2X05A

Inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine- configured castanospermine and an amino-australine analogue
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
851
structure length
851
Chain Sequence
AGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title Inhibition of the Exo-Beta-D-Glucosaminidase Csxa by a Glucosamine-Configured Castanospermine and an Amino-Australine Analogue.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 275
structure length 851
sequence length 851
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2x05A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x05A03
3TA3D 1MCPL 3T4AB 1CFSA 4LPWA 4WJXA 4KHTL 4MCYA 3BHBA 4PJDB 1NDMA 3V5DB 4WJ5B 4MDIB 2H45A 2J6EL 4OD2A 3MJ9H 5IFHH 1WAAE 1MCWW 3O6MH 1B90A 4XB8A 3X13B 3OGVA 2VQUA 4DTGL 2ADFH 4M8VA 5HYEA 1EVUA 5KZCB 3RVWC 1TR1A 2WAHA 4D6DA 5JORA 3IJSA 5E24E 2F74B 2XTKA 2AKRA 3QJFB 4PJXE 5J1TC 3CQOA 1F6AA 3G6MA 2D20A 4P46D 4P2OA 3FQNA 1Q6FA 2NCMA 5IVZB 3NA4A 4UDTB 3O6FA 4POUB 4XTRC 1QW8A 4V2BA 5T1KB 1K42A 4O58L 4B50A 1WPCA 3HZYA 3DX7A 4J28A 1ZSDB 1OF3A 3DIFA 3RZCB 1AFVH 1RK0B 1QI5A 2RAMA 5A6KA 3KPMB 1IE5A 3W9DA 1XGPB 1P7KB 5E8NA 5ERWB 3NBNA 4QAWA 2JKXA 1WZMA 5HYQA 3P11L 2VXVH 3VNZA 3L3IA 4QHLA 4QFUA 1QRNA 2NY4B 4JY4A 4JFDE 1CG9B 2FEEL 2QQLL 2EH7L 4X6FB 2VC2H 4X6DB 1A9BB 3FQXA 1FJ1A 4APQB 2DYPA 2XICA 4PJ9D 4X0KA 4TVCA 3IJ8A 4PCSA 3W6LA 3FKUS 1A6TB 4KY1H 3A6OA 1I1FA 2GAZA 4LU5L 3TBTA 3X11A 4OSUH 4AD0A 4HPYL 2E3ZA 1N5AA 5FCUH 4X4XA 1AXSB 2MWCA 4JJHA 1JRHI 4P23A 1GGBL 1OD9A 1U8HA 1KPRA 1S5HB 3QI9D 1AKJD 1LWRA 1VFFA 2Z4QA 3OKMA 5CP7A 2BERA 5AAWA 3MOAL 5HI3C 4EN3D 3RVTC 3B9KD 4EE9A 3HRZA 1A1OA 3WH5A 2M26A 3WSQH 1A7PL 4OIIL 4ENED 2YR3A 1S3KL 3EZ8A 3D0VA 3GIVA 4JR9H 1JWMA 3BJLA 2NY0C 1FN4A 1U6AH 2WAAA 2WINB 4I77H 4LKCA 1S7SB 4WNQA 5DJZA 5SWZE 3U9UB 3UZEA 5FO9B 4G43B 3RWGA 4Z78B 4XUOA 1ZT7A 3HZVB 3ZJKA 1A6PA 2E6PA 2FEDC 4QDSA 1PKOA 4YGVB 1MLCB 2GKIA 1CWVA 3SY0B 4U0QB 4ZOEA 1HE7A 3LRSA 5MI0B 3OLIA 2QJDA 4IM4A 1OAKL 4LVHC 3S88H 3C7FA 1CCZA 1NWSA 1OIFA 3V5KB 4CMHC 4R6UA 4I2XA 1BEYL 5HPCA 4NRRA 3VVGA 1S7UA 2LTQC 2HJFB 3BCDA 1RHHB 2OL3L 1A5FL 2VXUH 4OLZH 3W26A 2BVQA 1XYFA 2DQHL 3WDQA 1T04B 4R90H 5FDWB 3UBXA 3CLEL 3D2UB 3OQ3B 1XGQA 4LLWB 1YMME 4UINH 1T89A 4JPIA 1ROWA 3RUGB 3VI3E 4P4KB 5IB1A 4RFOL 3AQUA 1U3JA 4A44A 2QPUA 1EX0A 3V7MA 4FXKA 3QO1A 1CS6A 1RJLB 1ZGLB 1A7NH 4D6HA 2EO9A 4PJ8B 1BBJB 2HKHL 4MA3B 2WAGA 4KWUA 5A6LA 2BSSA 1KEML 1U42A 4R2GC 5C0BA 5GNYA 4ZOAA 4L4PA 2N1KA 3BESR 4JQVA 2J7FA 3FO1B 3C8KB 4GRMA 4NQCE 4YBLB 1AGEB 3MRDA 4R97C 5IVXE 1RV6X 2VE6A 3GB7B 4HV8B 1RULH 2J3SA 1L8NA 3ESUF 1JUFB 3BAEL 3C60C 5F44A 3NCYP 5JNYA 2PBOA 4GO6B 5C0GB 1NAML 4WUUB 1NEZB 5BRPA 2AXGA 5D9SA 5ETUA 1R3LB 1BX2B 2MHAA 5CLTA 3P4LA 3MFFA 4X5XB 2ITCA 3C6SA 5L2KD 1HI6A 4G6ML 5TDNA 4QEGA 3AU1A 1PG7W 5C0CE 5HHXL 4HJGA 5E08H 4U0RB 5AUMB 2QQIA 4NZUL 1TETL 3KWWA 1SBSL 4GMTL 4NO0D 3WS6C 4Z7OF 2PB1A 3D3VD 4LK4A 2NY7H 3EFFA 2FX7L 1F6FB 2H1PH 4QRRD 5TJWK 3RWFB 2DWEB 3U2SA 1KXVA 3GNPA 1FNLA 5F6IC 5TQ0H 4WCYL 4U33A 3WFEH 2F5AH 3VXSD 3V8OA 3CPLB 4QB2A 2VITB 3LKRB 5E2TL 3T8XB 4CVWA 1ACYH 3KPRB 3TOPA 1P4LA 1IEAB 3W11D 3PTKA 2BVUA 3BO8B 5HYJD 3D39B 3STZB 3HCVA 5CIPH 5HDQH 4UQ2B 5GHWL 1HHKB 1L6XA 1VGKA 2X70A 3VE0B 3HNMA 2QHAA 3AY4C 1J0HA 2WP3O 4BCEA 4Z0XA 2W0PA 4JRXA 4LOUD 4WWKD 1YPZE 3TBYB 5SWQB 4KH2A 3SDCB 2DSKA 4X9YA 2AK4D 3WQ4A 1BBDH 2VISB 3VKKA 1IC7H 4DCQA 4X98A 4KJWC 2YD6A 4H41A 1E4XI 3I6KA 3ROOA 5C08D 1FFPB 1PZ5B 3O11A 2O61B 5DUBB 3KXFA 4Y8AA 1WBZB 3ARDB 2E7LC 1JNNL 2BVDA 3TNMB 2XFXA 4GS7C 4KKNA 5FV1L 2WHMA 1O7SA 4EZMA 2G9HA 3QCUL 4JM2F 4IDJH 2GSGA 2EE2A 3B5HA 3U5YA 4OUOA 1A6ZB 1HKMA 4UZSA 2Y07H 2NW0A 4P02B 5F72S 4LLMA 1E6OL 4OFIA 1FPTL 3TGXA 1SFSA 3H2WA 1A64A 1W72L 3KYNA 3UZQA 3INUH 1AD0A 1XF3B 3ZE1E 1I8IB 4NBXB 4C56E 3L3GA 3KPSE 4AAXA 3WF2A 1KBKA 5I77A 1UWUA 4Z2AA 2FB4H 1QLEL 2Y23A 4KAQL 5JXEC 4X83A 5DC9B 4KRUA 4Y4KA 3IU3B 1I3UA 3C5JB 1NL0L 1NMCC 1XH3A 4R4FH 2EE6A 2AS5M 4HFUH 2WCSA 3T65A 4AXNA 1SHMA 2K7PA 3CLWA 4P3CH 1G0DA 3NPZB 3MMEA 2J8UB 3HNSH 3VI4F 5HBBA 5A2BA 1WF5A 4ZSOE 3QFJA 4MAYB 3TBVB 2PWHA 1EFXB 4OLYL 1AY1L 4OZ4B 5CGYD 1MFAH 3PGDA 3V95A 3AMLA 2IPTH 5F1IA 3TA3C 2GJ6A 5JW4Q 3MRKB 3U0PB 2X7LB 5FD0A 1V03A 4JFYA 2Q76A 3L4ZA 4M9PA 3C2SA 3MGOB 3V8CA 3IT8D 4TNWK 5A8QA 3GIZH 4LGPB 3HAEH 3KLSA 3P4NB 1I4FA 4JFEE 5D2LB 4J7RA 3KYOB 4LEXH 3WD1A 4Y4FA 3K75B 2ZXBA 3NZ8A 1BQCA 1M7DA 4AL8H 4Z7WF 1P4IH 2DQEL 5BXPA 4G8FA 1QFWI 1H5BA 1R5WB 1Z5LB 1G6RA 1CXEA 4M8UA 1GC1C 1HK6A 5DJ0B 2ZUNA 3LSOB 5HHME 2C9KA 1GZQB 4YHOH 3I3DA 5CAYB 4P46C 1UY1A 4TYUA 3UETA 2E7HA 1IBGL 4MX7A 4HS8L 1WICA 4O9HL 2LU7A 2WUCL 4IMLB 1FGVL 3GI9H 4Z7UB 2VMCA 1VFAA 1XGUB 3ARXA 2CBJA 4GQRA 4IIQB 4ELKA 3S3PA 1BVKA 2ESVE 4OIBA 2DIJA 3U4AA 1JXKA 2IPUG 2OBGA 3TM6A 1SEQL 1HKLL 3AIBA 3NYDA 4NWUL 3HE7D 1WDQA 2FJGB 2DQJL 1DLHA 4PJ9C 4RFEB 3O6KH 1PX4A 2MQ0A 1KC5H 4FMKA 3EKCA 3T09A 4HS6B 4MJ2A 1UM4H 1UYZA 4NNXA 1G7LB 4M61A 2D24A 5DFVD 3P4MB 3JZ7A 2GK1A 5JR2A 5IW3A 1DL7L 3L3HA 5D5MF 4DWSB 3EYUL 2VVSA 4DVBB 4XNUH 4GKNA 4RAUB 1K5NA 1GJUA 2J7HA 1UB6A 4S1DD 3QI9C 2WWMD 5LA1A 2DH3A 1FYTB 1XGTB 1J12A 5EC1B 3UXFA 2EPOA 2ATKB 4EN3C 3B9KC 3DO7A 2ZICA 3G9AB 4UT9H 5HYIA 1T0NA 4ENEC 5AYQA 4G9FA 3WFBL 5GS0L 3HNTH 4MD5B 4XAKD 3NCFB 2FLRT 5MEPB 1CDCA 4NKDA 3SQOL 2HFFB 2VDNL 3SDDD 2ESCA 3CFCH 2QF8A 2VX4A 1YEJL 4A6YB 1HQRA 4GRWH 4FQLL 4X9IA 1XZ0B 3AREA 3SJVD 3TIEA 3EHBD 4PTXA 2A9ML 2EIZA 1MFNA 4BZ1L 2DM2A 5FKPA 5I74C 1BMGA 1IILE 1PX8A 5D7KE 2EYRB 3EO0A 3MRCA 3Q3GB 5ALBH 1HIZA 1T5XB 4NQXA 1QFOA 3CIHA 4P4RB 3QCVH 2I24N 4PY8J 3THDA 4Z8FH 1A7OH 4J3WA 3PZOA 3LD8C 5I1DB 1FP8A 2H8PB 2H3NB 4H04A 2D03L 2R29H 4OT1H 1MIEL 4Q0XL 2AJYL 3O6LL 4XHQA 2CRIA 3PHQB 1ND0B 5BRQA 4MA8H 3C9NA 3LCYA 4W93A 3CH9A 1HDMB 1GOMA 5GZND 1IGCH 5D1XB 5FXCH 4M56A 4N0RA 4GG6B 2VSCA 3Q5YA 2V5TA 3KPPA 1LL6A 2VN7A 2P49B 1W1YA 4PJEE 4R96A 3A6CH 4ODBD 1J0YA 4MQ7B 2A1WH 3MRQB 3N18A 4V27A 2OJEA 3RY4A 1GZJA 4D8PB 5CSZA 2X05A 2WN3A 4OZFA 2OLDA 1EEYB 1U8PB 2ICEB 2Q86A 3WQ8A 2G75A 4QYOA 4F66A 1BOYA 1IGJB 3FTGA 1KF9B 5D8JL 5DJ8A 5I6XC 1G01A 1TVNA 2VX5A 4TQEH 1CE6A 3U30B 5HYSA 1K45A 4GAGH 4EDXA 4PRDB 5C9JB 3T2PA 3DHJA 3UTPD 2WVSA 4HXAL 5AC5A 3HE6A 1YHTA 5J9PB 1O8SA 4B7LA 3WD5L 4WGVB 3N0PB 5EU6E 4P5TB 1A6UH 1OGAE 3H0TB 4JB9H 5KSAD 5T1MA 1FNEA 3RL2B 3HNYM 2PW1A 2IMNA 3QUKB 4KI5F 5CMAA 3KLHD 1U93A 3OKKA 1X5IA 2NW2B 3MBEA 3FFDB 4HK3J 3U1SL 3RJYA 2CO7B 5DS8B 4MTVA 5I76A 5IGXH 1NCCH 3QXAB 4HTYA 3WQBA 3ZHDA 1S8DA 5DK3A 2P42B 3VFRB 3GKZA 3FB5B 2BVOB 1VFBA 4QCFA 2GFTA 4LPTA 3W11C 3BRDA 1LEIA 1WK0A 3HJEA 3DC0A 5M03A 4I5BA 3U7AA 4WEMB 3MCKA 2CIIB 2WVUA 4XPTL 1XR8A 3RWCA 3WEZA 4LCYB 5K9JH 5DJAA 1GPOL 1NGWB 2NX5B 5JPMB 1GJIA 1M05B 25C8H 1BYCA 4LOUC 4WWKC 3SHSA 1YEFL 1F42A 1JHJA 2JIEA 4X7SH 3EDKA 1WITA 3UPCA 4F7EB 4RDQF 1UD6A 3LMYA 2UWEB 3MO1A 2J77A 1JD7A 2FIKB 1KTKE 1MWAL 5D96C 5E95B 1ES0A 3IKKA 2DF3A 1I9RL 5E6ID 4WI8A 5B8CC 4UU9A 2DQFA 1QOXA 1S9YB 1CLOL 5FYKU 4QX0A 4ZUUA 4FNLL 3SE9H 2FWOB 2GEEA 1U8MA 1X6LA 5KJRH 6FABL 4N8VG 1IQDA 2X9YA 4NZDA 1BOGB 3WIIL 1RZFH 5ICZA 3MNWB 5C3LD 5FA3B 3ESVF 4GAJH 4M5ZL 1VF8A 3SGJA 2G41A 4WIWA 4TNVK 1MCLA 1MQPA 2VZOA 5E1AB 4DW2L 1J87A 2EPMX 2VRAA 3G5VB 1GORA 3ISWA 1FORL 4JAWA 2F8OA 4OZHF 4AK1A 5AD0B 3H9YA 4O2FA 5JO5B 1F4WH 3OX8B 5CFHA 2Q3ZA 5E8DL 3TONA 4ZFMA 1QQDB 2JF7A 1JYNA 1A7QL 2R69L 4RNRB 5CGYC 1BGXL 4MMXC 1R3IL 4MQSB 1UR2A 3FXYA 3T0VA 3PWJA 1DWHM 2APXA 4G80A 4Y19D 3SOBH 5BZDB 5CEYB 1RJCA 2OS7A 5EU5B 1Q9WA 3F7YB 2BDNL 2CLVA 5JUEH 4YHKH 3ZTNL 2X4NA 3W0WB 1F4XH 2C3WA 3TESA 4MXVE 1CF8H 4IMKC 4GXVH 4GW1B 5GJSH 4EQ3A 4P2QD 3QUZA 2IAMA 3QUXB 3S36L 4FA8A 2XG9A 4NQDB 3QOMA 1XF1A 3FB6A 5LAXA 4N8VA 3T1FB 2V3GA 3RM8A 2B5IC 1ZVYA 1R0AL 4U1KA 5F6HI 2JB5L 4DUXA 2DQCL 4FRWA 2DMBA 2PWGA 4BQ4A 3CZFB 2GFBB 4Z5RA 3BPNC 5F7EL 1DUYA 3LRHA 4LSTH 5E9DA 2ZUSA 1C91A 5GS3A 3DPBA 3LQAL 2HVJA 1RIHL 2X4OB 1Q8MA 5L7XH 3CKHA 1KTRL 4YDJA 1NKGA 3V4PH 1Z3GL 2VZPA 2ZE0A 1MIMH 3S34H 4OF6A 4KU1A 1L0PA 1YEEL 1YJDL 2F53D 3G08A 1TZIA 5FGRA 2XM1A 3LH2L 4ZNEA 3ARBB 2IWGA 4F7CB 4G6JL 3EB7A 2D3LA 5CJOH 3GH4A 1NBYB 2IMMA 1MH5B 3GJFB 3HE7C 3VFNA 2EQDA 1AQDA 3WF3A 5BV7H 4ODXA 3BAKA 4HFWB 4NJ9H 3CFKA 5C2BH 5EWIL 3QQNA 1TVHA 3C2AH 5DFVC 1HXMA 3GSRB 4Q6IB 4D0BA 3SDXF 5ID1A 2ARWA 3O3EB 3L3OA 3P9LA 2WABA 2OKXA 2C8NA 1NCWL 2CKSA 4S1DC 3FB7B 3NCOA 3ZM8A 2WWMC 1NUFA 4AMKL 1TITA 3RNKB 1TVBB 3V52L 1DLCA 4YR6B 3JV4A 1JNHB 1P9MA 3SUWA 5EUOF 4AIEA 1MAKA 3WJJC 1LO3H 4U3XA 4X7CC 4K9EL 1UH3A 2XWTB 3ZMRA 5D1ZA 3ACHA 5I3DA 4FXLA 3JWDL 2BNQD 1MHEB 4HJJH 2XVPA 4QRUA 3EJYD 1EPFA 3SDDC 1HIML 3KPLB 5T3ZH 2W9LA 1EAJA 4I18C 4I3SL 1NKRA 3EHBC 4PV9A 4W89A 4W7VA 2UVFA 5DR5L 2JF1A 4XVTL 5D70L 4GINA 5L2KE 1FZKB 3OGOE 4K55A 1J18A 1J9CT 5I9QC 4RWYH 5EJZB 1CPUA 3PG2A 4NJAL 4IRSD 3GNOA 4HJ0D 1ZLSL 4FQHB 3BKJH 4F7MB 3T0EB 2FJFA 2CEQA 3D3VE 3L5HA 5ENWB 1MCKA 1CD1B 1WE5A 2FJHA 3UEZA 4OOZA 4QRRE 2D7TH 3QEQA 1MY5A 1LQ0A 2L7JA 3H42H 4BQCA 2CBUA 5KZ6A 5DK0A 5AG8A 2C7UB 2JJWA 4F9LA 3VXSE 5E56A 2X0YA 5GZNC 3C6LD 5ADPL 4UIKL 3K1KC 1OAUL 1K4DA 3BH8A 3BISA 4Z7NF 4AD2A 4F3FB 5DD3L 3W2DL 4K3GA 3GXDA 5HYJE 3MRBB 1KGWA 5T3ZD 4P59L 1JPGA 4MVBD 3N85H 4CU8A 1T1XB 3A0OA 2P1YA 3G04B 1CEOA 1AR1D 1ED3B 5JXIA 2B4CL 4ODWA 4WY7L 4PJAF 5SWSA 4NFBA 5DK2A 2AK4E 2DMCA 5CEZH 1AHWB 3WN5C 3U37A 3ARFD 4TTDD 4M7JH 3PJSA 4WO4D 3OLDA 5E03A 1W3HA 2VMEA 3MYZA 1FP5A 4HEME 1KPVA 4QDRA 3QIUD 5C08E 4MO3M 4QHUB 1OPGL 1LD9B 4P5KA 4TUKL 4HG4K 2CKBA 1TTFA 1BLIA 1FL5A 1MFUA 4LCWD 5DD0L 2PXYD 3WKNA 4R0LA 5J11C 1LE5A 3QQ4A 5D9PA 2BGOA 1YA5A 1C12A 4PRIA 5T5FL 2X4UB 3NFSL 5F9JA 2OTWB 4F33B 5DJ6A 4WTXA 5KSAC 4XBPB 4TULL 3P40A 1UY0A 43C9A 3KLHC 1ONQA 3O81A 1YNTA 2W5FA 3HR5B 5EU4B 3VDCA 5KVFH 3U36A 1H8SA 4HT1H 4MJIA 5MEQA 3KNBA 2PO6A 4CJ0A 4JCLA 4JG0L 1IEBB 4OQTH 5LQBH 4Z7QF 4P00B 5FUOH 2YEZA 5A43C 2UVEA 5ANME 1N64L 2JIXB 3OL2A 4UFMA 5A95A 3R4DA 1I85A 1BWWA 1K8IB 5EIIA 3D9AH 2NQCA 5CEZD 4NO2B 5GISL 1NMAH 5AYUH 2V2XB 2VDQL 2XT1B 4TOYH 5K9KB 2EO1A 4PMUA 5JMOC 3TF7C 5H35B 3EYSH 5DHVA 1YZZA 3B8SA 5I1HL 4PV8B 5I1KH 2GJXB 1KNOB 4PJFE 2AK1L 4PY7B 4PIRF 1IV8A 4R26L 1KJVA 4WW1B 3FT2A 1OSZB 3KYMB 5AWNH 3FMGL 3TTQA 5FA4A 1ZHBB 4U6XB 2Q20A 1JU4A 1TCMA 3WL9A 2OYPA 2W38A 3FO9B 3MLYL 4N9GB 4EI5D 3KLAA 4NO3A 3ZDXE 4XX6A 2K7QA 4L3EA 4L9LB 4K07A 4HWBL 1OP3H 1T80A 1RQ5A 2VURA 3KAAA 2YSSA 2V3DA 3QAZC 5E6IC 2WCGA 3BKCH 3WQWA 1QBAA 1IT0A 2XACC 4NHUA 4S1SH 5DVOA 1JPST 5T1KD 3RWJA 2R8SH 1H0DB 5JBFA 3VXQA 4PJAA 5C6TL 3BAIA 4UOJA 4ZNCD 3PGCA 1PPIA 1UB5B 2D31B 3C8XA 2PF6A 1N0XL 3QXWA 1J1XH 3N1FC 5FOBB 1UWRA 2PYFA 2ZSVA 1LP9F 5D9OA 3VJ6B 5GS1B 3AUVA 5MERB 3I3EA 1MPAH 35C8H 4B9YA 1SJVA 4HDIB 5T1LA 3QFDA 2WKGA 4ODUB 3FAXA 15C8H 5I2UA 1X44A 4JQIL 4HPGA 3R06B 4HH8A 4U6TA 3IANA 2BC4B 1GOHA 5BVJA 5EIQA 4ZTOH 4PCTA 4OMDA 4CVXB 2YL5A 3EYVB 4APQD 5KS9A 4XPFH 2XNAB 2E7MA 3A6BH 3VA2C 4X6CB 4S0SD 4KROB 2DCKA 5A6MA 5JW5A 3QQ9D 2B9VA 3IFLH 4MS8D 1P7QA 2P5EA 2XRAL 3BHBB 1NDMB 3W5NA 4OGXL 4YXLH 4UFKA 3QHZH 2QQLA 4TSBL 2L0DA 3NSMA 1TG7A 2OSLA 2O92A 4U4BA 3FCTB 1C8XA 2ZJSL 1DJSA 2W60A 3QWRA 2VLJA 1B4JL 2CUMA 5DGQA 2WMJA 3A22A 3QG6A 5MENB 2BSTB 3G6AB 4MD4A 4NI3A 3MXVL 2DLEA 5B3NA 5LA0A 3TN0D 2JCCA 2AKRB 3SCMA 4MNJA 4LLDB 4NO5A 1DQLL 4MXWL 4P2OB 2OQJB 5CJXA 5LCWL 4HC1L 4XAKE 3MBWA 4U1IA 5JUVA 1YEKL 3EMCA 1V5JA 2IADA 3DX7B 4KZDL 3BIKA 3DIFB 5F9OL 2VNCA 5DI8B 4J8RA 3SJVE 5ACZA 5DMKB 1RZ8B 2DKSA 3V7AE 1JP5A 3UTQB 5HYQB 1A7RH 1T1WB 4K3EH 3QZWA 4HKJA 1QPXA 2A6KA 1ZOXA 1S9VA 1QRNB 4JY4B 3W6MA 4PJ5A 2E8YA 3NFNB 4YZFF 1FSKC 3UTTA 5EBWA 5T3XD 1CENA 4HUXB 4JZOA 1IKNA 2XA8H 5DQ9A 1FJ1B 3K74B 2DYPB 5CJQL 4X0KB 2GVYA 3D2UD 2VDLL 1UG6A 4YXKH 5E9AA 5HTSA 5FGCE 2RFXA 2ZKHH 1MXDA 1CL7L 2Y6HA 2AQ2A 2ZCLL 1U8QA 2V7HA 1LP9A 1N5YH 4P23B 4FN0A 5DFWH 2WWCA 4G5ZL 2W9EH 3CFDB 1XCXA 5JXAH 1TJGL 2BVYA 4AMCA 4BELD 3CLFL 4ONFH 3TIDA 1KOAA 4QO1A 4H20L 3VFWA 1V08A 1WP6A 5C09A 4DVRL 5KAQF 4FABL 4OF8A 4GRWE 2VZ1A 2I5YL 1R7OA 1VPOL 1NGPH 3VINA 2J1SA 4MXQD 1W99A 1JNLL 4LKCB 4OZGA 4WUUD 1UCTA 4GRLB 5ALCH 3RWHA 3SKJL 2FD6H 3WFDL 1PMJX 4UQ3A 3VOCA 1R6VA 1RZKL 5F21B 4G9FD 1YY9C 3EJYC 2DTMH 3EZJB 2W87A 4D0QA 1T7XA 4WU7B 5HXMA 3POHA 3MJ7B 3D0LA 3LRSB 1SEBA 4OF7A 3ZZ1A 1UXXX 4ONOA 3ZE2E 4D3CL 3QPXL 4FQJH 4I2XB 1WCQA 2VCCA 2WVTA 2XZAH 4PB0L 1IGFH 1NAMA 5D2NC 1SG3A 3UTPE 4PJIA 1OD7A 3DVGA 4IRSC 2BVQB 4HJ0C 2JEQA 3L6FA 1K4CB 3JV6A 5KVDL 3AS1A 4YFEA 1PJ9A 1KPUB 3JWNC 3UBXB 1E28B 2UV3A 4XMLL 5J6GA 4J27A 1MHPH 2E9WA 1DANT 4RISL 1CXFA 4GSDL 3WCYA 2N7BA 3X3GH 4DKEH 5EA0H 4JFWA 4FXKB 1DDHB 3L2LA 1TPXC 3KPRD 5KW9H 3C6LC 5DMJB 1RUQH 1IFHH 5M5DA 3RX7A 1NCTA 2BSSB 3D39D 4K94L 1T5WB 5IMLA 1R3KA 5F89A 4GRMB 4OOUA 2IBBA 1F02I 3MRDB 3BD3A 1J0IA 1F3DH 3W82A 4F8QA 2C3VB 4DUWA 5BO1H 4MVBC 3NOIA 1IARB 2YK1L 4U6VL 4MGSA 1JN6A 2ZEXA 3SDCD 1AR1C 1JV5A 3STLB 1CBVL 1W9SA 1TE1A 4LLVB 1FFNA 1A1NA 1RUKL 1ISWA 4BJ0A 1KWGA 2B2XL 4HZ8A 3N1PC 2DBJA 3TH4T 4ISVA 4EBQL 1EVTC 2MHAB 4ZENA 3ARFC 4TTDC 4WO4C 1FFRA 5I8OH 3O3UN 2FGWH 4XH2A 3ARDD 2IC2A 2ZX9A 3GSOA 3AIQA 3QIUC 2BRRL 1GOGA 3GMMA 3AU1B 4UV7L 3B9AA 2YDQA 1CU4H 1TQCB 5CZVL 2F2HA 4HJGB 3U46B 2PXYC 1YQ2A 5C0IB 2XTLA 5BXFA 5E2WH 5GS2H 1BLNB 4QXGL 1KULA 2ZEWA 4CADB 5LBSL 3IFNH 3AJ7A 1KTLA 3U2SB 4WFHE 3FFCA 4U3CA 3BYTA 3AXHA 1C5CL 1H09A 5E2VH 4PJHF 3U7BA 2GUOA 3MUGA 3R1GL 1DLFL 2J1TA 3TT3H 4J3TA 4QHKI 3BC9A 1NWRA 1E0WA 4NGHL 1UUQA 4G9DA 4LSRH 1OM0A 4BQ5A 5DA4A 5A2CA 4M7KH 4UUJA 1W72A 1T83C 1BYAA 3AISA 3DX9A 4MAYD 4OIAA 3ULSB 3JBG7 1EFXD 3EBVA 4F15B 4KKCD 4OV5A 3EJJX 3VW3L 6CGTA 3P6BA 4XC1L 1GIGH 3WXVL 4JANA 4Z0XB 4JRXB 4Y19E 1JPTH 2DKUA 2X4SB 4IBLT 3CO4A 3PP3H 3B5TA 2YOCA 1OSPH 1H6XA 1GOQA 3JTSA 4JE4B 2O93L 3ROOB 1WBYA 1G7IB 2WNGA 3D18B 1IM3B 3QHFH 5J89A 5GS2D 4EI5C 4ZXLA 1AE6H 1EQPA 4QY8B 1BAFL 4CN4A 4OLXH 4P2QE 5ILTH 2G9HB 2GSGB 2DM4A 4OZIE 1GMMA 5B38A 1NJ9A 2KZWA 3VDHA 1CFNA 4XCNA 5TPWH 2XKNA 1XIWB 1F3JA 2ADGA 4KV5E 3I97A 1D2KA 4UQAA 4EAMA 4X7DC 3DXAB 4E8DA 1TIUA 5E6YA 2VL5B 2YS4A 1WBXA 5CILL 2R23A 3PUHA 2DIEA 4AYSA 4RMTA 4XB7A 4XMKH 4A6YH 2V9RA 1NLDL 1X7QA 4QPWA 3T65B 2F53E 4HKZA 2A2QT 3X3FL 5GRVL 1IGTA 1DWIM 4W4ZA 3MA9H 1QLFB 4APQC 4FLOA 2YRLA 3ARQA 1NWTA 4FFYH 3AYSA 3KHQA 3PGDB 4YHMH 3VWJA 4RGNB 4K8RL 1R8LA 5F1IB 1YQVL 1PG7L 2GJ6B 4K68A 3QQ9C 2DB8A 4JFYB 4MS8C 2Q76B 1I3GH 4Z2KA 4DWSD 3FQWA 2RCSL 1S5IH 2VABA 3F5KA 4EI6A 4PJHA 1C5BH 1I4FB 1FE8L 3U0WH 1B6UA 2QQMA 4FF5A 1NC2A 3BRGC 4WUKH 3TJEL 3NZ8B 3BI9X 5I71B 5LA2A 5E5MB 5DD5L 3VFPA 1UY4A 3MOBL 3VXMB 4G8FB 4JDZB 4DKDC 1FO0L 4OI9A 5F96H 1OGTB 3M8OH 4O2CA 5IQ7H 3TN0C 3GBDA 4LFHD 1IT9L 3VX1A 2XWBA 5DEGA 3SEEA 3Q0HA 4HULB 4E0RB 2R7EB 2FEEI 3OA5A 3O45B 3ZKXC 3G6JA 1H5BC 1RZJH 5FHAL 3AI0A 4K23L 4OCRH 3C7GA 2BNQE 2EEBA 2UY7A 1PFCA 5DD1H 4DEQA 1MCFA 5I1LA 3CMJA 2H26B 4XHJD 3BLKA 3TV3H 3P9WB 1CXLA 1L4IA 1HL8A 3BGMB 2OJZH 5MI0C 4ELKB 3T4YA 4YHPA 1BVKB 2X4PA 3KR3L 2HG5B 1H9VA 2FH6A 3GSWA 1FQ9C 3PGFH 3KYAA 2Z31A 3WN6A 4ELME 5D2NE 5BXRA 4WGWB 1LNUA 4I9WD 1A6VL 2WBJA 4QOKB 4JM2B 1N8ZA 3SDAD 4TX6A 4BUGA 5C07A 3IDNA 2R0WL 1DLHB 4ET7A 3QRGL 4ARYA 1WJ3A 4QX2A 5D8WA 3QUML 4XBGA 3EOAA 4GO9A 3DMMB 4ODTH 5FL1A 4M61B 1RJYA 5D7IA 5EO9A 5D1XD 3WDRA 4L29A 1FCCA 3NQHA 1MFEH 1J9YA 2NT0A 3L3HB 1FAIH 1BQHB 4H25A 2ZPKL 2Q7NA 4GKNB 1MW3A 3UPRA 5SV4A 3G5YB 1CGWA 1TA3A 2B4KA 1X4XA 4Y7EA 1AJ7H 3VXTB 2P4AB 1LO4H 1Q9KB 3GMOB 5JQHC 4YBLC 5KG9A 3MV8A 3VRLE 1INQA 1IL1A 2H6PA 5T3ZE 1A8JH 3K77A 1RIVL 4YFDB 4XUTA 3S97C 2YL9A 3T3PE 2HYMA 1MVUB 4E5XB 2ZCHL 4Y89A 3GBNH 4NRYA 3MJ8B 4TVPH 1XF2A 2E6QA 4IHOA 3HOBA 3CUIA 1BG4A 1WIUA 4D6IA 3FRPA 4JRYB 2BGPA 1E70M 4CMMA 1Q0XH 5D7JA 2GK2A 4NFDA 5FK9A 2BFGA 3EO0B 1ZS2A 5I16B 5F1NB 4Z7WB 1MWOA 2FYYA 1ZGLM 4LBEA 4LCWE 1V3LA 1CZ8L 3MACL 2XZZA 4P5TD 4XCCL 3F7VB 4TUOA 7FABH 5AYBA 2ID4A 1ZVHA 2F5BH 8FABB 2QHLA 4ZTPH 1JI2A 1A3LL 3CD4A 4G42B 4GQPH 1BQLH 4LX4A 2XZCH 1G7HA 3C9NB 2Y8KA 2MJWA 3VFGH 4X6EA 4UT7L 1W8NA 1OP3K 1T2JA 2AEQL 3WKML 1MQRA 2EDBA 5DXWA 3DX8A 32C2B 3DX6A 1CLZH 1U58A 4M6MH 3IDXL 1RU9H 3ARWA 3APGA 4TVPD 2AJSL 3KPPB 5LGKA 2CIPA 1OAYL 1U8NA 1PIFA 4P49A 2ZWYA 4EOWH 4R96B 1SJXA 5CEZE 1ULPA 4E8CA 1KWKA 1QUNA 4Y1AA 2DLGA 1NC4B 2E3VA 3NABL 4BSWA 4UAOB 4JFZL 3VD9A 4MA1B 4AG4H 1WNOA 5FYLH 1QKZH 3SDCC 4EEEA 2CKNA 3WNOA 3WF1A 1MREH 2MCPL 5IDIA 3QDJD 4QYOB 1KB9J 3FTGB 4HXBH 2YDRA 1D5IL 5SWSD 3WBAA 3V6FA 4QKXB 3PUCA 5MEOB 5DT7A 5F7NC 2IBZX 3T77A 1MQQA 1Q38A 3ARDC 5IESH 3PUIA 5D9NA 1T21A 1YNLL 4NUGH 2WMHA 1GNYA 3SE4C 3ULUF 2J2ZA 1X1NA 3HE6B 1FDLH 4NKOB 2VH5H 4NZRH 5DUPL 2VDRH 3VGDA 3UR7A 2VWEC 4B0MM 1MWAA 1BD2A 5FL0A 2P5WA 1U93B 3OKKB 1GC1L 1INEH 5IB3B 3AS3A 1UY3A 4FOMA 1FBIH 2YC1A 5I76B 1UC6A 3LOWA 4I0PA 4QTHB 3V6OA 5M3WA 4KHTH 1MQKL 1E40A 3TYFA 1R24B 4LCUA 2CDGB 2QSTA 5TE7H 1S8DB 4ZFZA 1XF4A 2J6EH 1MJ8H 2RGSA 4X6DE 3LEIA 4UT6L 5DQJA 5GIRA 3MGAA 1LEIB 4MAYC 2J1EA 5I0DA 4RBPH 4ZUVB 3G5ZA 3CFEA 3QG7L 3H7LA 2V7NA 4HZLA 4KKCC 2WLYA 2QQJA 4OM0L 2AJZA 1XR8B 3RWCB 1T7VA 5IM7B 1QA9A 5DJAB 1ZT4B 1HEZA 1N6QH 4QLJA 1T2QL 4UTBH 4NZTH 4J23A 5KANG 4HKBB 5AY7A 1SJEA 4MSWA 1W9XA 4LGSB 3MJ9L 3GJFH 5IFHL 3W0WD 2XWEA 3O6ML 1NANH 1MAMH 1R64A 3ULVH 3SKVA 4YBQD 2PCPA 1YMHA 3PWUB 2ADFL 4YAQA 4DKFH 5LGJB 1ZA3A 4JVPA 4MA7H 3M46A 1X5ZA 2E7CA 1U3YA 1ZVSA 1W0YT 2QKIA 1KJ2B 4HIXH 1UMIA 2GITA 2EDOA 3WIHH 1R5IB 3HMCA 4HIIB 3OEBA 5GGVY 5IEHA 1ZV5A 2YUZA 1MF2H 3VFMA 1IAIH 1PW3A 4HMDA 4WI7A 4Z2JA 3DGGA 3MREA 1WWAX 4IIQC 4F2MB 3UO1H 4UQEA 3KEHA 4U1LB 3HTLX 3CVHB 2VXVL 2WP3T 2RQ8A 3RFZC 1JWUB 3ARBD 2OYLA 3O3BB 2VC2L 3O3AA 4RGOH 5T3XE 2DM7A 1DWGM 2V17H 1B0IA 3MOAH 5E8PB 3ULVD 4F57H 2BSRA 3EYFB 2BVEA 2X89A 4KY1L 2XSBA 3AAZA 3MNZA 1RURH 1O5DT 2R1YA 4OSUL 3DNKA 4ZMAT 1H4PA 5F9WB 5FCUL 5BRZA 3V79C 3L1OH 4JO3H 4DWSC 3NCCB 2IXVA 2CLVB 2HMID 1A02N 2A3EA 4B15A 2X4NB 2B1HH 1ODUA 1KIUA 1IGIL 3RIFF 1FNSH 1IAOB 2IBGA 3WSQL 2AOSA 3LRGA 3QUZB 2IAMB 4LSUH 5DJCA 3ZTJH 1FNGA 4PJGA 4JR9L 2OP4H 1WWWX 1C5DB 1U6AL 4JFSA 4I77L 4LIQH 2KKQA 4HHAA 4Z7VA 1MCSA 4IEFB 4G8IB 1HH6A 4WUUE 2O5XH 2EJ1A 2VRJA 4GG8A 4JKMA 4P7OA 1DUYB 5E9DB 2DCJA 4R8WH 2QHRH 1EEQA 4G9FE 2HVJB 1Z9OA 4XHJC 1U30A 3MXWH 4OLWH 4WENB 3ACGA 4LP4A 1TMQA 1N6UA 3S88L 5CP3A 3IDGB 4RMQA 3WD0A 4JFTA 2Q8BH 3WYRA 2GCYB 4JDTH 4ATLA 3ARSA 5DRWA 1N59B 5J7CC 4L8SB 3WFHA 4LEOB 3T0ED 2VZUA 2VXUL 3BAWA 4OLZL 2RJMA 3WSUA 1N7MH 2PF0A 3SDAC 2HRPH 2YZ8A 3VFNB 1ZBKA 4R90L 2DGAA 3ES6B 3LV3B 5IHZA 4DZBA 1WT5A 4UINL 1VFUA 2YPLD 3I2HA 4KJYB 2CHOA 3MZTA 3X12B 1RP9A 4HF5H 4Q74A 4NHCH 4UQCA 5D1XC 3GMRB 4DGYH 5ID0B 2VO5A 1VHPA 1BZ9A 4D0BB 4OLVH 4OM1L 4Y5YA 5D7SH 3S37H 1UFUA 3M1BA 1A7NL 3P9LB 3KPRE 4CN1A 4NT6A 1T0MA 3KYKH 3D39E 1DQQA 2Z91B 1RZJC 2E9BA 3IXTA 1WVZA 4OZHB 1T4KA 2DQUH 4QF1A 3DUUA 3BIBX 5KSBF 4QRPA 1E6QM 4R7DA 5DTFB 1ADQA 2F8VA 4M93B 5DMIH 4Z6AT 1SVZA 1E5JA 1RULL 2A73A 4HLJA 5HHXH 3NA9H 5DJXB 1XEDA 3LQZA 2MTPA 4CDGC 1SBSH 1FGNH 4QRUB 5C0FA 4M80A 2ARJA 3BD4A 2Q8XA 4BS0A 3MYJA 3CZ8A 1Q0YH 1S7XA 4LPUA 1I8KA 4M6OH 2BJMH 1B3WA 1WWCA 3ZKMD 4KZEH 4LF3A 2PBGA 3U30C 1QBLH 3AOFA 3O4LA 5DWUH 2OWWA 3ACIA 3PN8A 3MLRH 4WHYG 1UH2A 1PQZB 4FQCH 5HSFA 3RA7H 3RBSA 5E08L 3CDZB 2FO4A 3BWAA 2NY7L 4LDOB 4P5TC 1R87A 2QQOA 2H1PL 2VWEE 4QP0A 4X80H 2Y6LA 2D4FA 1XSKA 4RMSA 2CLRB 3MLSL 5DYOA 2JTDA 5TQ0L 3QNZB 3WFEL 2F5AL 4OKVA 2OX5A 4IOIA 2IANA 3VWKA 4L3CA 2P46B 2PTTA 4MAZA 3OKEB 5BJTA 4ZPTB 3CH1B 1WUNT 5E7BA 2C5DC 3PZNA 2WCAA 1ACYL 2JIXD 1JAKA 4WFED 2NLJA 4RMWA 4MB1A 4AT6B 2QQNH 2GSIA 4CU6A 3NMEA 4G6FB 5HDQL 1HYSD 1PKQA 1RH9A 4PMOA 1G9NL 1D6VH 3PWLB 2XHNA 3EBAA 3F6LA 4MQXD 3LQMA 4ODWB 3ZDZE 3Q1SH 3IDAA 4XUQA 5D1QD 4LCIL 5DK2B 4XXDB 1BBDL 1DBMH 3BDYH 1IC7L 4NDMA 3VM5A 5B4MD 4XP1H 2OTPA 1JVKA 3QA3A 3OZPA 3LPOA 4FTVD 3SE3C 5SX4I 3SDXB 3D69A 4HGWB 4W68A 1KPVB 2HISA 3WMSA 1QVOB 5ITBH 2ATPA 3TO4D 3DV6A 4PLKD 1JYWA 2O5YH 3D25B 4IDJL 2Q6WA 4R0LB 4Y5XC 4N0CD 4NSBA 2Z35B 2Y07L 3FOMA 1E27A 3EDEA 4PRIB 5EUOB 1OD8A 3OTTA 4AWEA 5DJ6B 4RDQG 3QEUB 3INUL 3MRNB 3OJMB 43C9B 3MMDA 1ONQB 2ZP0T 1A22B 1YNTB 1VRXA 5IF0B 2FB4L 1WAAA 3N11A 4MJIB 5MEQB 5TDOB 5EB8A 4HWZB 2PO6B 3JV0A 1V0LA 4FFVD 5J6HB 1XFPA 5ABEA 3E6HB 1FVCA 4PYHA 4GW4A 4P3CL 1KLGA 1FL6A 3HNSL 4POZD 3ZR6A 5JHDB 1QBBA 1CVRA 4PJXA 5EIIB 4O4YH 4XP6H 2KL6A 1I1AA 2PW2A 4C7GA 4KROD 2C7FA 2ZOLB 1MFAL 5B39G 2ICCA 2IPTL 1E6ZA 5BMFH 3REWA 4QX3A 2YWYA 4U1MA 2XWJA 3LEXA 1HWGB 5EUKB 4MJ6A 4J3XA 2WMIA 5HHNB 2WQRA 5GSRA 3GIZL 1I1WA 3N13A 1T1YA 2DJ4A 2HLAA 3RM9A 1O59A 4O02H 1G7JA 4OLUH 2EYTA 4FQXA 4LEXL 5FA4B 3RWEB 4YBQC 2NTFA 4P57A 4NO3B 1XGRB 1P4IL 4AL8L 4L3EB 1FGVH 1C93A 4JFDA 3ZR5A 1G7MA 1E4KA 1ISZA 4WDIA 1QG3A 1XMWA 1NQBA 3L3KB 1SYSB 3A67H 4YHOL 5FO7B 1P5VA 3L7FB 5JDSA 2CJUH 3RWJB 3HMWL 5JA9A 4NKIH 2XM2A 3PHSA 1C08B 1W2PA 3MOQA 3VXQB 2YA0A 3MRIB 4PJAB 4YO0A 4ZG1A 4KGLA 1F6LL 3WF4A 1GRWA 1JGLH 2ILLA 3FT4A 4W4OC 4CN6A 3GI9L 3GEWB 1VJSA 1LQSR 5J13B 3EGSA 4HC1A 1ZKAA 4WKFA 4FQ2H 4L1HA 1CZVA 1QNRA 3IETB 4HBCH 3ARBC 3I02B 1EO7A 3BZ4B 4I9WE 1AGCB 1OGSA 5BWFA 4D0DB 4IOSD 5HVHC 3ECBB 3ORJA 1NFKA 3X14A 1KELH 2EDHA 2X10A 3O6KL 1T7ZA 1W2VA 1KC5L 4OFYD 1HJXA 5SWZA 3ULVC 5LWYH 3P4OA 3BPCB 4G7VH 2YC2A 1EFQA 4NQSB 4HWNA 1IGMH 1UM4L 4Y5VA 2P5EB 2VZ3A 2J78A 2BNRB 4DAGH 4PB9H 4Q6IC 4JZJB 3GGLA 5FM5O 4GG6E 1EHAA 3LS4H 4GLRH 2OSLB 3O2DH 3SQOH 2HMIC 4NKQB 3S4SB 5FIPA 2V4VA 2XG5A 2VLJB 5I19H 4FXGB 4K7PH 3ILQD 2J7LA 3DROA 1BVLA 3N12A 2J7EA 4UT9L 2P8PB 2R2HB 3SCMB 4C83B 5KANI 3WDHA 5FKAA 4QHMA 1UY2A 4X5LA 1YEHH 1ZHNB 3HNTL 1CR9H 4GRLD 2DDXA 4J4PA 4H2CA 1CZSA 4X0VA 1MY7A 3MRHB 1YMMA 1KCLA 3QYCA 4KC3B 3CFCL 2IADB 3S98A 1TNNA 1F13A 4R7NA 3U79A 1IEHA 3HA0A 1JDCA 5BZWA 3QXVA 1NGZB 2DQIH 5ACZB 3OXRB 1MIEH 2ZIDA 4XCEA 1RY7B 5KSUB 5ALBL 2D9QB 4PP2B 1UVQB 3DUHA 3TNNA 3QZWB 3IK2A 4HKJB 2NT1A 3QCVL 1S9VB 3AXLA 3CCHB 1M7IA 2HJKA 4PJ5B 3U48A 4IS6B 4Z8FL 1B3YA 1A7OL 4ZXBA 4NQCA 3UTTB 5EBWB 1N82A 5GS0D 5IVXA 3T0EC 4GQQA 5I1AB 1LMKA 4XNQB 2R29L 3FNDA 1NCUA 3HFMH 3SQBA 5IB2B 3BH4A 2BCKA 1E72M 3PTMA 3DARA 2RFXB 5FM8A 3CHCA 2D3NA 3EYOA 1IKNC 1SMOA 3ZE0F 5FF6A 2V7HB 1IAIM 2CITA 1K3IA 1YNKH 4WW2F 5GGRA 1IGCL 1LP9B 1OW0A 2DPEA 3W0KA 4HMCA 3EO1A 4X7TA 1RIUH 1KJ3H 2G3IA 1AIFA 3RKPA 1UD2A 1CXIA 3MLWH 3WNNA 4TVPE 4GAYA 3PV7A 4L8BA 2FLBT 5C0CA 4U1SB 5DZLA 3TIDB 3KJ4B 2APFA 1GJWA 2OSWA 3VFWB 5H37G 3A6CL 3PP4H 2A1WL 2IH1A 4HS3A 1B3ZA 5DURB 3NAAH 2WBGA 2V9QA 4S1RL 4XPGL 2ZUYA 1RZ7H 1RYYA 3UESA 1AHWC 2EYSA 4HUKB 7TAAA 3BP5B 1CICA 2J25A 3H7BA 2A3CA 1IRAY 3QDJE 5EJ1B 1JHKH 2AV7B 3D0LB 2XQYK 5IT2H 4TQEL 3ZKMC 4Y4HB 2X1XR 2LVCA 1SEBB 3NCBB 4ACYA 1GHFH 4BA8A 2J8FA 2ZEYA 1H0GA 2XOMA 3DV4B 3GMPB 4XVUD 1ACZA 4N8CH 2A3AA 3CDGA 3N17A 1MJJA 5CGTA 4NRXB 3DVGB 4N5ED 5ESVB 4LPVA 4EJ1C 2JJSA 5BXSA 5F3HA 4JB9L 4NQVA 4M4RA 2W59A 5TGBB 3AGVA 3TTYA 3UERA 1YPZA 5J6GB 4NYLB 3DTXA 2CH8A 3VGFA 2FDMA 2X4TB 5IGXL 3KWXA 4HZ6A 1NCCL 4MNGB 2XI9A 3R0MA 3AHTA 4DGIH 4TUFA 3WXWH 1U8LA 4XVHA 3FOLB 1H11A 1OT2A 5IMLB 5F89B 1CQYA 1VGEH 2MFNA 1LL4A 2EDQA 4TXWA 1HYSC 3RX8A 2JLLA 3VH8G 4JQXC 5K9JL 1JN6B 2ITDA 3UDWC 2GK0A 1JV5B 4MQXC 3S4SG 5HGDB 25C8L 4C56A 4RGMB 4HA3A 3KPSA 4Y1AD 5D1QC 4X7SL 1BJ8A 4YFLI 2NY5H 4XUYA 2VOTA 3IFOB 3W0WE 1GCFA 5B4MC 3ZL4H 4ERSH 4NZCA 2GJRA 4XH2B 2W0LA 3NZHH 3GMQA 3LAFA 4L9LC 2EPKX 1PSKH 3GMMB 1G6VK 3RY5A 4DW2H 5DLMH 5L88H 4AW7A 2LABA 4NQDE 4ZSOA 3TO4C 3CUPA 4PLKC 1U2CA 3SE9L 3RIKA 4ZPVB 4N0CC 4PUDA 3MNVA 5LG1A 3QJHB 4MYWB 5BXFB 5KJRL 3GKWH 4XCFH 1XIWD 4H26A 2ZUQB 4W7WA 1RZFL 3DXAD 4PR5B 4PYSA 1KTLB 2H2SD 4GAJL 4QRQA 5I17A 5J1AB 1LG1A 3GSVA 4NN5C 5FGBC 3U7VA 1ISYA 1A7QH 4JFEA 1UWEH 4ZUWA 1AXIB 3I85A 2UZIH 2FO1A 3AC0A 4UNIA 5CUSH 1UH4A 4FFVC 4ZO8A 4PRAA 4LYRA 2J75A 4YEFA 5ISZB 2J5LB 2DQDH 4KJQD 2DL9A 4ZFFA 1PIGA 3BPLB 1F4WL 1JTOA 4POZC 1T66D 2Y72A 1IZJA 3VH8A 1GZPB 2XVGA 5ESAA 1H49A 1G5AA 4KROC 4O2EA 3ULVE 1AR2A 4KXZI 2PYED 4JANB 3OG2A 3VGAB 4ZZ5A 3PL6B 1F3DJ 3SOBL 2A6JB 3RGVB 3V6ZB 4BQ9A 5HGBA 1E43A 2DBLH 5JUEL 2XIDA 4YHKL 1KENH 2HVKB 4N0UE 3IFPB 2F8XC 1F4XL 3JTSB 5C3TA 1WBYB 3VXMD 5EDXA 5EOCH 2DLIA 4O51A 1UACH 5IMKA 1CF8L 4PY8I 5EO1B 1T03H 3F12A 4GXVL 5GJSL 5TDPB 3GNML 3BW9A 1Z3GH 2ORBH 1MVYA 1NJ9B 1TZGH 3WY1A 4I3RL 1YY8A 4XCNB 2XKNB 1QSED 4Q2ZA 1I1YB 2H2PD 5FECA 4LSTL 4JAMB 3MRLA 2DT2A 1YN6B 1CIYA 1FO0A 1P69B 3HI1B 1WBXB 4DM2A 1KIQA 5L7XL 1Q94B 4MNHA 1I7ZA 3V4PL 4NCC2 1F2XK 1MIML 3S34L 1X7QB 1W9DM 1D5BA 4QOKD 5ICXA 2B39A 4JM2D 2KQMA 4DJMA 3FAWA 4K3JH 3T0EE 1ZJBA 5CJOL 2BBAA 2WZ8A 1BJ1J 1X3DA 4LSSH 4P7NA 3C60A 3CFIC 3NIGE 5BV7L 3CXHJ 1CDYA 3EW3B 2Y6SD 3CMGA 4HKXB 1DN0A 5C2BL 1D9KB 4XZUA 2YPLE 1LGVA 5JLZB 3HC0A 4RX4A 5F70A 3C2AL 5B22A 3IJHB 3S6TA 4PJHB 1RUAH 3T04D 4MJ5A 2G5BB 1CXHA 4ZDHA 3QUMA 4PPTA 5CZKA 3L2MA 3ILQC 3WS6A 1A47A 1V6XA 1D7PM 2NYYD 4O2CB 2D2OA 3MA7B 4M3JA 5DEGB 1LO3L 1TCRA 3FQUB 4XPAH 4GRLC 4TVSa 1MOEA 1RJZA 2CPUA 3NIFF 4HJJL 3GDBA 4JRYD 4ORGA 5IOPA 5T3ZL 2NW3A 4X5WA 3GUTA 4JKPH 1KYOJ 2A6DA 3P0GB 1CL7I 4EK7A 1HSAA 1QO3A 1U33A 3N9KA 4PJ7E 1MHHB 5EO0A 2X5PA 1A14H 2D9CA 1H2JA 5DO8A 4RWYL 1HHGA 2YIHA 4PTWA 2Z31B 3FQTB 3I6GA 1DFBH 4PJEA 1LNUB 3K8LA 4MPKA 3AY4A 3BKJL 5GS0C 5GPRA 1F11A 2QSQA 4V1DB 3QOKA 4HIEB 1NGQH 3HR6A 2D7TL 4JM4H 2ED8A 3EOAB 1CYGA 3H42L 2WLZA 1RJYB 1R3HA 3QDGB 4OCNC 4NRSA 3GMNB 1P4BH 3BT2H 5IB5B 2AP2A 1FZOA 3IDMB 4P2RB 1MCHA 1PZUB 4Z7UF 2E7LA 3LEKA 5FB8A 4WFEE 2AV1B 3O2WH 4I4WA 4XI5D 2WB5A 3BDXA 5KG9B 3MV8B 1NC4D 4KDTA 5F7KC 3THMH 3N85L 4X8JA 3HJRA 4C57C 3W39A 5EU6A 1OGAA 4GWIA 3CAFA 4PSRA 1T22A 1KN4H 4OAWA 4NRYB 1EK3A 4X9HA 1GQKA 1P84K 5CEZL 3IDIA 5JXEA 4KRMB 3W81A 5BW7C 4LP5A 4M7JL 5F7MC 3WEMA 4MCZA 5L9DH 4FTVE 4H0IA 1X5JA 2NXZD 3PDOB 2PQSA 2ZUTA 3QIBA 5K59E 1GOFA 2FYYB 1M04A 4XVUC 3OBAA 1QSFB 4V2XA 1FZMA 4TUOB 4F7PB 2HN7A 4N5EC 1JZ5A 2W92A 3UAJD 3TA3A 3WO4B 3SURA 3DBXB 5DPNA 4MAUH 2VZTA 1KJ2H 1G7HB 4ATWA 4X6EB 3PWPD 4HT1L 5IKCB 3VIJA 1BSIA 1F8TH 1G0CA 2DI8A 4JFOB 1BJMA 3DSFH 3DX8B 5LQBL 3DX6B 2R1XB 2CK0H 1JPFB 5FUOL 1Q72H 5ELIA 4BUHA 4DKAA 4F15C 5E94B 3D9AL 2N4IA 4LDLB 4X6CE 3MRRB 1NMAL 3CVHH 5AYUL 1EOKA 4P46A 5G04L 4HWBH 1ORSA 2C4XA 4OCXH 3EYSL 4TNVF 5JMRA 3A4XA 3W9EB 5I1KL 3QR3A 1MCIA 3MV9D 1ZANH 4EDWH 1P2CA 2FR4B 3REVA 5AWNL 1RZIB 3PZ9A 4A3HA 4FFWD 5DVMA 43CAA 2CK2A 3GGWA 3VMPA 2R4SH 1E6PA 3JSSA 4OIFA 5TH2A 4CNIB 3S37X 5DJ2A 3IDUA 5ADOH 3BLPX 3F5JA 2HTKD 1KCKA 5HNNA 2CMRH 1OIMA 3L9RA 3BKCL 4K2UH 1OGGA 3I75A 3MJ9A 3QNYA 4PJ9A 3H9SD 4S1SL 3B2VH 1ORQA 3NIDF 1L7QA 1XNAA 2R8SL 2I9LA 1XIWC 2CO6B 2VAAA 1OM3H 1BD2B 1GPFA 2P5WB 3WMCA 1QLRB 5FFLA 4ZUSA 1J1XL 1AC6A 2H2SC 1BM3H 2QQKH 1U0QA 1FG9C 4M5YH 2O5ZH 3QHMA 4I0PB 4NP4H 1MFCL 1ZS8A 4A45A 35C8L 3QI9A 1AKJA 3TVMD 4ZFZB 3BFOA 4UV4H 4EN3A 3B9KA 2H32A 4ZTOL 1P7HL 1SVCP 1AO7D 2HFEA 5GIRB 4TPRH 4KJQC 1JHTA 1QP1A 4XPFL 1E55A 3G5ZB 1FCGA 3CFEB 3A6BL 1T66C 2V7NB 3SKOA 1NBQA 1S7RB 2J7MA 3OGRA 4KI5D 2YXFA 2A74A 3IFLL 3KZSA 3O4OC 3MLUH 1UZ0A 1GGIH 2P8LB 1UQSA 4YXLL 4YN5A 3QHZL 1IGYB 4TX8A 1MJ7L 1NFDE 3BMVA 3C5SB 4X9GA 2V2TB 5I71C 5JOFB 1MUJA 5DGRA 5A2LH 2MANA 2CLZA 2VKXA 3T3ME 4MWFA 1BAGA 4DZ8A 1B0GA 4QRTB 1SR0A 1ZVSB 3T08A 3NNGA 1EZVY 4HIHB 5EH1A 3O41B 4DXSA 1JTTA 4ONHB 5HHPB 4J6RH 1WDSA 4RYDA 5IEHB 2IALB 4GFTB 1Q6DA 1RUPH 3DYOA 2H2PC 4OFKA 1KIRB 3NCEB 2WZIA 4GI8A 3U4EA 1B0RB 2Q3AA 3MREB 3IGAA 4AH2A 4GPNA 1A7RL 1AXTH 1HHHB 5IFAH 5L8LB 4K3EL 2AXFA 2DTSA 3VPLA 4U6HB 1E3ZA 3BE1H 2BOBA 3O3AB 4JM2C 1D6EB 2XA8L 4B3KA 4A3ZA 3MGTA 5E2JA 5EU7E 4YXKL 1FG2A 2BSRB 2W65A 2BNUB 2ZKHL 5A2FA 1SJHA 2R1YB 2Y6SC 1KQYA 1VPOH 4HZ7A 5ABDE 5BRZB 3TEUA 4RAVA 4H1LA 4Y16B 3VXUD 2R2EA 4KQ3H 1J01A 5L2KA 5JXAL 2F58H 1U92A 5F8QC 2NY2B 3WH6A 3GJEA 1EJOH 4Q9BA 5BOZG 3I9GH 1A2YB 1ZT1A 1VJZA 3FL7A 4X99A 5DJCB 2DDQH 4NO0A 1NOWA 3OXSB 2AERT 2NYYC 3D3VA 4RZCB 5E00A 2CDFB 1NGPL 1DQJB 1IC4H 1XH2A 4QRRA 1F00I 4KK9D 5ALCL 4HHAB 2FD6L 3FO2A 4GG8B 4PJFF 3VTRA 2DTML 1XNTA 2VMDA 2DT1A 4Q22A 3MRJB 3MUY1 5KVEH 3L3JB 3TZVB 4EANA 3KDMB 4LPXA 5DHYB 3VIIA 4FQJL 1H3GA 2XZAL 3TC9A 3PDGA 2LAGB 2VLLA 1IGFL 5HYJA 3CVIH 1B2WH 3WFHB 4GZ9A 2APVA 4NC0B 1ZLWH 3CZJA 3VFSB 1TQBB 1MHPL 3JUGA 1O7AA 4U49A 2COQA 1R85A 2AK4A 2ZUMA 3OR6A 4WFFD 4H8UA 1D7FA 3X3GL 1QNPA 2A9NH 4DKEL 4J12A 5EA0L 1BZ9B 4IRJD 3CZLA 4ZS6D 4Y5YB 4PMVA 5KW9L 5C08A 2XHYA 1RUQL 1T0MB 1IFHL 1W0NA 2QSVA 3CHDA 5HHQB 3CZEA 2J1RA 5IVOA 5A3ID 5B8CA 2W07A 1DQQB 2YD8A 5CBEB 3RPIB 4XI5C 1EDQA 5H94B 4PRBA 1T4KB 5BO1L 4QRPB 4CL7A 5FHBH 4UAOC 1J1OH 4NCDA 3P1IA 2HWZH 4C59B 4MA1C 1LVEA 2BXZA 3PXHA 4DN4H 2ZSWA 3OPZH 3ELAT 1W9VA 1TTGA 4RA3A 3LQZB 1V0KA 4HMEA 1UJTA 1YN7B 3GMLA 5C8JB 5CIPA 3WS3B 1FZJA 5I8OL 4I8DA 4E2OA 2E6JA 1SQ2N 1OCWH 4XBEH 2NXZC 5ANMA 4JHAH 1D5MA 5E2UH 4D6FA 4LQ1A 2BVTA 1CU4L 2YBRA 4PMZA 4NGHH 3NCJH 4D6EA 5IHSA 3EDDA 1JGVH 2WV3A 1FVDB 1LILA 1NMBH 2FO4B 2ICES 3BWAB 4AM0B 3TO2A 5EN2B 4NNYA 3S7GA 3PZUA 2CNCA 2WUBH 1M6OB 1HWHB 3JVGC 5E2WL 3UAJC 3ECQA 1IM9B 4D0CA 3DXAE 2VZRA 4JN2A 5KN5A 2C1PB 4PJFA 3VGHA 5E2VL 2EDJA 3DVNA 3TT3L 5I8CA 4IOIB 3TFKD 2RV9A 1IKFH 4NN7B 2PTTB 1CT8A 4GO8A 1QFPA 2HP4A 4LSRL 1UXSB 4CAGA 2J62A 3F62A 2W63A 4IMKA 4M7KL 1JWSA 5JHDD 2FZ3B 1TZ7A 1EXUB 1OF2A 3GSXA 3IJ9A 4KUZL 1I75A 2OWXA 4Z7OE 3N15A 4OBSA 5DRXB 1PKQB 1MSPA 4JO4H 1GIGL 3HLAA 2AJXH 1VESA 2PYEE 1EHLH 3CMOL 4LQFH 1E6NA 3H9HA 1ZHLA 4WI3A 3QH3A 1JPTL 1V3IA 3SCSA 2VQ1A 3ARGD 1NH6A 4NDMB 1JZ7A 1GSMA 1INDH 3QA3B 1UR8A 4EXPX 5BS0B 1OSPL 2YD2A 3D69B 2VLMD 4LVOB 4FFWC 2EIDA 4AEFA 3QHFL 3VXME 4BFIA 1JYVA 1LO5A 1AE6L 1NOFA 2ATPB 2JK5A 4OLXL 1GCYA 5ILTL 2RGMA 4C55A 2HTKC 3VFOB 2VL4A 3RDTB 1BYBA 1G84A 3VRIA 1U95B 1L0XA 4OCSH 1Y0LB 3HAEA 3HE7A 1IAKA 3FT3A 5KSBB 4BSVA 1V02E 1E0OB 5CKAA 2O9OA 2K3TA 5TPWL 4RRPA 1VAHA 2G3MA 1OB1B 1QSEE 1XCQB 1OAQH 2OMBA 5BROA 3ALFA 2NY1B 3MV7D 5L6YH 4RE2A 2VZVA 4A2MA 1UEMA 1YEIH 2ZZUT 5CG0A 3BGAA 1X5XA 2XYLA 4XMKL 4A6YL 1AGFA 4PG9B 3TVMC 3UG5A 2OM5A 1TJIH 4F9PC 1XR9B 5MHSD 3ZIZA 1L6ZA 4QOKE 1W1VA 1CGYA 1CFTA 1BHGA 5HPMA 4WTZG 1SBBA 4LLUA 3S5LA 3MA9L 3WJJA 4DXTA 1JGUL 4G8EA 2WHLA 5IJVA 4FFYL 4PBVC 3SO3C 4EIGB 1I1RA 5C7XH 4YHML 2E9IA 3M7SA 4FQ1H 4YK4B 2BNRD 1NPUA 1ZXQA 4KI5C 3REWB 3TH2T 4U1MB 3SDDA 2XWJB 3I2CH 3LEXB 4MJ6B 4GI6A 1IT9H 5F9WC 2WMIB 1I3GL 4I18A 2ZNWA 4JDVA 4XMPH 4WIQA 1S5IL 3SJVA 3OAYH 1E5NA 1C5BL 2NNAA 4UB0H 3U0WL 2Y64A 1G7JB 1HYRC 4NIKB 1SYVA 3WNMA 1W3LA 3S9DB 1UYWH 4WUKL 4XWGH 1N6VA 3IKCB 2ZUUA 4P57B 3MRGA 3V4UH 5IMOA 5F96L 3VI4E 5CEXA 1G7MB 4GWJA 3SUVA 5GGSY 3M8OL 5F3BA 3LKQA 3NN8A 3KR3H 5IQ7L 3R0NA 4NNPH 1TUXA 1D5XA 3ALPA 4K8RD 5E1HB 3SCRA 1K8DB 1T1ZB 4M43H 1GONA 5E4EB 1RZJL 3QXDA 4FS0A 2LS6A 1WV7T 4OCRL 4HOZA 2ZUWA 5HYFA 4YO0B 4LSPH 1I8MB 5DD1L 2FL5B 4JRYE 1F5WA 1DWFM 1TVGA 4Z77A 5IK3A 3FT4B 3TV3L 4UAPA 5DZOA 5I30H 2OJZL 4H7VA 4KI5M 4M9OA 4YIQA 4Z7WE 3WIFA 3RWDA 3U0TB 3PGFL 1UXWB 2QMJA 4WTZA 2P24A 3DJ9A 5KVMC 4L8SC 4RCAA 4ZQKB 1PMHX 1GOKA 2MKLC 3M6DA 1KLUB 3AB0B 3WIJA 3GI8H 1IQWH 4K7FA 1GGCH 3P4OB 4KRNA 4XPHH 4OTXH 3BP7A 3WN5A 4XVSH 1MFEL 1FAIL 1P5UA 4JFXB 2W66A 4M1GH 2J22A 3MSDA 3D85A 2O26U 4HIJA 4BDVB 4L8CA 1Z9LA 3T1WA 4YWGH 2I25N 5J12C 5CINH 1FH5H 4YNYA 1C8YA 1BVLB 5K9QI 2MCG1 5FYJH 4QHMB 3OMZA 5KSAA 3GBNL 4XNYH 1WB0A 1GGUA 4KK9C 5L8KB 2XVNA 1JF1B 4XCCH 5EZLA 4R7NB 2N56A 5BZWB 3BP6A 5D5ME 2RJ2A 1Q0XL 3OKNA 3WUWG 4Y4HD 1A3LH 3DGCR 2KDGA 4NQED 3GSNB 3TNNB 4GW5A 1KIPA 2X9XA 3O2VH 4NF7A 4LLQA 3ACFA 1VB9A 4OZIF 1LHZA 1RUMH 2BX5A 5DEFA 3S3SA 3WEOA 1G9HA 4CKQA 5JMOA 7FABL 4PMXA 2DRUA 3AFLA 5TFSH 2F5BL 2Q8AH 3C5ZB 2WO3A 1X5KA 4ZTPL 3CU7A 1HQ4B 2ADJB 3OKYA 5DN2A 2O9RA 4WSJA 1I7UB 1BQLL 2J1VA 2XZCL 1K2DB 3GO1H 4ZYKA 5FF6B 3SE8H 3VFGL 2Y25A 2VTFA 5ESQA 5J06A 3PWPE 4ZO7A 3UPAA 4IRJC 4X7TB 5ICYA 1CLZL 4ZS6C 2ZX7A 4M6ML 4UTFA 1RU9L 2HJLB 2MCPH 5E6ZA 3B8YA 2VXSH 3TPUA 5IEKA 3HB3D 1WTGT 1BFVH 5E6IA 3QT2A 4JFQA 4E42B 5A3IC 1Q6EA 4CD6A 1EMTH 1W91A 3PABA 4EOWL 3SPVA 3S96B 4CD5A 4EQ2A 5A2IH 2Y06H 1QACA 2CXKA 1JPSH 3TYGH 1LF1A 4KVCH 4URIA 5CJBA 5KTEH 2I27N 4JZNA 4AG4L 1YNLH 2V38A 2B0SL 4KVNH 1JFQH 1QKZL 2XXMB 5FYLL 4KHXL 4Y2DB 2Z92A 1MREL 4B9ZA 3MV9E 3WUWA 3AM8C 3TWCH 3HPLA 1QEWB 4HXBL 1C7TA 1OTSD 4PTVA 1AI1H 4MZ2A 1F3RB 4LHUG 2XWDA 5D7LA 1W0WA 5EFIA 3VXNA 1P8JA 4K94C 5IESL 1CK0H 4LMQI 1U3ZA 3P73A 4FI9A 1BIIA 2XV6B 4NUGL 1GUVA 1JGDB 1VFOA 3N50A 5D93B 4L8DA 2W3JA 1FL3B 1FDLL 3H9SE 2VH5L 3QIBD 4YHIB 1FH9A 4NZRL 2E33A 4KK5D 4TSCH 2V3EA 3KPTA 4ZODA 4PD4J 1V6UA 4OMCA 2ZXAA 3UJIH 1BFOB 4Y19A 1INEL 3BAYA 2QPSA 2D7NA 3L5WA 4OM0H 1FBIL 2E32A 1LDSA 1DEEB 1QHZA 3TFKC 1T2QH 1KXHA 5TE7L 3VFTA 1NP0A 5ISZD 1RD6A 3LS5H 2DAVA 5MP6H 1E9LA 1MJ8L 1UZ4A 1KJMA 1GU3A 5KBNC 3MTRA 4P2QA 2VM9A 1AO7E 3Q5OA 5L2JA 1XH1A 3DETD 4U5KA 4YHEA 4PGBA 4OZIA 1EGZA 4BH8B 3QGVA 1UKTA 2DSUA 2YA2A 2AABH 3PL6D 1PX3A 4H5SB 1DVFB 4KI5E 1N6QL 3DURA 4UTBL 4C56B 1HILB 4CVUA 4NZTL 1UJ3C 5I8KH 1BZQK 2CIKB 1H5VA 3OB0H 4GUPA 1KFWA 3PZMA 4PUBH 2XKUA 1MAML 4WW2B 3ARGC 3ULVL 5F7LB 4HA4A 3CUFA 1ZA6A 4W87A 4D6JA 5I5RA 4DKFL 3GMQB 3BKMH 3EDJA 2F53A 2E26A 4MA7L 3E2HB 2DMKA 3O9WB 4QXWA 4ZSOB 3CUPB 5EBMA 4OUUB 5D71H 3AZRA 1ISXA 4HIXL 3GBLA 3WIHL 4JX0A 2OR7A 4H26B 4L4TB 2WUHA 4PGEA 4RQQA 2I60H 4QRQB 5DD6A 1MF2L 4Z18A 5I17B 4BQ3A 3GH5A 1IAIL 3GSVB 4S3JA 4DM1A 2XFRA 5BOPA 3TBSA 5J13C 3MCLL 2L4OA 2AEIT 4Z0BH 4ZUWB 3UO1L 3VDAA 3OLEA 3CSYA 1WO2A 5CBAB 4K71C 4L4OA 3VXOB 5GXBB 1L0QA 4WHTB 1ZLUH 1CD8A 2FGZA 4ZFFB 4RGOL 3BSHA 5HHMB 2V17L 1IGIH 1TENA 3OLGA 1F58H 1K9FA 2BP3A 4W6XB 3QUYB 2DD8L 5T33H 2NY3D 4F57L 4C7DA 3UJJH 1G7PA 4YQXH 5GSVA 3V5HB 3VCLA 3UMTA 3QCTH 1D9KD 1RURL 2BNQA 3CFBA 4S2SB 2Y7QA 2EPNA 1SDDB 3NRUA 3L1OL 4JO3L 1L9MA 4JZJC 3J8F7 2IEPA 4M7LL 5HGBB 3V0WH 5EORH 1W9PA 1O6IA 3VXUE 2B1HL 3ALGA 2ESVB 4CMHB 1FNSL 4ELMA 4OZHE 5D2NA 2LTQB 1WEJL 1QI3A 4NZJA 1UD3A 4LSUL 4IRSA 2WHJA 2YD9A 2ED9A 3K81A 5F1SA 5AAMA 2OP4L 3QR2A 3T2NH 4K8RC 3N1MC 1PY4A 2FCBA 4LIQL 1YY8B 2DLFH 4M8QA 4UIMA 1LEGB 2O5XL 4Q2ZB 2GW5A 2YKLH 5FECB 1Q9LA 5JPNA 2YPKB 3FB8A 5IB4B 4R8WL 2R4RH 2QHRL 5LYRA 2CYGA 5TE4H 4JJ5B 1CLCA 3BKYH 3LKSB 3KL0A 1J88A 3MXWL 3BEWB 4OLWL 3C6LA 2VR9A 1ZWIA 4MNHB 3UNPA 5C70A 1I7ZB 2V72A 3WH8A 3BEVA 5GGVH 3P77B 2EXYD 5H8DA 2GYSA 1OP5K 2Q8BL 1HHJB 1HNFA 2QBXA 5ICXB 4QT5B 4JDTL 1G94A 3EYQD 4OM1H 4XNXH 3NFPB 4NKMB 1UA3A 1U8JB 4V1DD 3AIEA 4LCCB 3ARUA 4U1HB 1N7ML 2HRPL 1MRDH 3SKJE 4R4ND 2Y5TB 2R0ZH 3AZTA 4HUWA 1R5VA 3QDGD 1TZHA 3IAGC 2ZEZA 3DI3B 4WFFE 4HF5L 3HC0B 4NHCL 3UC0H 3ARFA 5CPSA 4WO4A 3DVIA 3DYMA 3P2TA 3PIQA 4DGYL 1XF5B 2DWDB 3VXRD 4P2RD 4OLVL 5D7SL 1ZEAH 3S37L 1FIEA 1F4AA 1MHCB 1LG2A 4PN2A 3QIUA 3KYKL 3NSXA 4B16A 2BMKB 2HH0H 5I66A 1AQHA 1DUZA 4JY6A 4U1NB 4I3GA 5CCKH 2K1MA 4LCWA 2PXYA 3P0YH 2WZHA 2DQUL 3K46A 3WNKA 5EOCJ 3QNXA 1H1NA 2DIAA 4GBXB 2F19H 3IB4A 5DDHB 5DMIL 1TCRB 1X5GA 5DRZA 4FQPA 4M7ZB 1Z0MA 3CBWA 3NA9L 3FN0H 2BXYA 2WN2A 1TJHH 1J11A 5F6IB 1FGNL 3VG9B 2QR0B 3ZSSA 4OFVA 3F5WA 1Q0YL 3CPUA 1KXQE 2BJML 2NW3B 4M6OL 4X5WB 3SDXE 4BZ2H 3HC4H 3WQ6A 2DS4A 4ZFOB 4KZEL 2YJQA 4Y4HC 3M17A 1QO3B 5IHUH 3MLSH 2WIIB 4MHHG 1QBLL 1T83A 1Y7VA 4OCWH 5DWUL 5D4QA 3BVNB 3MLRL 5CGMA 2R39A 1QSFD 1V3KA 3I6GB 4FQCL 4U2ZA 5DVNA 4AEIH 3RA7L 5EUOE 3QDMB 2W4XA 4AY0A 4ZAKD 1F11B 3T4AA 5FV2A 4X80L 5DSCA 3V5DA 3RJQB 1YDPA 4MDIA 3LKNB 1CVSC 1G9NH 2LFGA 4R4BB 2VLKB 3X13A 4Y2OA 1EH9A 3OAZK 4KMQA 4LCIH 2VR4A 4EI5A 4HQQL 3A4AA 2F74A 4HCRL 3IAPA 5JHDE 4I4WB 4EVNB 2QQNL 4LSDA 4JVWA 5GRVK 1F4HA 3HB3C 4OF0A 1H3VA 5ECJE 1LJYA 5IVZA 5C6PB 3THCA 4ZO6A 3UROR 2V5DA 1D6VL 2KPNA 3W39B 4JFFB 4IRZH 5GGTH 2J8OA 5T1KA 5C0EA 2PWFA 3Q1SL 4OQTA 4OAWB 1NQ6A 4RGMC 1ZSDA 5E0QA 5IV2B 3RZCA 4G8GB 1RK1A 4PTTB 4KDTC 3KPMA 1DBML 3BDYL 5F7DB 1XGPA 1P7KA 2ZG2A 3ETBF 3IDIB 4MNQB 3ZDYF 4XP1L 1OTSC 3TT1H 3UX9B 2VLME 1R3JB 5C0DB 4Z7NE 5A2KH 2WWKO 4X6FA 3B9DA 4X6DA 5ITBL 1TVPA 1S9WA 4J3UA 3MMUA 2O5YL 3IS0X 4APQA 4OJFH 2FDBP 1GQLA 4LAQH 1II4E 1FZMB 1A6TA 1XPWA 2XJ7A 1XSIA 1FHGA 3OAYK 3QIBC 1KSRA 4KK5C 3RTQB 1OT5A 2QTEA 2VI0A 1AXSA 1GVYA 2IH3B 2YN3A 5B21A 5HHOB 4JLRB 3MV7E 2DI9A 1PDKA 1S5HA 1VERA 3OJDB 2X42A 1N26A 1MI5B 1ETZA 1UA6H 2CDEB 1DWAM 4K7PY 5JOEA 1HP4A 3CJJA 1KCUH 3HNVL 4TUJB 2J5LC 4TOQA 2F61A 5MHSE 4FFZH 5J4MA 2WMGA 4ATDA 1FAKT 3TN0A 4O4YL 4XP6L 3VG0H 1GGTA 3DETC 1LK2A 4KPHH 2WINA 3U9UA 1S7SA 3PZIA 2VXTH 1WZAA 5FO9A 4G43A 5BMFL 1CIDA 2BNRE 2EDLA 3PL6C 4Z78A 3D5HA 3HZVA 1NEZG 4OLEA 1HJSA 3ULUH 4Q9RH 2EDDA 1MLCA 1P2CB 5EZJA 3SY0A 3HMWH 1QVBA 3REVB 3ZYIA 5HHVH 4O02L 4OLUL 2Z8RA 1GUIA 43CAB 4PRHB 1J8HB 3QISA 5TH2B 1HVQA 3RVXD 2RB8A 5JXGA 4C54A 1RHHA 3ZQ9A 5F88A 3I75B 1A6WH 3AXIA 3A67L 3D2UA 4P9MH 2CJUL 5DZNA 4NKIL 3IDJB 3RUGA 3OJVC 5LKNA 4P4KA 2VAAB 2Z93B 1OLLA 2OXGA 1JGLL 4YJZL 1QYGH 2YRPA 1RJLA 4JKKA 1ZGLA 1S78D 3RWIA 1BBJA 4MA3A 3KG5A 3QI9B 4X6BB 1RI8A 2A0LD 4JFPB 3SKMA 4EN3B 3OF6D 3FO1A 3C8KA 4FQ2L 1AGEA 1Y6MR 2H32B 5IFJA 2X44D 4HBCL 3SCWA 3GB7A 3OGCA 1CLVA 4HV8A 2UUDH 5CP3H 1BG9A 1JUFA 3NGBB 1BREA 1KELL 5C0GA 4LPYA 5K9OB 5LWYL 4PMNA 4G7VL 2NY3C 4WUUA 1E6XM 1XGZA 3MBXH 1IGML 2PWDA 1D9KC 1H3PH 2J79A 4DAGL 4PB9L 1BX2A 1UQSB 3MANA 3DUSA 4Y16D 5E70A 2VRQA 1NCDH 3LS4L 4M4PA 3DVFA 3O2DL 2ORXA 3SGDH 4BSJA 4YHYB 3DHPA 2XG4A 4CVZA 2A3HA 2OZ4H 5I19L 1NCAH 4K7PL 2CLZB 1UT9A 3IS1X 5AUMA 3MJ6A 4AZ5A 3IDYC 3NIYA 1A4JB 3KLDA 2E7BA 5D6CB 1YEHL 5K93A 1CR9L 4MD0B 5D6DC 2A83A 2DWEA 4IPLA 3OZ9H 4PMYA 4JG1L 5C0AB 5JR1H 1ADQH 1UWXK 3QWOB 4JO1H 2DQIL 4M1RA 2MPAH 3LKRA 4L4VB 1WZKA 4LSQH 4OCLC 5A16B 3T8XA 4LGRB 4B7IA 3IGAB 5A6JA 3KPRA 1J10A 4DK6A 1IEAA 1XCTB 3JWOL 4NQEE 4XGZB 2AXFB 3D39A 2EXYC 3STZA 3SUTA 2BOBB 3VE0A 3WH7A 3EYQC 2ZOKA 3GBEA 5CZXD 3QQ3B 4KQ4H 3HFML 4ETQB 5SWQA 3QEHB 4HUVB 1FG2B 3SDCA 3BP4A 1AQMA 4R4NC 1SJHB 1DQMH 3EIFA 2P7TB 5ABFB 3MFGB 1V7NH 3AHVA 4MNGE 1YNKL 4S1RH 4GKSB 4XPGH 4MZ3A 4H1LB 1FFPA 1PZ5A 1CLXA 4WU5B 3VIKA 5DUBA 1RIUL 1AGDB 1KJ3L 1MCJA 2YN5A 3ARDA 4YHLH 4CCCA 3BXWA 5IYYA 3MLWL 4KKBD 1U92B 3U6RB 1PG7X 4OYUA 4XX1G 1W1PA 1NGXA 4YZFE 4YDKH 1A6ZA 2CRMA 3D85D 3SE4A 1MVFA 1DBJH 1QFHA 3PP4L 3JUYA 3UTSB 3NAAL 3V0VA 2Y36H 5DC4B 1XF3A 4D9QD 3VU2A 3JXSA 2BY0A 3F6IA 1RZ7L 3AIRA 4U7MA 2ICWB 1YC8A 4MAVA 1QR1A 3C5JA 3VXSB 1JHKL 1I7TB 5CSYA 3WQVA 3WUBA 5IT2L 3RHWK 5JW4M 3RVVD 4PS4H 1GHFL 5EIVA 5HGAB 1VEMA 4MAYA 2VLLB 4N8CL 3CDFA 4G3YH 1EFXA 5DJDB 5HYJB 4OZ4A 5E8EB 3V4VH 4YDLB 3DHMA 3VXPB 2DSZA 1IM9D 4ZAKC 2I07B 3MRKA 2G2RB 2X7LA 4KTDL 1CBGA 5EOQH 4N0FB 1CFQB 1B0WA 4WWKB 1Z6JT 2ZUVA 3IVKB 1WKYA 1HSBB 2AK4B 3II1A 1PYWA 5GRYA 5KOMC 4DGIL 3CX5J 5ISZE 3WXWL 2I26N 1R5WA 1Z5LA 1R7AA 4UOQA 5DJ0A 2VC9A 2DM3A 3LSOA 4N8PA 1VGEL 2DT3A 3MU7A 4F7TB 1FH7A 5GGSB 1A6AB 4LFHG 5EZIH 1EEZB 3O8XD 4IUGA 1B3JA 3DWTA 3D3AA 1HCFX 2F54B 4GXUN 2ZOXA 4E4PA 2IF7A 1G7QB 4LNVA 3UYRL 1XGUA 4OGYH 5BS0D 2NY5L 4IIQA 4DGVH 3SUSA 3ILPA 1KBGH 5CIPB 5K33A 4UDUB 2BOCA 3ZL4L 4ERSL 3ME0A 3WKZA 1QHPA 1SY6A 4WFHD 5FM4A 3NZHL 5CPQA 4PRPB 3KJ6H 1PSKL 5ANMB 1D5MB 5DLML 5L88L 3UTZA 2DQTL 4D6GA 5F1KC 2XGBA 2FJGA 1G9NC 5D7LD 3PDDA 3FRUB 4NNYB 5E99H 3U5UA 4H8WH 4HS6A 3GKWL 4UNUA 4H88H 4XCFL 4ZOCA 4Q9QH 4MHHI 3P4MA 2NY1D 1EJ6A 1M71B 5KN5B 4DWSA 4CGTA 4PJFB 4DVBA 3DVNB 4I13B 1UWEL 2UZIL 4XV0A 1XGTA 1UX7A 1MCOH 5CUSL 5EC1A 1N4XH 1WIOA 3RL1B 2ATKA 3PQYD 4ZFGH 3RQ3A 3QO0A 2DQDL 4JPWH 1NWUA 4KK8D 3BUYB 3VIFA 4MD5A 3ZKQD 5EB9A 2B5IB 2CGRH 4GAFB 4HUUB 5MEPA 1CZ1A 5SX5H 1AD9B 5ABGA 5I1CH 2FBJH 3HU7A 3GNMH 4A6YA 3BPNB 3H9HB 1U8OB 4OKDA 1ZHLB 2BRQA 4QTIH 4I3RH 5FEBA 1KEGL 3Q6FB 2DBLL 3Q3GA 1KENL 1EEUA 1DN2A 3E0GA 3N1AA 2ARJQ 3VUPA 5EOCL 1UACL 5JIKA 1T03L 1UENA 4LRNH 4RFNB 4LHUD 1DSFH 2H8PA 2H3NA 1EGJH 4XNMA 3RVXC 4N5UA 2R56H 4TSAH 3R8BB 4KDVA 4GQ9H 2ORBL 1PBGA 1IC5H 3SDAA 1TZGL 3HE7B 4ZY9A 5EU3A 3ROLA 3FT3B 3ZSTA 4BSVB 1S7QB 1BQUA 1E71M 3PHQA 2XN9B 4HP5A 5I1JH 4CJ1A 2R0KH 5T1DL 1HDMA 4KRPB 3IRZA 4EUPB 5D1XA 1KR1A 3CHFA 2JJTC 3QULA 4GG6A 3W29A 4N68A 4QHNB 3IF1B 1Z9MA 1S78C 3QIWD 4WV1B 4HOWA 1A3QA 1AGFB 2A0LC 2IPKB 5CYYA 1OQOA 1CFTB 4K3JL 2J1AA 3S5LB 2AEWA 4V1DE 4BF7A 4G8EB 3KPOB 3MLVH 3AICA 2HRLA 5GGQH 3GSNH 4D8PA 5IJVB 4GJTB 4LSSL 3SGEH 1VADB 2HYXA 1EEYA 3WSOA 3MRPB 2D0HA 2ICEA 2NZ9D 3GSQB 3QDGE 4JDVB 1H8NA 3LEGA 4Y16C 1RUAL 2QSCH 1H15B 3VXRE 4P2RE 3HUJE 2G60H 3FN9A 2G3JA 1YY9D 5C9JA 1SYVB 2EECA 4PRDA 1GOIA 4W8BA 2C0HA 4I48B 3MRGB 4M1DH 4YE4H 5CEXB 3NH7H 3AS2A 4ODHL 1C1EH 3LKQB 3NN8B 5F3BB 5J9PA 2VLRB 4AIUA 4P5TA 3H0TA 1KB5B 2FBOJ 4FLRA 3RL2A 1YC7A 3QUKA 2C3XA 2HVMA 1ITCA 4XPAL 2NW2A 1MAJA 3FFDA 5FGCB 1PEWA 4WK9A 5DS8A 4L4JA 1B1YA 2XXCB 2PR4H 5BXTA 3QXAA 1UZ8B 4BKLA 4JKPL 3MCG1 1YECH 1DBKH 4KKLD 3VFRA 2E31A 2D1ZA 2BVOA 5I1EH 3OSKA 3UP1A 3H6JA 1LO2H 2GJZB 1A14L 1DFBL 1QSFE 2CIIA 2P24B 3C7HA 4LGXA 1U8IA 2VR5A 2GJPA 3BQUD 1G1CA 3C5ZD 5CZXC 1NGQL 1NGWA 5JPMA 2GTZB 1M05A 3NVQA 2UY2A 4JM4L 1DE4B 1EUUA 3RJDA 2EEAA 5GJTH 4F7EA 1DBBL 3QDJA 3SE3A 4S11A 1P4BL 3BT2L 2FIKA 1HKIA 1UWQA 1S7VB 3HN3A 3K3QA 1E1EA 2ZCKH 3O2WL 3HG1B 4KKBC 1S9YA 3EJZD 4Y5XA 4W8JA 1GL4B 3THML 3OG4B 5IMMA 1VKXB 5F7FA 2Z8WC 1FV1B 5I0ZA 3MNWA 4Y2DD 5KS9F 1KN4L 2PN5A 4NWTH 2QL1A 1NDGA 1I3VA 4JFHD 5EZLB 5E1AA 1MEXH 3GYCA 3R8QA 3BP6B 4LMQE 3G5VA 3MC0A 5L9DL 4JGJA 1LEKB 2EIBA 4KMLB 3S35H 3GTNA 1W3JA 3RVVC 4JPKH 4LPCA