2X05A

Inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine- configured castanospermine and an amino-australine analogue
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
851
structure length
851
Chain Sequence
AGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inhibition of the Exo-Beta-D-Glucosaminidase Csxa by a Glucosamine-Configured Castanospermine and an Amino-Australine Analogue.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 275
structure length 851
sequence length 851
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2x05A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x05A03
4S1RH 4QHMA 5D1QB 1ZTXH 4MWFB 2NY6C 3KPSD 1WDSA 1UM6H 5C09E 5C9KA 1DVFD 1D9KD 5E56A 3DX8A 1U95A 2HTLC 3DUSA 4N1CA 5IB4A 3BEWA 3WIHH 4UCFA 4AISA 2EDKA 2X4NB 4JY4A 4ONHB 4F33B 1EJOL 5DD3H 1DEEB 3LN9A 5F7EL 3VFPB 1VADB 1GU3A 3WBEA 4HX1B 2P5EB 4DW2H 3DX7A 4TUOB 2JB6A 4ZXBC 4Z78A 2IGFL 4PTUA 2Y8KA 1KB9K 3VI4E 3MROA 1MEXL 3CU7A 4FQ1H 2APWA 4PRAB 1FCGA 2X4SB 3BPNB 3WLBA 4PLJC 3FOLA 4PJ8A 2AS5M 2FX7L 2XONA 4OCWH 4PFEA 5JXEC 1JTOA 4JRXE 1GUIA 1UA6L 3MRHB 3PWPE 4PRBB 3TBSA 4X7TA 4PRAA 1ZJBA 4K3EL 3WEOA 5CKGA 3IJSB 4KDWA 4O5LL 4Q7NA 2DB8A 4NWTH 3HMXL 2GJ6E 3GMQA 2W5FA 5KN5B 4FQCH 2IBGA 2YD5A 4JQIL 3FN0H 3U4EB 3CC5A 1T1YB 5F8QC 2BNQD 3VWKB 1ADQH 2IMNA 3AISA 3ARGD 1RK0A 1X5AA 5CSGA 3DMMD 4IHOA 5AYUH 1O8PA 3VXTB 3CZFB 3RPIB 3RAJH 4F37F 2AERT 3X13A 1PBGA 4I0PD 3MRBA 5A2IH 1YEDA 3QQ9C 2XKSA 4YPJA 1I8IA 4LKCA 1JPSH 5F97E 2LW8A 3RY6A 4ZSOA 3N11A 5E4EC 2DQUL 1ORQB 2R1XB 1AGFB 5GRWA 2WCSA 1TG7A 1DBKH 2A74A 1KPUA 1KBBA 3QUZA 5D5MB 4QWWC 1VBUA 5T1LA 2W1SA 1A1NB 3L3DB 5IVZA 4ML4A 1BSIA 3TCLB 1FOBA 1XPWA 1CG9B 4LK4A 2EC9U 1NBVH 3EYUL 4YUEL 4CGTA 6TAAA 4YHMH 5EU5A 3RJXA 1ZHNA 5L8JB 1JPTH 4RMRA 5HI4D 3BH9A 4LGRB 3PJSA 2Z1SA 5H2BA 4M5ZH 3RBGA 4XVTL 4YHYC 4M48H 4AIZB 1NDMB 1GGBH 2YPLD 4YIQA 1TUXA 2ARJQ 1F3DH 5KG9B 2QQJA 4LCWB 4XPBH 1RV6X 4R97B 1A7RH 1ED3B 1JNHA 1CL7H 3GSOB 43C9B 4MNMA 1GCYA 5DXWA 3ZM8A 3SJVB 3WD3A 1KGYA 1LEGA 1YEJH 1WK0A 5GGSB 1X5FA 5F89A 4M7KH 1CECA 4C55A 4ZUUB 1T1ZB 1MHHB 5CWSB 2DDQL 3DURA 1H3PL 1AQDB 1KCVL 1OW0A 4NO2B 2NY0B 5IHUL 1BVLB 4GW1B 4S1SL 1URLA 4WO4A 3V5DA 3UR7A 4POYA 3IVKB 2WBJB 4KKLD 1CD1A 3KWWB 4NFBA 4DZ8A 1ZHBA 3AAZB 4ODXB 1MNUL 3NA9L 3MJ8B 3HNSH 1PQZB 4I0KA 4RWYH 4BKLB 2XFYA 4WV1C 5FHAL 5IEHB 4WEBH 5GZND 1K2DB 4YC2B 2XN9D 5GGVY 3AAZA 4ODXA 3RWHB 3DXAE 4OUUB 3HR6A 4HGWA 3CK0L 1ND0B 3QFDB 1TXKA 1CN4A 2QQLH 4HBCH 5KJRL 4KRPC 3BDBA 5FOBA 3MRNA 2ZPKL 1XF2A 3W0WB 4HC1L 2OR9L 1AD9B 1TQBC 3VRJA 4P4RA 3RGHA 1QOKA 3HC0B 3QSKB 2F74A 4JL2A 4XBEH 1X44A 4PRIA 4Z2GA 1BYBA 4WHDA 3SPVB 5EJ1B 3LS5L 3UTZA 2ZNWA 1LWJA 4MCZA 4P23C 1MJJA 4AQOA 5FKYA 3QWOA 4ODWB 3CXDL 4P3WA 5T3ZD 3ZR6A 3CK0H 3GI9L 4CMHC 4GKZA 5ACLA 5JW4Q 3QUXB 4CMHB 4RQQA 2OXHA 3SGDI 7CGTA 2BSSB 2VL5B 1I9JL 4OF3A 5E6YA 1RYYA 1AXIB 1C91A 3WLWD 1XC6A 1QSFA 1OAXL 4HWEH 3RGVD 2DLTA 3EYVA 2ED9A 1CLYH 5SWZE 3MRIB 3PGDA 5EBLA 5D1XA 1L0PA 3O81A 2V5MA 2Y36L 1B0GA 1OSPH 3RWCB 3S5LA 5J8OA 3DX7B 4TUOA 3I2IA 1OB1B 4UV7H 4OCLC 5DJXB 4R97C 4D0BB 3ZKXB 1C5CH 2OJEB 4KK9D 4MAVA 2BXYA 1JWMA 4C4KO 1H3GA 1NQ6A 3PGDB 3TZVD 1SHWB 1E43A 1YMMA 4LCYA 5H37H 5EO9A 4KVNH 1KIPB 1VIWA 2VH5L 2OLHA 1R5VB 1A7RL 2ZNXA 3NFNB 3NPSC 2DI7A 4U1MA 1HP5A 2EEAA 5KN5A 3W38A 1RZIA 3SDAA 4D9LL 5F7DA 1TLKA 3VFWB 1NC2B 3WEXA 3F6IA 4S1QH 3EYSH 4JKPH 4LF3A 3NTCL 4IIQC 1TA3A 3POHA 4GW4B 2WIIB 5D7LB 3GIVB 3EO1B 5LXGH 3DJ9A 1EEUA 2J88H 1FPTH 3K1DA 3NIFF 2X4PA 1OL0A 5IBTL 1G5AA 2GDVA 2NTSP 4MA3B 4NQEE 2VE6A 3RWFB 4JDZB 4XCYB 4ZZ5A 4A2MA 2X9YA 4AD2A 2H26B 2JTDA 2HN7B 4P57B 4P3DA 1IT9L 1B31A 2W9EH 3ARED 3D3AA 4XP9L 4PCTA 4DKAA 2OP4L 2H2PD 2CKNA 1HE7A 2WZ8A 1F42A 5HHXL 3TEUA 4HK0B 1CGVA 2BBAA 3LKOA 3O2VH 4YHNB 2ZUMA 1UWIA 4OM1H 1P53A 5ICYA 3B5HA 1KJ2L 3R06B 4PP2B 3A4AA 5DMIH 3MYJA 5D7IE 3IKCB 2XHYA 4OTXH 3KPTA 4HG4K 1KCRL 2GW5A 4HEPG 4HTYA 2R29L 1P4IL 2GY7B 2ZG2A 4F7CB 1V6YA 1OARL 1CEOA 1WZAA 3GH7A 3HAEB 2QBXA 4HJGA 3QCUH 4TNVF 5D7JB 2L4OA 1K8IB 5EWIL 2UZXB 3CXDH 3DURB 3ZDZF 1N5YH 2Y72A 3VCLA 5JBDA 4Y5XB 4TULL 3C5SB 4KZEL 4AY0A 1R8LA 4HJ0D 4JDTH 2QSQA 1EJOH 1V0NA 1Z6JT 2BJMH 1OM0A 2Y2WA 4NOFA 4MJ5A 2RBLA 4FTVB 1TTFA 3NACL 4RMQA 2CLZA 2RFXB 2ZCKL 4NZDA 5F6IC 4GRMA 4PV9B 4AD5A 4LLMB 4PGEB 3QG7L 1Y6MR 2WWDA 4OZGB 3QUXD 4G80B 3UYRL 1BQCA 4LHUA 4YNYA 2ADFL 3C87A 1TFVA 1KEGH 4Z7WE 4MD5A 4TOYL 1S3KL 3MV8E 4GW5A 1A4JB 5K33A 4R7DB 1X5JA 5LQBH 1BWMA 4ZO9A 1XEDA 3PBGA 4JQVC 3TNNA 5EBMB 4QB6A 3R8BB 3N12A 3BP7A 4LSVL 2PW1A 1G7MB 5FUOL 1V3HA 5HVHC 4S10A 3IFOB 1XF4A 3EJYD 2YA1A 1E4XL 1UYWH 2KQMA 5F8RC 3TBVB 4QRPB 4PJIB 2PO6C 1IC4H 1MWAB 5GSRA 4LCCB 4UTAH 5E1AB 3TZVB 5I8KL 5L0QB 5T1LD 5BXPA 3DOSA 1RSFA 3PWVA 4G8GB 4Q7DA 1DLCA 3WDPP 1T21B 2DLHA 2VLJB 3MLZL 4MS8D 1W72A 3THDA 2R9HD 4BZ1H 1KJ2H 3KXFA 3P9MB 4JFPB 2W91A 5FDYA 1NJ9B 3IDIB 3BPLB 3TBWA 2O5YL 2WMIA 4LP5A 3IDNA 3OZ9H 5FKAB 1DCLA 4M29A 3DXAB 1WTLA 5C9JA 4XZUB 3ZO0A 4PP1C 1S7TA 5IROA 1DBJL 4ODSL 1ITCA 1UZ8B 1XMWA 1N6UA 4I2XE 1XCQA 2VSDA 4GUPB 5F3BA 3WLBB 3AMCA 5IMMB 1VPOH 1EK3A 3IDNB 1A21A 3MRLB 3ZJKA 1EHNA 3C08L 5DO8A 2J3SA 3FN0L 4RCAA 1MRFL 4WWID 1NFKA 5ACZB 3QXUA 3BC9A 2QQKA 1QD0A 5FO9B 1DBKL 1T89A 3G6JE 3BXWA 3WH8A 3IF1B 4UILL 5C07D 1XGTB 4G5ZH 2QHAA 1M03A 4FQHB 5J9PA 3GSUA 5E24E 1ISZA 4NFCA 1ORSA 1C1EL 5L2JA 4HFUH 5ISZD 4HK3N 1LEIA 2R7EB 5JQ6L 2FBOJ 4WFHD 5ENWB 5GRUL 4YHIB 2AEWA 3SOBH 1E6OH 2CK0L 4WUUB 1CZSA 1LGVA 5D9SA 5GHWH 2AEIT 3WFDH 5ALCH 5FYJE 2WPGA 3H9SB 25C8L 3PP4L 3SKMA 1TIUA 1WWWX 5F9JA 1AGFA 2EIBA 4YE4H 3T0ED 1JYXA 4QLLA 43CAA 2QQKH 1BZ9B 5D4QA 3B43A 1AC0A 4MA3A 4LOUD 4DUVA 5DC0A 4P5TB 5A8PA 3RZCC 2VXSL 5I9QB 5C08A 2ZXQA 4LDEB 4CVXB 4R4FH 2G2RA 3O6LL 4HZ8A 5A6KA 4Y4HA 5C1MB 2VLRA 5T3XH 2WVSA 4ELKB 2AJUH 1J1OH 2EPLX 4TVCA 2VUYA 3OJ2C 4IRSB 3MODH 1IQWH 2F58L 4YBQD 4HLZG 1F3DJ 4HV8B 4K23L 2ADJA 2WW5A 1N7MH 2R2EB 5EORH 2FIRT 1R24A 3H7LA 4M62L 3CSYA 4WEBL 1TTGA 1FFOB 1UZ0A 2Z31B 2ITCB 5D2NC 4PRHA 2HVKA 1V7MH 2CITA 1F11B 3BIAX 1D3CA 5D70H 1A8JH 3SY0A 1QI4A 1DLFL 1P5VA 3OXSB 4LPLA 5T33H 3FFCD 4N1HB 4MQ7A 4UZGA 1FO0B 3CHCA 2HLAB 4JO2H 2VCAA 4YDIH 1Q0XH 2ERJB 4A3HA 3CFIC 3TYGH 2HJFB 3BN6A 3K4AA 4FXLA 4MMXC 3FCTA 4UI9L 1UR9A 1I8MB 5A43C 3QIBD 4CN4A 5T3ZE 3G5YA 4V1DE 4DGYH 1DBMH 4HIHB 4Z2IA 3CTTA 1JRHL 4PJCA 1ADQA 4J7RA 1J1PL 1OAYH 1WCBA 2B39A 5CZKA 5GRJH 1TCRB 1WC7B 4EN3D 4H7VA 3PABB 5T3XD 2R69H 1CR9H 4HCRL 1ITBB 5FOJA 4C7DA 3IJ7A 1G9ML 5FKPB 3GZKA 4GKSB 4Q2ZB 4O51A 5EZOL 4MD5B 1BQHG 1NMBL 2PO6D 4J6RH 3DX9B 4QY8B 4UT6H 3HR5A 1CDBA 4K07A 4Q9BA 1EJ6A 2LVEA 3TONA 1I1YB 5JQ6H 3I84A 1BOGA 1JAEA 1A14H 5BXRA 1JPTL 4KMTH 4NYLA 2R0WH 2B4KA 4WI8A 3MJ9H 3O3DA 1FVEA 4R2GB 5SWZD 2V5TA 4P5KB 4R4NC 5GS2D 1BHGA 5ID0B 1P9MC 2B8OT 4CN6A 4UIMA 4WWKC 5CEZD 2APFA 5JZ7C 2EO7A 1VFMA 4R8WH 3JUGA 1T21A 2VLJA 2VQ1A 3QBTB 5GJSL 1CIYA 4NKIL 3DTXB 5HYEA 3A21A 1Q6DA 4YWGH 3WQVA 3H0TB 1NCWH 2X70B 15C8H 1MWAA 1RHFA 1JNLH 3BRFA 4Y4HC 1ULOA 2E9IA 4PJHA 4OCYH 1JUFB 4DAGL 3VX0A 1MFNA 4NJAH 1EHLH 2EO9A 3I6KB 4U1IA 4U49A 4OZOA 2ICWA 3SCOA 1ZT7B 1YEGH 1OF2B 1JGDB 3VGGA 5ADPL 1SEQL 3ZSSA 2NY2D 2A83B 2MQCA 2UVFA 1Q9KB 3ULUH 4KK8C 2EXOA 1CX1A 4MJ2A 3HNMA 5D1XB 4OFYD 4WUUD 1NANH 1B0GB 3RWCA 3S5LB 1EAJA 4JHWL 2KBGA 3O2DL 3WUWA 4Y19D 5IR1B 2XY2A 5CCKL 5IUSA 1I5PA 2Z31C 5GS1B 4I8DA 4OZFG 5IIEA 1XCQB 4GUPA 4Y0GA 1BPLB 4UT6L 1GHSA 2NZIA 3P2TA 3AXLB 1DFBL 4XCFL 1BLNB 1RZ7L 1CT8A 3GGWA 4W70A 5L2KB 1IGCL 3I02A 4PUEA 3EOYG 2W1WA 1IAOA 1ZVYA 1ZVSA 3WSQH 1FE8L 3PZMA 1DLHA 2G4FA 5J12C 3RKDC 1BEYH 1ZLSH 2AJVH 4P4KB 4IOFD 5GJSH 3CUJA 1CENA 3SDDD 1IAMA 1UOKA 4JHAH 4QXUL 2GFBA 4YBQC 3WF4A 4N5EC 3K80A 5I6XB 2YC2A 4N0YH 5AD0B 4JQIH 4AG4A 1FZMB 2P8PB 3ARYA 3U1SL 2DM4A 4O2CA 3IDYB 3ETBF 3IDGA 4WHYG 1E6JH 5CJBA 2R0ZH 4NKQB 4ZXOA 3TNMB 1Y6KR 4DWSC 4JANB 3VXSE 4WWKA 3WNMA 5F89B 4PLOB 2GJPA 3FQWA 1D5IL 3O8XC 3WENA 5TE6H 3VH8G 2OBGA 3LN5A 4PTTB 5DK0A 4EXKA 1FNFA 4KRNA 2Q8BH 4PRPE 4J8RB 1L7TH 1FVCA 5J1XA 5C3LD 3MXVH 3NJXA 5CYYA 4R4BA 2VZRA 2PXYA 5E6ZA 1E6RA 4C7FA 4WO4B 3MA9L 3QI9C 1SFSA 3DV6A 3T77B 2GSGB 3FONA 4Q9QH 2VISB 5B22A 1YZZA 5IVXA 4QX3A 5JHLH 5C09B 4X4ZA 3L3JA 3OAZH 4E5XA 4Q9RH 3MMEB 3OLEA 4QNPE 4QX2A 3HFML 3ZDYF 4YXHL 4NQCA 1QRNA 3LEGA 3KPSE 5IHZB 1A4KA 1M53A 3OKOA 1RJLA 4ZDHB 4K3JH 2WKGA 2FX8L 2YL6A 3RZWA 3VFVB 3QEQD 3DNKA 1UACH 2O92A 4F58L 3VFPA 1L7IL 1DWIM 3OPZH 4LQFL 3VFUA 4NN6C 1JF1B 4R90H 1E4WH 1UUQA 4H8UA 2GJ6D 3NA4A 2XA8H 4ODHL 1N2RB 3B9KD 3WN5B 3KYAA 3PHSA 5IHUH 1RZGB 5EFFA 1NM9A 2CPUA 1T89C 4CUAA 2IG2L 2W3JA 4PJEA 1EPFA 1NMCB 3U2SB 4S1QL 3AMKA 1A1MA 1JI1A 3RJYA 3HMCA 2EDEA 1EXPA 2PB1A 2B4CH 4PJ7E 3F8UB 2E6JA 1XSJA 1OQOA 4PG9A 3SCQA 2O5YH 4FFWC 1AD0A 4MTVA 4FQQB 3BP4B 1FO0L 5HHOE 4AZGA 4YBLC 1XGUA 2VXQL 3B9VA 2FR4A 3SUVA 4P5KA 4KVNL 2D22A 2P24A 2FBJL 4AG4H 1PIGA 4LSUH 2VERN 2EKSB 1CLOL 3SKNB 2DWEA 5FOOA 4EKJA 2PCPB 2G41A 4E42A 5JPMA 3P77A 12E8H 5KSUA 4KHXH 3I2KA 1WNOA 2DT0A 5E94B 5DEFB 1GZQB 5JMRA 1JE6A 3CFEB 1X6LA 5B4XA 3IXTB 1TVHB 5JPMB 1F3JB 3RTQA 3SDCB 1E4NA 1U3HD 1BAFH 4U7MA 3S88H 1A1OB 4UOZA 1UACL 2D4DA 1E55A 1J1XH 1U8QA 3ARXA 1IQDB 1OGTB 2P5WE 5E94A 3EW3B 1P4LA 2HJKA 4EI5A 2FJHB 4CJ1A 5CIPB 2LE9A 1QSFD 4CN1A 3OIHA 2WHKA 1PVHA 4CD7A 3R0MA 1WKYA 4QHUB 5HHPB 5TDNB 3V52L 3GTNA 1RULL 4P49A 3BGFB 2MTPA 3AY4A 4PBXA 2HLEA 3QUMA 4JPWH 3MLSH 1KIQA 1NQBA 3KPRD 3W82A 3LPOA 4V2BA 3THCA 4P08A 4YHGA 4XC1L 5D7SL 1JWSA 3LS4L 3WEMA 1UWWA 2R39A 5DUBA 2E6QA 5JR2A 1EOKA 1DVFB 5D71H 1KUMA 4P2OA 3X3GL 2VLKA 5J4MA 4P0DA 3O0RL 3QQ3B 5INCA 5GGRA 2DH3A 4F80A 2H26A 2DPEA 3DHUA 4JAWA 5BROA 3L3HA 4LLWB 3X14A 2P49B 3BAEL 4L29A 3QO0B 4PGDB 5B21A 1GIGL 3C60A 3HB3D 2W9XA 1KB3A 2WC4A 4IS6B 1P4IH 1R7OA 1BAGA 2KH2B 5EZJA 1MFDH 3TYFA 1S9WB 4LCIH 1PLGH 1TDQA 1D5BA 5F1IB 4MX7A 3JV6B 1RJZB 1KFWA 4KC3B 3VUPA 2R2BB 1MCOH 1FL3B 7FABL 4M3KB 4J8RA 1PZ3A 1XV8A 3S2CA 1EMTL 1NDMA 1KSRA 4XPGL 3DYMA 4UR9A 2DDQH 1QLFB 1S9VB 4U0QB 1NLDL 5I78A 1CZ8H 5D6CB 1HWGB 3FQWB 2IH3A 3NACH 3GSQA 3V6OE 1TJHH 5I24A 1YMHA 1U30A 2HN7A 1UWUA 4YHEA 1SMDA 6FABL 4X6EA 4JFOB 3OR7B 3DV6B 3T77A 1TZGH 1RP9A 1UR2A 3SCMD 1UA3A 3RMEA 1JMXA 3MV9E 2YPVL 5B39A 4M5ZL 4GPNA 1BVLA 4GW1A 3GBML 3V5DB 2NY3D 4S0TD 3KYNA 3LS4H 1WIPA 4PLJD 1W32A 3FQUA 3OKMA 4BA0A 1NWUA 1X5YA 4XUQA 4D9RE 4OD1H 2CKBA 3MGAA 4JFEB 4PCSA 2CR6A 2MFNA 1S8DB 3G04B 3WJJC 1OGBA 4WV1A 3FTGA 2FIKA 5TFSL 3WXVH 4NNPH 4ISVB 3SCTA 3FFDA 1NP0A 4KHTH 4HUVA 3C8KA 1MFBH 4QO1A 3BHBA 1A6ZA 4Z7VE 3UMTA 2AJYH 4D3CH 4HFUL 5EOQL 2F5BH 1JGUL 1UXSA 5HJ3B 2J22A 1X5GA 2WQ8A 2D23A 3HPLB 1E6SM 4WU7A 3PDOB 5FHBL 3VGFA 3OEBA 2DOCA 4NJ9H 4XP1H 3S36L 4ZUVA 3F7RA 3C8KB 3JV0A 3W9DB 4LLYA 5CP7B 1FL6A 2YSSA 3LKNA 3MV01 1HH6B 3WQWA 4KZDH 4D8PA 3CFKB 4AZCB 4LF3B 3UBXG 4LQRA 3RX7A 5E6IB 4JZNB 5I8CA 3HE6C 4KI5C 5EULV 3DYPA 2CDGA 4OZHE 5D1QD 4LIQH 4RX4D 5EPMA 4KHTL 4Q6IC 3KPSB 4M24A 1CFQA 2V2TB 2I24N 3MUGA 4KV5F 3UCRA 5HPMA 5JR1H 1D9KB 3DVIA 1MCWW 3H0TA 2D3LA 3OA5A 4C58B 2WWMD 5LBSL 3V0AC 4NBXB 5HDLA 4JRYE 2VLKD 1N4XH 2DYPA 3D18A 2ICWI 1JUFA 3OJDB 3NCJH 1QKZH 2HFEB 3N1QC 3KL3A 1JPGB 2VDOH 4OJFL 3MUZ1 1U92B 4MQXC 3KHQA 5J0BA 1BQUA 4LSQH 2P47B 3UJTH 2UY4A 2WO1A 4OZFH 3LH2L 2BNUA 1KV3A 1HSBB 1KQYA 1FZJA 3VILA 1N5AB 4PGCB 2YPVH 5CEYB 1F4HA 2I5YH 2DJ4A 2RJMA 3ARZA 5ABFB 1A2YB 1FG9C 4ETYA 1WT5C 3KYKL 3N1FC 4GLRH 1EGJA 5I3DA 3ECBB 5SWSE 4P8UA 4ET7A 5I66B 3FO1B 3DHMA 1BD2A 3ZE2E 1MFEL 2EDRA 5CEYA 5D96B 5TPWL 3NFNA 1M04A 3QJFB 5E2TH 3HNSL 4U1MB 1KJ2A 3UZEA 1AMYA 1U8KA 3VXNB 3B9AA 5HD8C 2DKUA 2VXTL 4D71A 3BE1H 1XF5A 1FN4A 1E6ZA 3ARGB 4M7LT 4YHKL 4DM2A 5HHVH 5CD3A 2C7FA 5ICXB 1LE9A 4OSUL 3RI5F 5IMLB 2Q87A 3IS0X 4OLUL 3N1MC 3V8OA 2C0HA 4S3KA 4HUUA 1UWEH 3WUBA 3U6RB 4PLKD 3VG9B 1IM9B 5E8EB 1E71M 2BOBB 4PRDA 4HIJB 1QKZL 3NCJL 1CK0H 5D2LF 1AIFB 1F6AB 1IZKA 1R24B 4DQOH 4NNYB 5AYIA 4HUMB 1ODAA 3A67L 3WDHA 5ESVB 5HYQA 1NGWA 4NCDA 1UR8A 3C6LA 3DROA 4PJGB 3BAKA 3RWEA 1IGJB 3DRQA 3KAAA 1TITA 2PYFB 1ACZA 5DI8B 4QGTA 4PTXA 1YEHH 2OL3H 5TDOA 4Q0XL 3VXSD 4OQTL 1YEEL 2EDOA 1NFDA 3LVEA 2ZX5A 2R1YB 3WL9B 1BFTA 2Y06H 1XR9A 1INEL 2EH8H 1QHZA 3OLGA 1T7XA 4P2QB 1GYAA 1E70M 1RH9A 4P8VA 1EXUB 3Q3GA 4MQTB 3P0YH 3M8OL 1DQQB 2EBNA 3EB7A 4ZFOA 3P4OA 4YDLC 1QI2A 1MIEH 4YK4C 1HKFA 4NZTL 5CINL 3PWVB 3HKFA 1RZJC 5FF6B 3WH9A 4RNRB 5F93C 2ADJB 1GC1L 4JFEA 2OTUA 4R0LC 5J6GA 1NGZA 3SE4C 4M81A 1HJUA 5HNNA 5I6SA 1ZT1B 4XGZA 5FEBA 2VXQH 2XWTB 4FNLH 1QFUH 5DD6A 5IB2B 4KPHL 4LEXL 4YHPB 1KOAA 5KSAB 1JF5A 2VVSA 1HVQA 3E2HB 4PMQA 4JJHA 3T4YB 2AGJH 4CUCA 2J12B 5B3JF 1HVXA 2C4XA 2WCAA 2XN9B 3U7YH 3AICA 3FCTB 4KMTL 3QXAB 4FMFA 1Q9OA 1EDTA 5I8KH 4YNYB 1UY0A 3CPLA 2JCCF 3HJRA 4ZOEA 4YJZL 2L9LA 3GJFA 4D9LH 4V2XA 2X10A 1RUPH 2C1PB 5CP7A 3O4OB 4YEFA 3ZKNC 3NZHL 2CIKA 2ORXA 2E27L 1G9MH 4JDVB 3JVGA 3PDOA 3ULVD 3GSNA 2UZIL 1CU4H 3U79A 3W11C 3VWJA 1XIWC 4CW1A 4W68A 5B38A 2P8MA 4G8FA 5JMOA 2F53E 4GG6A 1XIWB 4M56A 3IKKA 3KR3H 1NCWL 3D39D 5IP4A 1F6FB 1YY8B 1HHKB 2UY5A 2P43B 5JHDA 2WNGA 4G9FE 5FK9B 4QHLA 2EKSA 3HRZB 5BQ7B 5B38B 2X9WA 1XH1A 1DSFL 3SDDA 1CFQB 3KJ4B 4JO2L 3F12A 2IAMD 1NCCL 5FO8B 2PWGA 4WVRA 3ZTNL 4HWEL 4P2RD 3OG4B 3RGVB 2LU3A 4GBXB 2J7MA 1HOCB 4TPRH 3MXVL 2XIBA 2J7EA 5GNZA 5F7NC 1YQVL 2MANA 4MVBD 3QO1B 1U9KA 3FAXA 3GB7A 4Y2DA 4QFUA 2AV7B 1MAKA 1KXQE 3BPCB 4KKBC 3VFOB 3ZYOA 1JMZA 2XHNA 3ECQA 5DRWB 4OMDA 1XGQA 4JGMA 3ULVL 1T20A 5J1TC 3MYZA 5ADOH 3L3IB 1HWHB 3PIQB 1RZKH 1TENA 3BN9C 1R3HB 5F3HA 1HJVA 4ATDA 3O2WL 3W27A 4L4TE 3U46A 5ACZA 3AFBA 2CHOA 3FRUA 2GTWA 2FATH 2RVAA 1G1YA 3SDYH 3WY1A 1JL8A 1L7TL 4OIBA 5HVWA 3QUXA 1DQML 1YN7A 1UWXK 3WIIH 2AXFB 2ICEA 2JDAA 3AB0B 2A6JB 3IDGB 2X05A 3FQXA 3W24A 4DWSB 2V38A 2EYSB 5IIEB 4V1DD 1SYVB 2GDUA 1K85A 5F1NA 3K1KC 1UQSA 1K42A 1AFVH 3DETD 1QBLL 3VXUA 3D87B 2PQSA 4RGNE 2DT2A 2QSVA 2YXMA 3UCQA 3AOFA 5E2VH 4LEOA 2DJUA 3EMQA 2FNBA 2ZKHH 4IS6A 1KJ3H 1RUAL 3LAFA 1AQHA 1T03L 1H3UA 3BEWB 1F02I 4FG6C 3DROB 4H88L 4PJGA 4WO4C 5IW1B 4DKEL 2XQBH 4CDHA 4XCEA 4XI5C 3RJDA 4M43L 4B9YA 5EBGA 1K4DA 5CP3H 1P7KB 3B8YA 1ZXQA 4ELKA 4W4NA 1J8HB 1LK2B 4BELD 5E08L 4JFSA 2YZ8A 1VGKB 4CD5A 3BPOB 2GK0B 5KSAD 1ZLUK 1HKMA 1UWGH 4FXGA 4EDXA 4I77L 2IALA 5EIQA 1JZ5A 2BVUA 4UT9L 1Z9OA 1U6AL 3P4MA 5JIIA 4K7PL 1P7QD 2P46B 1C8QA 2F53D 4NQSA 4OZIF 3BGMB 1HYSD 4W88A 5SWQA 2BNRD 3C60C 3KJ4C 5TE4H 5JLZB 2B0SL 2B5IB 3QDGB 1V6WA 5KSBA 4PGZA 1MAJA 4YR6A 3I2HA 3RWFA 5T5FL 5F44A 2J7BA 2XWDA 1VEPA 3LY6A 1X7QA 4P23A 4Y1AE 5KSBF 2FGZA 5DVMA 3BGFC 1G0XA 1INQA 3W11D 1FL5B 1XIWD 2Z4FA 3ZJ7A 2ZX6A 1OAXH 2OLDA 3WV0A 3IFLL 3ARTA 1KQZA 2AW2A 4L3EE 4TQEH 3RWJB 5MENB 2W63A 4XHJD 4PJGF 5DLML 2AJYL 4D3CL 2C1PA 5D2LB 4GAYB 5C6WH 3HZMB 5IR1A 4P7QA 1DYOA 2FEEI 3NOIA 1HI6A 2L7UA 4PJFF 2F5AH 1KTLB 2P24B 1LO2H 2GUOA 4HKBA 4J3UA 4JFQB 4LSSH 5CSYA 3I6LD 2IAMC 2H32H 2X89A 2AI0H 4K8RL 2CUIA 4PJAF 2VLME 5DD5H 3RRQA 1UB5B 4J3SA 5C0BD 4BK5A 4LX4A 4HJJH 1GHFL 1T0PB 1OTSC 5AWNH 5DWUH 3B2UC 1MY5A 2UV3A 3W2DL 5D7IF 3QCTL 2UYLB 1KN2H 4OCRL 5F6HI 1MFDL 3T0EE 3QWQB 2R1WA 5L6YH 3LE0A 3MU7A 4JHBA 5FYJD 4JDTL 3IJ9A 3GXMA 3RZCD 4IDLA 5E6IA 1W9SA 3TA3A 5M5DA 4O2FA 3OZPA 4Z0XB 4QLJA 3RWIB 3D2UD 5IJRA 1U8MB 4MD4B 1TZGL 1HF6A 4WSKA 4J2XA 2P8PA 1IGYA 4E2OA 2YDQA 3X3GH 4ZUSB 4J4PC 4JN1H 3MUAA 1D5XB 3L3GB 1DUZB 3IK2A 1A7QH 1ONQA 3OG6B 4JQXC 3OGCA 4K9EL 2R0ZL 2CKBL 5CLTA 5HSFA 2P4AB 2XG5A 3W2DH 2XNAB 1RUQL 4D94A 1S7UA 5BO1H 5EO0A 1HOCA 2MHAA 1GAFL 3BN3B 1QFWL 1WBZB 3DXAD 1OVZA 3PL6A 1NCNA 4TUFA 1FNEA 3PV6A 1KCUH 3VDHA 1HL8A 4UUJA 1OWRM 4JRYD 4IOIA 1KEXA 1JZ3A 1P5UA 3U0TA 5CPQA 4NO0B 2O9OA 3DX9A 1A6TA 4KRMB 4QY8A 1U8NB 3KPLA 4D6GA 2BY1A 4U6HB 2D7TH 3AI0A 3U5UA 1FNEB 3PV6B 1E3ZA 4H1LA 1MQKH 3S88L 1JWUB 4K9EH 1N64H 1CF8L 4QKXB 1FRGH 4J1UA 1SG3A 1UWGL 1KEMH 5J3HD 4N42A 1S9KC 3HN3A 4R3SB 4C56D 5CIPA 4U3CA 4RFEA 1E3XA 5GRUH 3OKNA 4LVOB 4P9ML 4CD8A 2I9TB 1GPFA 4BJLA 4Y16C 3FT4A 2YG0A 4U1NB 4YBLB 3BKML 4JR9L 2GJJA 1JDCA 2VN7A 1ZA6B 1VFFA 4RFEB 5KTEH 1NC4A 1NH6A 3QRGH 2D7QA 2YMXH 1T1XA 5FYJH 4FK9A 1W72H 4LSPH 4MGQA 1T2XA 4BZ2H 2DQGH 5IG7A 4XP1L 1XZ0A 4P5TD 4QRRB 3QUKB 2BNRB 5F96L 1VEOA 1FHLA 1KYOK 2WLZA 3GBNL 4EK7A 5JZ7D 1BVKA 2K3TA 3KJ6H 2XKNB 2GTZA 1JDDA 3AFLA 2ORZA 1VRXA 5EUOE 5HYQB 1CTOA 1U95B 3ZYIA 4MNGE 3EFDL 1NEZA 4GRLB 2NX5E 2A0LC 3UTSE 3D1MC 1Q4NX 5GIRA 4Z7UE 2VN4A 3SDCC 5GSVB 3JWOC 3TIDB 5IT2H 4W8BA 1LD9A 2XPGA 3RUGE 3FHAA 3RP1A 3FT3A 5BZWB 1GMMA 1KJMA 1YYLL 3TJEH 1A3LH 4ERSH 1F6LL 5IVXB 3T04D 1W8OA 1C5DB 4WUUA 1R3KB 2G5BA 4W84A 4L3AA 1GQLA 2HTLD 2EC8A 2R0KH 4LLQB 2ZJSH 3TESA 3QDGE 3TV3L 2ARJB 4E41B 1NC4D 2E9WA 4DFHA 2BXZA 4N90E 3QIBB 4HWZB 4JY6B 1N0LA 2Y64A 1W1TA 5BWFA 4APQA 4OF0A 1FFPB 1GOIA 1U8IB 4ZXBD 4R2GC 1GGCH 1N6VA 2FJFB 4MA1B 32C2A 3B2UD 1YQVH 4YGAB 4MB1A 3QHOA 1CR9L 4HCRH 3L1OH 4QDMA 1G7IA 4LRNH 2FX9H 3CMGA 4AD1A 4PG2A 4HT1H 4TOQA 3X13B 4BFIA 1A1NA 2HJKB 2YN5A 5IVZB 4X8JA 4EI5B 5C6PB 1ZB5A 3LEIA 1OF4A 4DK6A 1HH6A 4P2OC 3CHDA 3BVNA 3GMOA 3U57A 3RNKA 4ZS6D 4YHLL 4Q22A 1KCUL 1K5NA 4M1RA 2UUDH 2CIIA 3VGHA 5HDQL 2RHEA 2XFXB 3UTTE 4LLDA 4MA8L 4QCIA 1FAIL 5CFHA 3WKNA 2XM1A 3CMOH 1L7IH 1UZ1A 3V79C 1K9EA 1AGEB 4OFIA 4RA3A 3SGDH 5ID1A 5DT1H 4FS0A 1QYGH 3MYJB 4HWBA 1BFVH 1ISWA 4QCIB 1UXZA 2ERJC 3ACHA 1I1CA 3MTRA 4QT5B 1I3GH 4MAUL 3V6ZA 2WN2A 4LVHC 1AKJD 4YHLH 4PMOA 2WHLA 3S3PA 5JHLL 5I75C 3NUKA 2EDHA 4G8EB 2V5SA 4EE9A 2DCKA 1AO7A 1BM3L 5HI4C 1R5IB 2OX5A 1KT2B 1UM4H 3UPRA 4BYHA 3RJQB 5MI0C 1ONQB 3D85A 3L1OL 1AGDA 2EZ0C 3BDYL 3IFNL 3C5ZA 5I76B 4G8EA 3FB5B 4FNLL 1BVNP 3IIIA 5IGXH 3TBYB 4HBCL 1FG2B 2HLFC 4LASL 5HGDB 4P59L 4AENA 5FO7A 2VVNA 3UPRB 1S7RB 4G8IA 5AC4A 4NSKA 2R4RH 1QW8A 5E00B 3JVGC 2CO6B 4G6ML 3I6GB 3QFDA 4LU5L 5FCUH 1T20B 4RFOL 4HC1A 3RBSA 5M95B 3UJJL 2D9QB 3EYOA 2XWEA 4PJ9C 4IM4A 4KZDL 1Z3GH 3LQMA 3S37H 4J28A 2BGOA 4AYFA 3ZTNH 3S6TA 1AR1D 2X1QA 4JKMA 1ES0B 1WBYA 3JWDC 1OLZA 3A6BL 3KPRE 3II1A 2BC4A 2YD8A 2A9NL 3RUGF 4GRLD 5E9DB 2AK4D 5DVKA 1LO4H 2VKXA 1I7UA 4NNYA 1DBJH 4QRPA 4BSVB 4ZZ8A 1EQCA 3QDJB 2VDPH 2AXGB 1B1YA 3SDCD 2VITA 3CX5J 4XV0A 3QJFA 2HT3C 4ONFL 4NHUA 1C7TA 5BV7H 4DGIH 1AXTH 4HDIB 5AY7A 4W4OA 4FLSA 5F1SA 2CDFB 4JG1L 2AQ2A 2ATPA 1HH9B 4HS3A 4F7EB 1UWEL 1ZAGA 3QWRA 5CCKH 1W0YT 1PG7H 4JRXB 4MWFA 5JO5A 1X5LA 1D9KC 3QDMA 5ABHA 2FYYA 2I26N 2JD9A 2Z35B 3L3KB 4I0PA 5D9NA 3WCYA 1Q9WB 1OAKL 4JFDA 1UEYA 3U7YL 5IM7A 2AEQL 5CEZH 4WTZA 3KPRB 1MCHA 2W61A 4XUOA 4JFYB 1R3IL 3I75B 4XNUH 1H0GA 1V3MA 3QDMB 4CUBA 8A3HA 1HSAA 1XAUA 3UBXI 1G9MC 2FJHA 1DWGM 4U05A 3VXRE 5DF0A 3WL1A 5E2VL 5C7GA 2Z91B 3QEUB 1H11A 4ZYKB 4X6EB 2DAVA 3ZHKA 5B39G 5CGYC 1Q72L 4QHUA 5ELIA 2E9BA 4WI6A 1INDH 5FV1L 3WNNA 2VC9A 3ESVF 4JJ5A 4BSWA 4YDKL 5DHXB 3SDXA 3C5ZC 3MZGB 4WENB 1LO0L 4KROC 3CLEL 4R26H 3ULSB 2GJXB 1I8IB 2A9NH 2EPNA 4HUNB 1QHPA 2A1WH 4G6KL 3C5JA 4AD0A 1OD3A 3FQRA 2ZUUA 2F8VA 3D3VA 4EUPH 2FO1A 4ZO8A 2BHUA 1CGYA 3MLVL 3TM6A 3IU4H 5I73C 1LO3H 4H20H 4ODVH 2YLAA 3QISA 4D6IA 1MHPH 1Q6GA 4ZFOB 32C2B 3TCLA 2DIAA 1UA6H 3OEAA 4L4VE 1NBYA 5HDBF 1L0XA 1RHHA 2YC1B 5JXJA 1E0VA 4CNIB 2BSRA 1QVBA 5I5RA 4PJ5A 1S9WA 4I3SL 4RRPA 1GGCL 3Q5YA 5FECA 5JXIA 1H49A 4R4BB 2I27N 5LGKA 1E4KC 2VDNH 3FO0H 4MD0A 5HJ3A 4AM0B 3V7AG 1QA9A 3QEQE 4XH2B 1BJMA 4MAYD 5DD6B 3AS2A 3TOPA 3GFUA 2XIDA 4FMKA 5HGAA 2DSKA 4NSBA 2OTWB 4MNQE 2HH0H 1K8DB 4XMPL 5G05L 1NLBH 5FYKD 1UG6A 2EQDA 2FEDC 4MXWH 1GQJA 3UG3A 1OHQA 3F12B 1H4PA 3DX6B 4JCMA 5HDQH 2DQFA 4K3DH 3DVFA 4HQQH 4M7ZC 3TN0B 4DFIA 4F9PC 4U1KA 1QHOA 4U1LA 2CKRA 1X5IA 2DQTL 1FFRA 3DLQR 2G75A 1MCKA 2VABB 5ECJE 5HHNA 5HY9B 3KLHC 1KXVC 3OB0H 4L8CB 4DEQA 1IAII 5EC2B 2NXZB 2HJFA 1A6UL 4JZOA 1RURH 1QNQA 3VE0A 1QYGL 3B4NA 3O8XB 2NW3B 3MOBL 4UQ3A 5SX5K 4P5MB 1C3FA 4K2UH 4PMZA 4RMWA 2V9TA 4JY5L 5HHNB 3D39A 4NC2B 5HY9A 2A3AA 2IMMA 3CFBB 4M8QB 2W4XA 1IM3A 3NIYA 4HZ6A 3FQUB 1XD0A 1MHHA 2UWFA 1MRFH 3MODL 3O8XA 4KAQL 1MWAH 2X4SA 4G3YL 1OINA 2AK4B 1L9NA 3REWA 3MBED 5E9DE 1IZJA 3OL2A 4O51B 5FOBB 2YXFA 1WFNA 1WFUA 2HRLA 4OGYH 8FABB 2A3CA 4H04A 5CHNB 2E33A 3U7WH 1HINH 4Q58C 3KE0A 5AZ2L 3VG0H 4JFZH 4NM8L 1OP9A 2BFVH 2HT3D 1HYRC 1TVBB 2NY3C 2F54B 1PEWA 5GZNC 5BMFL 3S37X 2HYXA 4G6FB 5D6DA 1BIIB 3PWLA 3JWNC 1T1YA 4OQTA 4O9HH 1KJ2B 2W1QA 1B3WA 1X4ZA 4X6FA 4ACYA 5GGTL 4ORZC 2D7NA 2VL5A 3W9EB 2HFFB 5TGBB 4QOKE 5C0IA 2K7PA 4G43B 1XF2B 2GUYA 4YDVA 4CADA 2CMRH 4JQXA 3UG4A 4ZUTB 3UESA 1HJSA 1TVNA 1Q6CA 4YHML 5K59E 4GSDL 4UNVA 5HVGB 4HHAB 1OD7A 4HS3B 5E8PA 5C0AD 4U3XA 5EO1B 5IHRA 1W72B 3FFCA 1KPRB 4EOWH 1BGGA 3VFSB 4ZD3H 1TCMA 2GI7A 3D18B 3MOBH 3OKDA 2J1EA 2FDBP 5FCUL 4Z7NF 1EEYA 3SE3C 1JFQH 5ESVA 4XMLL 1H1NA 1TZHA 1UM5L 2WBWB 4M6OH 1UD2A 1JWMB 1WV7T 4NKDA 1IEHA 4MAZA 5T5NG 4NUJA 2CIKB 4DOHB 2NYYC 3F7YA 5CMAB 3R4DA 1GQPA 1V0MA 1ZBWA 4XPTL 5AEAA 3CZKA 2NY1C 4QP0A 1QPKA 2EYRA 4KGLA 4YC2C 3TO4A 4UB0H 4M6ML 1BBDH 3KS0J 2YD2A 1IEBA 5BJTB 1OAQH 1B0RB 3WJLC 4M6NL 2OJZL 3S34H 1VSCA 3QDJE 4JAMB 3O3EB 3SKJH 1U42A 1GIGH 2AI0L 2V5RA 4K8RH 5DD5L 3G5VB 4PJFB 5JTWA 3WELA 4MAYB 1N5YL 2D7MA 1PKQE 3RWJA 5MENA 5B3JE 4M80A 3UG5A 1XF5B 1O0VA 4DUWA 1YDPB 3HAEH 5DK2B 2IWGA 3A6CL 1DQDH 4S1DD 1OCQA 3FQNB 2Y25A 3MRCB 3P4MB 1NUKA 3BCFA 3ARBD 3D3VB 3QA3A 5ISZA 1EH9A 2CJUH 4ATLA 5IB1A 1A22B 5GGTA 5JNYB 5ALBH 5EU6A 3TWCL 3OX8A 4X80L 1WFOA 4XC3H 4XX1G 1H09A 4PREB 4F3FB 1GNXA 3WJLA 1WZ1L 4YHOL 3M17A 3MRGA 3BJLA 5KW9L 3W0WA 4AZ7A 4PJ5B 3HRPA 5BW7C 1UD5A 1T6VN 1MI5D 4S0SD 2AJVL 5F70A 1AHWB 2VRKA 2CD0A 4LCWA 5D2NE 1DTUA 2F74B 4PJIF 3SBWC 3WKML 3V7AE 5IBLD 2Y07H 3IKCA 4LVNC 3WHXB 5KBNC 1RIUL 2FO4A 4U1KB 4XPTH 1FVCB 3AUVA 4KJYB 1NAML 1LK3H 2DWDB 2DTML 3MBEB 4DN4H 1CFSB 4XP4H 4HFWB 5J12B 1IKNA 5JHDB 1GGUA 4GXUN 1YJDL 4LOUC 3PHQB 1BFOA 2BVOA 2R0KL 2IG2H 2DGAA 5AC5A 5L6YL 1KF9B 5L8KB 1OPGL 1CIDA 1ZS8A 1PG7W 1US2A 5C0CB 4O00A 2YEZA 1UKTA 3T0XA 2DRUA 2XZZA 1LWRA 1Y7VA 5DVLA 5A8OA 4P5MA 1KT2A 2VMFA 3G08B 1VESA 4M7LL 3DGCR 4GSDH 4IIQB 3VXPB 3U4BL 4OZGA 2VQUA 2AABH 3WD2A 1PG7X 2PN5A 3RVVD 2VDPL 1LK2A 2VSCA 2IANB 4BH8A 3GJFH 1Z5LA 3MZTA 1W99A 1NGXB 4NQTA 1DQLL 4MHHI 3HI1A 3TO2B 4O02H 3VG9C 3CFKA 5IQ9A 3BZEA 4MJIA 5GSRB 4Q9RL 3B2VH 2PKDA 4Q9CA 5BRZE 4HA1A 4CCDA 2Z8RA 2JJWA 3SDYL 2UZYB 3PWNA 2NSXA 3SGJA 2QADD 2A3HA 3H9HB 3OPZL 4LQFH 3OHXB 2ZOKA 3BKCH 4G8GE 4JFZL 4MJIB 1YEEH 1IEAA 5A94A 5IB5A 3EHBC 4J12A 3PZQA 2BHYA 1H3VA 2L7JA 4PRNA 1V6UA 4XX6A 2BC4B 2HFEA 3GSWA 1S7SB 1EIBA 4N0UB 3WBDA 3DVNB 1Y0LB 5DMKA 4E8CA 2EE9A 3BAXA 2HTKC 1T7WA 4ODUA 4I13B 4PJDE 3UJIH 1HXYB 3PF2A 3PWUA 4HHAA 1HILB 4MQSB 4LRIA 2DBLL 3X3FL 3SBWA 2ID5A 1GHRA 4UINL 4QRPD 3ARFA 4M00A 5LG1A 2CDFA 4A41A 2B1AH 1E73M 1MFAL 3MCLH 1OBAA 2ZSWA 3FN3A 4EVNB 3FT4B 4OLEA 5LVEA 2Q8AL 3KGRA 4OBRA 5F3BB 1NUNB 3T2QA 2R2CA 1E27B 1J8HA 1NCAH 3MV7A 4ZUWB 1Q0XL 5IJKA 4HOXA 1V3JA 5L2JB 4AEIL 5I19H 4WI3A 4PTUB 5I1CL 3JWOH 3C9NA 4RMUA 4W7UA 2AEPH 4U1JA 3PZTA 4N8VB 2DBLH 4LP4A 3C2AH 4BQ9A 1BVKB 4U31A 2E9JA 4NI3A 5L2KA 3RWIA 3VFRB 1NC2A 4HIXL 5D1ZC 5DUBB 5KAQG 1WAAA 1X4XA 4KXZH 2VLMD 1DQMH 1AIFA 1F6AA 2E4TA 3T2OA 3E6FB 5E7FA 4XC1H 5MEQA 1F00I 2VCCA 1VBRA 2DYPD 2WM0A 3VXTA 4HT1L 1AO7D 4XNMB 5JIWA 1YEGL 2BGPA 1FHGA 2W65A 5ISZB 1EHLL 5JW5B 2CYGA 5DR5H 1UH2A 1J8HD 1V3KA 1AP2A 1RK1A 3GHEH 3HZMA 2Q8XA 4GZIA 4XNMA 4U1HB 2F5AL 2NT1A 5F88A 3NCYP 3MRGB 2HMIC 3H3PL 4HLZH 3S8WA 4P7OA 4YHNA 3A7QA 2J75A 1AY1H 1BAFL 1QQDB 2J5LB 4NOBA 2Z31A 4JFTA 5M03A 4IOFC 1RIHL 1HJQA 1KGCD 3QAZB 2MWCA 4PJXA 1RJCA 5HXMA 5KZ6A 4XXCA 5FB8B 3C08H 4FG6D 5IOPA 5DEGA 1VCAA 4JQVA 4FA8A 3AS1A 1PYWA 4KJPD 4LPXA 3MJ7B 5D93C 5HPOA 2JEPA 3MXWH 4XPFL 3MACL 4Y16A 3WS6A 4IPLA 5H8DA 5B39B 3BPNC 1D5XA 4LFHG 1T1ZA 5CWSA 1MF2H 4FQXB 3N04A 2Z92B 3QCVH 2JE8A 5GGTH 5CXPA 5C09A 2BNRA 1UD8A 1MCIA 3RY4A 4MJID 4MQ7B 4XVHA 4IBLT 5IQ7H 4ELME 4IJ3B 5C0DA 3CFJB 3BP6A 2C7UA 2XTJC 1OTTD 4PJAA 3VWJC 3SCPA 3RDTB 2PTVA 5CG0A 4I2XB 4RE2A 5IF0B 1D5ZB 2XQBL 1V0KA 4OM0H 1YECL 5K9KA 5BRZB 5FO9A 4QLRA 1UJ3C 4G6JH 1N59B 4DW2L 4ZODA 2QPSA 4J1UB 4DAGH 1A7NH 1I1AD 3WIFA 2PR4L 5ABDE 1UB5A 2GJ6A 3LKNB 3QQ4B 1MJ7H 4K3JL 4V1DB 2VKWA 1FZOB 4YFDB 3ARDB 3DVGA 1K9FA 5LA2A 1IGML 3WFBL 2XZCH 1CD8A 1DEEA 4P9HH 3WXWL 3P77B 5KSUB 4YPGA 3CUGA 2WP3T 5JUEL 1DLFH 1IGFL 3DSNA 1ZT7A 2ZSWB 4EVNA 1Q94A 3S7GA 5IESH 1C93A 4NQEB 3SKNA 2DWEB 5EO1A 3MS8A 4BDVB 4AEHL 1CFTA 4PJ7B 5C0EB 5LYRA 2XICA 4OIIL 2V3EA 1RZKL 4TSAL 5DQJA 1QI3A 2WVVB 1I4FA 4KTYA 3W39A 3ULVH 1E6OL 1R5WA 3VI3F 5E9AA 1AXSB 3S5LG 4L3CA 1VFBB 4L8SA 1P8JA 1KB5L 1HQ4B 1I7TB 3AREB 1CD0A 1N8ZB 2W95A 1ZA3A 3QHTC 4JFVA 4OZIE 4C56B 4S2SA 1CD9B 3GM0A 4HK3J 4MYWB 5EU3B 1IGFH 4Q97A 5GXBB 5IROC 1MCNA 2Q7NA 5MHSE 4WFFE 2F53B 1N3NA 4ZMAT 5GGRY 3VRLF 1N8ZA 5A3HA 2PTUA 5EO9B 4PMVA 1MI5E 5J6HA 1QLRB 2OSLA 4MLSA 3Q6GH 4G9FB 4M8UA 3ABZA 3MRFA 4TSCH 4XCCL 4X7CC 5JMOC 4JANA 4YXLL 1RZIB 3FQTA 2YPKA 5D7JD 3BUYB 2HWZH 1CT8B 3GGWB 1XH3A 2B31A 2VR9A 2BDNL 4DCQA 1OGAE 4Z7OE 3N9GH 4ZFFB 4I9WE 1O6IA 3WE6A 4WRLA 3ZYJA 5FA4A 2D20A 2XACC 5MEND 4XWOD 3SDDC 4TVPH 4PT6A 1YY9D 1WSST 4YIQB 4Y1AB 4MSWB 2AMGA 3ILPA 3NAAH 4XT1C 3TV3H 3AMDA 4P2RE 1SBSH 4FXKB 3ZE1F 5FUIA 1JNHB 2ZUVA 2IQ9H 4XAKD 2QQQA 3PZUA 3C6LB 2EXWC 4U1LB 4UOJA 4Y4KC 4NRSA 3ARPA 4OFYA 1MFCH 5CJ8A 5IK3B 1ZLWK 1B6DA 4QRUA 3GSQB 4Y4KB 2K9UA 3RI5K 5KVMC 1JXJA 3V8CA 5KSBB 3Q1SL 4P5TC 4LGSB 4U6YB 3GNOA 1G6RH 5EOQH 4Q6YA 3RDTD 1JYNA 2CBJA 5LJYH 3L5WA 4MD0B 1S5HB 1CZ8L 4L9LB 2BY2A 4K94C 3HZVA 1QSED 2O93L 3ES6A 1CZVA 3BLKA 4ARXA 1J9YA 1UKOA 2VZ1A 4GG8B 1A3HA 5IW6B 1CXHA 3UC0L 1NFDF 1CICD 3MUHL 4FFYH 2GITB 1MY7A 3LKPA 1EEZA 4CKQA 3UAJC 3UYPA 4YZFE 3EZ8A 4OFKA 1AC6A 1RUQH 1MJ8H 1O7AA 2C3WA 4PJAB 3ZLQC 4LCIL 2GAZA 5I30H 3ZDXF 1NGQH 3U82B 5C0RL 1M05A 5GS0D 3LZFL 4M8VA 4JFDB 3O6FB 4YX2H 5SWZA 1QUNA 1WIOA 3QEQB 5MEOB 3PE9A 4NGHH 4MNLA 1UADC 3GJEA 2J7DA 4X6CB 1Z5LB 4UTBL 5HOSA 1A6ZB 5I75B 4OOUA 5C8JB 3HHRB 1IM3B 3SCMC 3BVNB 3VGDA 3E8UL 3GJFB 3BP4A 2GJ6B 4FQQA 1NWRA 4ZYKA 5T1MB 1DDHB 1SYTA 3HPLA 3SQBA 4KUCD 1HQRA 4NNXA 1B0WA 1XGRA 5SWSB 4MNHA 2CCRA 1IV8A 4XAWH 2XFXA 1GOHA 2JCCE 4M61B 2WXDM 1V02A 3VJ6A 1IGYB 4MCYA 4D6EA 4OM1L 2PCPA 3RIFK 1YUHA 1MRDH 5SV3A 1LQ0A 1ZSDA 1JK8A 4RIRA 3DWTA 1WZ1H 3B3IB 4NQDE 3GSWB 2XWBB 1B3ZA 4JO3L 1QTYT 1VA9A 2E3ZA 3FZUD 5IV2A 4CVUA 4FQXC 2HFGH 3CFEA 1PY4A 4NKDB 3DC0A 3VIHA 5FCZA 5GZOD 3TO4D 2F15A 2ZUNA 2DQEL 3M45A 5JOEA 1KPUB 2PBOA 1VGEH 4MA8H 1MHEB 1C5BL 5TDNA 3GSNL 4NQEA 1E1FA 1VFBA 4L8SB 4MZ2A 1C90A 2OZ4L 4WF7A 5HTSA 3GBEA 5ACMA 1FYTA 3MX0A 3MNVB 3D85B 3EJZC 4U0RC 4Y2DB 4UBDD 3C7HA 1ZA3B 2A1WL 5DQJB 2WVVA 1YEIL 4H8HA 2B0SH 4ZTPH 3MROB 1YNLL 1HCFX 1KPVA 4UOW1 5D7JC 1IGTB 2DQCL 1T66C 3IFPA 4L3CB 3I75A 1H2JA 3SKVA 1U3HC 2W9DH 3MRMB 3OAYH 4M6MH 3ZJ8A 4P7NA 1KPRA 4OJFH 3DUUB 3BAIA 4AZ6A 4IRSD 3MFGB 3LMYA 2FECL 2EDWA 3V0WL 1TFHA 1K6QL 4U1JB 2DQFB 5C0AA 1BD2B 1U3JA 4UT9H 1YY9C 2BRQA 2WHMA 3EFFA 1YEFL 4P2OB 2B4CL 4XPAH 5EZJB 3EGSB 1RJLB 5DZLA 4ZDHA 1N82A 4D6JA 2FWOB 4E41D 5KVGL 1NC4B 4TNWF 2GJXA 3O2DH 3NABL 4MX7B 1ZBVA 2OSLB 5ICXA 3QG6A 1FVDA 3M1BA 3NSMA 4B50A 4WKFA 5J9PB 1G9NH 5J57B 2DLIA 4Y4KD 3VXNA 3P4LA 3RIAF 5GS0H 3ALXA 4MMZC 4JRXD 4XUTA 4IPNB 1OWQA 4OI8A 3MCG1 4MSWA 4QTIL 4WTXA 1LE9B 4U7KA 1E9LA 4C83A 2YC1A 1FNHA 1LHZA 4OAWA 1OP5K 3UC0H 2CUHA 2CLVA 3QIUC 1AR1C 3G6DL 2D03L 4EN3B 3QUZB 4UV4H 4W5UA 2FO4B 2DI8A 5D8JL 3LOWA 3PWJA 4KKAD 1CI5A 3JTSB 3QDMD 3M07A 4LLWA 4IEFB 4H8VA 1QLFA 1S9VA 3NQHA 5I23A 1LMKA 1T3FB 5ESAA 2YL5A 1QR4A 3MRNB 3G5XB 1C5DA 3MOAH 4Z95L 2XFRA 1F4XL 3JV6A 2VLRB 3X11A 3E3QE 4LLVA 2ARJA 4E41A 4ZFGL 5DTFA 5HYSG 1VKXA 1MXGA 3RU8H 4X4XA 1NGWB 4JFDD 1UZ4A 1PMHX 1NOFA 5C0FA 1JD7A 3RVUC 3H7BA 5HYSB 3SCUA 2ZCLH 3HUJE 5E70A 3LKPB 1PYWB 5TE6L 1JNNL 4LSRL 4Z2JA 2HKFH 1WZLA 2Y6SC 4XPAL 4X9IA 3T0WA 1NMBH 1GZQA 4XVSL 3CIVA 1P1ZB 5AUMA 5SWSD 4HPGA 2FGWL 3GIZL 3HE7B 1SQ2N 3P0VH 3FOMB 3SKOB 1MNUH 5HDOA 1JI6A 1T5XA 5AUMB 2FD6H 1RZGA 4QCFA 2BVOB 8CGTA 1ZJAA 2EXYC 4CRPA 5IB3B 5IFHL 3HPNA 2EEDA 1ZT1A 1FSKB 4MA7L 2V6HA 1JIBA 4BQ8A 4AXNA 3LRSA 4P8XA 5EU4A 2Y24A 2VZSA 3C6LC 3F6LA 1KTLA 1R3JA 1BEYL 1ZLSL 3BD4A 4TRPL 1G7MA 5BXTA 1BFVL 3V6FA 4U5KA 1FL6B 2YSSB 3T4AB 2I25N 3QQ9D 1I9JH 5A6JA 1YNKL 1OP3H 5C2UB 5BS0E 4AWEA 2Z0BA 2A73A 4AMKL 5D5MA 3V0VB 1MCBA 2Z1KA 3CZEA 3O6ML 3ZE0E 1HHKA 3W5NA 1NBQA 1JXKA 3WMSA 3ZKSD 5C92A 1NGYB 5AZEL 1MREL 4WK9A 2ZCLL 3MUY1 4PJBE 4UNTA 1F8TL 1BD2D 2NMSA 1U8HA 4HPYH 4MZ3A 4M7KL 3IU3A 1C8PA 5CILH 3E3QC 5EFIB 2A6DA 3RVTD 3UEQA 3CJJA 2BX5A 4CU7A 5D9PA 1TQCC 3OKLA 3DGGB 5L7XH 4XNYH 3MRLA 5BW7A 2LU4A 2AVGA 3GGLA 2YFZA 3UZQA 2NY5L 1KBGH 1SJHB 2W9EL 3HJEA 3O4OC 5CIPH 5E99H 3KLHD 1EGJL 1AXSA 3NCYS 4QEGA 1OB1A 3F7YB 3ACIA 3ALGA 2VLRE 3WKZA 1RFDH 2A83A 3MJ6A 4TQEL 3WHE0 5HVFB 2ICWJ 3RIFF 3QO1A 4HPOL 3WIJA 3MBEA 5CBAB 2X1OA 3BEVB 3P0YL 2AAVA 5HI5D 4X7FC 3E6FA 1W72L 4LSPL 2M26A 1JTPA 2Y06L 4NP4H 3DBXB 3KVQA 4AIEA 1FPTL 1P7HL 2O9PA 2R0WL 5C0CE 4H41A 5D1QA 3N85L 2ADGA 4K7PX 1L6ZA 1HNFA 2VO5A 4LAQL 3VDAA 3I02B 3RWDA 1BJ8A 3VFWA 5FYJU 2FL5A 2YIHA 2E0PA 1IC7H 3VOCA 4QHNA 4LDOB 2BVEA 5DC4B 5IB4B 5DUML 4PRDB 4LEXH 2F8OA 3QI9B 2LQRA 4DGIL 2ZUTA 3PWJB 5C08B 1KCSL 2W07A 4PJCE 4MXQD 2J8GA 3S35H 1XGPA 1MF2L 2P5EA 3RVUD 3AMGA 3WSUA 1MVYA 3BKYH 2AK1H 2C26A 5IHLB 3NSXA 3BKMH 2DIBA 3OAUH 4JR9H 4QDRA 2DQCH 4JFYA 4JPIB 1DVFC 3GBMH 9CGTA 1A6WL 3U30B 2VZPA 1IGJA 4XBPB 4Y2DC 5LA0A 2AKRA 4OV5B 3BZEB 2DLFH 1U2HA 3AGVA 5I71C 4Z7VB 2CQVA 3MOQA 3HMWL 3LEVH 1YNTB 3OMZA 4D2NA 3TC9A 1XF3B 3GNPA 1PSKH 5T1DL 3VKKA 1GRWA 3P9LA 4HK0A 1H8SA 2HG5B 4KTDH 1Z3GL 2MNUA 2YUZA 1QG3A 5IK3A 3WFLA 3J8F7 4UFLA 2K1MA 2YRLA 3LPWA 4X6CF 3ZYZA 2BVQB 1GORA 1M7DA 3FB8A 3JWOL 3H3PH 3RIAK 1KTDA 2M8XA 4FOMA 1D5MA 3VXSB 5C0NC 4F79A 2K7QA 5LGJB 5ILTL 2IBBA 4MJ4A 5TF1L 3TTSA 3OLDA 4X4ME 4WJXA 1A7PL 4GAFB 2QHLA 1KELH 1KTDB 2NYYD 2V7NA 4XTRC 4HLJA 4Z5RA 1NAMA 4DWHA 5FB8A 3F5WA 5GRJL 4YO0B 3ARGC 2QF8A 4ORGB 5JW4R 3RA7H 4KQ4H 2BJML 2DQXA 4RRPG 1NWTA 3TBWB 3UEZA 2HISA 3WD1A 1Q9LB 5EB9A 1VFOA 2D0HA 2Y6KA 2I60L 1R3JB 4N90D 2E8YA 2P44B 2VZOA 2CK0H 1VENA 4UTBH 3WNLA 2DDUA 5IHSA 3ARSA 5K9QI 5F9OL 4PIRF 3CMJA 2CK2A 3PHOA 5L88L 5ID0A 4QWWD 5B4NA 5F7YC 1CDUA 3MLUH 5KOMC 3FO9B 2R29H 2WBJD 1KN2L 4OCRH 1V7NL 4PJ7F 3RNQA 1X4YA 1UT9A 5FAAA 4PJEB 2ZXBA 2DN7A 2XN9A 5DJ0B 4KTDL 3LMJH 3ALWA 1UVQB 5FYLL 4P46B 1C7SA 1YEKH 4H5SB 4MNHB 3AIUA 1U36A 4N0YL 4PB0H 3TTOA 3CPLB 3QFJE 1CE6B 2GK2A 4PJ8D 4FABL 1MFAH 3MSDA 1ZANH 2B1HH 4P99A 1GCFA 3VIPA 4P5YA 3VFOA 1I1FA 4UZUA 4L4VB 5BXSA 4OLZL 3K46A 2PR4H 4B53A 4WFED 3L4TA 1PQZA 2H2PC 3I50L 5IBLC 3CH9A 1OD0A 2IAND 1G9HA 1W9DM 2P8LB 4Y5YB 5JOFB 2DH2A 4W87A 1MFCL 1RZ8A 5KVEL 4CD4A 5LAXB 3BQUD 1OTSD 2FH6A 7TAAA 3ZKMC 3OR6A 4FFZH 1FYTB 3MV7B 1UY1A 4U7SA 2ICEB 3W29A 3B8SA 4UILH 2Z8SA 5ETUA 3VWKD 2C8NA 3NZ8A 4FTVA 4AG4L 1MWAL 4G3YH 4GWIA 4P2QA 2AGJL 3VIFA 2YD6A 1JGEB 3FB7B 4MOAA 4OZ4B 4OZFB 3F7PC 4JFFB 3W39B 5MP6H 3IDJB 3F2ZA 4NZRL 2DQUH 1E72M 4PBWD 2X4QA 4L8BA 4PRIE 1LNSA 1IC7L 4W50A 4OUOA 3T2PA 1LQSR 4YXLH 4HMEA 3PIQA 4M9OA 4P2CG 5JW3H 4GRMB 3O9WD 1BWWA 4XGZB 3PGFH 1ADQL 1HHHB 3CUPA 1MCOL 1GGTA 3BZ4A 3CDCA 5GRXG 3IFOA 5E0FA 3AIQA 1NSNL 2NY3B 3W28A 3OKEB 4P23D 5HYJD 1GZPA 5BO1L 3TWCH 3D69A 2BNQA 2YPLB 1NLBL 3QI9A 2XXMB 4JG0L 4L29B 4F8TA 1MVUA 3O2WH 2YKKA 4KXZI 3O4LA 2OTPA 1UZ6E 4KFZC 1QBLH 1XR8B 2G9HB 3EZJB 4C57C 4F7PB 4L9DA 3K8LA 3UETA 1P7QA 5DJ6A 3KXFB 3WO4B 2Y8VA 4YZFF 4TSAH 2R2BA 3WL0A 5MEPB 4HZAA 3S34L 2XVPA 4NHCL 4G8FB 3WQ8A 2AJSL 4PJXB 5C7XL 4KRLB 4RFNB 2FGLA 1XD1A 2J25A 5A16B 4Y16D 1ZLVK 1BM3H 2GITA 5C8BB 4JO1L 1DBAL 2GYSA 4KK9C 2WVUA 4J3XA 2WAAA 1JN6B 3AHTA 4WFGD 2ED8A 2GJZB 1M7DB 1TA3B 2V7HB 2KDGA 1EO5A 4QRQA 2E7LC 2G5BB 3L6FB 4OZHB 4GWJA 4F15B 1TR1A 4OSUH 2ZX9A 1AQKH 1CDJA 1ZT4A 1T2JA 1K3IA 2QSCL 5E2WL 5FXCH 5JXED 1INDL 2ZICA 2N7AA 4BH7B 1HI6B 4P46D 3GSUB 5C86A 4YHPA 4Y19E 3VNZA 5EUKA 4X83A 1J86A 4YO0A 1SY6H 5DA4A 5T1MA 1ETZA 4R0LA 4BH7A 4YDLB 3O2DA 2X0HA 4YK4B 3TVMB 4L4VD 5I1KL 1KXTA 2EDNA 2P5WA 1KFAH 4K68A 2QQLA 5JW3L 4FQLH 2E9MA 5CJXA 4PRBA 1YUHB 1RUKL 2H1PL 1FA2A 4AK1A 3SGKC 3DARA 4JFHE 3BW9B 4TSBH 1AJ7L 1B2YA 4F66A 1X5XA 3L9RB 1KCSH 1GOMA 5CZVL 3BQUB 3MOAL 3QUZC 3MR9A 3WFDL 3QCVL 1E0XA 1GC1C 1HKLL 1BOYA 1SYVA 4ONGH 2V5CA 1WAAF 2I07A 1I3RA 3G5ZB 2DSVA 1GGBL 4WI5A 4Y4FA 3IDUA 4Y5XA 4OGYL 2Y5TA 2Z8VC 5ABEA 2XTKA 1G7HA 1G9NC 2J2ZA 3DYOA 2Y36H 3K2UH 4GKNA 4LNRB 3ROLB 3VXMA 4RGMB 5EU7E 3W4RA 1BBJB 4NO0A 3D0LA 3IDMA 1CG9A 2NXYD 4XCEB 2QPUA 4NJAL 1S9XB 4GXVH 4XRCA 1IM9D 5GS3A 3D2UB 3ULUC 1AQ0A 4OF6A 3VMNA 1JU3A 4HJ0C 4RGOL 5ETUB 1R5WB 3N13A 4MDJB 4S11A 2HT4D 4HBQA 1OM3H 1GVYA 5KAQF 1A6TB 3KJ6L 4H25B 4R3SA 2MQ3A 2VLLB 3BSZH 2WBGA 5DMGD 1PZ2A 4NZRH 1FCCA 2ZOKB 2PWEA 1JWUA 4AZ5A 5FKPA 1VFUA 4I1NB 4Z2KA 4LKXA 4N9GB 4WW2A 5D7LD 3T65A 1T4KB 4RAVB 2SEBA 2B9VA 3H9SE 4YQXH 5EN2A 1LWHA 4L4TB 4KK5D 4F15C 5CPTA 1YPZA 3ARDD 1OSEA 1W3LA 5DQ9B 2BFVL 5C07E 3UDWC 1WDRA 4JRYB 1PKQB 4KVCH 4P2QD 4ZTPL 4UQBA 5T1KD 1GJUA 4NYLB 3K3QA 1XF1A 1D6VL 5I9QC 2XTJD 4NKMB 3FMGH 3QQ4A 1TJGH 3MUIA 3JTSA 4H8WH 1OT1A 2WKLA 3TA3D 1KJ3L 1RUAH 4GKOA 4J3OC 5IMLA 2W0FB 3HG1E 4P02B 1DZBA 3KLAA 3U1SH 3T0BA 1FH8A 2QSCH 4PJDB 5E2WH 2X4RB 4GJTB 3CDGA 5CJOH 2X8RA 4EI6B 2DQHH 3WN5A 3MLVH 3AIEA 1CQYA 1VEMA 3QIWD 1TZ7A 4K94L 5C8JA 1OAZL 4LVNB 3QWRD 1F2XK 2XPKA 3EOBB 4LLQA 1SM3L 6CGTA 1I4FB 1CS6A 4Z7VA 1WP6A 3O41B 4DEPB 2ZXAA 4LSQL 5FYLH 3UJTL 4JFUA 1EZVY 3OR7A 4LHSA 1V03A 1EDQA 5DQ0A 3DECA 4OAWB 2IADA 1Q72H 1RQ5A 2VDRL 2BVDA 1YC8A 2UWEA 1HDMB 4M7JL 1B3YA 1C16B 3A0OA 4IMLA 3LQZA 4W7WA 4C56A 4JM2A 3KYNB 1S78C 4RAUB 4ATWA 4NBZB 4FLRA 4QOKB 4M02A 4LLAA 5DRXB 4X4YB 3K8MA 4OIIH 4PUBH 4NQCB 4TVUA 1EUTA 1RMFL 5LGHL 2RGMA 3GMOB 2H45A 5E09A 1OF3A 2XNAA 2LABA 5ADPH 3TF7C 4CAGA 4M4RA 1HXMA 5FDWA 3HI5L 1PPIA 4OI9A 4BFIB 1IC1A 2ZSVA 4WDIB 4J4PA 3WQBA 4WW2C 1KTRL 2D3NA 2EDTA 1ZGLA 5D7KE 2VQTA 4YDJB 4JHAL 1JBJA 1QNOA 3RNKB 1KPVB 3PDGA 4ZXBB 1PX8A 1FFNB 4YH6A 1G7QA 3I2GA 1M01A 3GO1L 1EVUA 2MCG1 3T0EC 4R96B 3VFMA 2RR3A 3WSQL 1HP4A 4XUYA 4PJXF 3K8KA 3ILPB 1EAPA 5F7HA 4OCMC 1KGXA 5MP6L 1KENL 5D7IB 3MRDB 4EJ1C 2IUZA 4CNIA 3FO9A 1EV2E 2NXYC 1XGRB 5SWSA 1BZ7A 4OJYA 4J23A 2CRIA 4Z7QF 2JIXD 2OM5A 3HMXH 2P42B 3S37L 3L3OB 1MW3A 4PRHE 2QKIB 3BO8B 4KHXL 4NT6B 2UVEA 4I3RH 1HZHL 3HNVH 3WDQA 1AY1L 2VX5A 1OLLA 1MCPH 2W62A 4FFZL 1JFXA 3TBTA 1X3DA 3JV4A 2X4UB 2QSTA 4DWSD 3C2SA 5IV2B 2W92A 3IAGC 4U6VH 1HKLH 1HN1A 2XM2A 3MLPA 2XKUA 2LAAA 1I9EA 3L3JB 5DQDL 2D0FA 2XT1B 4FP8L 3AHYA 3MO1A 2VNCA 3MA7A 3QZWG 4H25A 4HPYL 1ZHBB 3CZLA 2WWKT 4U1GC 2NZ9C 3OAYK 5GIRB 4E5XB 3DIFB 1J0IA 2X4OB 4I5BA 2YBRB 5ICYB 3K4DA 1I3GL 4D72A 1U8KB 3EDJA 1KWGA 4UTFA 3KPNB 1DQJA 3SCVA 5EBWA 1BQHB 1X1NA 3P11L 3WMBA 1QSEE 3GJEB 4BUGA 3MLYL 5JDSB 1W9BM 1IAIM 3KZSA 2XTLA 2ZKHL 3L3IA 4OZ4A 1TJHL 5HHPA 1HIZA 4RGNB 3CZUA 4KTEL 1XGYH 3E2HC 4RMSA 1CXEA 2FHFA 2WMKA 1TETH 2A6KA 2MMXA 3CHFA 2BRRL 2AXGA 4F9PA 1UY2A 1F58L 2I60H 1VAHA 1CLCA 1S7WA 4NKMA 4JFEE 3L7EB 1UGNA 3TT1L 1J18A 1DL7H 4ETQA 5D4YA 5BRPA 4TVPE 5HGHB 1B4JH 3INUL 3MV8D 5IESL 4PJHE 1WDQA 1E0WA 3C6SA 1G0DA 4X99B 3OKEA 1R6VA 5DHYA 1CTNA 2BSSA 3PP4H 4OCWL 4GZJA 4CU8A 4P7RA 3LRSB 2D1ZA 5TDOB 3HZYA 2BRRH 1FZKA 3ILQC 1MHEA 4JLRA 3QR3A 3P4NA 1JPFA 2DQJL 5EOCL 3R0NA 1C1EH 5D2LE 5D7SH 3P9WB 1E6JL 2F19H 1TNMA 1OAUH 4D0BA 5D2NB 4JFHD 1VACA 2UY7A 5D6DC 1NX9A 2EDDA 4D0QA 3F62A 3PQYA 2IQAB 2I5YL 2N1KA 3QEHA 5DJCB 5ANME 3NPZB 2IF7A 2J8HA 5T1KA 3P40A 2GFTA 3NNGA 1V3LA 3ZHDA 1G6RL 1BF2A 3THMH 5C0BE 3LHPH 2BS9A 4JFPA 2WVTA 1ZGLB 3PHOB 3BKJL 2WIIA 2C1OA 5D7LA 4N8CH 1N4XL 5MI0B 1W0WA 4FXKA 3S97C 5I1JH 2AV1B 4D9QE 1NKRA 1QOXA 1V0LA 2EDJA 1I85C 4AIZA 1W3KA 2D3VA 5ERWB 1ZWIA 3P73B 3FRPA 3C5JB 1INQB 3L4VA 3AY4C 5EU5B 5IMMA 3OWEA 5SX4I 3ZL4H 1A9EA 1IVLA 5HI3C 4JDVA 2EDLA 3GSVA 3ULUL 1E1EA 1K45A 1PG7L 5FCSH 1JD9A 4BQ5A 5EU6B 3W81A 3CDYA 5GGRB 3RKPA 3VA2C 5KVEH 4JG1H 1SBBA 4DN4L 5EC2A 1NBZA 2GSGA 4PRPA 3EOTL 1UXXX 4N8CL 2N56A 4NJ9L 43C9A 1ZV5A 3O9WA 3GH5A 1EERB 2O5ZL 4H26B 1FGVL 4QHKI 4F9DA 1KBGL 3OAZK 3UR8A 2J47A 1S7VA 3SDXF 2ZEZA 1I3RB 4FZ8H 3SIMA 4PY8J 4YXHH 4UV4L 5KZCB 1QRNE 1P6AB 4LRIC 4JVWA 2HKHL 1CFSA 1UYXA 4XC3L 1E4WL 5E8OB 5I15H 4O5LH 3NZ8B 1FP5A 4B0MM 4JPIA 3C5SA 3IDMB 1MUJA 1T1WB 3DGGA 1A3RL 3EYFB 5A69A 3NFSL 5GRYA 2J8UE 3MA7B 1RVFH 3D85D 4PJGE 4NQVA 3VXMD 1ZS8B 5EIVA 5L88H 4UOW0 2R4RL 4UTAL 1RUML 2D31A 3QUYD 3J7HA 5DVOA 5EWIH 4Z7OF 1TVBA 4MXVF 3T1WA 1MUJB 1T1WA 4E0RA 4I18B 2BP3A 1NGXA 1W0VA 1XH2A 4DXTA 1F2QA 4Z6AT 1I1XA 1G6VK 3B9KC 1Z9SA 3UTZB 4PRHB 1K6QH 4P4KD 2R69L 1PGRB 3MBEC 4EN3C 2AK4A 3U0TB 4CKVX 3CUPB 2QQNA 5EJZB 4UFMA 1HCVA 1KNOA 3M7SA 1B30A 4ZPTB 1O8SA 3SHSA 3QPXL 1XT5A 4UQEA 1I3UA 2CGRH 1S7WB 2CUMA 2MCPH 1MIMH 1OY3B 4LLUB 3G9VA 3T08A 2JF6A 4YHOH 5DRNB 3IJYA 1GJIA 4G6FD 1AVAA 2FD6L 4GI8A 1FLTX 3DO7A 1XGYL 4RX4A 4X6FB 2IANE 4ZPVB 1A64A 2DQEH 1OH4A 1NBYB 2YN3A 5HYJE 4A6OA 2IC2A 2YPLE 2BSRB 2KPNA 3HPJA 4KZEH 2APTA 1U33A 2XQYK 3P4NB 2F58H 4QB2A 3VGEA 1BPVA 1JJUA 4L3EA 4S1SH 5CD5D 1KACB 1C08B 1OAKH 3QFJD 3V4PH 1KCVH 1HXYA 4PSRA 5H2BB 1E4MM 5C0AB 5C09D 2P7TB 2DDXA 2VTFA 2O9RA 3GXFA 1SJEA 1ZVHA 3OZOA 3LKRA 4KI5D 5DHVH 4I48B 5EZIH 5DS8A 5IMOA 2KKQA 4ODTL 2IPUG 2ZG1A 2Z91A 3C8DA 3IDXL 4O4YL 4TXWA 5AAWA 1UB6B 3WL9A 2AJZA 4LSSL 4JGJA 5J11B 3T3PE 2E6PA 1FH7A 1E15A 1YY8A 2CERA 2DKSA 1AI1H 3WEXB 1YDPA 1C5CL 1JPST 4EDWH 3FO1A 4L5FL 3PP3K 3QIUA 4IHOB 5IFTA 3RX8A 1SEQH 4YFLI 3LSOA 4LGPB 5F7LB 5ABFA 4LKCB 2AJ3B 5CJQH 2O61B 3WFHA 2HKHH 1FBIL 2NY4B 3QIUB 4OF8A 4A6YL 3U9UA 2NX5B 3UTSB 3C8XA 2GK1A 5IEHA 1D2KA 4MAYA 4F58H 3PTMA 4LVHB 4U6TA 1HJXA 5JA9A 3QEGL 5E6IC 5FECB 2BV9A 3BPCA 1A6UH 1MCLA 5DFVD 4NRRA 2A9ML 3WFCL 1QI5A 2OI9B 2X09A 4C4KT 3PWLB 4XNYL 5IFJB 3GMPB 3ZKQD 4NO3B 1F90H 2W46A 1YMHB 5DR5L 3LS5H 4AD4A 5JXHA 4JM2C 3W9EA 2JJUA 4L8BB 4R0LB 5EZIL 5HHOB 4MNQB 1GZJA 2WMFA 4JFXB 4K3EH 4FLQA 3DX8B 3VW3H 5IFJA 4HV8A 2Y4SA 1JHTB 2YKLH 4POZC 5HHMD 4P4KA 1C12A 2A6IB 3VFTA 1UMHA 4PMDA 3LEKA 3AXIA 1NFDB 3GXUA 1QRND 4QB1A 4PUDA 4K55A 5CZXD 4JN2A 1WJ3A 3CDFA 1K8IA 4TVPL 1GZPB 1T80A 5DJAB 2DTMH 1VDGA 3BQUA 4OT1H 4F7MA 1PDKA 5DYOB 1XNTA 1JHKH 5IVOA 2HMID 1CDIA 3GHBL 4WFFD 5F21B 4HXBH 5I73B 1KJVA 5I8EB 5IEKA 3BD3A 2WZPD 4LMQE 4F7TA 1IAIH 4Y88A 1BFOB 3NIDE 5EBLB 1FFQA 2YL8A 5K9JH 1WTGT 3TH4T 2D2OA 1NCAL 3EAKA 3CXHJ 1ZHKB 5C0CD 1LL4A 3PDDA 4IISA 1H3PH 1CXLA 4HGWB 1LP9A 3HNTL 4JKKA 4I2XA 1E6NA 1FE8H 4MNGA 3MA9H 3QHNA 3KR3L 3VIOA 3W0WD 2YD3A 1S7SA 3MV9D 3HS0A 1B4JL 2C3GA 2C7UB 4PMYA 3T2NL 2B2XL 4KY1H 3N17A 5A2CA 3UJIL 4J3TA 1HEZA 1CL7L 1KWKA 3EMZA 5I1HH 1H5BB 4NQDB 4QF1B 5F72S 1N7ML 1ROWA 4GS7C 4TVPD 3EKCA 3T3PF 2XQXA 2QV2A 3MRPA 4EI5C 3HZKA 3ZJ6A 4WUUE 1YA5A 3TBVA 2VB5A 3QDGA 2RJ2A 3RVWD 1MFUA 2EYSA 2OJZH 3EO0A 3IAPA 2Q86A 4OFPA 5CKAA 1EBAA 2CBIA 1KCRH 2QADB 3QCTH 5JNYA 3RM8A 1NBVL 1BBDL 3EYUH 3VWJD 5DQ9A 1MHPL 5IQ7L 3TJEL 1I8LA 4JRYA 3DSFH 1IBGL 3O41A 2YWYA 2DT3A 2EIDA 4QHLB 4WCYH 2LAGB 3NDYA 3ARUA 1NL0H 4J27A 3BIBX 2H3NA 1O59A 2ZXDA 1XIWA 1LO0H 3ELAT 2PWDA 1ZU8A 1KR0A 1A1MB 4JM2B 2IH1B 4PJ8C 3A22A 3VO0A 1UKPA 4HSQA 5JXEA 2NLJA 3EDDA 3AHZA 1F4WL 2BY3A 4TNVK 5CBEA 4ESKA 4W6WB 4BZ2L 3IS1X 4X98A 1HNGA 1H6YA 1INEH 2EH8L 4XBGA 4HWZA 3MRKB 4ZQKA 4PMNA 3MNZB 3UJJH 3CSBA 5DFVC 1D7PM 4H0GA 5GGUB 2I9LA 3L4XA 1CGSL 5B3NA 1YHTA 4I3RL 3EOAB 3PP3H 2CLRA 4KJQD 4OF7A 1I85A 1FVDB 1G7PB 1IRAY 2PYEE 2J77A 1CDYA 4TYUA 3EO1A 4WEMB 2CDEB 1TVHA 2NXZD 1YN7B 1LK3L 1Z2KA 4W5ZA 1CK0L 3EOAA 4M7ZB 3TN0C 2BVTA 3RVXC 1QQDA 4NZCA 3SURA 1AJ7H 2KD7A 3F7VA 1U8QB 1TVPA 2CIIB 3H9YA 2MHAB 5FA3B 2J7LA 5F88B 3AHXA 2C4FU 4XWGH 1P9MA 4HH9A 3PTKA 4NN7B 1CBGA 2DQTH 2VAJA 2GSIA 2IBZY 5CGMA 3TNMA 4MA7H 3DHPA 3CZJA 2QL1A 3OXRB 5I1DB 4K3DL 2VRQA 3O9WC 2WSPA 1MCSA 2R1YA 2WUHA 2H2SD 3GSNH 4MGSA 1SR0A 4DVBB 2J8UF 2XA3A 2ZUYA 3LMJL 3RPMA 1KIQB 1NCDL 5I77A 4K2UL 4BFGA 5IB5B 1MELA 4QRUB 4X6DA 3NBNA 3PJSB 2OK0H 1QNZH 4JN2B 1XGZA 2Q3AA 4JN1L 3ZHLA 1FDLH 1B3XA 2ZEWA 2IBZX 5J6GB 3QRFM 3D25B 4PRPD 3UYRH 1ULVA 3HZVB 4W85A 4HXAH 2DIJA 3OB0K 4X0NA 3QZWB 2V7HA 4CD6A 5IEKB 1JP5A 2YKLL 4HIIA 4Z7UF 1IJ9A 2Q1EA 3O6KH 3VCLB 4TUKL 2HT2C 1NKOA 3LEXB 3MLSL 2IFFH 5E8DL 3VIGA 3TIEA 1ACYH 3B6SB 3CSGA 5JUEH 4AEFA 3WD0A 5DMIL 5E8OA 1KIRB 1W9WA 2F54E 4JGUA 1PIFA 3H42H 3LV3B 5KSAC 4UQ3B 2VZTA 4LFHD 3TFKD 1J0JA 1LVEA 1LG2A 3B9KA 2ZPKH 4S1RL 3GM8A 1FYTD 3TYGL 4G7YL 4B5EA 5C9JB 2XKNA 1WBZA 3PL6B 4AIUA 2OWWA 2IH3B 4HKJB 1FL5A 1FIGH 4QXGH 1L8NA 1X5HA 4CVZA 4JFDE 1E4IA 5DGQA 1DE4B 3OJMB 5HYFA 1CICA 4PB9H 1J87A 4M7JH 2VR4A 2XWJB 3ARDA 1CQKA 3AXHA 1V6XA 1OTTC 4KI5F 3NIDF 1ZLUH 2V2XA 3RWHA 1MPAH 4RN5A 4GBXD 1MVFA 4XURA 3HS0B 4MGXA 3V4VL 5I1IH 5HGHA 3DMMB 3CD4A 4CVZB 4P7LA 5E4IA 5IYYA 2ED7A 5EBMA 5ESQB 5GGQH 1MLBA 1XYZA 5T5FH 1KR1A 1UCBL 4PGJA 4QX1A 4UFHA 1VPOL 1DQLH 1A6WH 3VVGA 3NMEA 5JHDE 4LXFA 3CO4A 2DTSA 1FGVH 5BOZG 4FQJH 4KUZH 2Y23A 2WAHA 3I3BA 5IWLA 7A3HA 5T1LB 3SPVA 1QLEL 4TUJB 5IJVB 1G7LA 4G8GD 3X3FH 2WNWA 3U7VA 4WI7A 4PJHB 3QNZB 1PZ5B 5DMYA 5BV7L 1FO0H 3I2CH 3WNOA 1AQMA 1MW0A 1KULA 5EFIA 1BQSA 4A6YB 4Z7NE 1FIEA 5F7WC 3MUJA 4UU9B 1F45A 2IH1A 1TTUA 2ENSA 4GAGH 2OZ4A 2NW2A 1KXVA 3CUHA 2CXGA 3CZGA 3MGOA 4PJ5E 1BJ1J 2H3NB 2PETA 3DXAA 3WDIA 3JBG7 1DUYA 2WWCA 1SJHA 2Y