2X05A

Inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine- configured castanospermine and an amino-australine analogue
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
851
structure length
851
Chain Sequence
AGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inhibition of the Exo-Beta-D-Glucosaminidase Csxa by a Glucosamine-Configured Castanospermine and an Amino-Australine Analogue.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 275
structure length 851
sequence length 851
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2x05A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x05A03
1ODUA 1LP9B 4TUKH 3FONB 4K9EC 3QI9A 1NLBH 2ZEWA 3MBEC 3ILPB 4L9DA 3QXWA 1EOKA 4N42A 1UQSB 1FAIL 1S7SA 3VXQA 4I48B 3CVIL 1ZS8A 5CP3A 4FMVA 2NY4C 1DFBL 4JY6A 1HL8A 1LEGB 2F8QA 2AJ3B 5FO9A 4W89A 1UH2A 1W3LA 4X80H 5F3BA 5BRZB 3TIEA 2CBVA 4TUJB 4FQ2H 4M93C 1EXUA 2OZ4L 3MLTB 4JDZA 4MJ5B 4PJ8A 4U6HB 3WXWL 3PTKA 1AGFB 1MUJB 1KIRB 1Q9LA 3CSYA 3BN6A 3UPRB 3L4TA 1QSEA 5ACZB 5IKCB 4JFDB 2FATH 5I17A 3OKMA 1KXTA 3VCLB 4RN5A 3QUKB 4XGZB 5IMMB 1HKLL 1ZE3C 2NW2B 5H8DA 5KTEH 5K59F 3WMBA 2Q76A 3CH8A 3QUMA 1M53A 4NNPH 1UYYA 1HIMH 3RA7H 1CVSC 5HYQB 4HEME 3IDUA 2G41A 5DRZB 4LVHB 1G9HA 1GHFL 2A6DB 1JNHB 1HQ4A 3O6FB 4PP2B 4PRAB 4B53A 1OAUL 1OD9A 1FL5B 3OB8A 1HSBB 1J0YA 1I3RA 3BP6B 3C6SB 4JRYE 5FGRA 4Y4FA 2HJLB 1CL7H 5IXEA 5FKPA 1YN6A 1IC7H 4LVOC 4LPUA 1PG7W 3BGAA 4XPTH 3VU2A 3ARPA 4XCNA 1YNLH 4MDOA 4QHNA 4H1LA 2VABB 2BVPB 1FC2D 1TCRB 5CLTA 3L7FB 4Z2KA 2OSXA 4JE4B 4NQVA 1T5XB 3V8CA 2ID4A 3SKUD 3NABH 1IFHL 4LVOB 5T33H 4MAZA 1D7FA 1QZ1A 5A40E 5I1AA 4NQDA 5IFAL 4X9HA 5MENA 3GBLA 5C0AD 1BZ9B 2I25N 1XCWA 5CD3A 2YIHA 2B5IB 5IR1A 3IANA 1ETZB 2VLJE 3HPLB 5KSAA 2CR3A 4AENA 4D6DA 1SVZA 3UG4A 3OR7B 5EWIL 1TIUA 3GSXA 3CVHH 1KB5H 2Y6JA 3L6FA 4RISL 3K7UA 1DQJA 5EIIB 2LFGA 3FW6A 4ENEC 2P8MA 2CBJA 3WS6A 1R3JA 4CW1B 3TFKC 4YHYC 3O3AB 3BAEH 1ZGLB 2X4OB 4P3DA 5SX4I 5I1KL 3GBML 4EUPH 1JWSB 1T21A 1U91A 4TPRH 3BCDA 3AZRA 2XTJC 3IJ9A 3HMXH 4JX0A 4PB0L 2OP4H 2EC8A 4CCEA 1LNUA 3MV7D 3SPVB 3W27A 4WJ5A 1F4AA 3ARGB 5D9PA 1BQSA 1XGTA 5LGHH 3KXFB 4JFEA 4BQ9A 1CZ8L 2NY3C 2HP4A 1FJ1B 4K68A 2V2TA 5DUPL 2AJSH 4KDWA 4Q97A 1U8PA 1CDBA 2HFEB 2XY1A 3F7VA 3WXVL 4XCCH 5E0CA 3KYOB 5GGTA 3RM8A 1D9KD 4JFFE 3JSSA 4AZ5A 4ZFGH 3QULB 2CK2A 1IT9L 4W70A 4YHOL 5F9OL 3GEWB 4LAJH 4UQ2B 3MNVB 4YR6B 4ZFOL 4P2CG 3WNPA 3QDGA 1ZVYA 3PL6D 2A3HA 1QSFD 2VLLB 3IKCA 2A6KB 5JOPE 1RHHA 4QDRA 1K9FA 4P8UA 5DZOA 4EI5B 4BZ2H 1H0IA 5C09B 3H9SB 3KHOA 2J7BA 2HVJB 3K2MC 3NZHH 1YEDB 1NUGA 5ITFB 5IHZB 3T0DA 2J8GA 4LCWA 2A9MH 3QUYD 1UR2A 1UKOA 4C83A 2GJ6B 2ADFL 4HU0A 1NUDA 3LEGA 1X5FA 1P4IH 4UZUA 3LQMA 5MP6H 4XVSL 4UNUA 4PFEA 3TNMA 1FN4B 1JGEB 3TTQA 4XX1G 3D25A 3GJEA 5DD5L 3CVIH 3PZIA 2A9NH 4RNRA 4J1UB 3SKMA 1DFBH 4F7PA 4RYDA 1MFAL 1INDL 2WWKO 2X70B 1V3JA 1HEZA 2HRPH 3O6KH 1ZMYA 4LLAA 4P5TC 4RAVA 2D1ZA 1P9MA 2ARWA 5K33A 4F33A 5FM5O 4XXDA 4ACZB 4HPGA 1WAWA 4X6DB 1V7NH 2NT0A 4JO1L 4HZ6A 5J0BA 1I75A 1AHWA 4W4OA 4Y5XC 4GFTB 3EO0A 2AXGA 2OXGA 1TETL 4WTXA 1Y0LB 2BNRA 2BFVH 2PTTA 4U0QB 3SDDD 4HW6A 1QLRB 2IXVA 3BPOC 4FLSA 4CKVX 1H5BC 3IDXH 2PYEE 4GW4A 5DA4A 2WMFA 2Y5TB 3VI3F 4BA0A 2VDMH 4LARH 3OLDA 4EUPB 5ID0A 4H0IA 5EFDA 3L3DB 1AHWC 1DQLH 4W4OC 4M61B 1FH5H 4JO2H 4LEOA 3RNQA 1SHWB 2DQIH 3PWJB 3NA9H 2J8UE 2X42A 2BK8A 1E4NA 1J84A 4H8VA 1IC7L 1A6AA 3NFSL 2XG4A 2FEEI 3HG1D 5I75B 3WH7A 4PJHF 3VXSA 3OB0K 5CEZH 4OD3H 2M2DA 3ZR6A 3HRZA 1G7LA 3CDGB 4WI2A 3FQNA 1HH9B 3GSOB 4HLZH 5F7YC 1BECA 1YEGL 2DYPD 2CYGA 1HJVA 4HUNB 3QEHA 2ADIA 4O00A 2OJZL 4PMQA 1KXQE 4O02L 4YBQC 4KKCD 3N1GC 3TBTA 5DI8A 1UJ3A 1WIPA 1GRWA 2J74A 1GZQB 3AHXA 4KJWD 2J1TA 5AWNL 3CH1A 3CPUA 3CXHK 4OGAD 3KPQA 1YPZA 2BNQB 3GSWB 3DIFA 2C26A 2DDQL 3DPBA 4G8FA 4XRCB 2VCCA 4OI9A 1C5CL 2YL8A 4JRWA 4UINH 1A2YA 2WO3A 2VT0A 1G6RA 2ZUQC 5SV3A 5DJXA 1KEGH 1OGAD 2HT4D 2GTWA 4LX4A 4PIRF 3AHVA 5JIHA 3BAEL 1NEZA 4NIKB 1UH3A 4QRRA 2FH8A 1U8OA 5DVLA 4A6YA 3HC0B 4HSQA 5I1KH 2PXYC 1KF9B 3VG9B 3EO1B 2DD8L 1DDHA 3M45A 4X7CC 2DDXA 1ISWA 1ISYA 1ES0A 1HJXA 2EIBA 4BH7A 3DURB 3KJ6H 4FQQA 4NN7B 2DQFB 2BCKB 2ED8A 4B15A 2KDGA 2OR7A 5DTFA 5F6HJ 3T4YA 3WFDH 5FB8A 4K7FA 5H2BA 3C6LA 1YECH 2IH1A 2CXKA 1M7IB 1T66D 1VFOA 3MV7A 2R4SH 4P5MB 2N7AA 1JZ3A 4OUEA 5HDRA 1T7VA 2ARJB 4QX0A 5F1NA 1T2XA 4OCXL 1OF2A 1D6EA 3NFPB 3LVEA 1NFKA 4JHAL 5MERB 5I1GL 4Q6IB 4FFVD 4MQ7A 3ES6B 4GG6B 3IYLW 2PYEB 3QHOA 5L0QC 2X4RA 2DIJA 1C5BH 4X6FB 3K2UL 5EC2A 2R2EA 3VWJD 3UTTE 3BH4A 5D7LB 4PCSA 3C6LC 5FA4A 1ZT1A 4XPGL 2ATPB 1XCQB 2JB5L 3BP4A 4K7PY 1WIUA 4JAMB 3MLSL 5CJ8A 1W72B 3BW9B 1TQBB 1T3FA 2RV9A 1NDGA 4PJ9C 3RGVC 1L6XA 1SYSA 3HNTL 3KNBB 4PJGE 3KYKL 3R1GL 4QXGL 1PZ5A 1QVOB 3HAEA 4I2XE 3RGHA 4QXTB 4ALAH 3WDRA 4PBVC 5DJ2B 3AMDA 2EKSB 5CSUA 1FFOB 1CZVA 5HDLA 5EFFA 3AB0C 3WQVA 2WIMA 3ARFC 3WH6A 1WWAX 4MGQA 3F7PC 2NY6B 1ODAA 5DD5H 5INCA 2A9NL 2XFFA 5FK9B 2V9RA 2CMRH 4IIQC 5HYJE 5JLZA 3B3IA 1AQ0A 4OUUB 5F7KC 5GGSA 4PV9B 1J86A 2J1KA 3EYVA 2ZSVA 5HHNB 3DETC 1AP2A 2XOMA 2DSKA 1KULA 2WMHA 3IDNB 1RD6A 5D1ZD 4JO1H 3QO1B 4J3OC 4NO2B 3RWEB 2VM9A 1FO0H 3T1WA 1EZVY 5C07B 5D1XC 3V6FB 2E27H 5D2LB 2A83B 4M4RA 5A2FA 2UUDK 2X4UB 2W4XA 1HHIA 5HHMB 2GUYA 5FHAH 3ZE0F 4ZNCD 4C56B 4U1LB 1ZHNB 5EOQH 1GW1A 4N0UB 1YEFL 3MRPA 3KYAA 5F89A 1DQLL 4E41B 3BSGA 1FLRL 5JNYA 3FQXA 5KVGH 5D96C 1INQB 1TLKA 3C5JB 4PRBB 4L3ED 3LDBC 3QJHB 1AI1H 3OKEA 5DN2A 1NFIB 5L2KE 4OD3L 2W66A 1X4YA 1E9LA 5JHLH 3M17A 4HGWA 4POUB 4ZTPH 4ODUA 3AFLA 5INDA 3RX5A 5E6IC 3U1SH 2ZX8A 3WIFB 1RZJH 1TPXB 3GGWB 4E8CA 5HGHB 5KSUB 4KROB 1JPST 5J1SC 5FCSH 1EJOL 4Y7MA 5ENWB 2W47A 4QCFA 3VE0B 5K9OB 1F3DH 1F2XK 4ACPA 3VXUB 4GT7A 4Z7VF 4RBPH 5F9JA 2NY7L 4ZO7A 1QQDA 2EZ0C 2C7FA 3QFDA 2F5AL 4HEPG 2DDQH 2BHYA 5EBMA 2XNAB 4ATDA 4NQDE 2AABL 5D8JL 4IOIB 4P2QE 5E7FA 4ZUWB 5GRWA 1J05A 1CFTB 4AY0A 2YUVA 3C8KA 2WABA 3U0WH 2IH3A 4PLKC 3N1MC 1P6FA 2UY3A 1NCUA 4WFGD 3WDIA 3H9ZA 3K77A 3VXUD 1KCSL 2VMFA 3LEVL 5SWZE 1XHGA 1JD7A 3DYOA 1VKXA 1A6VL 4Z7QF 1VADB 5FYJD 1OARL 2EO1A 2FJFA 2MNUA 5T3XE 4EK7A 5GGVH 4FQPA 4X9BA 2ORXA 2CUMA 5GGQH 1MIEL 5GJTL 1N7ML 2WLZA 3RPIB 1ZHLA 3LIZH 1U8QB 3WLWD 3WFDL 3PP4L 2NXZC 3LS5H 3OSKA 2DL9A 4Y2DC 1FYTB 5M3WA 3OWEA 3S34L 3R8QA 2DIBA 4WY7H 4UQ9A 5EBWB 2EYTB 4G43B 2AJXL 1G7QB 1FGNH 2GJXB 4HG4J 1F4WH 4L3EB 2YXFA 4HS3A 4KY1L 3AXXA 2X10A 1CDGA 3S7GA 4N0CC 1IGYB 1JWMA 1OM3L 3AYRA 3MOQA 3IXAA 1NAEA 2WAAA 1C5BL 4JQVA 4UAOB 5C7GA 2JJTA 4P02B 5I9QC 3MOAL 4WHYG 5IFTA 4E2OA 2BVTA 5KJRH 2ATKB 1KTDA 3QDAA 6FABL 1FYTD 5FF6B 5J12C 1I4FB 5CEXB 1TJGL 5T5FH 3JWDC 3SDXE 1GCYA 3LMJH 5EBAA 3HNTH 1YJDH 1IV8A 3T65B 2H45A 1F4HA 5DMIL 3W0KA 4YHNA 5DURD 2I9TA 3VWKD 3V7AG 2XN9E 5DMKA 3KEHA 3RM4A 3RZCC 4WW2B 2HJKA 4I5BB 3I02A 4NKIH 4HUMB 4CL7A 3MFGB 4GG6E 3SCPA 2VDRL 1TVGA 3VGEA 2YFUA 3MR9A 3DGGB 1OWWA 3ULUF 3TP4A 3TPUB 3BIAX 4NQSA 1HKMA 1BWMA 1U93A 2DS4A 1UFUA 1R3KA 1IQDB 3AZSA 1EERB 3LSOB 4GRMB 2WHJA 2EBNA 3VIHA 2VDQH 2CDEA 4UFIA 1HCFX 4HZLA 3TWCL 4P5TD 1A21A 2AKRA 4LLWA 4D0BB 4D8PA 5F3HB 3MLWL 5CSZB 1JG9A 1I8MB 3OGSA 4LRNL 3WHXB 4Y1AA 1NGXA 2OL3A 2W59A 1GGCH 3FCTB 2CRZA 3KHQA 4GWIA 1K5NB 5I1JH 3I3BA 3SURA 3MRDA 1XH3B 4ETYA 1OTTC 5LAXB 1E4WL 3GI8H 4WKAA 1KJ3H 3BMVA 4KRUA 1SBSL 1YEFH 4JN2A 4KKNA 3KYNB 3KPRB 3G6JE 3PZVA 3HHRB 2WYSA 3HLAA 5GHWL 5HHVH 2R1YB 3OX8A 1WWBX 1HSAA 7TAAA 5FO7B 5DD6A 2W91A 3RBSA 1UMHA 4BF7A 5EBGA 3S88L 2KL6A 2D22A 1QFWI 2W65B 3QWQB 2IAMD 1PX8A 3DXAB 2VE6A 1Q6FA 3HC4L 1FVCA 1LF1A 2YN5A 4Y0GA 2BSTB 3IGAB 1QEWA 5HI5C 4GH7B 3BAWA 1R3IL 1NQ6A 1MIMH 1RZJL 4EDXB 1LILA 4N9GB 5GSVB 5SV4A 5E94B 3EOAA 2AJ3A 1MCHA 1KR1A 1GOHA 1Z6JT 2Y6SC 4UOQA 5JUEH 4L8CB 3D0VB 2XT1B 3U7AA 4PMNA 4MCZB 3S3JA 4WDIB 2ZWLT 3TT1L 3VXPA 1FRGH 2LTQB 2NY3D 5T5NF 4IHOB 2ESCA 4YHPA 3GSNB 4UDTB 3HG1A 4F15B 1NCNA 4JFDA 3VGAC 4JFFA 2IPUG 3QDJE 3N1PC 3RKDC 2IXUA 4JQIH 3I6GA 1ULPA 2W67A 2X1QA 3D87B 3MLUH 2YG0A 4XHJD 5GS1B 4Z2AA 3PZMA 1GQPA 3OKYA 3QQ9D 1MFEH 3VMNA 2CNCA 4M56A 1E6QM 4MZ2A 5KZCB 1O7AA 5T1KA 4YXHH 3CZJA 1RU9L 3CMOL 2BY0A 2ZICA 4ZXOA 3AS3A 5I0DA 1JNHA 4D0CB 4Q9QH 4AC1X 4NC1C 2V5MA 1RIHL 1E4LA 3PUCA 1VA9A 1GU3A 1C93A 1YN6B 2YS4A 4UIKL 3VIOA 4XCNB 3D0LA 5BRPA 4QHNB 3ZTJG 1TCRA 2EDKA 4NQEA 1VHPA 1GGYA 4F7EB 5FFLA 2QQOA 4JQXC 3WEZA 3ZKXC 2MANA 2NCMA 4LL9A 4X7SH 3RJYA 4JFSA 3P9MB 3FHQA 4IPNB 4M8UA 3LPPA 4F9LA 1WEJH 4I3SH 4PGJA 4NBYB 2JJWA 3H9HB 3HPJB 3N1AA 2ZKHL 3DLQR 1DBML 1DQDH 1VRXA 1ZLVK 4MB5A 5ILTL 1UYWH 1F2QA 5I2IB 3MV7E 4K3JH 2V7HA 5IR1B 1HI6A 4HWZA 2CPCA 3NCJH 4MAUL 4UU9B 4BFIB 4Y5VC 1UYQA 3FRPG 2QV4A 4P2OA 5FIPA 3O8XD 5KOMC 5D1ZA 4W8LA 5D9MA 4PMXA 1KEMH 3WBDA 5C6TH 3RUGE 1CBVH 2WHKA 4JKLA 1YJDL 3BD5A 2P8MB 3X3FH 5SWSB 4Y5VB 1U95A 5I8OH 2XVKA 1QNRA 3L3HA 4P3CL 4QRRD 1FP5A 3OKOA 3LPOA 3NA4A 4ZENA 2VDPH 2VZSA 3ARGD 2HA1A 1JWSA 1U91B 4RMUA 4U3CA 4HOWA 4WFED 2UY2A 4N0CD 3ZTNL 4PTUA 1CD1B 1AH1A 3VRLF 4LCCC 2V5TA 3QWOB 3SDXF 1AMYA 4IJ3C 5KS9F 4EBQL 1EPFA 1G0YR 4RZCA 4YXKL 2XTKA 2O93L 4U1JB 4AIZA 2YUWA 2AK4E 1I1WA 2JJSC 4JM2D 3PV6B 1CFNB 3OPZH 1T22B 3TO4C 3DRQA 3DX9A 1UM5L 5GZOD 1F6FB 1FJ1A 3HFML 1ZWIB 2K1MA 4MNJA 3TH3T 2BVOA 5G05L 3MLWH 2HFEA 2C1PA 3F7VB 3TT3H 3P9LB 4Y16A 1MI5A 2F5BH 4FTVE 5TE7L 4EI5D 4KHTL 1I7ZB 2VXSL 3NIFE 2C3GA 2ITDA 4O2EA 1A7NL 2LABA 3MODH 2X7LB 3MNVA 4PJDB 1BPLB 3L4YA 2FO4A 1SBSH 2H32B 2D7OA 4U5IA 3HMWL 5FDWB 5C0JB 4LQFH 2YR3A 3IKCB 5MEPB 2DQXA 2X4PB 5C07E 1N5YH 4KHXH 4I3GA 4P23D 1IQWH 4ZS7L 3LKPB 3U4EB 4OLWL 1JE6A 3H2WA 3EJJX 4UIMA 2GYSA 5EH1A 1DQTA 3M7SA 2VLKA 5A1AA 1OWRM 4NQTA 4QTIL 2G3MA 3S5LG 5I1HH 2UWEE 1IMHC 4LVNC 4X5XA 4PSRA 2J78A 1AGEA 4UOZA 2Q8XA 1MIML 3FAWA 5IOPB 5A2IH 3PWPB 1U8NA 5F6IC 1CFVL 3GJEB 2XRAL 5T1LD 1E15A 1UCBL 1YUHA 4RNRB 4F7PB 4YPGB 1BIIA 3W2DL 5FV1L 1HL9A 4UTFA 3ZL4L 1T5WB 3GHBL 3IDJB 4ZO8A 43C9A 3EYPA 5JUEL 1R5WB 2VX7A 4HIEB 5IVXB 4IUGA 2OSLB 1KNOB 2PF6A 1L0PA 4I2XB 2AEQL 1U3JA 5I15H 4NKDA 3TT1H 4EN3A 1FRGL 4M3KB 1XD0A 4ZUVA 1N0LA 2J1VA 3KPTA 4XC1H 2DQUH 2HKFL 1B9ZA 1Q94B 4X7FC 4PT6A 1W9DM 1ZT4A 3GRWL 4DWSA 4TUKL 2MJWA 1IE5A 2O61B 4EUPA 3TTYA 3GM8A 1FAIH 3K4ZA 2IFFL 4R3SA 3HEIA 2Z91A 4U2YA 4URTB 1ISXA 2DICA 5D72H 3VD3A 4HBQA 4JPIA 5DUMH 5DJCB 5BMFL 4DEVA 4R2GB 3MOBH 1RIHH 4QF1B 5CBAB 4DUXA 2IALA 4NBXB 1I3GL 1AE6H 1ZLVH 4DWSC 2O9PA 5JO5B 3JVGA 4PJIF 1OSZA 5HDQL 4UV4L 3V7MA 5IQ7H 3W11C 3BGFB 4OZOA 3NCMA 3LRHA 4JRYD 3QR3A 3GSOA 1FVEA 5A2BA 3MRLB 5FAAA 4K23H 1OCQA 4ELMB 5DD1H 5L8KB 3T0AA 1A7QL 1RUKL 2EO9A 2C3VA 4NNYB 5IVZA 1DBMH 1Q0XL 2JF1A 5HGAB 3S97C 4IRJC 1QRNB 2YC4A 1DUZB 3IU4H 4P2RE 4MAUH 2BNQA 3DIFB 3GSWA 3HNSH 3DETD 4YHZH 3PWVA 2ZUQB 3P77A 1D5XB 2VC9A 1BZ7A 2OI9B 3CCHA 4HJGA 1XGQB 1ZLSL 3RVVC 4ZUSB 1IARB 3L5WB 4HC1L 1NC2B 4YO0B 2VUOA 3ZKNC 1MAMH 5CSBA 4CUCA 2NMSA 3BAYA 1BD2A 2GTWB 3ARYA 4PREB 3AYSA 1AQDB 5JBFA 4U7MA 3VD4A 1V6VA 4BFBD 2E6PA 2DGAA 5EFIA 2VZQA 2ZOXA 4M7ZC 1BWWA 2H9GA 2HLFD 3NABL 4YIQB 5T33L 1YEKL 2Q7NA 1FIGH 5KVFL 4J4PC 1V7ML 4AL8H 2E7LC 1E5JA 2KPNA 3O9WC 1US2A 1AGDB 1B2WH 2FECI 1FQ9C 2XFYA 3MLYH 4HIHB 1KN4H 4BQ6A 1MLBA 4PRID 4XNMA 4ZZ5A 3IJHB 3S4SB 2YMXH 3IF1B 4U1MB 4HQQL 4GQ9H 5L2KA 3CVHL 1WV7T 1WC7B 3ZR5A 1KB5L 1HQRB 1HCVA 1A8JH 4BQ8A 2PO6D 4N5EC 2N4IA 4FG6D 2C8NA 4EQ3A 4U6TA 5HY9B 2R1XB 1C16A 3REWA 3FB8B 3PABB 2EXWC 1GNYA 4NM8L 1N5AB 5ADOH 1RJYA 4Q6IA 3NAAL 2EEDA 5FDYA 2J6EA 1I1FA 3ES6A 1T4KA 2ILLA 3MLRH 1M1SA 2R2EB 2EXWD 3HMXL 4LCYA 3BISA 3JXAA 1CDIA 5CBEB 1S9VB 1W72A 3BW9A 4AD3A 1SYVA 4KHXL 4NWTL 4QCIA 1IQWL 4R27A 3H42H 3KNBA 3IFNH 3MCKA 4LGPB 2XYLA 1YY9C 2FJGB 4MWFA 1TZ7A 1OT2A 4CJ1A 1VDGA 4RFNC 3MTRA 4GKZB 1CZ8H 1S9XA 4UZSA 3G6JA 2YK1L 2VYRE 5HI4C 4O51B 1KFAL 2PXYD 3CSGA 3GMLB 5I78A 2H2PC 4WO4A 2FDBP 5EU4A 3WXVH 2QHLA 2DPEA 4MB1A 1K9EA 1HXMB 5F9OH 5C9KA 5TDNA 1DLCA 3QXUA 4OCSH 1WKYA 4FFZH 5SWZA 3FQUB 3IFOB 4MD0A 1CFSA 5FK9A 3PZTA 1EV2E 3TBVB 1V0MA 3DHUA 4HAGA 3BKCH 5GGSB 1JRHL 1JI1A 3SOBH 1E71M 1B90A 4CN1A 1M05A 3GNRA 2ZSVB 5HHNA 3PHSA 2WHMA 4NUJB 3ARBA 4KK5D 4BZ2L 5HHXH 2VAAA 5M5DA 5LBSH 4KJWC 1PPIA 2HLAA 3PGCA 4I1NB 2OKXA 1M7DA 2DQUL 2HKFH 3BIKB 2B4CC 1G1CA 4PN2A 5JW4R 1D5ZB 3LPFA 1XCTB 1IAII 3GSNH 4R7DA 1ND0A 1OGBA 2V3FA 4AEIL 5D2LF 1OP5K 4XVSH 1JDCA 5DK0B 5IB1A 4JCLA 5IHBA 4JFQB 5AAWA 2PYFB 3HI5H 5EU6E 2IFFH 5D7IE 3ARBC 3QDJA 5HHOB 2HRPL 5JNYB 2HYMA 3UC0H 1KIUA 1GOQA 5MHSD 5FV2A 5DUML 3MOBL 3MLXH 3WN5A 2FGWH 4E8DA 3CQOA 1F97A 4U1KA 4MA8H 1EIBA 2DRUA 3K46A 4H0HB 4LCIL 1EVTC 5A2JH 2QADD 5FHBL 1OD0A 5B39A 1BGXL 2GFBB 4NPYB 4JDVA 3WIFA 4QHMA 4HCRH 3KPOA 1RUMH 4YHIB 5GS3A 4KKAC 4DOHB 4H26A 2F8XC 1M4KA 1XIWA 4RSVA 3VNYA 4JRYA 4XPAH 2FZ3A 2XV6B 3LDBB 1KGCD 4YWGL 1YNTB 5J1AB 3OGVA 1UC6A 5FKAB 1D5MB 3E3QC 1HKFA 3DUSB 3IU4L 4PG9B 5CSGA 1FV1B 2WVVA 3QFDB 4DCQA 1TVHB 2XNAA 3E6HB 5HVGB 5KVMC 2YB7A 3K8LA 4F3FB 3TZVD 3MJ9A 1ZEAL 4V1DE 4ZUWA 5F7MC 5TFSL 5C92A 1A1NB 2R2HB 3PGFL 1Q72L 1MCSA 2IH3B 3IIIA 3POHA 2CQVA 2GSIA 5CEZL 3EBVA 3CO4A 4JDTL 5GPRA 2WWDA 1L9MA 1NMBH 1QKZL 2DSWA 3I2CH 3N04A 2VLJA 1ZKAA 5IB2B 4RGOH 1GHRA 3G5VB 3WUWB 5IF0B 4DXRA 2JB6A 2BGPA 1DBBL 3P30H 4O02H 4GAYB 3HZVB 4MA1B 4AL8L 1T0NB 2QHAA 4WEBL 4D6HA 4GZ9A 3ZM8A 1CDJA 3EOYG 5M03A 4HKXA 1JGLH 4UNIA 3QUYB 1T1YB 4QOKD 2RGSA 4QKXB 3MXVL 2QHRL 4HWBA 2QPUA 2GIYA 3JV0A 4Z0BL 4UINL 5IEHB 1C3FA 2GQHA 3V52L 5DRNB 2NW3A 2C5DC 2EYTA 4G43A 3BP5B 1G7QA 2GJXA 4OLYH 1BVKB 4QGTA 3WO3B 5BOPA 2W1UA 5C08D 4LHUG 1MJJA 3TBYB 1NPUA 1J8HE 1H5VA 3LZFH 5F1KC 3F2ZA 1QD0A 2W60B 3AAZB 5JXAH 4R4ND 4Z18A 4AZHA 1KELH 4XTRC 5IB5B 1OIFA 2DD8H 2WZEA 3FFCE 4X7TB 4GJTB 1D5IL 4ZO9A 3W26A 3FRUA 4M1GH 3O8XA 5IVXF 2I9LB 1MI5E 3U36B 1MRDH 4XNZB 1CLZL 4QDMA 2R39A 3ALXA 4D9LH 4EI6B 5JR1H 2H32H 4NWTH 5ABFA 4XNQB 2UYLA 1D5BA 1V05A 1U8MB 4BA8A 1R6VA 1QFPA 3L5JA 1KFWA 4G6FB 5GRJH 2DN7A 2DI7A 1CGTA 4EXKA 4AYSA 4O2FB 4D1JA 5D6DC 2FIKA 5C8BB 5D9OA 2Y8VA 3WFLA 2CDOA 1XGPB 4KTEH 4Y19A 2J7HA 1H15B 4MYWB 1W9BM 2NX5D 1PDKA 1C08B 4M5YH 1ZOXA 4M7JH 5DJ0B 3BKCL 3ARDB 5DJAA 1JRHH 1WP6A 4TUFA 3I6KB 1OAKH 3SEEA 3RWJB 3HOBA 3X11A 1ADQA 5AZEH 1KCRL 4D0BA 3OJDA 5T1KD 4KMQA 1FNGB 1BEYL 4OD2A 1NGXB 1ZHBA 1XR9B 4GLRH 3BKJH 4FZ8H 1XNAA 3OZOA 2ZZUT 2Y23A 1I9RH 2MKLC 4NZTH 5IW1A 4PB9L 1U8LB 4RWYH 3VXTB 3A4AA 1S3KH 4XNZC 5SWQB 2CO7B 4ODBD 2Z9TA 4OV5B 2IQAA 2J25A 1JWUB 2C4FU 3U5UA 4OKVA 4PBXA 3RWDB 4FA8A 3O4OC 1NGZA 4PLOB 3QIUA 5ESVB 1HP4A 1HIZA 4F66A 2YEZA 3G08B 5KS9B 4DK6A 1VACB 2HG5A 5C0GA 1I1YB 4FQ1L 3OAUH 1IVLA 3JXSA 4PTVA 2FGWL 1TZHB 1S7WB 2NNAB 4GI8A 3VIGA 1FVCB 2GJ6D 3B9EA 3RWHA 1FO0L 3LEYL 1RZKH 5L6YH 2BSRB 4PJAA 4LCIH 3IGAA 3T3PE 1VPOH 4FFYL 3SCRA 3U57A 2CIKB 4WV1A 5EZIL 2WHLA 4ZUTA 1TTUA 4HCRL 1CGWA 1A5FH 1JGVL 5T1LA 3GI9L 1PEWA 2ADGA 5FHAL 4HFWB 5E94A 2FLBT 2X89D 4HXBL 3F7QA 4YWGH 5EOCJ 1ZJAA 2DLTA 3NCYS 4CMMB 4EAMA 3O3BB 3C5SA 3UTTD 3L3GB 4IHOA 1R24A 3IJYB 2F2HA 4LSTL 2AI0L 1MCEA 2NX5B 4JVPA 3PGFH 1F58H 2W0LA 3OKNA 1XRVA 2AEPH 4YFLI 2ZCKH 4M6NL 4CVZB 1NMBL 4K7PX 5GS1A 2IADB 4MA3B 5D7LD 3U1SL 4YEFA 1G0CA 3V5DA 4DGYH 2QL1A 1W1TA 1UR1A 4HMDA 3RL1A 4AWEA 2OXHA 4K9EL 1A3RH 2PF0A 1BD2E 2XYCA 3O6FC 2DIAA 4NCC1 4ZYKA 1OGSA 3MUIA 3O6ML 1FGVH 1GQIA 4HA1A 1KXVC 4K8RL 4IDJH 4JGMA 3MV11 3VGAB 1NOUA 4D9QD 1UH4A 1J12A 2FB4H 2NY7H 3PUIA 1NDMA 3QG6A 5IK3B 4KQ4L 3GZKA 3T2PA 3D3AA 2F74A 3K8KA 2DKSA 1E4XL 1S8DB 1XEDA 2EPMX 3FMGL 4FQHA 3SY0A 3TNNA 1KG0A 3PWUA 2BY3A 3ZT6A 3UNPA 3JWOC 2X4TA 2WXDM 5DHXB 1XF5A 4XZWA 2YZ8A 3LZFL 1NFDB 3QDGD 1P7HL 1UZ1A 1JI2A 2V7HB 1HI6B 3FQTB 3AQUA 1ERNA 4UU9A 3FFDA 3I2GA 2DT3A 5EORH 1W2VA 4LCUA 4M1GL 4ET7A 4ZXBD 4H20H 3VH8A 4D71A 1HILB 4J12A 4OLUL 4I18C 5JR1L 4TUOA 3BSHA 1GMMA 1A14L 5J06A 4HZ7A 5LQBL 1JXKA 3BQUA 4FLQA 2Z8WC 4S2SA 1UR8A 4B41A 2BNRE 4MS8C 3QCUH 3PWPD 2BY2A 1IILE 4UV7L 2H26B 5GRJL 1QBBA 4CMHC 1FGNL 3Q6FA 2WMIB 1X3DA 2XA8L 5D1XD 3RWCA 1X5KA 1MI5D 4PTUB 5JIPA 1RP9A 4P99A 4TSBL 4ZXBB 2OMBA 1P2CA 4EDWL 3TO2B 4U1JA 4HIXH 5SX5H 3TVMB 4CMHB 5JW5B 1EEZA 5F7DA 5D93C 5L2KD 1U8JB 5KSVA 5D5MB 4Y5YC 4ONHB 4P5KB 1TJIH 1KCRH 1ZWIA 2D4FA 4QLRA 3GTNA 2OQJA 2WK2A 4S1RH 4MNGB 3ZKXB 3JWOH 2JD9A 4P46C 3TVMC 4PY7A 1BEYH 2HISA 1KJMA 4XAKD 2VZVA 2BVQA 1DWJM 1VGKB 2YLAA 3GO1L 2G9HA 3KPSA 3VFNA 1HHHA 4R0LC 4MNQB 3L3KA 4PB9H 4NKIL 4UBDD 3VFTA 4EVNA 4YBQD 4K94L 1W72L 1LEIB 4TXEA 4W8AA 2CLZA 1S78D 5MEPA 4BJ0A 1T0MB 5TE6L 3WLWC 3U4EA 2A74B 3ESUF 2GK2A 3HI1A 1W99A 5IHSA 2PUQT 5DMJB 5B4NA 1BJ1H 2J22A 2YUZA 1KTLB 1II4E 4WKFA 4ATLA 2YKKA 3RL2A 1Q6EA 4R0LA 1GVIA 3UDWA 2EIZB 5ALBL 3STLA 1RZKL 1QNQA 1FL6A 2R1WB 4FQCL 3RDTC 1WFOA 4G9DA 1GGIH 1KIPB 4OZGE 5EU6B 5EU5B 1AY1H 4OF8A 3OTTA 4XNYL 3ROOA 4F2MB 3O11A 4DWSD 2DTSA 4D6EA 4HXBH 4XP1L 2XTJB 5C0AA 1D9KA 5EPMA 1W0YT 1XF4A 1OAZH 3LH2H 2ZUMA 1IL1A 5HYFA 5CWSA 5F93C 1KNOA 2DSUA 2VX5A 15C8L 2KZ1B 2VWEC 4NKDB 4XCEA 1VFFA 4EIGB 1YN7B 3DNKA 3SUWA 3I9GH 4QLJA 4J6RH 5MEQB 3D39E 4ZMAT 4TYUA 2EC9T 1QI3A 3CTTA 3T2QA 3FY1A 4ZOEA 1CICD 1H5BB 1G6RL 1GYAA 4KTDH 1S7QA 3NIYA 2P1YA 1E0XA 1RZIA 3HPNA 5DO2C 4YDIL 4RX4D 2W63A 1FHDA 4Z2LA 2K3TA 3QO0B 2RB8A 3ZKSD 4R3SB 3SE4A 4Z7WB 1A3RL 1NQBA 3SGJA 1I1AB 2FX7H 1ORSA 3TA3B 1L6ZA 4HPHA 3VXME 4KMTH 4OLVL 3RIAF 4EN3C 3VG0L 5CBAA 4W50A 2QADB 4Y4KC 1MCWW 2XVPA 1OSZB 1S7RA 3DVNB 3NUKA 3F5WA 5D9SB 5DHYA 3TLRA 3MRQA 2YA0A 2H8PB 1E4MM 3II1A 2ESVB 2IEPA 4NQCB 4E41E 4ZTOL 4QRPB 3QIWB 1FG9C 3DUUA 4ZQKA 5IW6B 4NNYA 1MFEL 1UY3A 1IRAY 1MRCH 1NSNL 2QKIA 4Y4KA 3RVTC 4MHHG 3WEOA 2R69L 3LEXB 3I84A 1RU9H 3LQAL 3VFMB 4Z7VB 2D23A 4P5TB 1H6YA 3CUIA 1X4XA 1HOCB 4PJ5B 4TVSa 2XVLA 3CCHB 4JM2F 4NC0B 5CIPA 3IRZA 2ZUVA 4KWUA 2NT1A 3C7EA 4Y89A 4M7LL 5IESH 4NQCD 4XVHA 2CUHA 5LQBH 4UT9H 4AMCA 4TNWF 3C60C 4Z78A 3VJ6B 3ULUE 4MPKA 1IM9B 2WANA 5AD0B 2R7EB 5EFIB 4NKQB 3FT3A 2HTLD 3IFLL 2H9GB 3TA3C 2XA8H 1W8NA 4RGMB 3LS4L 5D2NE 3BRGC 3VFRB 4YDJB 1NP0A 5LCWL 1T1ZA 1N2RB 4MXQD 1VFMA 4TX8A 2EYRA 2IAMB 1G9ML 5DJZA 4GINA 1X5JA 3MRGA 3T0EA 2GK1A 1IAIM 1YC8A 2WC4A 3INUL 4XBGB 3E3QE 1GGBH 1H3TA 2XN9A 4PGZA 3UBXB 1W9UA 4HA3A 3GIZL 1WC7A 5JORA 2ZG1A 2G3IA 3C7HA 3EB7A 1HINL 4YZFE 3VW3L 3TJEH 1NGYB 4WI8A 4QFUA 4KUZL 3WN6A 5HY9A 5HNNA 3AXLA 2KBGA 1NJ9B 3L2LA 1RPKA 4ELMF 1G01A 4HG6B 2OTWA 4LLVB 4PRIE 5C0DB 3ZYOA 5A8QA 1FVDA 2GITB 4M6ML 4XZUB 2MCPL 5J1TC 2E7LA 4KMLB 4PG2A 1R5IA 1OIMA 4JFVA 1NAKH 4A44A 3ZTNH 2JIEA 5CPQA 5B3JF 1R3HA 2OZ4A 5J6GA 3MRRA 4PJGF 4K94H 5E5MB 1W72H 3GMOB 3RTQA 4L4VA 3D5HA 4TSAL 3DRTA 5CZKA 2CJUL 4HX1A 4OF7A 4ZFOB 1E27B 1QA9A 1U8HB 1HZHH 4E42B 3QXDB 1CXFA 3BVNB 2FJGA 2DKMA 4R96A 1JF5A 3RQ3A 3L4UA 3KPMB 2VUYA 1UM5H 1U3HD 5EO9B 3QRGL 3KWWB 4ODXB 3GMLA 3FB5B 3ARBD 1FSKC 5IVOA 3AJ7A 2Z93A 4OZHE 4M7ZB 2AXFB 3CUHA 5GZNC 4K7PH 4NQCE 4IRZH 4E0RB 3N18A 3K1KC 3B2UC 3QRFM 5CAYB 3VG9C 3LKRA 4X98B 4NKOA 4XP1H 3EO9L 3GXMA 3M6DA 1JHJA 1N0XH 3BGMA 1BLIA 4LQFL 4HULB 2GVYA 5TQ0L 4PJEE 5EIYB 4GMTH 1KB5A 4HMEA 3SE8L 1N5YL 3HE6A 2XOTA 5I73B 3CZFB 2FYYA 4HIIA 4OLWH 4UQEA 5I6XB 4J6RL 1I85A 3QQ9C 3BSZH 3APGA 3QCTL 1OQOA 1OGAA 3BIKA 4QTIH 1AIFA 1SJEA 1LO3H 1V6WA 1XCTA 4R7DB 1B0RA 2I07A 4KTDL 3MXWH 1HE7A 1KGCE 3C60D 3G5YB 4R5EA 2LU4A 4YDIH 2PYFA 1CFVH 4R4BB 3G6MA 3BZ4B 1HVXA 3TFKD 1FE8L 3LD8B 3CFEA 1NARA 4QRTA 2OK0H 1MF2H 4W93A 3CD4A 4XPBH 5FGCB 2O92A 1E0OB 5JHDE 4BSWA 2AEQH 1GPOL 2V17L 5J4MA 5IFHH 3PQYE 1J11A 4RIRB 5A6KA 3MUAA 3OHXB 5B4XA 3N1QC 4HJJH 1LO5A 5IWLA 3PXJA 3FHAA 4WJXA 2JELH 3B5GA 4QHMB 1AD0B 2NY1D 3TCXA 2Q20A 3W39B 3IT8D 4LSUH 2P46B 1BFVH 3MREB 4MGSA 3TZVB 1NGWB 2EEXA 4WI7A 1KJ2A 1YNTA 1MRCL 1Z9MA 4WTWA 1MRFH 2ZOLA 1JZ7A 2D9QB 3GMPB 3RIFF 3C09B 1WAAF 4I0PA 3LKOB 2XA3A 4U6YB 4YQXL 5IYYA 5IVXE 2BDNL 3HUJE 3J7HA 4KKBD 3G6DH 1I3GH 5KVEL 1CXEA 5FOBA 1I9IL 4HK0A 5C0FA 4GBXA 4X6EA 1A1NA 2VISB 2AK4B 3NCOA 3D85A 5EUOA 4UV4H 5IQ7L 4XP4H 2P5ED 1U36A 4X7EC 3PWNB 3B8YA 4GUPB 5F7EL 4XBEL 3DX6B 1FOBA 4NP4H 4Q0XL 1MCLA 5L9DL 5F97E 5IF0A 4GMSH 2JB6B 3MMEB 5FYKD 3ACFA 2V2WA 3QNYB 1B0GA 5CP7B 3ZHKA 3GZAA 1A7QH 1RUKH 4FP8H 1BVLA 5FGBA 3CLEH 4TRPL 2JIWA 4YDKL 2DH3A 2OR8A 3QUYC 1IAMA 3HR5B 4JEGB 1J5OH 3W9EA 1UD6A 1IC1A 3LY6A 2WVSA 1AGBB 1MPXA 1E6RA 2CKBA 3TBSB 4NNXA 1GGBL 4FQJH 4WHTA 4KK9C 1IC4H 1LO2H 1QYGL 3PGDA 5CCKH 2NW3B 1A3LH 3X14B 2APBA 2YD7A 4BKLB 4MX7B 4H8HA 3TJEL 3BP5A 2XY2A 3BUYB 3LHPL 2E7MA 3MROB 4KGLA 2UVEA 4LSPL 4J3XA 1GC1C 2PCPA 5CIPH 1W2KT 4ZFZB 1BQHA 3EGSB 4OLXH 3T4AA 3ORJA 3FJTA 3OB0H 4PUEA 4LNRB 1TVBB 5E8OA 2IGFL 4X7TA 1NBZA 2BRRL 1NKOA 1FIGL 3MPCA 5KVFH 3JBG7 4DQOH 3KJ4C 1KJ2H 4XI5D 4YZFF 3F7RA 2ADJA 1B2WL 2A6JA 4WVRA 1J10A 4TVPE 3W0WA 4S11A 1KTRL 4CVUA 5HYIA 2MPAL 1AJ7H 4LDOB 4F9DA 1JZ8A 1HZHL 1LNSA 2DB8A 4J2XA 1U8MA 3ECBA 2PWHA 2CKBH 1X5HA 3GNPA 1VENA 4LFHD 4DVBA 4PJXE 2PWEA 4V2CB 2VXVL 2E3ZA 5E2WH 2VMDA 4HOXA 4O2FA 1F11A 4WW2C 1HIML 4KUCF 2V72A 3KPSD 3VXSE 4N0UE 4ZS6D 1F4YL 5BRZD 2XWJA 4U1HB 4RFEA 5C0RL 4XXCC 3RUGB 3NCEB 1VSCA 2OYLA 5J12B 4AZCA 1CL7L 3MJ9H 4OIBA 1J8HB 3UTTB 5AYBA 3ARDA 5DJAB 4RMRA 1PBYA 1AQKH 4E5XA 2ICWB 3X11B 4PJ8D 5A6LA 4X6CA 4PLKD 2WW5A 3ZKMC 3U79A 3CZ8A 5IHUL 3I2IA 2J4WH 1V02A 1NC4A 4PRNB 3T3ME 1OAXL 3ZO9A 1RFDL 4JAWA 3WMSA 1T2QL 4NQUA 4OV6F 3RZCA 4YFEA 1WDPA 4TSCL 3ARDC 3UTZA 4N0RA 2HYXA 1F6AA 5CUSL 2JTDA 3O6FD 3OJMB 2DBJA 5SWQA 5EZLB 4DZ8A 3C8XA 4F8TA 3VWKA 3IETA 4HUXA 2ERJC 3D39A 4LMQE 1K45A 3CK0L 1QNPA 5LA0A 3RWDA 5DVNA 1I9JH 4FQXA 3QIUB 5ESVA 4IS6B 2DBLH 3OKDA 4NZUH 4ZSOA 5IFJB 4OZGB 3MLVH 3U0PA 1T2JA 3CDFA 3CJJA 4N9OB 2V17H 5E8EB 1S7WA 3AHTA 2ERJB 1IZJA 2ZUUA 4FG6C 3ZT7A 4YDLB 1T1WA 3OF6A 4HGMA 3UAJD 3X3GL 2VKWA 5FD0A 5DJYB 3B43A 5ESAB 3ULSB 4L3AA 4WV1B 4P2YA 4P4KD 3QFJD 3ZKND 3VGBA 1BFVL 1EHLH 3BP7B 1VJSA 3MRKA 4GRWF 1DVFA 1CE6A 2K7QA 4PRHB 4IRSA 1P4BL 4QT5A 1LE5A 3VRJB 4AM0A 4MJIE 1WK0A 1Q38A 1H41A 3HI5L 2UVFA 1GAFH 2Q8AH 2O5YL 3Q5YA 3MRNA 3B9KC 1AR1C 4WWKC 2ZEXA 2J77A 4D0DB 5BV7C 5F7WC 4POYA 3UBXI 2D03H 4ZFFA 4XP5H 2LTQC 3L3GA 2QMJA 2FJHB 5BWFA 5I16A 2DT2A 5I1DA 4XVTL 3GJFA 2OM5A 3THML 4QRQB 1B1YA 3Q6GL 4ZFGL 1W0WA 1EHXA 1IT9H 2VXQL 4LU5H 1UQSA 1KC5L 2QQNH 4XBEH 4OKDA 4OLEA 2VIRB 1I1AD 2BSSA 2QSTA 1PY9A 4WWKA 3LEIA 1YNKL 3MRHB 4X0KB 2NY4B 1Q0YH 3QHTC 3PG2A 3SO3C 3P9WB 3J8F7 4YDKH 5A95A 1UA6H 1HNGA 2Q3AA 2V6HA 3D1MC 1J5OL 1A4JB 3MJ7B 5FUCE 2KH2B 2D24A 3NZHL 1QSEB 5ACZA 1ITCA 1Z5LA 5D1QA 4JFED 5IBTH 2ZUTA 3S8WA 5I17B 5TPWH 3TC9A 4X4XB 5CPSA 1YEHH 1K6AA 1ZEAH 1UUQA 3BAKA 4P57A 3AMLA 4ODTL 2V9TA 3FQWA 2VX6A 3C7GA 3LHPH 1XGRA 3CMJA 1CWVA 5CEYB 1KXHA 4RGNE 5HYQA 2YD9A 1AXSA 2MOVA 4XMPH 5D7SH 4GQQA 2VZOA 3I2CL 2F58L 2F9BT 1BIHA 1INDH 4HH9B 3B9KB 1K8IB 1HQ4B 4OQTH 5I8KH 1JN6B 1JBJA 1HWGB 2FWOA 1KXVA 4MD4B 5JXHA 4Z7UB 5D1QC 5F9DC 4Y4FB 3OEAA 4JANA 4P23A 1JJUA 3UTPE 4DQOL 4AMKH 3QEQA 3QG7L 3QOMA 3CVHA 2B5IC 4WEBH 3VH8B 3SCSA 3BHBB 4M81A 1H49A 4H1LB 4PGDA 2L7JA 3QNZA 5IHRA 4NO5B 2BFVL 2XN9D 2PTVA 4MXVE 4WNQB 4WUUA 3BQUB 1JZ5A 4NQVB 3NACL 3WDHA 3O45A 4QX2A 2WMJA 1CICC 3V52H 1DEDA 3FN9A 3DMMB 2B4CH 1GJUA 2J1AA 2WQRA 5E2WL 3SO3B 3SCQA 4F7MB 3WKZA 3O3UN 5DA0B 1M01A 1S7SB 5ELIA 4CN6A 3GMQA 4APQD 4LCCB 4AENB 4JZ5A 3RJQB 2A6IA 1XT5A 5F3BB 3MZTA 5FUIA 4KV5F 4MMXC 5DVKA 4L4VD 1CICA 1EXUB 1MRDL 4U6HA 4C56E 5KSVB 1XH2A 4ONHA 1AGFA 1HK6A 3RWIA 1MUJA 1Q9LB 3CSYB 3O3EB 1MNUL 4Z2IA 2X4OA 2OQJB 4UTBL 3V4VL 1OD3A 2FIRT 4ZXLA 4MNGA 4MTVA 1NKRA 5G04L 5IHUH 1KXTB 1JZ6A 5C0ND 1KJMB 1T21B 4LAQH 2QQLH 2YPKB 1RFDH 2YPLA 3IDMA 1VGKA 5HVFB 4UQBA 1FIEA 2Q76B 1NGQL 4B3KA 4D6GA 4AT6A 2JEPA 5AWNH 2ZPKH 1UKSA 4PJFA 3BD3A 2XPKA 2V5RA 3RVUC 2Y6LA 1N3NA 3U2SB 1IEAA 3EOBA 4WJ5B 1FBIH 5IM7A 4LHJB 1QW8A 5JOFB 1KENH 1W0VB 2CH8A 3NZ8A 2DBLL 1Q9WB 3KS0J 1PZ3A 1SFSA 3B9KD 1BJMA 4NZUL 4NRYB 4K3EL 1TR1A 2P47B 1QNOA 3SUSA 2ITCB 1KEGL 1U3HA 3MFFB 3RL2B 3OLEA 4J3WA 1WCBA 2BVPA 4XUPA 1MEXH 5K9KB 3STLB 3WQ5A 2PR4L 3QUXA 2APXA 1FL6B 3B2VL 5CMAA 5EU6A 5J3HC 1UY2A 2GCYA 1DEEB 3U48A 4JY5L 5MENB 1FG2A 1IEBB 1NCBH 4LSRH 2HFGL 2DSVA 1UWTA 4PJ7B 4A2MA 1QNSA 5CD3B 1P4BH 3OKKA 1X44A 5GXBB 1XCXA 1U3HC 3AIVA 3WS6C 4U49A 4GAGH 3DTXB 2Q8AL 1LDPL 3OAYH 2CDGA 2JALA 5E2VH 4M43H 4MCYA 1YECL 3LN4B 5A3ID 4S1SL 3L6FB 2D0GA 1NWSA 1EO7A 4HUWB 5EIIA 1FFNA 3B5TA 5MEQA 1P7KB 4OCXH 1LL7A 1LWHA 4CW1A 5DHVB 3THMH 3TNMB 3O3AA 1UVQA 1BP3B 3LEYH 5L6YL 1KC5H 2QQNL 1CDUA 3ZOAA 4J1UA 1RZIB 3SKMB 5EZIH 1VESA 4RWHA 3BDBA 1CLYL 3WKML 1D9KC 4XPGH 4D2NA 4JKPH 1I7RB 4WSJA 2FHFA 3EYOA 1Z0NA 2OTUA 4AZ8A 1LEKA 2DM7A 4HUVB 4R97C 2Y5EA 2ENYA 5T1DL 3E8UH 3SJVB 4ONOA 3IVKA 2W1WA 4HZAA 3FOLB 1K2DB 4OIIL 2VZ1A 4GS7B 4HTYA 2BHUA 2WAHA 3UYRL 2EE3A 1I8IB 1U8PB 4FFVC 5DVOA 4B9ZA 3FT2A 2X41A 3KYOA 2Y5TA 1F58L 4NQCA 3AHYA 4QRPA 4F8XA 1W3KA 1G7PA 3Q0HA 3WF1A 5D7SL 1KN2L 4MNLA 3L3DA 4G3YH 1IC5H 2X6MA 2DL2A 4G6AD 1B4JL 4UB0H 4ZNEE 4NFDA 3RNQB 1DUYA 5TE4L 4OZFG 3W29A 5DS8A 3HMXA 2BNRD 1OSPL 1F4XH 3UO1H 4F57H 1AO7D 3WF4A 3QG7H 4K8RH 4IDJL 4Y2DD 4U05A 3BDYL 4IMKC 1CL7I 4CRPA 1NBVH 5DGRA 3CDGA 2FR4A 2HVJA 2LE9A 2PW1B 4OFYD 2JDAA 1E70M 3NACH 2O9OA 1TFHA 2NX5E 3FMGH 2BERA 1NWUA 2B4CL 3FT3B 4V2BA 3TBTB 4UAPA 2PTUA 1GZQA 4PJAE 3D25B 3O2DL 1UB5B 1W9WA 4WW1A 3TONA 2IAMC 1PMHX 3KPQB 3WJJC 2F61A 1YPZB 1OW0A 2WUCH 3VXSD 3WFEL 5DJZB 3IJ8A 1L7TL 4MSWB 5D7JB 2J7MA 2VLMD 2GK1B 2OLHA 4JRXA 1P69B 2LAGB 5D70H 4ODHH 5C71A 1P84K 4CD7A 2HJFB 4R2GC 4MLSA 1JNLL 1ZSDB 4RA0C 4HF5H 3V5HB 4BS0A 4HIJB 5T3XH 4YC2B 4ZTPL 2MCG1 1S46A 1TE1A 1B30A 5LKNA 4X8JB 3VO0A 4DEPB 1SBBA 1ADQH 1O59A 3O2WL 4P4KA 3WHE0 4Y19E 3R8BB 1YQ2A 2QQLL 1LWRA 5C0DA 4XCFL 1NGQH 3PWPE 4XZUA 3DURA 4JFDE 5E8DH 2G5RA 2DQFA 3B2UD 1UCTA 4AZ7A 1DZBA 2FL5B 2YD2A 2PXYA 1FBIL 1WZMA 4ZFOA 1GJIA 3LN9A 1RK0B 1FZMB 1UEYA 2MFNA 4IOFD 1UHVA 2P5WE 5I1IH 4K3EH 4JGUA 1CD9B 3U0WL 3ACIA 4M02A 2IMMA 4L1HA 4LSSL 5T5NG 4OTXH 3SKJH 1IKFL 4HKBB 3EDKA 3HRZB 5MEOB 1W1YA 5L2JA 3WL0A 1AKJA 3MBXH 4KROD 3FB7B 5HPOA 4DUVA 4OBRA 1JFQH 4CDGC 1KCSH 2D4DA 5ESQB 5D2LE 1URLA 5EC2B 2AOSA 1MHCA 1WLHA 1RK1A 3A0OA 5D7LA 1T03H 2IBBA 1EXPA 5CINL 4YBHA 4MJ4A 2YSSB 5FA4B 3MKKA 3LKRB 4JDZB 3CH1B 4MJ5A 4PJ8B 5TF1H 2W46A 2Z31C 4JAMA 5B3JE 3PZGA 2HVKA 1BG4A 5GGQL 3A6CL 3LQAC 3A22A 1A4KA 2RQ8A 4M43L 1EFQA 4QXTA 2XJ7A 4KQ3L 1ZJBA 5IMMA 3L4XA 4ODWA 4HHAA 4OZ4B 2BOBA 2DLFL 4PUBL 5DWUH 2BMKA 2DQHL 3N06B 5ALBH 2YWZA 5E9DA 4A6YB 2A6DA 5TQ2L 4PRAA 3CFDA 1YJDC 1GGIL 1J1OH 2YN3A 1I3RB 3C6SA 5JLZB 3WNKA 2RAMA 1MFNA 4NKMA 3ARFA 4P46D 6FABH 1JZ2A 4FNLL 3S37L 3CFEB 2XVGA 3W38A 3W0WE 4K3HA 2BCKA 2OCFD 1MFUA 1VBUA 3E8UL 3L7FA 1C7SA 2Y64A 4I0PD 4AK1A 1VERA 3VNZA 4N8PA 4K7FB 4QNPF 1T5XA 4RDQF 4PJXA 3CHDA 2B8OT 1RSFA 4OYUA 4J3VA 4G9FD 4KK6C 1SVCP 4TN9A 5D1XB 1LO5B 1CZTA 5C0EA 4H25B 3FQRB 1FSKB 1H3VA 5B38A 1FDLL 3LPGA 1OAQL 2P42B 4B7LA 4ISVA 2CCRA 4N0UA 1WTGT 3SUTA 1LO4L 5DQJB 1KN2H 4EKXA 1XF3B 1G7MB 1KGWA 4LPVA 4P7LA 2JJVA 1B4JH 4UB0L 2UWFA 3KPSE 3C08L 2XZZA 3WNNA 5E99H 4I0PB 2Y06L 1INQA 4OMDA 3DVFA 4K3DH 1F4XL 3QI9D 3SHSA 3KLDA 3EJZD 4WTZG 2Y6KA 4PGBA 4KMTL 4EQ2A 4X6CE 5D96B 1ZGLA 1SYSB 1JNEA 1GOMA 4M62L 2SEBA 3MLZL 4X6EB 5IWLC 2HFFB 5EUOB 5FEBA 4UDUA 2JFEX 2WBJA 5I1EL 1U2YA 2B39A 3ARVA 3IRPX 1YMMA 2QV2A 2DLIA 3MNZB 4ZTOH 2EEBA 5EUKA 5INCB 5F1IB 5CFHA 1ISZA 4DW2L 3IDIB 5GHWH 3MA7B 5F9JB 3A23A 4TTGA 5IT2H 3WQ4A 3B3IB 5FCUL 3WFEH 4N5UA 3O9WD 1J0JA 4IOIA 1GH7A 4NNXB 4GAJL 4NO2A 4LQRA 1QUNA 3QULA 1JNLH 4PEEA 5JBDA 2VQ1A 3V6FA 4OM1H 5IJRA 1DP0A 3BUYA 4UQ2A 4RAUA 5FM5M 5AAMA 1UD2A 4IDLA 4C56A 5I6SA 4YX2H 2CERA 1GOGA 3T4AB 1LG2A 5F44A 2AQ2A 1IM3B 5E8DL 3LS4H 1NBZB 2KQNA 4QEGA 2W95A 1ZHLB 2BVDA 3P0YL 2DM2A 2BXYA 3WFCH 5IHZA 5ITFA 3M46A 4C4KO 4Z7VE 4PJBF 4PRBA 2J5LB 1CR9H 4C83B 2YKLL 2GJ6A 3QJHA 5I1IL 3ECBB 3INUH 3PDOB 3OKEB 2V3GA 2NXZB 5EBWA 3U7WH 1FN4A 1JGEA 1PD6A 1PGRB 1NFIA 4MS8D 2YWYA 1HINH 1KQYA 3VW3H 3MLUL 1J8HD 2P44B 3ULVC 3MBXL 3CZGA 4AG4A 3VXNA 2X70A 4YXHL 1FLTX 2XGBA 1K8DB 3CMOH 2WWMC 1CT8B 1MVFA 4MJ6B 3GH4A 1WFNA 1QLFB 2ZWYA 1ZA3B 5GS2H 4NQXA 1A7PH 3LKNA 1U58B 3TVMD 3RVXD 4P3WA 5TF1L 5FF6A 4FQIL 2W9DH 2W87A 3QISA 4O58L 5FYJE 3PWLA 2NXZD 5BROA 1VFBB 1KGUA 1NWRA 2PTTB 4HAFA 3WD4A 4TSAH 4Z7WE 2Z92B 2G3JA 4A3YA 4HMCA 1I1CA 5F1OB 4CN4A 3L1OH 2I9TB 1WGOA 4I4WB 4KUCD 4U6VL 5MHSE 2QSCH 1UM4L 3HI6H 2BNQE 1YEIH 4JFDD 1OCWH 4G9FE 2XSAA 4WW2A 2HJKB 2BY1A 2IFGA 3U37A 1LK3L 4XPFL 1DQDL 1N6QH 4RA3A 1C8XA 2JIXB 3DSFL 4RGNB 1EFXA 3P0GB 3DGGA 5D7IB 1TNMA 2HWZH 4XXCA 3SKOB 5K9JL 2GKIA 2OJEA 1FL3A 4JFXB 3KJ4B 1DLFL 4LYQA 5LCVL 3E6FA 3CSBA 4FQXB 3S37H 4A3ZA 3EO9H 4YLQT 2E31A 4JIEA 3WMCA 4M00A 1KEML 4UI2A 3OMZA 4TULH 2EDFA 4RE3A 5C09D 1QSEE 5IV2B 3N0PB 5F3HA 3U0PB 1JAEA 3BPCB 2BC4A 5CSZA 4GMTL 1G7HA 1P5UA 3O6LH 3SE8H 2C9KA 4Y1AB 4X0VA 3QEHB 1K5NA 3WNLA 2FRGP 2VDPL 5DI8B 1UJ3B 1BAGA 4H88H 5DJYA 2ZX6A 5LAXA 4PMOA 2F53A 3FT4A 1XGUB 3X12A 5B8CC 1TXKA 4XB3A 5I71B 4HS3B 2F54E 3MNWB 1LO4H 3K81A 3MRKB 3TN0D 1CE6B 4PRHA 4L1DA 4G8FB 1MHEB 3PP3H 1LE5B 1HJWA 2ZUSA 4GRLA 1G0XA 4CVXB 1RV6X 2ZCLL 5DUBB 2VMEA 4PMVA 4QLKA 5FO7A 3DYMA 5B8CB 5LXGL 4U31A 5GS0L 4Q9RL 2AQ3A 4PRIB 2PO6A 2XI9A 2G3NA 4ZFFB 2XXMB 4XPBL 4L4VE 3ZDYE 3RY5A 1HHKA 3SUUA 3ARXA 1KT2B 3MX0A 5LJYH 4UOW0 1GPOH 1CBGA 1QEWB 1NAMB 1PFCA 4NHUA 4QRQA 3Q48A 2VN4A 4CAGA 3EO1A 1DDHB 4KHTH 2FBJL 3GMMB 4KI5M 4F15C 4N9GA 4P5YA 1ES0B 1WZKA 2CHNA 3EOAB 6A3HA 3I02B 4IRSC 4WWKB 4OIAA 4LPWA 4BUGA 4FQQB 1TITA 4MXWH 1PX4A 3SJVD 3JV4A 1RUAH 4FS0A 4X6CF 4XBPA 1CDHA 2ZNWA 3GIVA 3MBEB 3P3YA 5TH2B 1XGZA 2XIBA 5A2AA 3S9DB 3TPUA 1WVZA 3RCNA 1LK2A 4KKLD 5FCUH 5C0BD 5BXRA 1IGIH 2VXTL 1D6VH 4P59H 1CLOH 4Y7EA 4D9RE 2D2OA 3MJ7A 4IRJD 1CIDA 5E08L 4YQXH 1WE5A 1CX1A 2X9XA 3BEVB 4OZFB 4ELME 4LLQA 2XVNA 2V5SA 4JFFB 2BDNH 5EMYA 3LQCA 2VQUA 3NIGF 3I6GB 2EDWA 5F96L 4MQ7B 1NBYB 1I9IH 1AKJD 1RZJC 3QQ4B 4XP9H 3ZYZA 2DYPB 1KCUH 2X4RB 4QRPD 4X6FA 3VGFA 4JN1L 5F7EH 4JRXE 3P73B 5SX5K 2XRAH 2IPTH 1UCBH 1ZT1B 1PG7H 1RMFH 2ATPA 3BP4B 4G6ML 4YX2L 1OP3K 1T80A 3QA3A 5D71H 3ZL4H 2FWOB 5JW4Q 2PN5A 4Z7UA 2WW8A 1OPGH 4G6AC 5C0AE 4P23B 1AO7A 2BV9A 4JFFD 4AJ0A 2YA1A 4W5ZA 1PZ5B 1QVOA 3CUJA 5FYKU 2J2ZA 2VLRB 5J56B 4UI9L 4KVNL 1BOYA 2ESVE 2YKLH 3KXFE 5GGVY 3HZYB 4MA7H 4WUUB 1K42A 1RJCA 1XFPA 4R26L 1UWGL 4WU7B 2UZIH 3P9MA 1AGCA 4YN5A 1A3LL 1DJSA 3NBNA 3TBWB 3DMMA 3HPJA 1BGAA 32C2A 1T7XA 5JMRA 2W1NA 2E6JA 4F7MA 4M8QA 1MCOH 2P5WA 1QRNE 4PV9A 5GGRY 3GMQB 3RKPA 4OQ1A 4KRPC 1AP2B 5JDSB 1A7PL 4ZEPA 4HPYL 3IS0X 25C8H 4HJ0D 4AYFA 4QRUB 2W3JA 4ETQA 1W3JA 2HN7B 2YBRB 4KKBC 4KI1A 1FFPA 3DMMC 2O26U 4OM0L 5D2LA 2E6QA 3U4BL 4Y5VA 1A9EA 3O3EA 2XONA 3GUTA 1OAYL 1DHKA 5IGXL 3GSNA 4OZHA 4MXVF 3L1OL 5JA8B 3CFBA 4Q9BA 2BVUA 2EIEA 2EDNA 4Z7OE 1J1PH 2F15A 1OCWL 2H3NB 1HHJB 2YPKA 5DD1L 1QACA 5KSBA 1E43A 3F5KA 2PYED 5F89B 4E41A 4AT6B 5KVDH 1X4ZA 4WI9A 4PJFB 2NY1C 4LSVH 5JW4M 2DQDH 1EJ6A 1WT5C 3C5JA 5K9JH 3K80A 4Y4FC 3NJVA 1F4YH 1L8NA 1DLHB 4LP4A 4YHEA 1SJXA 3HNSL 1FNFA 3FB6A 1SR0A 1U33A 4YHZL 4NJ9H 3IAGC 1MCPH 1HH6A 2XICA 1WIOA 2A3CA 4KK5C 1ZLSH 2AGJL 2HT2D 3M17B 4HGWB 3FO2B 2ITCA 3E1F1 1U6AH 1QBAA 3UERA 1T83C 3W5MA 4NGHL 2DF3A 2WN2A 1I7ZA 3GXIA 2GJZB 4MB4A 5IMOB 1BOGB 3RWFB 3PXHA 1YEKH 3GSRB 4YE4L 3AIBA 1E4XI 2FX8L 1JMXA 4NSKB 5F1SA 5CGMA 3WBEA 2ZCHH 2MTPA 4TSCH 1QQDB 4PJ7A 4LDEB 5DJDB 5EBMB 2YC2A 3MLYL 2P5EE 3BE1L 4Z7UF 4CUBA 3CK0H 1AC0A 5GRZA 1J05B 1CFTA 2BNQD 1KLUB 4W84A 1W9TA 2ENSA 5D1ZB 4GQ9L 3DX8B 2VLRE 4AD2A 5ISZA 2B7DT 2LQRA 4Y5YB 4QB2A 4X5XB 4DVRH 5DHVA 5E9DD 1M71A 4JLRA 2J75A 5IBUB 3PWPA 3IU3A 3U0TA 4KK9D 4NO0B 1CDYA 4PF1A 2D20A 4HT1L 4JHWH 3VTRA 4KRLB 5D4YA 3KLSA 5F6IB 6CGTA 3O3DB 3BIBX 3QUMH 3QWOA 4M48H 3CLWA 3EZJB 5IVXA 1BYCA 3RPIA 3AS1A 2OSLA 4RZCB 1Q9OB 1TVDA 1FYTA 3SJVA 1GAFL 4EN3B 1WUNT 1WBXA 3DRQB 4YNYA 1UACH 3ZE2F 3HZMA 1Q94A 1UZ8A 3HR6A 1UWXH 3P9LA 4GRWE 4Y4HB 3WH8A 3AMKA 3L3OA 1A9BA 3PZOA 3F7YB 4J23A 4LU5L 4XP6L 2NY2D 1G7PB 4J8RA 4KPHL 3G9VA 4OCSL 4FFZL 4LDLB 3L5XH 3BH9B 5KANI 4O5LL 3LKQA 4Y16D 2NY0D 4POZC 4LQ1A 3SDYL 2J7DA 1DUYB 3BT2H 4GS7C 2H32A 4LVNB 5DJCA 1Q0YL 4CVWA 5C0JA 5FDWA 2VZUA 4QF1A 3SE4C 1K12A 2UY7A 1F45A 3EJYC 4CD6A 1B3WA 1TTFA 2X4PA 4PBGA 3ZMRA 1I1XA 5HHXL 4WI5A 3LKPA 5D5ME 1OTSD 4MDJA 2AJYL 3VDBA 5DMKB 5CJXC 2HT2C 3AS0A 5GJSL 5GRUL 3N50A 4M9OA 1E6NA 4GG8A 4TXWA 2P8PB 4AEIH 1OGAE 3JVGC 1KB3A 2C3VB 4HLJA 1NLBL 3MUGB 4EIZC 4HS6B 2L0DA 4BQ5A 4NQSB 5IOPA 4F9PA 1WISA 3HTLX 2EPKX 1YUHB 1B3ZA 2F58H 4GG6F 3ACGA 3PHQA 5I8KL 4U1NA 3IDJA 4X80L 4HIEA 4IMKA 2QQJA 2XZQH 4WFHE 5DVMA 1JGUL 3MLXL 3S37X 4GZEA 1I1AC 1MJ8H 4I2XA 2FCBA 3WHXA 1NC2A 4OM0H 3FCTA 3KE0A 2NR6D 1R87A 4PREA 1K6QL 3MRDB 1AQDA 1GORA 3QFJB 2D9CA 3ZSSA 2FATL 1ORQB 3H7LA 1J1PL 3ARFD 4GW5A 4EN3D 4XMLH 5DK2A 2RJ2A 4HDIA 3VI4E 4YIQA 4B16A 1FCCA 1A1MB 3BGFC 2PBOA 1AGDA 2DQDL 4YJZL 1FP9A 5DQ9B 3ARZA 8FABB 2FL5A 4G9FA 3QDJD 4HWEL 1KLGA 1KTKE 1HXJA 1MCPL 4JPIB 3W28A 4NRRA 2Y9RT 5DRWB 2EDJA 2IALB 1DL7H 1LO0H 1DBJH 2QQMA 3ULVL 1MAKA 4TNVF 4XWGL 4MDPA 3B8SA 5J8OA 5MEOA 3MUJA 4PGCA 1ONQA 2CUIA 5GSVA 2OYMA 1FVEB 5HHPA 1I1FB 1WNOA 1ZBCA 4ATWA 3EYFA 1X7QB 3D0VA 3HE7D 4YXLH 5IFAH 1WF5A 1YHTA 2CIIB 5EC1A 2R23B 3GNML 1ZANL 1PBGA 3QI9C 1DUZA 1IGTB 5D7JC 5L0QB 3JTSB 1TA3A 2MWCA 4Z0BH 2BZDA 3BJ91 4RQQA 1HKJA 1KENL 4HJGB 2F54A 1XGQA 4GKZA 3QEQE 4ZUSA 4KDVA 4NZCA 5E9AA 4O51A 2BOBB 3WS3A 3B5HA 4OLYL 5JTWA 3MV8B 2VN7A 3QCVH 5FM8A 3I2KA 2DI9A 1MEXL 1L7QA 2Y8KA 4RL3A 1YPZF 3B2VH 1JU3A 1C8YA 1FC1A 1P6WA 3FQUA 3IFOA 4MD0B 4TPRL 3KPRE 2NXYB 4RFOL 1LLOA 5DHVH 4G8GB 5K59E 4PB0H 1T89C 2GAZB 4WFHD 4URIA 3ARFB 4LSRL 2HFGH 1N64H 3DECA 2V38A 5LG1A 4ZOBA 1CYGA 2JCCB 1NMAL 1NAML 3MA9H 4DGIH 5BVPL 4IRSD 4P2QA 3KS0H 2DWEA 3HRPA 3MV8D 3IF1A 2Z35A 1WCGA 4PJHA 1M7DB 3P4OB 1QNZH 3D9AH 4Z76A 5IFPA 1VJZA 1BYBA 5CZVL 3OA5A 2AJSL 2R1XA 4BH8B 4LYPA 2HTKD 4LGRB 4MNGE 4ISVB 1I7TB 4JGJA 1T4KB 4BFIA 1PQZB 4AISA 1MLCA 3L5XL 4O5LH 2ICWJ 3RI5F 3G5ZB 1FPTL 3OGCA 4PJ9A 2ZG2A 4GKNA 2DM4A 1OAKL 2P8LB 2BJMH 1TZIB 2AJVH 4L29A 3S36L 4QCIB 3C5ZD 3MACL 1B3XA 5T1DH 1ITBB 5KOVC 5BVJA 2JK5A 2SEBB 2F19H 1EEQA 4M1DH 1JNDA 2HFFA 4OIIH 3T08A 2WVTA 2GFBA 1AXTH 2UUDH 4NPYA 4MQXC 1CGXA 2A9ML 5GRUH 4XNUL 5IG7A 5CJOH 1CD1A 1XH1A 1I9RL 4NZTL 5EU4B 3KR3L 1P4IL 4TTDD 5GGUB 5HDOA 4UILH 1UD4A 2FZ3B 1HXMA 2VCAA 1H8NA 2WCGA 4YUEH 4AIZB 4A6YH 2PKDA 3MRIB 4N5ED 4G3YL 3PV6A 3U30C 3H8NA 4MAYC 3ARDD 5I8CB 1FV1A 2WVVB 5HPCA 4MNMA 4WUUE 3OL2A 1KSRA 1NGPL 2XFXB 4FQ1H 5BXFA 5A94A 2X2YA 2E5EA 1IAKB 3BDYH 4KI5E 2EDQA 5LVEA 4MD5B 2OWWA 1TETH 1K6QH 5H37G 2VQ1B 5D8WA 5FYLH 4FFYH 2ITDB 4O2EB 3AISA 2UY6A 2GT9B 3MV8E 4U0RC 5SWZD 3WUWA 2GY5A 3IDXL 4N8VG 3H3PL 1ND0B 3ARUA 2APFA 4XNXL 1IGCH 4GBXD 1F3DJ 5DK0A 2WWMD 3WIHA 4BSVB 2AJZA 5CYYA 1T0NA 1H8OA 3O2DH 4HD9A 1HDMB 3JZ7A 3ZO0A 4JFQA 2FSEB 1OF4A 1FZOB 5IW3A 3KPRD 5HJ3B 1QP1A 4LHSA 5DC9B 3EFDH 3VDAA 4NFBA 1BX2B 2DQIL 1L7TH 2AI0H 4UUJA 35C8H 4HXAL 5JR2A 3N11A 4RE4A 3W53A 5GNXA 2EJ1A 2GDUA 5D70L 2B0SH 3NFSH 2LU7A 4DKEL 2VR9A 3A67H 3NFNA 4N8CL 3UYPA 3OR6A 1C8PA 1BFSA 2C7UA 5T3XL 3T3MF 4PY8I 3BESR 4YPGA 3IDAA 1BIIB 3BI9X 3VXNB 1G0DA 3PJSA 4YHIA 3O2WH 3U83A 1T5WA 4H26B 3S4SG 1R5WA 2UZXB 4EI5C 1MPAL 2Y6HA 4EE9A 5E1HB 3O6MH 2I9LA 3QZWG 4J7RA 5FKAA 4EI6A 2FB4L 3PWLB 1VFAB 1MVUA 3NIDF 3E6HA 1C5CH 1N26A 2Z92A 4NWUH 1E4XH 1J18A 1JL8A 3UP1A 5IDIA 5EBLA 4Q9CA 1Q4NX 1P84J 2P5EA 4NT6B 4WWKD 4DN4L 1AVAA 1S7UB 2VZ3A 3AIEA 4AD5A 4Z2JA 1K9TA 2JIXA 2DQEL 4UMGA 4JHOA 4Z0XB 4Y19B 4NOBA 5KZCD 1E4IA 4CBPA 1U0QA 3P6BA 1A1OB 4JFXA 2D7MA 5DJ0A 3B9VA 3MO4A 2A3AA 3BPLB 1E3ZA 4YK4C 1T7YA 3BAJA 2F8OA 5JO5A 4FQLH 3KJ6L 3RWJA 3SE3C 3M8OL 1NMAH 4DGIL 3VWJC 2WAGA 2OYKA 3A6BH 3PHOB 4JFUA 4G42A 4LLDA 5T1MA 2E8ZA 3T1FA 1MQPA 3U82B 4LEXH 5L8JB 3JUZA 4S1DC 4I8DA 3G9AB 1ZHBB 1XR9A 3GJFK 3WENA 3FRPA 3D48R 3ALFA 5CZVH 5IVZB 3T0EE 2DLFH 3E2HB 4PUBH 5DWUL 5A16B 2V5DA 5DEFA 1BVKA 5HGAA 4JHAH 4D1IA 3O8XC 4R7NA 3A21A 2HT3D 1MJJB 1QRNA 4D8MA 3MNWA 2XZAH 1JWUA 4Z8FH 4OKVB 1MHEA 3PWVB 1J1OL 3UTSE 5IB5A 1E6JL 5JQ6L 2DQCH 3G08A 5KS9A 1KCVH 1VACA 3N15A 3L5WA 4FNLH 4YO0A 3CHFA 4PRIA 4HOZA 1SMAA 2AJVL 4WUUD 3MLSH 3I75A 1XIWD 1TJIL 2NNAA 2Q3ZA 1WDRA 3RWHB 1ZL1A 1A7BA 4UNVA 3BN3B 4LSDA 1KT2A 1MQ8A 1J0HA 1GUVA 4QXGH 1E55A 4J3UA 2WSKA 2NQCA 3HNVL 1PMJX 4WK9A 1WCQA 1AXTL 2MHAA 5SWSD 3U7BA 4MNQE 4KAQH 3GMMA 3ULVF 2FDMA 3GO1H 4APQA 3SDCC 3VXMB 4M7KH 3BPLC 4UOW1 4UILL 1OAQH 1UXSB 1OHQA 2X44D 1BQCA 4ZODA 1QO3A 4AEEA 4JM2A 4A6YL 4HIHA 3VWJB 2YBTA 3KZSA 4CMMA 4XNMB 5HHMD 1H15A 4KTYA 4FXGB 4U1MA 4ZAKD 2ZX5A 3GYCA 5IROC 5L2KB 4R2GD 1HQRA 1J88A 5KAQG 5KEZA 1YEJH 1JTOA 1A64A 1DVFD 2ZIDA 1U41A 3MRCB 1KIQB 2B1HH 2NX5A 5CEZE 3BLPX 3FB8A 3PABA 3D3VE 1PEZA 3OKNB 1UR0A 3VFWB 2UWEB 1KPVB 3QQ4A 1TZGL 4FQCH 4L3CB 2JKXA 1Q9KB 2ZSWB 3V5DB 1JPFA 4XI5C 2JCCF 3SE9H 3BEWB 3FO9B 3BWAB 5C8JA 5GZND 3BH8B 2I27N 5JMOC 4XNXH 4H5SA 2D0FA 1IGCL 4U1GB 3EDJA 4KH2A 4P2RB 3S5LA 3UTQB 4ZYKB 1ZA6B 2YLLA 1OAZL 4OV5A 4NRSA 1AO7B 3VFSB 1RZ8B 1UD3A 1NGZB 1FLRH 1UR4A 2VLRA 2YEZB 1S9XB 1K4DA 3HZKB 3I9GL 1EGJA 2FEDC 3F58H 3QIBC 4TNWK 3VFOA 5C0GB 4JFEE 1UXXX 1WBYA 3BX7C 4P8XA 4FQHB 3EHBD 1FZKB 4GAJH 5JMOA 1B3JA 3TNNB 4WU7A 4JKMA 3POCA 1HNYA 2BSRA 5JHLL 3TBWA 2YDSA 1LL6A 4OM1L 3QDME 4G7YL 1BZQK 1GOOA 5JHDA 1ZBKA 4ZUTB 3NJ3A 2NW0A 4EOWH 2P5WB 1V0LA 5I79A 3WF3A 1EJOH 1JK8A 1MPAH 3GMRB 3IJ7A 2OR9H 3QIBA 5JDSA 2VL5B 3OEBA 3NYDA 3SJVE 3LQZB 1V6YA 1CGUA 1HILA 3VXRB 3S35L 1JXJA 2VAAB 2VDOH 4TQEH 2CESA 3PE9A 4EUPG 3D18B 1E56A 1OT1A 2ZJSL 3LRGA 4LHUB 5E4EB 12E8H 3C5SB 1VB9A 3IJYA 1ECEA 1CXLA 1D5ZA 1X5ZA 2AABH 4OZHB 5D8JH 1IGFL 2YL5A 2HMID 3U7WL 2H26A 4OT1L 2WP3T 4I18A 1ZHKB 1WITA 1HHJA 2NY1B 4DN4H 5KSBB 5CPTA 4OUOA 1W9VA 1OH4A 4XMKH 4HP5A 2WO2A 4X99A 4MHHI 2PNDA 1G7JA 3QDJB 4K71B 4HK3N 2Q6WA 1MW3A 2G75A 3RKDD 1UZ6F 1NCDH 5DT7A 3LQAH 3TA3D 4PGEA 3K4DA 2DSZA 3N85H 1BQUA 4ZNEA 3QUXD 2J62A 1C12B 4P49A 5GS0C 1OARH 5D5MA 3UTPD 1V08A 4O58H 3M8OH 4RRPG 3A4WA 4E9LA 4M7LH 5IESL 3A6BL 4WGWB 3LIZL 5IK3A 5B39B 4PTWA 3PP4H 4JDVB 2F74B 1MXDA 1S8DA 3AOFA 4F9LC 3GGLA 3CHEA 4ERSH 3V9FA 4QB1A 2QSCL 2RBLA 4JRYB 3BFOA 1UM4H 3HI6L 5IMOA 3TO4B 2G9HB 3IFLH 2XIIA 3L9RB 3HE7A 3EDEA 1FZJB 3VIMA 3HKFA 4NSKA 1LK3H 4XPFH 1OF3A 3O0RH 3WL1A 5AYQA 3LE0A 4ZZ8A 4Z8FL 1AC6A 3GSVA 5DJDA 4DCQB 1G9MH 3FQTA 5DRXA 1Z9LA 3MOAH 5I1LA 1QRND 4ZUUB 2DQCL 4PLJC 4X8XA 1UB6A 3FTGB 1ZLWK 5HGBB 4W8JA 1XAUA 4H04A 4JCMA 4U4BA 5ACMA 5GGTH 2EIZA 3W25A 4ONFH 1RUPL 3OZ9L 1QR1A 3O6LL 3MMDA 4S2SB 1CS6A 3ET9F 5BRQA 1J1XH 2MKWA 5BXPA 4HFUH 3OXSB 5F8QC 3HZVA 4PPTA 3IU3B 1X1NA 4TX6A 2EDDA 3OAZK 3P0VH 4WWID 3R06A 3UDWC 2P24B 4P4RB 1NAKL 2AAVA 2GK0B 4Y8AA 3UZQA 5EPMB 4C56D 4P46B 3FAXA 1KJVB 3U7VA 2VDRH 1T04B 3BO8A 3ETPA 5E1AB 1DWFM 4AY1A 3WD3A 3TO2A 2GDVA 1OD8A 2DCJA 2DJSA 2HAZA 2VTFA 3WIHL 2VCBA 1YEJL 2E9LA 4JFYB 1EAPB 1OGGA 5LWYH 5FECB 4P5KA 4YH6A 5E03A 1YMME 5FYKL 3QRGH 4L9LB 3WD1A 4UQAA 4PJEF 4PRPE 3AAZA 3F7YA 4HPOL 5KW9H 4R4FH 1UXWB 5I1JL 5JA9A 2FBJH 4C7GA 4AZGA 3FN0L 3TA9A 3VFNB 3FRUB 2EECA 1E4WH 3GI8L 1DR9A 2WZIA 5FA3B 1OP9A 1ROWA 4BZYA 4BQ4A 4MXWL 2GTZB 5C0IA 1D3CA 3DVGA 2EXYC 4XNQA 2FGZA 2CLZB 5TQ0H 3CIHA 3LRSB 5IB4B 5HHQB 1C92A 4Z9KB 3RDTA 2Z1KA 1D6VL 4P59L 4W5UA 2JJTC 2FNBA 3O4LA 3NCBB 4YGAB 1FH8A 1B3VA 1L0XA 2P8PA 4WF7A 4B9YA 3V4UH 4N0YH 4ZQKB 2GJRA 2R1WA 4XP9L 3MXWL 1UYXA 4G7YH 3WFZA 4HS6A 4P7QA 3A47A 5E9DE 2UY4A 1ZAGA 3KPNA 1XMWA 3GBNH 4FQXD 4OD1L 3DJ9A 1YA5A 4Z7VA 4G6MH 2YDQA 1HN1A 1EX0A 5C0AB 4N8VB 1D9KB 2GJ6E 1MF2L 5GQBA 4AEHL 1ZB5A 1XF4B 3BDXA 3IJSB 3SQBA 2XQYG 4W81A 2VITB 1P4LB 1OPGL 3P4NA 4HKJA 5JQHC 4AAXA 2Z4QB 1FP8A 4JG1L 4QTHA 1DSFL 1LJYA 1R7OA 2G5BB 3UG3A 1KB9J 2KUTA 1AD9A 4XCYB 1QFUL 5AD0A 1I8LC 2JELL 1ORQA 1JCKA 4WU5A 5C08B 3GNOA 1H5BA 1MFVA 4HDIB 3SCMD 4JFHD 2OMNA 4ZPVB 2XGIA 2DT0A 2P49B 4R6UA 3C60A 5B39G 4H2CA 1OB1B 4JJ5A 1I1YA 4Z7WA 3N85L 3SDDC 3PBGA 1S5HB 4X9IA 5JW3H 4X4YB 4CUAA 4Z77B 3PZ9A 3T77B 3QZWB 1GGUA 2D31A 2H41A 2Q86A 4XP4L 1I3UA 1QTYT 3AM8A 3DV6B 3HS0A 5DYOA 3F5WB 5A6BD 5DEGA 3NIGE 4PGCB 5GGSY 4D3CH 4NP4L 4Q0XH 1EGJL 3PZQA 1JGDA 1UGNA 3D2UA 3EUUA 4PJ9D 2XWDA 3PDGA 4FXKA 1QPXA 5IMKA 1HX0A 5IW6A 1ZVSA 1Y7VA 3C6LD 4TRPH 2W07A 5ILTH 4P8VA 1UYWL 5EC1B 4PJ7F 3RTQB 4ZDHA 4LSVL 1MQKL 3QR2A 3DRTB 1IGTA 3C5ZB 1R24B 3NCJL 1SYTA 4QDSA 1TA3B 2YDRA 1BM3H 3NCYP 4RGMC 3N1FC 4OGYH 4PJ5A 4LMQI 4X5WA 5C0BA 4X5LA 3UJTL 3A7QA 4XX1E 2F54B 5FUCC 2AGJH 4ONGH 3GSUA 3KGRA 2ORZA 4MAYD 3RTQC 2F53E 3GMNB 1CBVL 2IPUK 5JXEC 3LKSA 1RUPH 3MV8A 5CKGA 4LSPH 4P3CH 3NH7L 4P9HL 4WEMB 4YDVA 4Q7DA 4HFUL 5I6XC 4NGHH 3RTQD 4W7UA 5JBEA 4OLXL 3VUPA 5J11C 1OQXA 4PJ8C 2YPVH 4WFFD 2IGFH 2BRRH 2FX8H 1VF8A 5EB8A 2X5PA 2ZNXA 1E5NA 1W9SA 1N2RA 4S1QH 2DEPA 1DWHM 3QG6B 3KL3A 3C8HA 5FUOH 3WSOA 5C6WH 3TESA 3V0AC 3VI3E 3T0EB 3MRMB 3D6GA 4U6XB 2DQJL 3VIFA 2CKBL 2XN9B 3OPZL 1JHTA 5C9JB 4X0NA 3CU1A 3TYFB 4Q6IC 1CGYA 4KJYB 3U9UA 4BSJA 3CLFL 3MV9E 4HPOH 5KW9L 1E28A 2F5BL 3RRQA 4R4FL 1I7TA 5TE7H 3ARTA 4PP1C 2GITA 5CZXC 1PQZA 3FN0H 1JNJA 1KR0A 3D3VA 4LVEA 3ZE0E 1ACZA 3G5ZA 1JDDA 3OXRA 1R7AA 3MJ9L 4TUOB 1R3HB 4PJ9B 4KKCC 2P8LA 3V5KA 4L4VB 1AQKL 5F70A 4HX1B 4RIRA 3Q3GB 3VMOA 3QXDA 1CECA 4GSDH 3WUGA 3SGEI 1MOEA 3RHWF 1T1XA 1RZFH 3KPMA 3AB0B 5DJ8A 3UAJC 1OAXH 1UACL 1V3MA 2NY5L 4Z5RB 1CVRA 3OAYK 4L8SB 5BCAA 5I1HL 2VC2L 3HJRA 1G9NH 3THDA 5C86A 5CUSH 5IJVA 1P2CB 2XM1A 3C7OA 4MAYB 4PR5B 1SJVA 4XP6H 3ULUL 3E