8CA 3RG0A 4COWA 2Y38A 2Z69A 2HWD2 3NV1A 4LHLA 1RUG1 1YUDA 1COV3 2GH2A 5EYYA 1KS4A 2AREA 1FXZA 1Z7S2 2ZACA 3ZXGA 3HT1A 1SLBA 4AVBA 1PGW2 4OHZA 3PTYA 3DN7A 1RUH2 3PMSA 4COYA 2R0HA 5ABJA 1HRI1 3H3UA 4AEMA 4OI4A 4EN6B 2HWC1 2WINB 1WMDA 1Q5OA 2GMEA 4Y26A 4YM0A 4YSFA 2XWBB 2TNFA 1G9FA 3D0JA 3J8F1 1CJPA 4BIOA 2A3YA 1R091 3FFQA 3ENRA 5FBZA 4QXKA 2Q30A 1I3HA 1QNYA 4ATFA 1W6OB 3HIFA 1Q8OA 1ND3A 3QH6A 1QQP3 4XDQA 4SLIA 1OLRA 3AZVA 3MZHA 1HQNA 1ZZBA 3AFGA 1XXNA 2VUAA 1PIV2 3HBZA 4ONUA 4BLIA 2VQ0A 3SH3A 4Y5Z0 2PHFA 2ZKNA 4JDOA 2VNRA 3FX3A 3SLIA 1WBFA 3WDYA 1O3SA 2E7AA 3PVBB 4LBNA 4C0BA 1NQDA 1YFYA 1ENQA 4WM8C 5DDJ1 2WJSA 1Q8PA 1AL21 4QPIB 2WLPA 3UJOA 5IK8A 1ULCA 1NA1B 1C3HA 2XH6A 4BPZA 3O12A 2R30A 4XW3A 1G9DA 4E9KA 4H3WA 4OLLA 1PK6C 1AR63 3FMGA 5L7OA 4AG4A 1RITA 4HN1A 3K48A 4HBNA 1LOCA 3NWKA 5C4WB 4IL7A 5EYXA 4AGGA 4QGLA 1HRI2 1LHNA 4Q1RA 1FI2A 4Q4Y3 3MF6A 3VZNA 4DZGA 1AR82 1MVEA 5J36A 1MS0A 2VVDA 4CDUA 1YI9A 4XZPA 1VRH2 5GM0A 2Q5TA 4U36A 4HL0A 5J09A 4SBVA 4Q1PA 5T54A 3OTFA 2HWD1 4IEZA 3ZSLA 2YHJA 2H6CA 1E57A 2GMMA 2R0FA 4AFDA 2VNGA 2DFCA 2ZGLA 1LOAA 4XHBA 1SLCA 3R4DB 4CDQB 4WM8A 1ALYA 3FBYA 3VBUB 4RHV3 1REFA 4YG3A 2CGNA 4FCAA 1UMZA 4W6YA 5FLJA 3WLUA 4INDA 4UBHA 2HWB3 3FBMA 4Y1ZA 2XG3A 1JBCA 3WX5A 5C4WC 1W0PA 3O5SA 5H9RA 2VMGA 1IKQA 1C8M1 4HKOA 5AC93 1HQLA 1V6NA 2VVFA 4BYYA 4KGGA 1R1A3 2IFRA 3EQEA 3VHNA 1YXWA 2DCJA 1YI7A 1GZ9A 2O8QA 4ITCA 1QQP2 4AHWA 3WW3A 4AVVA 3R4UA 2PN5A 1AYM2 1IS5A 4CEWC 5F1RA 1V6OA 1XYPA 4CEWA 1R081 4YM1A 1PO11 3IKWA 1RUF3 1B35B 2IWGB 2UYBA 3NO8A 4AI2A 1IOAA 4Y22A 4P9JA 2A6VA 4JGYC 5KHKA 1C1LA 3SXWA 4M3CA 2RMU3 3N35A 1UCXA 2BNOA 1V6MA 3WXPA 2WNUA 1Q56A 4FAHA 3E6CC 2WSVA 4XJZA 1KRIA 1UPIA 4COZA 5FO8B 1C8M2 3AP6A 1AXYA 2ZGQA 4JDNA 4MZUA 4ASMB 1YFUA 3FLPA 3H3ZA 5F5QA 3ZN4A 5K9YA 1LJ7A 3VL8A 2PFWA 3THPA 2ZMNA 1HRI3 4PJYA 1VLNA 2D5HA 1O4TA 2GMPA 3FLRA 3M3QA 3MFAA 4IESA 4HPKB 1RUD1 4YM2A 2E6VA 4UW6A 1WA4A 3CL1A 2BUKA 2EA7A 2YY1A 4M01A 1AL23 4OUSA 1VAKA 1RUJ2 5CU1A 2WNVA 1ZREA 5GKAC 4PDWA 2ARXA 2WNVC 3ZN6B 4CP0A 3AB0A 3E6BA 3NL1A 1QHDA 5BUVA 4QM8A 2AGSA 4KU8A 3HAGA 2JG8A 2ATFA 1AR61 3EO6A 1Q8SA 3GZTB 4KBBA 5CNAA 3IMNA 3W58A 3MIGA 1HV1A 3TOJA 5I0SA 1LENA 2ZX1A 3VBRB 1V6JA 2CWMA 2A75A 5SV5A 3MF9A 2E9QA 3RI8A 2VMHA 1QDCA 3OPZA 3WG4A 4KG8A 4RA0A 1RUC3 3ZMOA 5BNNA 1IQAA 1MEC2 4YGDA 2A6ZA 1SEFA 1RVF1 2D6KA 2ZAHA 3VV1A 1XYOA 4OFGA 4OVEA 2RS33 5DUWA 4D94A 3IM0A 2GSYA 3ZYIB 2B39A 2UWCA 1VJ2A 1DGWX 2AYHA 3AMQA 2ZX2A 3JB4C 4Y1VA 1SFYA 3KT1A 3OF1A 4P9LA 5GLVA 5JSOA 1LESA 4JQRA 5T55A 1QJY3 4XBNA 4EWEA 4YGEA 5C9AB 3WNXA 3S6PA 1RUNA 2FZ2A 1DG6A 3ZXKA 4ZXKA 2NQYA 4I01A 1W6OA 2WQ4A 4YFZA 1COV1 4JV4A 2QDRA 1A3KA 1J3PA 5CG9A 2D5FA 2C9AA 1OSGA 5L7OB 2DVDA 1PO21 1N1TA 4L2NA 1J1LA 4GB33 1N3QA 1NOVA 2VG9A 2I2SA 3PHMA 1WCSA 1IS6A 3VKMA 2RM23 3AXEA 2YGLA 1CAVB 4MGZE 1S0FA 2G9FA 1C8M3 2HJIA 2YZ4A 1O7FA 1NLSA 4XF1A 1GNZA 4YW3A 4IEVA 3VN4A 3ZYGA 1U5XA 5C8CA 2VOXA 1UN1A 1NCQB 4B3NA 5L36A 2D98A 1CGPA 1SBFA 1CN1A 2VMIA 4K21A 2QDNA 2ZBJA 2K9ZA 3AX4A 3ZYJB 5JSPA 3WUDA 2QZ3A 2ZX3A 5CG8A 4PF5A 5KBFA 1OLQA 3QCWA 3WW4A 3A0NA 4AVTA 2CGPA 2ZS6B 4I3GA 1PGSA 5T50A 3WZ1A 3CEWA 4ZKTB 4G4FA 4AW7A 2WKKA 3KT4A 1CVNA 5GZDA 3MFCA 2D3RA 1O5UA 1PZ9A 3FHIB 3AKPA 3VDDC 3PVOA 2R1BA 4ORFA 4R8HA 1RUJ3 4URTA 3M70A 2VOKA 4H55A 5DZEA 3ZVXA 2ERFA 2NN8A 1ENRA 2GC2A 4AI8A 2BPA2 2RR11 2V5YA 4GH4B 4M3CE 5KXEA 3WVJA 3J8F2 2JJ6A 4NWWA 5CFCC 4EN0A 3ELNA 2W39A 1W6QA 4FPLA 1QXJA 3I59B 5KXBA 2R073 4TZDA 1ZM1A 1LOGA 4FXGB 5FOJB 1R1A1 4XPVA 3E6DA 4RQPB 4D7TA 4QPGB 1IS3A 1SDWA 1ZRFA 4QX5A 3LB9A 3NV3A 2JEMA 3WDUA 2RR13 3NAPA 4BIFA 2SBAA 2YDEA 2HWE2 3UK9A 3ZFFB 1B35C 4P9IA 2XJUA 4PIXA 4B7KA 1RJ7A 2XLGA 4XBLA 3ZXEA 1RUOA 5ACA1 5I0TA 4PLNA 2ZABA 1BCXA 2GC0A 4GQ7A 4WVMB 4Q4W2 3URFA 2IC1A 1NCRC 4K7JA 4N9HA 5HXVA 5FCCA 2ZZJA 3AKTA 1JUHA 2LTNA 1DQ6A 3TWIA 3IT8A 1KD7A 1XNBA 1ZZ9A 4IEPA 1LTEA