2X05A

Inhibition of the exo-beta-d-glucosaminidase csxa by a glucosamine- configured castanospermine and an amino-australine analogue
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
851
structure length
851
Chain Sequence
AGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title Inhibition of the Exo-Beta-D-Glucosaminidase Csxa by a Glucosamine-Configured Castanospermine and an Amino-Australine Analogue.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 275
structure length 851
sequence length 851
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x05A04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2x05A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2x05A03
3VXQB 3L5XH 1FLTX 3IKCB 1LE9A 2WQ8A 3BQUA 1QUNA 1PX3A 5I1KH 1H11A 4YO0A 3QXTA 1ZLVK 4FQCH 2X4PA 2GSJA 4MJ5A 4QT5B 3RTQB 5JBDA 3VCLB 1KG0B 1OAXH 3QB7C 4F7PB 4UAOB 4Z8FL 3MLRH 1HJXA 4CMHC 1RU9L 1JDAA 2B20A 4Z7WE 3PUIA 1JPFA 5FCZA 4EUPB 2YR3A 1S9WB 4ZZ5A 5JUVA 4GW1B 1DUZB 3OJVC 3ZTJG 3G6JB 4R7DB 5E9DA 5GSVB 1B0IA 3KEHA 4WWID 3AIBA 1O7SA 1QNRA 3EKCA 5E03A 3OKNA 3RPKA 3RWFA 1MLBB 4FG6D 3QHZL 2WAAA 4DTGH 1JDDA 3GZAA 3GJFA 3MLXH 4PV8A 1EZVY 1BYBA 5LJYH 5JNYA 3MV9E 1FL6A 2GJPA 3ZYJA 5HYJA 4QHNB 1OD0A 3DMMB 3NUKA 3WDIA 2DSKA 4JPIA 4H8VA 1FZMA 1HE7A 2ORBL 5JZ7D 4QLJA 2WINA 4HWEL 5DMGC 3ZTJH 4WO4B 2DQXA 3NIFE 3MV11 4XNQB 4HIIA 3AXHA 1KQYA 4CMMB 1RJLA 1OM3H 4OM1L 3HG1D 4JHAL 4JQXA 5CP7A 4XCCH 4MXVF 1JWSB 1OAZL 1UZ4A 4JO1L 2CSPA 5DQDH 4L9LA 5A1AA 3MJ6A 1J84A 1E70M 5DD6B 3S88L 4MNLA 1LP9B 1OSZB 4M1RA 4UT7L 2J7LA 1CI5A 4OCXL 3ARZA 3B43A 3IDIA 1JNNH 3PJSA 3VD4A 3I6LD 4JQXC 1P7QA 5FDWA 2DTSA 4QHKJ 4UR9A 4RGNC 4L9LC 2EEAA 1MVYA 2OJZL 5TH2A 5MI0C 2R7EB 1KELL 1DN0B 1ETZA 3R0NA 4P7RA 1L7TH 4OCWL 1V6YA 2A9NL 5FGCB 1WB0A 4Z76A 3C7EA 5DK0B 2C5DC 1OTUD 1EFXB 4KRLB 5D1XD 3V6OE 1C92A 2GK1B 5DN2A 4FZEL 2CH8A 2B7DT 3AZRA 1NC2B 2IAND 3WLWC 2FJFA 1OAQL 1QLEH 3IGAB 1WAAA 1E4KC 4EI6A 5I1EH 2FEDC 3JV5A 5M95B 4XVJL 2CITA 1HXYA 1LO2H 1U8OB 4JE4B 3WUBA 3B4NA 1RZKL 4LCIH 1ZU8A 2R8SH 4NO2A 2VCCA 4R97C 2VLJE 1Q1JL 4N1HB 2FIRT 3OR7B 1H6XA 2GSIA 5GGSA 2WMGA 4P23B 4WUUA 5I24A 3EYOB 3QA3A 4XI5C 4TUKH 3CHCA 4U6XB 3OAUL 4JIEA 5CG0A 4F80A 1HSAA 3HE6D 4PPTA 2RHEA 3RA7L 2A3AA 2V5CA 1ZLVH 4DXSA 1KB5L 1DFBL 1ZHBB 4H25A 1NSNL 1LNSA 3EO0B 4LIQE 3VH8B 5KSAA 3LE0A 4E9LA 3UPRA 4FQPA 1VGKA 4WTZG 4UDTA 3RWCA 1OCWH 4MDOA 5D8WA 3MRGB 5DURB 3EDEA 4IS6B 5HYSG 4OLEA 5BW7A 3RO8A 1ZHKA 3IXAA 3SEEA 4R4BA 5ADPL 4RNRA 2VDMH 4P5TB 3IFLL 5CIPB 3ULVC 1ZSDB 1IAIL 1XF3B 5D6CB 3SDDD 5KSAC 4GLRI 1FO0L 4CU7A 3MV7B 5MEQA 1W9VA 3BDBA 3CVHB 3E1F1 3AFLA 4LSUH 4OB5H 2DJ4A 4DN3H 2B5IB 5JR1L 4XP4H 4NJ9H 4QDSA 4F37K 1NCCH 1NKOA 5EORL 4UILH 1A7BA 4P7QA 1DLFL 5KBNC 2EJ1A 2JCCE 3WXWL 4HUXA 3KLHC 3QHOA 4CN4A 1EGZA 2HT4D 3P0YH 5ACZA 4FZ8H 4D6JA 2M8XA 1QRND 2H2SC 1E6SM 3GI8H 3F8UB 1WGOA 3PIQB 1VFUA 1E1EA 2R39A 5BZWB 2J47A 5E5RB 1CDJA 2ZEXA 5IW1A 5BXFB 3RM4A 3U7YL 5GZND 2Y07L 1OWRM 2EYRA 1MW2A 3FQUB 1FBIH 5ACLA 5HI3C 1OSEA 1BVLB 1MVUA 5TPWH 3MXVL 4PRIB 4PJ8A 3VGHA 3CU1A 3ISWA 5IIEB 4ARXA 2YPLB 2HP4A 3QUXC 2UZIH 3HMWH 5HHPB 3DVGB 3FFDA 4NN5C 3NCOA 1CGVA 1EFQA 3B9VA 3BYYA 3A47A 1T0NB 2DQDH 3C5SB 3KYNA 5GISL 4J28A 1YEIH 3CKHA 1PD6A 1L9MA 1XHGA 2HISA 4JHBA 4CBPA 3O4LB 1JF1B 1ZBWA 2XACC 3H9YA 3JV6B 4PJ8C 1W1TA 1HYSC 5HPCA 2NZ9D 2NY0B 4LLWA 3PZIA 2ID5A 5CYYA 4M7LH 1U3HB 4Y5XA 5CWSB 1R24B 3QGVA 5I17A 1NEZG 4EKJA 4UNUA 1YEGL 1BHGA 4JJHA 5F3BA 1DQJB 4DVRH 4U1IB 5L9DL 1HP4A 3IDGB 3NTCL 4S1RH 4K7PY 1QQDB 3BO8B 1U3YA 1KC5H 4UV7H 3PUHA 4TNWF 3U7WL 3HG1E 3TBYA 4YIQA 4NZUH 2ERJC 2DQCL 1PG7L 4MXQD 3P77A 4TULL 1O5DT 2Z91B 4HV8B 4MNGA 3OLEA 2D7TH 1A1MB 5EN2B 1FQ9C 1QYGH 4Z7VE 1F6AA 5E2WL 1CF8H 1ZAGA 2IQAB 3GJFH 4JM4H 4KV5E 3V95A 4W8JA 3MRLB 2YD2A 2Q76B 3I6LE 3TN0D 5ANMB 5FDYA 3O8XB 1Q9LA 1TIUA 1KCSL 1JYVA 3H9HA 2Y24A 1SHWB 4ODUA 1AFVL 1Z5LB 1C16A 2EC9T 3TVMA 4D9RE 4U0QB 2ZX7A 4OLWH 4IJ3B 3SUVA 1T3FB 4K3JL 3MRIB 1GHFL 1EJ6A 1SMAA 3I6KA 3Q0HA 3VRLE 3PQYA 1D7PM 1KGXA 2P24B 3I2GA 1VIWA 2V7HA 5JMOA 2IANE 1KR0A 4TSCH 4WU5A 3WFHB 3AS2A 3WEMA 4OZIF 3HE7B 2V2TA 1WISA 4X6FA 2RCSH 5C0AB 4K9EC 5D2LF 4HXBL 2HJFB 4LOUC 5D1ZA 3DNKA 1U8IA 5AWNH 3QSKB 5K9KA 2AJ3A 2CHNA 1Y18A 3IDMA 1YC7A 1GZQA 1NAKH 4RMTA 1O7VA 4Z7NE 3FAWA 1W2KT 5I74C 1T03H 4DFHA 2YUWA 4PMOA 2VDKH 3GNRA 2XWJB 3DV4A 2ZSWA 1I9JH 3IFOA 4ODTH 4Q6IB 5HBFA 4Z7UB 2DSVA 2WCAA 1ZA3B 4YBLC 5I18L 4JDZA 4WSJA 4Q0XH 3VPLA 5T1LA 5ETUB 2J4WH 1KEGL 3QFDB 3L4ZA 3FB6B 4PY8J 1NPUA 4PP2B 3QQ3B 1DE4A 1JZ5A 4AD4A 7A3HA 3G5ZA 3BW9A 3W28A 4DUWA 1U9KA 4I2XA 4YXKL 2LVCA 5ADOH 2J1RA 4ORZC 1E4XL 4QTIH 5E2VL 3D18B 1CFSA 1K4DA 3U0WH 3O0RL 4PB9L 2CKBB 1VCAA 4JR9L 3DI3B 4XBPA 4HPYL 4I5BA 1T04B 4AEIH 2DIJA 4JDTH 1A9BB 2UZYB 1G7PA 5HHMD 4YHPA 3AAZB 3B9EA 2YA0A 1VFFA 4XPHL 5F7EL 5JDJA 4KUCD 5C07A 4KK5D 4DM1A 2PF6A 1GOGA 4NN7C 1G7MA 3CSYB 4JQVA 2PXYC 3WH7A 4O58L 5IB2A 1F2QA 2VDRH 3VIPA 1UEYA 3D9AL 3S37L 1I3RA 2R4SL 3ULVH 5D5MF 3VW3L 1TCRA 2UZXB 4QWWD 2DQHH 3QFJB 4IRSA 4L3EA 3P6BA 3OKMA 5FOOA 4GG6F 4QB2A 4D6IA 1MPAL 5DZOA 4UFHA 5CSBA 4QCIB 1QP1A 4EN3A 1IGYB 2P5WA 1PKOA 1QFWL 2D23A 4AIEA 3JV0A 1NGQH 1DBBH 3QHTC 1JP5A 4ZENA 2APFA 2WC4A 2ARJB 3WKMH 4P3DA 4L4TA 3KPRB 1CXHA 1RZFH 3GK8H 2ORXA 5I78A 4IRZH 1KIRB 2WMJA 2VDPL 2W0FB 4F7MA 4JFEB 1NANH 2OR7A 3WH9A 4LLUA 2DPEA 2G3NA 2WWMD 4RAVB 4IRJB 5E5UB 1AE6H 1R5WA 3RUGE 3LKOA 1E0OB 4AAXA 2X44D 2QSTA 5A8OA 3L3OB 3L3GA 4F7TB 2JK5B 1FHLA 5JHLH 1RYYA 4ODVL 1W0VB 5E9DD 1D5MA 2YSSA 2NT0A 2XYCA 1U41A 1EZVX 2G60H 1QO3B 3AROA 2ZUMA 2W9XA 1LNUB 3K4AA 4OZFG 4QRPE 5J06A 1S7WA 3QULA 1R3JB 4DEPB 2RJMA 5DMGD 4XTRC 1MCPH 4Z0XA 1I7RA 1ED3B 2IXUA 3VXRB 3PXJA 2XXCB 1KEMH 4AT6A 2DYPA 2ZCKH 2XN9A 3EYFB 5DWUH 1OTSD 1CE1H 5HYJD 4JFSA 1WZ1H 3G9AB 1BGAA 2AMGA 4X6CB 2AEWA 2IUZA 4OZHA 4JFWA 3VXUA 1A0QL 2ZJSH 5I8OL 3TTSA 4M8VA 2VXVH 3TBVB 2VI0A 3FO2B 1X5ZA 3AJ7A 3WD0A 4KQ4H 5DFWH 5IOPB 1I1YA 3HB3C 4OZFH 1FH5H 1I3GL 1I9RH 5IFHL 4A42A 2Z93A 1CDHA 3DRTB 3QUKA 2XONA 4G5ZL 4BH7A 2YRZA 5ESQB 5ILTH 1T2XA 4RGND 2ORZA 4XMPH 2E9LA 4LVNC 3SGDH 1GQIA 4HWNA 1NOFA 3QXDA 5J9PA 1H49A 1VFOA 2OWXA 5L2JA 5FYKU 4XZWA 1HHHA 2D7OA 3QH3B 4GS7C 4IOIA 4WRLA 3TT3L 1JPST 3HZKB 1CENA 2FJHA 4UFLA 3IDXL 1FFPA 1VGEL 1P7QD 3GXFA 5EC2B 4P46A 1NBQA 5CGYD 1G9ML 4AH2A 3DXAA 4HGWA 5FO8B 1UKQA 2YN5A 4PJHF 2FEDD 2VYRE 3CLEL 1KJ2H 1NL0L 4MGQA 3VNYA 3WBEA 3GSWA 2CIKB 3O4OB 1MCNA 2ICCA 1HKMA 4LNRA 5CJ5A 4XH2B 1OARL 1LE5B 1FP8A 1CICA 5FA3B 2DCKA 1E15A 2C0HA 1TENA 1M05B 3SGKA 3WXVL 3RWHA 3D5OF 1U36A 4K9EH 4HMEA 1I1AA 4XI5D 5KAQG 4O2FB 3RPIB 2VT0A 3IAPA 3AUVA 4PG9A 4KHXH 2DBLH 5E0FA 3CMJA 2VSDA 2PUQT 3VI4F 3MU7A 1GGTA 1CICC 4W68A 3FQWA 5EU3B 1OGGA 2JIWA 1H8OA 2ADJA 4MNQA 5TE6H 1OIFA 2XRAH 1N4XH 4APQC 3KNBB 1TVGA 4WUUD 5DR5L 5I6XB 3A67H 1AGEB 2ATPB 2D7MA 2F74A 4KGJA 4OBSA 9CGTA 4KKBC 3P9MA 1QSZA 1G7LA 1SYSB 4MA7L 2WZIA 1KGUA 4YXHH 4OZIA 2R1YB 2OR9L 2R0WL 2DL9A 4JZJB 4O2CA 4XNYL 3L5JA 1N6QL 4CDHA 3SCWA 3QO0B 4NKMA 4X98A 5DD0L 1R0AL 5LXGH 3ULUD 3P4MA 5K9QI 2DQTH 3ULVD 4I77H 4FK9A 5I71B 2E4TA 1XEDA 5M17A 5KSAD 1R3HA 1TMQA 3WNPA 4ELKB 4FQJL 5GGVH 1XCXA 1GORA 3ZYOA 1JWUB 4M62H 3QIUA 4RGOL 4N0RA 3OPZL 2XWBA 1FRGH 5IGXH 1JRHH 4NQDB 4NZRL 3KLHD 4BQ5A 5E6YA 4X0VA 1J88A 3RIKA 4DJMA 1RZ7L 4N0YL 1AKJA 2H2SD 3OKDB 4FQ2L 2R9HC 1BIIA 1XZ0B 4M48H 4XVTL 3WUWB 3MJ7A 3NA4A 4W6XB 1ZT4B 4NYLA 3HNYM 3RWGB 3QIUC 3NGBB 5DJ0B 1D6EA 4WKAA 5J6HB 4YHIB 3BYTA 1GW1A 2R69H 5C0CB 3O3BA 3UZVB 1P6AB 1JAEA 1YJDL 1OVZA 3VXTA 4F66A 4XV0A 5I1HL 1LL6A 3H9SA 1UZ6E 1HWGB 4PUEA 1K6QH 4NSKA 4QX0A 4M43H 2OI9B 3U82B 1B9ZA 1RK1B 4PJ8D 4ZOBA 3MBEB 4NO0A 5FL0A 4PGEB 5D5MA 1NGPH 5E9DE 5C8BB 5A2CA 1NFDA 4ZXBC 4D8PA 1NOWA 4P8UA 1GJUA 3N04A 1CLYH 2C1OB 3V7AE 4GG6A 3BP4A 1UA6L 3UC0L 1QBBA 4FN0A 5C0BA 5B4MC 3O3AA 2NW3A 1NFIA 4Q7DA 5GRJH 4HWBL 4W6YB 1LO0H 2P7TB 4Z2JA 1X5IA 2E3ZA 1N0XL 3F7VA 1EQPA 4RE2A 1QFPA 2XPKA 4U1SB 3GSQA 3OGCA 2ZEWA 1ADQH 3GUTB 1W9PA 3HS0B 1ZVHA 4Z6AT 2J5LB 3L9RA 1XCQB 4K7PX 3RRQA 5KZCB 4UUJB 3ILPB 5IEKA 1WJ3A 1ZMYA 4JY6B 4EQ2A 3LKPB 5EB8A 2QLVB 2Y25A 5L0QB 4MD5A 3LPPA 4FS0A 5L8KB 3WBDA 3BIKB 3WJLC 3X12A 2VERN 3BAKA 3LH2H 3MFFA 3UTTB 4PJAA 1Q72H 3CZFB 1XT5A 2XIIA 4QRRE 5DO8A 1YNLL 1TDQA 4WI4A 4UOW0 3MLUL 4TUJA 3HR6A 4KRTA 4PJDB 5A40E 2WABA 1NMAH 4R6UA 2BNJA 4H88H 3KPQB 3BT2L 1ITCA 2A3HA 4OD1H 2WDBA 4FQHA 4YUEH 4JRXA 1MFBL 3TLRA 3NJ3A 3QDMB 4DZ8A 1NUFA 3L7EB 1ZHNB 2WMKA 1EQCA 4AZCA 2ICWA 3F7RA 1EOKA 4JRYD 3TVMD 3SKOA 3UPCA 5JW4N 3PWPB 4WFHE 3ZTNH 4BELD 1SG3A 4X80L 1BD2E 2PYFA 4GMTH 2DQGH 2FX8H 1G7HB 3PQYD 3QPXL 3P0VL 4AMCA 4YFDB 5DTFA 1QI2A 2IALB 3BKJH 5I8EB 4HJJL 4MCZA 2X4NA 5AD0B 5JA9A 4UDUB 2YFUA 3DSNA 1G7QB 4JY5H 1F42A 4LYPA 1WAAE 4NZTH 3TH4T 1UYWL 1NBYA 4JGMA 1DLHA 1T7WA 1TJHH 4V1DA 3LB6C 2G9HA 3FW6A 2VAJA 1MAMH 2WN3A 2W4XA 2F58L 1KFAL 4TRPH 3WN5B 5MP6H 3ZZ1A 1ODAA 4WV1B 2OSYA 4X4XB 3U2SA 4RQQB 4HUVA 5IMLB 4WUUE 2NQCA 2VXTL 3QZWG 1FSKB 4A2MA 4JO3H 2JKXA 3CLWA 5T5FL 2O5YH 1YMMB 3OAZK 4YDJA 2CO6B 3C60A 1C7SA 4HOZA 1NC4B 1EO5A 3GMQA 1ULPA 4PJCE 4PJHA 4R9HA 3K75B 3NCJH 5JMRA 1KACB 2FWOA 5T1LD 2FO4A 4D3CH 5C0JA 1BBDH 5CP3A 3ULUE 3P9LA 2W61A 3SCMA 4UQAA 2WB5A 4ONHB 1I1FA 4GJTB 4ATDA 1W99A 3CHFA 1RK0B 3QIWB 1UCBL 5D6DA 2I9LB 1S7XA 1EGJA 2G2RA 3C7GA 1DR9A 1YHTA 2AXGB 5JORB 2DN7A 2PXYD 4LSVH 4ZUUA 2B31A 4ALAL 3SCMC 1QACA 1DWJM 5AC5A 2AV7A 4G8GE 4TVUA 3M45A 1ZANL 3IB4A 1PBGA 3OKKA 4MX7A 2GFBB 5SWSA 2WO3A 5B38B 1W91A 5D6DC 5C07D 1MCFA 3U46A 2MCPH 1I8MB 3FCTB 1LL4A 2R0KL 4WI6A 5E8NB 2CIIB 3LN5B 3BP6A 2FJGB 2JF6A 3SKJE 3JUYA 3P4OA 1B3YA 1QRKA 3LDBC 4QPWA 3WELA 1BFOA 3OJ2C 4IRSD 3FOMB 1NCNA 1P84K 1JD7A 2DH3A 4HT1L 2LQRA 3GNML 4UOZA 5CCKH 2DKUA 5C08B 2L4OA 2YPKB 1XPWA 3PL6C 1A8JH 1E55A 1H1NA 4YDKH 4OLUH 5F8RC 4IDJH 4UTBH 3W39A 1L0QA 4PRPB 2C1PA 2XG5A 4L29B 5KANI 1ISXA 2Z31C 3GHBH 4JZ5A 4L4TD 4NZJA 1QNZH 5DPNA 4KTDH 1MSPA 5F7LB 4UTAH 1JTOA 1KPUA 3T77A 4IDLA 3ME0A 4GWJA 5MENA 5AYUH 3IFPA 4KWUA 4XB8A 4E41D 3QJFA 3DIFB 5FB8B 2E7LC 3D5HA 2XOMA 1FJ1B 4WHDA 5MEPA 4CNIA 4HD9A 4ZFFA 3FB5A 1SVCP 2OM5A 2ZZUT 1PZ2A 3KL5A 4OGZA 3I3BA 5DMIH 4NQEE 3AB0B 1RJZA 4KJPD 1T5WA 5BVJB 4B5EA 4HQQL 1G94A 4J3OC 2VUOA 3RL2A 4P2OA 2MWCA 5DFVC 1FGVH 1FNAA 4RMRA 5I1CL 2AKRA 3C6LA 2XN9D 1BQUA 2DQFA 3G6JF 3V6ZA 1C12B 5HHOA 1X44A 2PO6B 1HXMB 1WUNT 2DT3A 4NZCA 5I2IB 4P2CG 3U57A 3D3VA 3NPZB 4MNGE 2ED9A 4P2OC 5LCVH 4Y5VB 1NCBH 2ESVD 3NDZA 1JNHA 4O51A 3C6LC 4K23H 4MQ7A 3OAZH 5A8NA 4OGAC 3QG6A 5CJOL 1GOMA 2QADB 2GJ6D 4XHJC 2VL4A 3WDRA 1WP6A 3MXWL 3STLA 4G8EB 4TX6A 2PNDA 2ZCHL 3VFRA 4GZJA 4HGKC 4LCCB 4GXVL 2UY4A 3QNXA 5DJ6B 3HPNA 4PJBB 5FYJH 4OI8A 2WMIB 4ERSL 2ZOLA 4RZCA 4Z77A 1JI6A 2XWTB 4UQCA 3MOBL 4XUNA 4ZS7H 4B7IA 1D9KB 3DXAD 1TQCB 1CVSC 4D0DA 5A2BA 2NY3C 2W66A 1PYWB 3CZJA 3VFTA 3LQCA 2BS9A 4PUDA 1LP9F 3HNBM 3T0EC 5GNXA 3F12B 4F9PA 4QLRA 3HN3A 3GGWB 4QP0A 3WO3B 4AYSA 2YWZA 3GKWH 3CFDB 4GW5A 4U1NA 1HHJA 4DKAA 1ISVA 1C1EH 4QRTB 1CICD 2X4SB 3HC3L 3LEIA 5ABEA 1WEJH 1K6AA 1YEKH 2AV1A 1I1AD 1QR1B 4KKBD 3BAYA 1DQTA 5IB3B 4ZAKB 4Z2HA 2HVKA 1OTTD 3H0TA 1H3UA 2P5EA 4CD4A 2P46B 4OJYA 1KPVA 2F53B 2QLYA 3VI3F 3LPOA 5HGAB 1MCSA 3ZE0F 3D0VA 2EDWA 5DD5L 3SGEH 2DH2A 2WBKA 3FN9A 5GS1A 2IG2H 4WUKL 2VAAA 1KENH 3BWAA 4LMQE 3QP3A 1G7JB 4YQXL 1FPTH 4F2MA 1CBVH 4KY1H 4NUGH 3ZE2F 3NH7H 4KVCL 1KB9K 4JO4H 5DMKA 3O81A 3MJ9L 3G6MA 4J7RA 1Z9OA 5C09B 4Q22A 3IETA 5KSUB 3SKUD 4A3HA 5GS1C 5GNZA 1KCVH 2MSPA 5I30L 1CZ1A 1FH9A 5IFJB 3CK0H 1XCWA 1NM9A 3WE6B 4K2UH 4F7CB 3N85L 3HAEA 4HHAA 4ODBD 1TTUA 3GSXB 1T5XB 2Y06H 1FH7A 4L8BB 4GKZA 2R9HD 3MRKB 3CVHL 5HI4C 3QCVH 4HKBB 4I0PB 3FFCB 3QIUD 1A4JB 4JFHE 2ATKA 2FX7H 3LV3B 1FL3A 1FE8H 4X9BA 1LEKB 4D9LH 2ADFL 1A22B 3GMPB 4L3EE 5E1AB 4AQ1B 2OTPA 2NPLX 5SWZB 2VM9A 1XCTA 1LL7A 1DEEB 2XA8H 4TNVF 1X9QA 2P5WE 1UQSA 3RWEB 5CSUA 3MREB 4M1DH 2H32A 5I8KL 5D8ZA 4LKXA 5ABFB 3JUZA 5IESH 3QWOA 2FECI 4G9FA 1V5JA 3I85A 1A47A 1K4CA 4L4TE 5IVOA 2YBUA 4KJWD 4ZDHB 5HGBB 2JLLA 4Y8DC 1T2QH 1TMCB 1TETH 5LA0A 3H9SD 4P2RE 4XC1H 5EBWB 5IKCB 1KSRA 2ED8A 3OL2A 5I76B 1UXSB 4JFQA 3CQOA 5I15L 3FONA 5B4MD 1ND0B 3QCTH 4OCRL 3Q1SL 4TSAL 2W63A 3F2ZA 3GSVB 3MJ8A 4NO0D 4PGDA 1RZ8B 1WDQA 5BRZA 3DTXB 2JTDA 4RISH 4NPYA 1TVPA 4P2QB 4G6MH 2XHYA 2VDQH 2RJ2A 3PWNA 4A6OA 1SM3H 1HHGA 3HNVL 4L4OA 2CDPA 4PG2A 3S96B 3A3HA 1UM4H 1LJYA 4JG1L 4BFGA 4LCWB 4ZYKB 5LVEA 3TTQA 3IT8D 2GUOB 4WNQB 4XB3A 4HKZB 1BQLH 1WC7B 1WQVT 2Y5TB 2RBLA 2WVUA 4MGSA 1QKZH 5EU7C 2CKRA 2XN9E 4JL2A 1VEPA 4YHLL 3ZSTA 3CDFA 1GOWA 1HN1A 4FMKA 1S9YA 5IJKA 5M94B 3NABL 4OZHE 1G84A 5T1DL 4AIOA 3VXUE 5HTSA 2DM2A 1Y6KR 1A1NA 5L6YH 3I6GA 4GQPH 5I1AB 1W1VA 1GNYA 4Y4FB 3CVIL 4LLMB 1MCCA 2WK2A 4QTHA 2W9LA 3VNZA 3QQ9C 4PJ9B 5IJKC 3NFSL 4ZO9A 3VXQA 3DYPA 3IKCA 1DUYA 4GUPB 5B21A 1KN4H 3BRFA 3GSUB 4ZOCA 2NTFB 1TQBC 4QXUL 1AMYA 4MNJA 4XBEH 3BH8B 5J1AB 2WHMA 1VB9A 1TUXA 2E6JA 4LCYB 4QT5A 3RTQA 5HOSA 1OGTB 4HFUH 3VCLA 1KG0A 2AABH 3S6CA 4F7PA 1I85A 2JB5L 5J8OA 3BAIA 2JJSC 4EUPA 1K12A 4XPAH 2BC4B 3E3QC 2KKQA 5GHWH 2VLKB 2XTJB 2CLRB 3LS5H 4GW1A 2CUHA 1DUZA 1YECL 3G6JA 4R7DA 5GSVA 4MXWL 3IU3A 2XKUA 1F58H 4MJ4A 4X5XA 1J0IA 1XGYL 5SX4I 4MA1B 4GQ9H 1XGTA 4WEBL 5DD3L 1A14H 2CDGA 4XNXL 2VIRB 2EC9U 1GOQA 1LO5A 1C5CH 1YEJL 2AGJH 3GBNH 4QHNA 4J27A 3DMMA 4PJIB 4W84A 4V1DD 3WF2A 5IK3B 2J1EA 2HTLD 4QX1A 3TJEH 2J25A 1M6OB 5FHBH 1F6LL 3L3DA 5FF6B 1DWFM 4MZ2A 3VMPA 3I02B 3MMDA 2R2HB 1E28B 1Q0YL 4MNQE 4PRHB 4XNQA 3EFDH 2A6IA 4D1IA 4CMMA 4O9HH 1LG1A 3DMMC 3PP3K 3VXPB 4MADA 1N8ZB 4RGMB 3QCUH 1JZ2A 1XIWA 2XZQL 1JWSA 4OZIE 2LV4A 3W0WB 5BV7L 3C5ZA 3N1QC 4OIIH 2MQ3A 5D2LE 1WNOA 1PVHA 3WFCH 4L8CB 3N15A 4LASL 1OSZA 1A7OH 2YKLH 5IQ9B 3BZFB 4N8VB 4X4MA 2OYMA 2CKBL 2D0HA 4M6ML 5B4XA 1MF2L 4EI5B 3SCMD 2Q7NA 1A7NL 4S0TD 3MJGX 5HPMB 3JVGC 1XIWC 1YYLH 2XYLA 4U6HB 1A7RL 3C5ZC 5DYOA 4S2SB 1YNKL 4Z7UF 5F7DA 5C0GA 2ZUTA 4AL8L 1DN0A 5DVNA 4QXGH 5E6ZA 3WUGA 3GSOB 4URTB 4GG8B 5D2NB 3MRMA 3GMNA 2NMSA 5DK0A 2WVSA 1EFXA 2GK1A 3QDGB 2HT2C 3FRPA 3RAJL 3SN6N 3MLWL 4LNVA 4YDVB 5H94B 1JNDA 1NC2A 5SWSD 4JPKH 4Q2ZA 5GS0C 5LKNA 3IGAA 4GRLB 5IHRA 2GKIA 4RFEB 3S2CA 1MHPL 1GOFA 4GAGH 1U8OA 4D2NA 1JI1A 2BCKB 2M2DA 1J1XL 32C2B 1EVTC 2DQUL 4JANB 5CD3B 3BAEL 4KI5F 4OFIA 3OR7A 5A6AA 1FLRL 2E9JA 3WFBH 4OQ1A 3NA9H 1LDSA 1YEDB 2CQVA 2Z31D 3TWCL 1JGDB 4AMKL 5FOBB 4P23A 2UY3A 4G7VH 2ICES 4EDWL 4HTYA 4M6AA 1DBJH 2BOBB 3H9SE 4U6XA 3FRUB 1MFVA 2XQXA 1WK0A 1A1OB 2WYSA 5TF1H 5JOFB 1GCFA 3AM8A 5JO5B 3ZO9A 3BX7C 5KANG 5TQ2L 2X4RB 4M7LT 4U1GB 1ZHBA 2Y9RT 2DWEB 3SDAB 2OL3A 3KS0H 5D5ME 3TV3H 4YPJA 3VH8A 1MRFH 2W65B 2WAHA 3MBXH 4N9GB 3BKYH 1IT9L 4GG6E 3TESA 3BCFA 5C0BE 3AM8C 5LBSL 3LZFH 4OF3A 1MRDH 2DLTA 4HULB 2DQIH 5MEND 4Q9QL 4IS6A 4ZOEA 4W89A 5F9WC 4PJEB 5G05L 1GQJA 1RFDH 4P4KC 5DFVD 3ETBF 1ZTXH 5CIPA 1Q9KB 3QEQA 1XF3A 5IG7B 3VOCA 5D6CA 3MV7A 5BCAA 1JNEA 3TO2B 4QRQB 1SBSH 2ZUQB 1ZVSA 4GW4B 4TOYH 4PTMA 4ONFH 4K3DH 1T1YB 1OGAB 4JY4B 4P2OD 4U0RC 4AD0A 1NEUA 1KXHA 1T6WA 4UV4L 4PTXA 3S34L 3C6LD 3VU2A 4B0MM 2ZUWA 1TVDA 3THCA 4OGAD 3WQWA 5HHOD 1IEBB 3GIZH 2D1ZA 3PIQA 4PBWD 5CHNB 5E4EC 2AEQL 2HRLA 3D3VD 5BZWA 3DBXA 5BXFA 4OFYA 3BKMH 3PP3H 1MW0A 3SJVE 3SO3C 3FQUA 1LEGA 5KJRL 2J8HA 3L6FA 3VIHA 4WDIB 1LDPH 1AXSB 4PRIA 2NXZB 4JRXE 2BSRB 4YLQT 1ACZA 3UROR 3X3GH 1J0YA 2VQ1B 1H5BA 4R27A 4X6CF 3AS0A 5CZVL 5IIEA 2YPLA 4KFZC 1WLHA 2ZUSA 5HHPA 3DVGA 5T1MB 2CK2A 4HPOL 4CVZB 2WUCH 1B0RB 1T0NA 2NY3D 3C5SA 1V7ML 4NNYA 3T0ED 3GXIA 3O45B 3GSNB 1JF1A 2P8PB 3JV6A 1ZKAA 3P73A 2P44B 4J3WA 4M93B 1ULOA 1XD0A 3FY1A 1H5BC 4KKLD 2XZCL 2D31A 3BPOC 4H0GA 1U3HA 4YFLF 1R24A 1KPRB 4MD0B 1YEEH 2GT9B 3WYRA 4MJIE 2BY3A 4V1DE 3DUUA 3V7AG 2DGAA 3VIFA 3VFVB 1WWBX 1DQDH 5JXAL 4OZOA 1B3WA 1DQJA 1P69B 1IAII 2C3HA 4U1IA 3A4WA 1CIUA 5B39G 3C9NA 5T3ZH 3IDGA 4XNZB 2OBGA 3FN0H 2FGLA 1S7SA 1T7VA 1U8HA 1XSJA 2XWEA 3QHNA 3G6AB 3U0PB 1QQDA 3BO8A 2E6QA 1PIGA 2XKNB 1MCBA 3DRQB 5GRYA 3T0WA 5B3NA 4RE4A 2W07A 3UTSD 4K71B 1GCYA 2P5ED 2Z91A 1CLZH 4HV8A 1HKLL 5IHUH 4PJHE 5EOQH 5GJTL 3ZR6A 1J9YA 4LHSA 3WF3A 2D03H 3MRLA 4FNLL 2O93L 2Q76A 2ZXAA 4RFOH 2Z1KA 3W5NA 1CT8B 4BSWB 3VG9C 4LSTH 3S36H 3HHRB 1C93A 2HH0L 1F3JB 3FTGB 3WSQH 2ZEYA 5KVEH 1Z5LA 4KTEL 4Z7QF 5HI4D 5AAMA 1T3FA 5D72L 3ACIA 2ICWJ 3A6BL 1MQRA 3VI4E 4NKDA 3IF1B 5LWYH 1NCUA 1P84J 4OLZH 3D85B 4JPWL 4NCC2 1RIVL 3TYGH 2OYKA 2HJFA 1QFUL 4DK6A 4FTVD 1G1YA 3GMLB 4WIWA 3ZKXC 2BFVL 3S4SB 1RIUL 6FABH 1KGYA 2QSCH 4ZFMA 1UXWB 4LLVB 3DWTA 5GS0H 3VGAB 3F6LA 3HZVB 2VRKA 1VFBB 1UJTA 3QWQB 3TO4C 1PZ3A 4W4OA 3HE6B 4J8RA 2W94A 3D25B 4Q6IA 4Z7UA 2PN5A 1OGSA 5DA4A 5ETUA 3GJEA 4U1LB 3ARSA 5CEXB 3QFDA 4PGCB 3FB6A 4PP2A 3QQ3A 1UKOA 3HNSH 3NDYA 4G6KH 1A5FH 2VMFA 4GWIA 3GI9L 1QSFE 5C2BL 4DGIL 4MNMA 4PYGA 4Q58C 3WNNA 4W4OC 3MV8A 3D18A 1UWGL 2V3DA 4XCEA 3IJHB 5ID1B 5JIKA 2CKBA 1P4IH 4OBRA 1B0WA 4E2OA 2A6KB 1UJ3A 1V3LA 4RAHA 5CUSL 5B22A 1FYTA 1BWMA 5FUIA 5BRZD 3WO4C 4E42B 1GSMA 4DAGL 4FABH 3X14B 3SDDB 4J4PC 2YUZA 3AAZA 2EDTA 2CRMA 1F4WH 3AREC 2V6HA 5FGSA 4R3SB 3C09C 3JWNC 4NRZB 2R4RL 2QV2A 3RP1A 2Q20A 5FYLL 2DMBA 4FFZH 5GJSH 4NUJA 4G42B 1UJ3C 3CSYA 1AGBB 3M8OH 1T1XB 4Q97A 3WQ6A 2OL3H 1E6NA 3MA9H 1BVZA 1WBZB 4PCSA 5HHNB 2A1WL 5HHOE 1A64A 3QFJA 3QQ9D 1QRNB 4TVPH 4ZUSB 1DCLA 5FM8A 1L7QA 2PW2B 4U1JB 3D3VE 3E2HC 3BMVA 4P0DA 1IGYA 4LDLB 3DHMA 2PWEA 5B8CB 1L0XA 3UCQA 5KOMC 2ICEB 5GIRB 3ARVA 3VXMA 5A94A 2R29L 4OJFL 3SUUA 2EO9A 3RHWF 2ARJA 4YX2L 3RZCA 1OOAA 2WC7A 1JF6A 3KPRA 4Y16C 3WY1A 3T2NL 1TVBB 1KIRA 3MR9B 4JGJA 2WO1A 2W0FA 1IL1B 1BAFL 3I50H 4PY7B 4LVEA 1JHKH 3CH1B 2DIEA 1X4XA 4IRJA 5EULV 5A3IC 4ZFOL 1AQHA 1RQ5A 3LPGA 1YY8B 3RZCC 5GRUH 3L3OA 2QEJA 3VFGH 2Z92B 4XP9L 1E4XI 2QPSA 4UFIA 5DEZA 4P9ML 3HFML 1A6PA 2V5RA 4IMLB 1UMIA 1W0VA 2VZUA 1H9VA 3PWJB 4TTGA 3O3EB 4PJDF 2WIIB 3QEHB 1PBYA 1QO3A 3G08B 1RZIB 4JAWA 1LNUA 2FATH 2ITDB 2Q8BH 2VZPA 1JNLL 4OLXH 1I8LA 2EE3A 5KSBB 1EA9C 4UMGA 3U7VA 1KCRH 1J8HE 5F9JA 3NCMA 4PJ5D 4HK3N 1ED3A 4MQXC 4RSVA 4A6YH 3PZMA 3VWKC 3VXRA 3IJ9A 2O5ZL 4JFVA 1GU3A 1LF1A 2PYEE 5BWFA 3S3SA 4HIEA 1QW8A 1W9DM 5BS0E 3DMMD 1QBML 3OKOB 4OLVH 4YGAB 2EIEA 4G3YH 5E2TH 1FZKB 1T21B 1EO8L 5D8JH 5FXCH 3X11A 2P5EE 2JD9A 5IFPA 2YL5A 1S7RB 2H9GA 1KB9J 1FA2A 25C8L 1H4PA 3OX8A 2BGPA 1AQ0A 2CERA 4KZEH 4DW2L 1B4RA 1N7ML 2PKDA 3GIVA 4M6NH 4JKKA 2AJSH 3FO2A 4LGPB 1E4MM 5SX4H 1Q6DA 3LKSA 4CU8A 3CAFA 2HLAB 5E24E 1QEWB 1QFWI 3TN0B 4U4BA 5IT2L 5FM4A 3DRTA 2HG5B 4BZYA 1XIWD 4NO5B 2AJZB 1H0GA 4J3XA 3AHZA 5ESQA 3C5ZD 4JJ5B 5C2UB 1PW3A 1I3VA 1NARA 1YQVH 4F9DA 4UIKL 2NY7L 3TA3C 4XAKE 3QH3A 5HDLA 2NY5C 5EOTB 2EIZA 4AD3A 4J3UA 3DO7B 3HZKA 1JBJA 4CGTA 1GUIA 1E4WH 3BPLC 1JGEB 3KJ6L 3DX8A 1WBYA 5DMJB 5EC2A 5FUOH 4F9LC 4R0LB 5GS0D 2W9DL 2WAOA 4GMSH 1MCJA 5CILH 1IKNA 5I1GH 1FORL 4G6JL 5HHXL 4UU9B 1PIFA 1UG6A 4FMVA 4KJQD 2E7HA 1H41A 1W9SA 3I2CL 1EFXD 4XH2A 1FIGH 1LE5A 3KPSB 1F4XH 2B4CL 3PN8A 5LGHH 3PZUA 2XWDA 1MCQA 4LAQH 4HC1L 1AQKL 2XZAL 2XIBA 5LGKA 5DS8A 4HFWB 1UY3A 2X40A 1X4ZA 4O2FA 3RPIA 2QF8A 1CFTB 5FYKD 1GYAA 2VABA 2NW2B 4G9FE 4S1SL 3RWDB 2VH5L 1MCHA 1GGCL 3NIDF 3MRNA 3MCLL 2YA2A 2FBJH 1AGEA 2ATPA 4I4WB 4QOKB 1SYSA 4HUKB 2CO7B 5CXPA 4JZNB 2C4XA 2J1TA 5DJCA 1Q94B 3IANA 4JZJA 3WH8A 2FZ3B 3QHZH 1ISYA 5BRZE 2DM3A 3FXYA 4ZEPA 2Y7QA 1YZZA 2YBTA 1LO4L 2Q3ZA 2Y6SC 5HHMB 2HRPL 2XI9A 2HJLB 4IPLA 4H5SB 5HYSB 1YYML 1GH7A 3PBGA 1IQDB 4ELKA 1KWGA 2AQ2A 2CJUH 1UM6H 2Z8RA 5DURD 1JWUA 3P4NB 4PGJA 3Q6GL 1ZGLB 1E6OH 2BNRD 2BOCB 5IBUB 3MLVL 1W32A 3WDQA 3VG0H 4C83A 4QO1A 5JPNB 3QEQD 4NQDA 2EQDA 3STBA 4R8WL 3MV7D 2Y6KA 4X6BB 4JHAH 1FFRA 3OEBA 5F1OB 3OKDA 3WBAA 1XZ0A 1RZJL 7TAAA 3RWGA 2C7UB 4PMQA 2VKXA 3OKLA 1JZ7A 2V4VA 5DJ0A 4UT7H 3GO1H 4YHIA 5I23A 2EDRA 5D7JC 2HKHL 1HEZB 2BHUA 3BZDA 5C0CA 1RIHH 5T5NG 5F9AC 5C7XL 4A41A 1BVNP 3RJYA 4TNWK 1QHPA 4Y1AB 1GGIL 4YO0B 1W3LA 2OJZH 2X4PB 3THMH 4YHEA 2CXKA 4OFYD 4OCWH 2LTQB 2E8ZA 3G5VB 2J7BA 5T3XD 4M03A 2ADGA 1NCDL 3U9UA 4DWHA 1V6WA 4GQQA 4X9FA 2VDOL 5EIVA 2A6DB 5IWLA 4CN6A 2W1UA 3W4RA 1RK1A 1JPFB 4A2LA 3MBEA 4I48B 4HUNB 5SWQA 1NCWL 3ROLA 4X0NA 2BVUA 3G6JE 3DETC 2FL5A 2P45B 1W9TA 4XVJH 3M17A 4TVCA 3BRDA 5D7LD 4FHBD 1VF8A 3LPFA 1FHDA 2IF7A 3ACHA 5DXWA 3OF6D 2Q86A 5IWLC 3N1GC 4P2YA 3D87B 1NEZB 2LABA 2NY0D 4QHUA 2CMRL 1DQLL 2I5YL 3GJFB 4U1SA 5JNYB 1B90A 3HPJB 2YXFA 4I8DA 4MVBC 2EDBA 1FL6B 3HS0A 3GUTA 1BSIA 5HYJB 2XFRA 4KQ3H 2ZCLH 3QQ4B 3IFNH 3OAUH 1JTTA 1XCQA 4UUJA 3ILPA 1JGUL 1NBVH 4JY6A 5GZOC 3LKPA 5L8JB 2J7CA 1MNUH 3BGAA 3VX0A 4PJBF 3EAKA 5D96C 1DBMH 1H0IA 3BIKA 3VFWA 4HZ8A 3O2WL 4ONOA 3T65B 1H2JA 2J7MA 3UTPD 3NFPB 3UTTA 1UYXA 4OFKA 4RGNB 3RILA 3OG2A 4L9LB 2UYLA 1LP9E 5MI0B 3O6ML 4PJDA 2AEIT 4L5FH 3VIIA 3BUYB 4X4ME 1CFQB 4WFFE 3TH2T 3CDCA 2VMDA 3IDIB 3QDAA 2IGFL 1OF2A 4X6DB 4IIQC 3KYKH 4H1LG 1P7QB 3QDMA 5FDWB 1ZHNA 5C0IB 4ZPTA 1E71M 4YNYB 3F5KA 4C7DA 2YLAA 1QA9A 5DJAB 2OK0L 3B2VL 3PWPA 2Y72A 5EORH 5A2JH 1ETZB 5FGCE 1BECA 2F5AL 2NX5D 1H3PL 1ORQA 1GNXA 3MLTA 2IALA 2NY5H 3ZE0E 2QQNH 3ILQC 2AEPH 4R97B 3MZTA 5I8EA 1GOOA 1NLDL 1FNSL 1UY0A 1G7QA 5IB5A 3TBSA 5I73C 3MRCA 1CDCA 1MAJA 1UR2A 1DBAH 1GIGH 5C9JB 3VD9A 3LKQB 5FUZL 1NGYB 3ZE2E 2HJKB 1V05A 5FYKE 5JLZB 3F58L 5DUPL 2W87A 4NFDA 3DJ9A 3DLQR 2HFGH 1B88A 3WN5A 2ARJQ 3X13A 1SMDA 1AIFA 3OWEA 2WO2A 1JGIA 4WV1A 4X4XA 2GFTA 2GSIB 1EXUA 2BY1A 5GGSB 5IMLA 5DUBA 1VFAB 2ZX6A 3UG5A 1U6AH 5HDOA 2DQEH 3GMRB 3SOBL 1YMMA 4ONGL 3WD2A 2EZ0C 1NC4A 4M56A 3JZ7A 3GH5A 4WV1C 4HLZG 4D6DA 4M1CD 1LILA 4HCRH 5DJ8A 2EDQA 5LQBL 1Z3GL 4H25B 4R4FH 1KBBA 1Z9SA 1HF6A 2J79A 4RRPG 4J4PD 4JDVB 2YA1A 4ZTPH 3MV8D 3N17A 2K1MA 4HWUA 3QIWA 5IVZA 5E94B 4D8MA 1CDYA 2I9LA 4HBCH 4F57L 5BVPL 3CSPA 1ZHKB 2AXGA 3NTCH 1MWOA 5JORA 4EXKA 2VR9A 1PSKH 1FYTD 3BDYH 3ZM8A 1U2YA 3SDYL 3MV7E 4LGXA 4DOHB 3EOBA 2EBNA 1ZLUK 5JW3H 3TONA 3QIWC 1HVQA 1IILE 1OPGH 1I8MA 3FCTA 4EK7A 3BP7B 1KGWA 4LVHC 3GNPA 5E8NA 1LD9B 2YRLA 4HUXB 2ZPKH 1MJ8L 3VUPA 2DBJA 3IJ8A 3QFJD 3RGVC 1EMTH 3FOMA 3VA2C 5FM5M 3QO1B 2A38A 5EOCL 1UB5A 2V5DA 5FKYA 3QUXB 2J1AA 2YPKA 4XVSH 5BJTB 1MYRA 4NN5B 4HXAH 1U8JB 1GHFH 2EYRB 3BDXA 5T3XE 5KVGH 3DURA 4PRPA 3VXMD 2IFFL 4PRIE 2VX6A 1UA3A 4L29A 3RZCD 3LOWA 4PJ8B 3GZKA 1LQ0A 1I7TA 2YPLE 1T2JA 2VO5A 2GI7A 3GBEA 4HKXB 1A7PH 3LRGA 4ZFGL 4KMTL 2EIBA 1NCTA 4CUCA 3BSZH 3FFDB 5FHAL 3KYNB 4IRJD 1QI0A 1MCRA 3O4LE 5E6IC 1X6LA 3DIFA 4LLWB 3V4PH 2W1SA 2XY1A 4MQXD 3VWKD 1ES0A 4IUGA 3O6FC 1CR9L 4OZFB 3S5LG 5I17B 2IFGA 3LRHA 1A3RH 3WUFA 3K81A 3RIAK 1XD1A 1N5YL 2ERJB 2DM4A 1QNOA 5BVJA 4GINA 5I18H 2WMHA 3BESR 2WLYA 4OFVA 4L3AA 5K9JH 1IT0A 2B0SH 5FA4B 1AR2A 2JJWA 1KEGH 3Q5YA 3VXRD 1MQKH 3RU8L 4YWGH 2VX5A 2PTUA 3UTPE 1C12A 2PO6A 1N5AB 1HXMA 1P5VA 4LBEA 2WZHA 5E2VH 3P77B 3MA7B 4PB9H 4QHLB 1R86A 1BPLB 5EC1A 2E9BA 5EO9A 5DQ9A 1PGRB 1KJ2B 3ZKNC 1F6AB 35C8H 1AD9A 1XSKA 3DX6B 3EZJB 12E8L 3QXUA 4P7NA 3T09A 2KPNA 3TA3D 3MACL 5ANME 3AMDA 4PJIF 1K42A 5F7EH 5BO1H 3CLFH 3ZOAA 3GH7A 1NJ9B 4OM0L 4G7YL 2I27N 2YD3A 5C0NC 1AY1L 1M71B 3GM0A 4JRYB 1C16B 4JO2H 2VE6A 3IU4H 1GQLA 1V0LA 1GPOL 4XZUA 5I16B 2IMNA 3CXDL 2VZOA 3I6KB 4O58H 4WTXA 3PQYB 3VW3H 1IC5H 4UCFA 4PJBA 2WMIA 5EFDA 2X4TB 1QLRB 5CBAB 5HYFA 3E6FB 4FQIH 5EUOB 5DT1H 5C0AE 1D9KA 5I74B 4X6FB 1PYWA 1QFWH 3ZHKA 3WEXB 2Q8AH 1LK3L 1BQCA 3GRWL 5D7SH 1EDGA 1QHOA 1ZLUH 1BJ8A 2KZ1B 4QRSB 3GGWA 4UB0H 5HDRA 4ZODA 2EICA 1U8IB 3K1DA 3CFDA 4ELMA 4YBLB 5T33L 1MXDA 5KSVB 4HS8L 4Q6YA 4QRTA 1EH9A 1GZQB 1Z2KA 5E8DL 1ODUA 3MOAH 4KDWA 3KWWB 1Q8MA 1MOEA 3TH3T 4KZDH 1JD9A 3ARBC 3O41B 2W9EH 1QBLL 4YDIH 1QR1A 4XCYA 1NBZB 4ZAKA 1FCCA 4G8FB 5IB3A 1ROWA 5DA0B 4Z7UE 4AEEA 2F53A 2J7HA 4NT6B 1WV7T 5FCSH 5HGAA 4JGUA 1XNAA 2BHZA 5T1LB 4DM2A 1I4FB 3WKZA 1ONQA 4RMSA 1G7JA 2Y6SD 1JZ8A 3BW9B 3MUY1 4I2XB 1T0PB 4GT7A 4X7FC 4AZ6A 3KPOB 4OCSL 3B3IB 5GS2H 4OD3H 5C09A 4NN7B 5KSUA 4G8IB 1DDHB 5CEZH 1FC2D 2PXYB 4ZO6A 4UINL 5TFSH 1G7PB 4KI5E 3D48R 1J8KA 1Q38A 4PTVA 4YHPB 4X9HA 1JZ6A 4F7CA 2D9QB 3VFNB 3Q3GB 3GSXA 1A3QA 1T5XA 1A6VL 2DDUA 1PLGH 5C07B 1DN2A 4L8BA 4U7KA 3KLAB 3PDGA 3NN8A 2IQ9H 3NPSC 4HKBA 4I0PA 4FLOA 1A4JA 4PJ7B 4JHWH 4ZE5A 3S3PA 1UR4A 4AZ5A 2IXVA 1WFNA 4NQDD 1V6UA 1LEKA 3QFJE 4DVBB 1CS6A 5E1AA 2VX4A 5SWZA 3OKMB 3HI5H 3PGFH 3FMGL 1HH9B 4FLQA 5FIEA 4QF1A 2KQNA 1UWXK 3MREA 4O5LL 4PJEF 1JGVH 1UY1A 3LHPL 1J0HA 4OMDA 5D1QC 3KPRE 4N0FA 4N0UB 1KR1A 3VGDA 3UZEA 1HIZA 3BZ4A 4ZDHA 5HGBA 1C08B 3Q6FB 4JFEE 4EVNB 4MAUL 3LIZL 5FL1A 2DDQH 3CLEH 1Q6CA 5EBWA 2FX9H 5IKCA 5I76A 3ZL4L 1UXSA 4WCYL 2EH8H 1R5WB 1ND0A 4E41B 4RX4A 3UP1A 2MJWA 3L3GB 4PRNB 1RZ8A 1UADC 1UZ8B 6CGTA 2YPVH 3DTXA 5FKAB 3EYSL 3JWOL 4UBDC 4AY0A 1RZGB 3LPWA 4JN1L 3WXVH 4P2QA 4MVBD 1D5MB 2YSSB 5EFIA 2J1VA 3O6KL 1UB6B 2OSLA 2EDKA 2CD0A 4P59H 3VWJA 4LL9A 4LCWA 4ZYKA 1AP2B 5ACMA 1AR1C 2GUOA 4WNQA 3S35L 5GZOD 4HKZA 4EBQH 1T4KB 1WC7A 1AHWA 4RDQG 3VXRE 2BMKB 3ESUF 4ZXEA 2CLVB 4HF5L 3C2SA 2X89A 1JFXA 2J22A 1DWIM 4X6CE 2MNUA 2V17L 5KZCD 3VWJC 2OR9H 2HWZL 2R0WH 5E0QA 1MEXL 3PP4L 1XF4B 4XNYH 1AHWC 5I1AA 4LVNB 2ESVB 4LLMA 3REVA 4PJ9A 1UWEL 4GS7B 1RURL 1PKQA 1S8DA 3QYCA 5EA0H 5BXRA 2GJ6B 2Z93B 3UTTD 3HI6H 3QUKB 3GSUA 4FQJH 4XMLL 4GI9A 1CE6B 3BH8A 5GGTL 5J1AA 1BIHA 3NACH 1OW0A 1KCUL 5E8PA 4LCYA 2OP4H 3QXDB 5DGRA 4NHCH 1OGTA 1UGNA 1OD7A 4BZ1L 3OA5A 3PZVA 4NZRH 4XZUG 4KAQH 1E6JH 3ILQD 1RZ7H 5FECB 2BC4A 3QDMD 5C9KA 2VLKA 4XC3L 1IV8A 4LRNH 2CLRA 4Y7EA 3DXAB 2DTML 4ZNCD 2DOCA 3PWPD 4QCFA 4XPFL 2XVKA 4M1GL 1IC4H 3GSWB 4EE9A 1OSPL 3U83A 2B1AL 5FKPA 3MUJA 4LAJH 2H6PB 1CICB 5E00B 4APQB 5J56B 3OIHA 5CLTA 4PJIA 3WIHA 5I1HH 1EUTA 1B1YA 3C5JB 2W5FA 4YHKH 3PV7A 1BQHG 1O7AA 5DJYA 3VRLF 2V5SA 5DRNB 2EZ0D 3B5HA 2PW1B 1HNYA 1HKJA 2X7LB 5GS2D 4Z7QE 3QZWB 5FF6A 3CPLB 2R2HA 4HW6A 4DZBA 4PRHA 5CEZD 4MA8L 5AZ2H 4FQLH 4LPUA 4XBGA 2JF7A 5I0DA 3VXPA 1N8ZA 2NNAB 3P9MB 3ECBA 1GMMA 2FIKB 3I9GH 5BROA 4LFHD 3HZMA 4YPGA 4W4ZA 4HWBH 5C6TH 4ATWA 4L8CA 2YFZA 2DF3A 2AI0L 5IHBA 3CZLA 5IQ9A 3BZFA 4N8VA 4GO9A 3VIOA 2F9BT 5HPMA 2WMFA 1LG2A 2QSVA 1OAUH 4HIJA 1JF5A 5DEFA 1NH6A 4I18C 4U6HA 4M5ZL 5D71H 4AXNA 3GXDA 4S2SA 3QIWD 5I5RA 1SY6L 3OXSB 3L5XL 4OF7A 4NDMB 5IBTH 4AIZB 1IAOB 2CGRH 3QIUB 3GSOA 4GG8A 3I2IA 5I1KL 4NQDE 3CPUA 4FQCL 1JZ4A 1E0XA 4NKIL 2C4FT 4UNTA 4YDVA 3RGVD 1OAXL 1JPSH 3GRWA 5I9QC 4WY7L 1CLCA 1YNLH 3MLRL 5CJ8A 5H35B 4GRLA 4H8WC 4RFEA 3K2UH 2UWFA 5LYRA 2BCKA 3TIEA 1D6EB 4MS8C 5CSGA 3U79A 32C2A 1FYHB 1RUKH 5CD3A 5C0CE 1ZA6B 1MFBH 1XGQA 1JGDA 5FOBA 4UIMB 4TQEH 1WZKA 4PUBH 5CQ1A 5D93C 1WCQA 2BOBA 3GB7B 1FH8A 3FRUA 2PC8A 4X80H 4ZXBB 2GJXA 2RVAA 5DRWB 1A1OA 2C3GA 3UZQA 5JOFA 3DECA 4PRPD 5JO5A 1HILB 1R3LA 4LHUG 2X4RA 4HJJH 1KNOB 4U05A 4NO0B 2DWEA 1J5OH 3MNVA 2V2WB 3ZJ8A 3ARWA 1UYWH 2B4KA 2W65A 1NFDB 3O6FD 4N9GA 5HVHC 2FHBA 4EQ3A 3FNDA 3CH8A 5HPOA 4LVOC 1E0VA 3GTNA 2NW3B 3NFNB 1NFIB 3FQXB 3MUHL 4YGVA 1GGBH 2D20A 4W8LA 4B15A 3DYMA 4XCCL 4PJEA 4LEOA 4OKDA 1CXIA 4WFED 4NGHH 1RJYB 5DQDL 1Q9KA 4DGVH 3UBXG 3N0PB 5TGBB 4M7JL 5IG7A 5FYLE 3EW3B 3TO2A 4HZ6A 5T5FH 4LYQA 4GW4A 2O9RA 1VPOH 3FAXA 5IEKB 1JNNL 5A95A 3F7PC 1T1YA 5MHSD 4L4PA 3BE1H 1UUQA 3ZKND 3DVNA 5DSCA 5J11C 3PUCA 2R2BB 3C8KB 1MCDA 1L7TL 3ZT7A 2GK0A 3UTTE 4LYRA 1IEBA 4KDTA 4X7CC 4PJAB 5CHNA 4E4PA 1UT9A 3OTTA 1UCBH 5CJXC 4A3ZA 1ZGLP 4N0CC 5KSBF 1CU4H 4PJDE 2WLZA 1HJSA 2CR6A 1QLEL 4G9DB 2GDUA 5IFTA 5I1EL 1A6WH 1AXSA 3FHAA 4X4ZA 4W6WB 3QDME 2VQ1A 4P8XA 4LCIL 2J77A 3L4TA 4AZ7A 2ICWB 3PHAA 1IC7H 3PWPE 4CVZA 2JB6A 1FDLL 3QIBC 3AMLA 4PBXA 3SDXB 2YC2A 1UZ1A 3AXXA 4AISA 3O45A 1MJUH 1RUQL 3GSNA 2P8PA 2MTPA 4FFWD 3INUH 4BSVB 3L2LA 4TUKL 4W93A 5HI5C 4JG0H 4S3JA 2X4NB 3W24A 3EOTH 2Q7YB 1HL8A 4LPWA 2V5TA 2FO1A 4LRIA 5IW3A 3MUZ1 1BEYH 1DBKL 3A7QA 4MD0A 2GT9A 1VAHA 3ARBD 3KXFB 4XXDB 3VFVA 1LGVA 1FG2B 4JM2C 5JIHA 4QDMA 4I1NB 2ITCB 4NQSB 4JPVH 4LPCA 2X1WL 3IIIA 5DGQA 3U0PA 1DL7L 1OCWL 4AY1A 3EHBC 1OP9A 4PLKD 3ZKMC 1LEIA 3DRQA 1YMME 2VDML 4PTUB 5HBBA 4YDJB 4ZAKD 1ZLSL 1TZ7A 1J1OH 4LDOB 4LP4A 1JYXA 1KGCD 4Z5RB 2CXGA 1UWQA 1JG9A 4ESKA 4LSUL 4OB5L 2DM7A 4YZFE 5A16A 4KK8C 4DN3L 5JW5B 4XP4L 4BK4A 4NJ9L 1K45A 3SCMB 2YD9A 4Q7NA 3VM7A 2GCYB 1T7YA 5GGTA 4UILL 1I1FB 2CKSA 4ZSOB 3WIHH 4W5UA 4BSWA 5BMFL 4YFLI 3FTGA 4KRMB 3K1KC 3P0YL 3JBG7 4FZ8L 1S7XB 1KT2B 5C09D 3GI8L 5F88B 4XP5L 4NNXB 3O9WC 4K8RC 2X1XR 3ARPA 2E26A 1UKTA 2D7QA 2WV3A 3IF1A 2BV9A 3HJEA 4YDLC 3NIDE 3LDBB 3A23A 3OKKB 1FBIL 1BG4A 5KVDL 5SWSB 3P30H 1HWHB 3D85A 3E0GA 1IC1A 4LSRH 5TPWL 3MO4A 1JUFB 4PV9B 4DGYL 3QDHA 1P7HL 4I0PD 3PL6B 1UWTA 2O9OA 4DWSA 1M7IB 2UZIL 3GMLA 1T7XA 3HMWL 4KPHH 1H6YA 2EEXA 2DQDL 1SYVB 5D1QD 1YEIL 2Z31B 5SWZD 1BTCA 1UXWA 1FZOA 3G04B 1FOBA 3PNWB 4J6RL 3WNOA 5C08E 1PQZB 3HZVA 4H8WH 5BZDB 4V2XA 1VFBA 4PMYA 4DWSC 5D4QA 3N13A 1UD2A 4PRPE 2XVGA 3FO1A 3D25A 3KGRA 1WDSA 3F62A 1GQPA 2ZG2A 5FO7A 2GYSA 5CEXA 4DVRL 1EAJA 4PGCA 1ZJAA 1WSST 3WQ5A 4XPBL 4ZZ8A 3VFMB 4UBDD 5GPRA 3DGCR 4LHUD 4GKLA 3MUGA 3O2VH 4FQXC 5IHZB 2UV3A 5F7NC 3IJHA 5ID1A 5MENB 5K9OB 1W72H 2XPGB 4RX4D 3VXOA 1AR1D 4EZMA 1E1FA 2GY5A 2BNQD 4WFEE 1W0NA 3GBML 2Z8WC 4LU5H 1FZJB 1JPGB 4E42A 2Y64A 3HNMA 3X14A 2P8MA 2D7TL 3FB5B 1SY6A 4P2QD 3CFCL 3TBWB 1CF8L 4JM4L 1S5IH 4BKLB 4R3SA 1TVHA 4NRZA 1WFTA 3ARDA 5BV7C 2VWEE 4PB0H 3VWJD 2LU3A 3RL2B 4G42A 5BQ7B 4ZUTB 4P2OB 5DD5H 1AGBA 1T1XA 4NC1E 4X0KA 3C6LB 3QUMH 3AYSA 1WBZA 5HHNA 1DP0A 4OLWL 4YQXH 2X89D 4X8XA 1I7ZB 3L5WB 4I3GA 4XXCA 2VMEA 1TFVA 4ZUSA 3ARDC 4F33A 1GOHA 2PW2A 4U1JA 2QQLA 3AHYA 3OXRB 5I2UA 2WCGA 1NWUA 2VZRA 3GEWB 1IGFH 5B8CA 4AJ0A 4TSCL 2ICEA 5GIRA 4KROC 3UAJD 5I30H 1CNVA 1I8IB 2W95A 1SHMA 2RCSL 3LAFA 1KJMA 3ES6A 3QG6B 4XXCC 3N85H 5EWIL 2BDNH 4K7PH 1TVBA 3T04D 2VMCA 3ZDZF 3MR9A 3P2TA 1IL1A 1QLFB 5AWNL 1MJ7L 3GNOA 1HX0A 4PY7A 3TF7C 4EJ1C 1NAKL 2NY3B 3CH1A 4I9WE 1QW9A 3VFRB 3T0EB 4HG4K 1ZS2A 1T03L 1YY8A 1ZBVA 3ARXA 3R0MA 4PJBE 2Z92A 1NWTA 1I9JL 4ODTL 1CWVA 2VLKD 1BMGA 4PSRA 4Q0XL 3I97A 4WW2C 2J4WL 3O3EA 3VFTB 3QEHA 2YD8A 2ITDA 1QPXA 5CSYA 4X6DF 2HMIC 1INEH 1CYGA 3UERA 4U1NB 4QHMB 4W50A 4BQ9A 4QTIL 3VFUB 4F37F 3U0WL 4LX4A 4GIAA 1BZ9B 2DLGA 1CZVA 2CYGA 3OKOA 1HI6B 3EMQA 4QY8B 3SGJA 1FZKA 2NZIA 4AEIL 4JDTL 2W0LA 1T21A 3E8UH 5MERB 3UTSB 2HVKB 1S7RA 2F53E 1CGSH 5DLMH 2DD8H 4TX8A 4YXLH 4P5KB 5EJ1B 4PRHD 5GS1B 4R4ND 2PWGA 1KXTA 4N8CH 2HLAA 1QEWA 1QOXA 3SGJC 1VEMA 2EE9A 3LMJH 2E0PA 5FOJA 1BWWA 3QEGH 2HG5A 2VDRL 2N56A 4NO5A 2AJZA 3OZOA 3ULUL 3ULVL 5BRPA 5DMKB 1IFHH 2DQHL 2DMKA 3DUSB 5C09E 4BFBD 3KPTA 5E2UH 1YEHL 2P48B 2AJYH 5EOTA 5F6HI 4ZXOA 4YHLH 3DO7A 2EO1A 4PR5B 4HHAB 3WUEA 1JGEA 1G0DA 5CINH 2VQTA 1NGQL 4XCFH 1DBBL 4R0LA 4UZGA 1MFDH 3SDCC 2ZEZA 2CIPA 4GKZB 3H9ZA 2EYTA 1P6WA 3FFCE 1RZFL 2GTZB 2VNCA 3GK8L 4UU9A 4IRZL 2ATKB 4D0CB 4FTVB 5IVXB 1ACYH 2C7FA 1CX1A 3ULVF 4MS8D 4K8RH 3KPSA 1RAMA 5SWZE 3U0TB 4GZEA 2VXUH 3D39A 1AE6L 1ORSA 1BREA 4GRLD 1Z6JT 1X4YA 1JHJA 5I8CB 4E8DA 3BJLA 2FSEB 2J7GA 4WWKA 1CFTA 1HKIA 4RMQA 5ITFA 3W38A 2JB5H 2OKXA 3V8OA 1JTPA 5CGTA 3RWDA 4CUAA 2F8QA 1K4CB 2G60L 1MRCH 5D7IA 2YBRB 1N82A 1WAWA 1AJ7H 1YECH 4QOKA 4I4WA 1F00I 2N7AA 3T8XB 1MCPL 4WWKC 1MFAL 2FGWL 1QG3A 1PG7X 4D72A 1KEML 4JZNA 3EO9H 5DWUL 3MZGB 2ZCKL 4N5EC 1Q94A 1CE1L 1UX7A 1WZ1L 2FZ3A 3BGFC 5IB4B 5KVFH 2A74A 4KH2A 1MCKA 3GMOB 1GZPA 2APVA 5IQ7H 5EZLA 3L3IA 4PGDB 4Z95L 2VJXA 2ZJSL 4WTZA 4P2QE 4Z2IA 5JR2A 4A44A 5HYSA 2W91A 1HHGB 1BAGA 1F8TL 1K3IA 2VXVL 5FYJU 4KQ4L 1X5YA 2KQMA 4LCWE 2P4AB 1FH5L 1T83C 4P9HH 1I9RL 4GXUN 3P4NA 1ZGLA 4BFIB 5ILTL 3U4EA 1KQZA 1U30A 3PTQA 5JPNA 2NY1C 1CQKA 2QQMA 4X6BA 3L3KB 5DHVH 2RGMA 4IMKA 3GH4A 4DN4H 4JFFD 3RCNA 4HEPG 5JDSB 5BV7H 1TQBB 4WVRA 4N0CD 2C7UA 4LASH 1EEYB 4AZBA 3PHOB 1U8NB 1MF2H 1IRAY 2A2QT 1OWWA 3TFKD 1L6ZA 4XP6H 1KJ2L 1WKYA 4X83A 1F90L 1DUYB 2OCFD 1A7RH 2IC2A 1ZLWK 3W9EB 4PMZA 1QSVA 2N4IA 3MLZH 2VZQA 4Y1AA 1N6VA 1XH3A 2VITB 3TZVA 4AL8H 1CWYA 4AC1X 2PR4H 2DQJH 1A2YB 2X4OB 5GRZA 1C8QA 1OAYH 4XB7A 3G5VA 1HJUA 3X3FH 2RV9A 3AZTA 5IMMB 1QPPA 3NNGA 3HC4H 4QRUA 5F1KC 4WI7A 4K9EL 2NXZD 1X3DA 2A6DA 1U8KA 5E7FA 3WHE0 4KHXL 2DBLL 4I48A 4CKVX 2VLKE 5A2FA 2XTJE 2QQLH 4P57B 3TZVC 4LF3B 2RGSA 2B39A 2VDNH 3IU3B 2LTQC 5TE6L 1N4XL 4X5XB 2C9KA 1WIUA 3A67L 5TDNA 1XGTB 2YG0A 3AMCA 1FLRH 4ZO7A 1NEZA 4FQ1L 1MFCH 2CDGB 4PJ5B 4YXHL 2VUYA 1UKSA 1LO5B 2BNUA 3HPJA 3SY0B 3EHBD 4PJIE 5B39B 3QQ4A 3ZKMD 3T4AA 5C8JB 1CGUA 3V4UH 5LXGL 5DQJB 3S7GA 4I77L 4DKEH 3L3DB 5ICYB 3G5XB 4KRUA 2G75B 4PRHE 3QNYB 5A6SA 3F7QA 2A6IB 3S37X 4FA8A 43C9A 4KK8D 5EUOF 5FUCC 3WF0A 1CPUA 4M62L 3T65A 3X17A 2VC2L 3NFPA 3VFOB 1NLBL 4NCC1 1XIWB 4J1UB 1FRGL 1CLOH 5HHVL 3W0WE 4PTTB 1G6RA 1JRHL 3C5ZB 3CDGB 4OUUB 2H2PD 3BUYA 1CFQA 2RFXB 5TE7L 3AC0A 4X6DA 2F15A 1H5VA 4K8RD 4UAPA 4RYDA 4XAWH 2WC3A 2VLME 1CGYA 1MCLA 1YEFL 5DYOB 5C0IA 4YNYA 2R69L 1E4KA 3BFOA 5DJAA 1JFQH 5F7DB 5C0GB 3UDWC 1KTDB 3IK2A 3U7BA 5A6KA 5D2NE 1EEZA 3MLYH 5ABDE 5E0CA 3MRMB 3GMNB 3D69A 3QDGE 3S34H 2HKFH 2ZWLT 5H2BA 1AXTH 1LHZA 1Q9WB 2A83A 2VN4A 1A6ZA 4RCAA 5CGMA 1MI5D 4S11A 4Y88A 2J8FA 4Q2ZB 3D85D 5EU6D 5A2LH 5IROC 5C9JA 3LKQA 1NGYA 2AERT 2AAAA 4HPGA 2HJKA 2ZKHL 5JLZA 4U3AA 5D4YA 5KJRH 4DWSD 3UESA 1NGPL 4F8TA 4CD8A 3TPUA 1F3DH 3ZKSD 5E8OA 1CLYL 1G7IB 3BPCB 1C8XA 5CZVH 3FQTB 3VXSD 4KRNA 3UO1L 1VFAA 5GRJL 1BFVH 4PJFB 3DVFA 1C3FA 3GMRA 4HPOH 1ZWIB 1NMBH 5JQ6H 4PJ7F 1EHLH 1V7MH 5I66B 1ADQL 2YD4A 3TP4A 4AG4H 4Y5YA 1DANT 2WHLA 5DFTA 5DMYA 4Q9BA 3O11B 5F9WB 2XZCH 3RHWK 1UKPA 4P4KB 2OL3B 5C86A 3LS4H 3WNLA 4EEEA 4MB5A 3A22A 4JDVA 1G9EA 1CXKA 2ZSVA 5HDQH 4CU9A 1NFKA 2BERA 5E94A 4Y5YC 2XUCA 4FF5A 3J8F7 3MSGA 3RKDC 1DVFB 1A3LL 3K2MC 4PJEE 4ZD3H 1Q72L 4KI5M 3FT4A 2BNRB 4U0RB 2WKLA 2IAMC 4PRDA 3T4YB 1BVKA 4GKOA 3QEQB 5CZXC 2XG4A 3MLSH 2VLLA 3ZYZA 1ZVSB 1NMAL 5E2JA 4H88L 3ARDD 3OG6B 4GRWH 3BP7A 1OGAE 1A6AB 4DEVA 1A4KA 4PLNC 5E4EB 4NNPH 3QPQC 1LD9A 3WIJA 3OB0K 4WW1B 3IDJB 4UT9H 5CSZA 4MMZC 4C59B 3SO3B 4KROD 3UTZB 1B2YA 3MMUA 5HVWA 2E3VA 3QUZC 4GAJH 4ET7A 2AQ3A 3ZTNL 2MPAH 4GMTL 4MB1A 2DQGL 3QO1A 2FX8L 3A6OA 4C56A 1V7NH 3WUWG 3VIGA 3WFDH 4HUWA 3BKJL 3QUXA 1EPFA 3DBXB 3ZR5A 1EBPA 4PYSA 1BGXH 5BJTA 5D72H 1F11B 3WLBA 5IEHB 1U8JA 1P7KA 4JY5L 4GO8A 2ZP0T 1LEGB 3L6FB 3W29A 4KHTH 1AD0A 3BRGC 3C08H 1ESWA 3IVKB 3VGGA 1TJHL 4Z2AA 1H5BB 2HAZA 1MAML 4A6YB 3V0AC 3MS8A 5EZOH 4HKXA 1KTLB 3BPOB 4OZHF 4TRPL 4Z78B 4ML4A 5MP6L 2J7DA 2R56H 1FVDB 4R26H 3N06B 1S3KH 5D7LB 4NNYB 2YDSA 4JO3L 2Y8VA 3V79C 1RIUH 1WO2A 2QBWA 4WIQA 4B16A 3P73B 2O5YL 2HMID 2Q8XA 4GI6A 6TAAA 5KEZA 3F7YB 2DWDB 1B4JH 2D31B 1T6VN 5JXEC 1IGCL 1JZ3A 4OZFA 3HJRA 3NCJL 3LQZA 5LCWL 2ADIB 1BBDL 3DUUB 2EDNA 3WHXA 2AJUL 2EE2A 2EKSB 2CLZB 4NQVB 5AUMB 1A7QH 3C9NB 2AW2A 5FA4A 3ZSSA 3RX8A 1S7SB 1U8HB 5F1SA 3AIWA 3VJ6A 1OCQA 4X8JB 2JEQA 5JA8B 1U8QB 5L2KD 2FEEL 1B30A 4ZE4A 5C2BH 1F4YH 1RUAH 1N5AA 4LSVL 3WQVA 3N9GH 4LQFH 1UWGH 3VG9B 3MA7A 3P1IA 4QHLA 5GNYA 1T66C 2XFYA 2X4QB 4L4VA 1KJ2A 3QXAA 3AIQA 2CUIA 3DX6A 2VZVA 2MCPL 4B3KA 2FYYA 1BGGA 4U7MA 3OAYK 3G6DL 1NJ9A 2R4RH 4HJ0C 5J6GB 1MELA 3H8NA 4QLLA 1M71A 2VL5B 3HUJB 4JRYA 2Y1VA 3IDUA 2CEQA 1Q6GA 1PZUB 4BXSV 5I16A 5BOZG 4MTVA 2NX5B 4QHKI 5EU5A 3EBAA 5CCKL 4NKDB 3ZKXB 2N1KA 1D2KA 4PBGA 1UG9A 4OLUL 4UFJA 4UTBL 2X4TA 1CFBA 1QLRA 5CBAA 1R6VA 1G6RH 3E6FA 5EUOA 4AZHA 1SEQH 1CQYA 3GHBL 2YEZA 3Q2CA 2GJRA 3L3HB 3EYUH 3WEXA 2VB5A 1DSFH 4QRSA 3TO4B 2EDFA 4LEXH 1FNEB 1FN4B 1QNZL 3AXLB 2R29H 1W0YT 1W3JA 3MRJA 3IDYC 2AXFA 2O5XL 3KPSD 5KSVA 3B9DA 1J87A 4O4YH 5GXBB 3D39D 4MO3M 3KWWA 5AYUL 1UXXX 3NYDA 3U36B 1OGBA 3N50A 3O41A 3DOSA 3PTMA 4WWKD 1NBZA 4G8FA 4JZOA 4J8RB 2C4FU 4NT6A 2XV6B 3CZGA 4W87A 5DMIL 2V9QA 1RVFH 3SQBA 4NRYB 1U58B 3GJEB 4O02H 4P9MH 1I4FA 5IHSA 1P4LB 3MFGB 1HHIB 1TPXC 5AYQA 3WO4B 4L8SB 4QOKD 3EYQC 1FGVL 3BN9D 3CIQA 3UYPA 3AREB 4Y4HC 3KPOA 2FD6H 3MV8B 3C09B 2HLFC 3B3IA 4XCEB 1XF1A 4FLRA 5C3TA 3K7UA 4G8IA 2ZUNA 1DDHA 4CJ0A 1UJ3B 4WJ5A 2PXYA 4ZTOL 2O92A 4YBQC 4D6CA 1FYTB 1HXJA 1UH2A 4MDIA 2LW8A 3ZJ6A 2OZ4H 2NY1D 5LCVL 1NCBL 2Y6JA 3VFNA 2C26A 3OMZA 3Q3GA 4K23L 4OSUH 2G3JA 5DVLA 3KLAA 3E2HB 5F6IC 2NYYC 4NUJB 5F7UA 4HU8A 4PJ7A 3EJZC 1OLLA 1MVFA 2HTKC 3QUYC 5L88L 4BFEA 3QQNA 2W60B 4DVBA 1NFDF 1QRNE 5IT2H 5AAWA 2DCJA 2E40A 4X4YA 1Q6FA 4Y16B 4FFYH 1HH9A 5SV3A 4Z2KA 3DPBA 3PDOB 2VC9A 1PY9A 2VLRB 3KHQA 4I3RH 5C0FA 3QRGH 2QQKH 3ULSB 3WSUA 4RFNC 3VXMB 1R5IB 1AGDB 5F44A 3QHMA 3RZCB 4N0UA 3IDNB 4PS4L 3SQOH 2DAVA 4NHUA 4OAWB 1E6RA 4MB3A 4Y1AD 1C08A 3Q6FA 4EVNA 1ADQA 2HN7B 3TZVD 4W86A 1C5DB 3K8KA 3VD3A 2ID4A 5HHXH 4PJGA 1IQWL 4GXUM 1WEJL 5ECUA 4E41A 1L8NA 3ECQA 1YEKL 5EZIH 4NQXB 4PRNA 1UZ8A 4PJAF 2FH6A 2W47A 4HC1H 5DZLA 3VWKB 3HNTH 5FKAA 1RZGA 6A3HA 4N5UA 4KXZI 3NMEA 4LGSB 4MQTB 5C0RH 2DT0A 1MY7A 3B8SA 1A02N 2IG2L 4DXRA 2W1NA 2XVLA 3SE9H 1UB6A 1MFEH 2NY6C 1KENL 4JREB 1MCEA 3RJQB 5KSBE 2GK2A 1AP2A 1FPTL 4S1SH 5A8QA 1CBVL 1T4KA 4NUGL 5F9JB 2JJTC 2R0LH 4JO4L 2BMKA 5E5MB 4NQUA 1ZK9A 4MD4A 2R23B 1OLZA 1DWAM 2CLVA 4HIEB 3SDXF 4DKFH 1KCVL 3ARFC 3X11B 5KS9B 1CLVA 1KXQA 3EMZA 3F4VA 3J7HA 3CK0L 4GH7B 4P4RB 4HZLB 1FNLA 2H9GB 3ARGC 4AIXA 1YNTB 4C7FA 4K2UL 5I1IH 1XF4A 3OX8B 1NAMH 4X9IA 4QCEA 2Y06L 2ESVA 2MKLC 5TQ0H 4B53A 2V3EA 5I1DA 5EH1A 3GIVB 1K8IB 2W0PA 1HT6A 5IR1B 2YC1B 1LO4H 3LKSB 3TA3B 3QCVL 3K80A 2HRPH 3HR5A 4EDXB 2GJ6A 3BAWA 2W67A 5F21B 2NTSP 1UY4A 2FX7L 4OOZA 3BPLB 1QD0A 1DQMH 1CE6A 3IYLW 3TYFB 1FE8L 1KIUA 4I3SH 1M04A 4RN5A 1SBBA 3H6JA 1UEMA 2KH2B 4RBPK 5JOEA 3SE8H 1WIPA 1FC1A 4H1LB 5KW9H 1E72M 1EGJL 5IYYA 2EIZB 4FXGA 2IJ0C 4OGXH 2Z35B 2AVGA 4M1DL 5FECA 1KN2H 1GAFH 3W27A 3DX8B 1WBYB 3RWJB 1L6XA 3QNZB 3WLWD 5IESL 3TBTB 3CFKA 5EBMB 3I2JA 4W81A 3MPCA 3ZIZA 3LEVH 2C8NA 1W1YA 1MWAH 2AJVL 3R06A 3ZLQC 3UR7A 4Z2GA 3MRDA 1T2QL 4WF7A 1TETL 3KPSE 4EIGB 2B2XH 2H6PA 2MHAB 1S5HB 4XC1L 2NW0A 1YC8A 1WCBA 5E00A 1J0KA 4APQA 3QCTL 3B9KA 5DS8B 3CMOH 4JAMB 2LU7A 3A6CL 3FKUS 1OP3K 3C5JA 2XJ7A 3NRUA 3CTTA 2K9UA 1MCWM 4HUMB 1KCLA 3MV9A 5DRNA 2VABB 4RISL 2PW1A 1NCDH 2X7LA 4G6ML 2VDQL 3QZWA 4NQTA 1NDMA 3CPLA 3S36X 4WK9A 1UM4L 5DUMH 5D7IE 2HFFB 2NXYC 4OCYH 3MRNB 3B9KC 2WCSA 4QOKE 5F96L 4CW1B 1TZHB 1BQLL 2WZEA 1SJEB 4MAYC 2NNAA 1WCGA 2XM1A 4OF6A 4M6OH 2FIKA 1QKZL 5ISZB 1KXVC 1KYOJ 4PY8I 1O8PA 4RA0C 2H1PH 5DJCB 3NQHA 1M1SA 2LU4A 4QGTA 3EJYC 2Y7QB 3QR2A 5HHME 5E9AA 3ALWA 5L6YL 1RMFH 2V2XB 2E27H 5CZXD 2F5BH 4WLCA 4TTUA 4XNUL 3ACFA 5ALCH 3FO9B 1U8PB 3WD5H 1F3DJ 3OXSA 4NDMA 4AIZA 1C8PA 1IAOA 1KULA 1CD9B 3VTRA 4HU0A 1G9NL 1O8SA 2XTLA 4XBEL 2J8OA 2R0ZL 3SIMA 4C83B 4PMVA 5D7JB 3V6FB 4R5EA 3R1GH 2OQJA 4JFPB 3U4BH 1REIA 1B3JA 4HFUL 3BZEB 3TJHC 2AABL 3RPMA 2VSCA 3BVNB 5H35A 2Y6LA 5C3LD 4O2EB 2WM0A 4KUZH 3T0VA 4XPAL 3OKLB 5GHWL 3PHQB 3UJTH 3LS5L 4R90L 5EO0B 5HI3D 5IMKB 1EHNA 3UX9B 2NR6C 1F58L 3U1SH 1LQSR 1ZA6A 4C56D 4GQ9L 4J3SA 4UIMA 1HZHH 4Y1AE 2O26U 3U6RB 3MC0A 3V6OC 3V4VH 2QHRL 1CGXA 3QUXD 1ZXQA 1A14L 3GB7A 3T1WA 2OK0H 4GLRH 4JQIL 5ECJE 4ZXBA 3V5HB 5DRWA 3NAAH 2FHCA 1UD3A 2J8UB 1C5CL 1PY4A 1HILA 2ADGB 1HDMB 3GBNL 3WDJA 3U9UB 1XRVA 2IPUK 1KNOA 4F15C 7FABH 1CDGA 3BLPX 1HYSD 2QQIA 4RBPH 2EDXA 3TJEL 2V2WA 4YHOH 5FHBL 5SWQB 3ROLB 4XMKL 5C6WH 3UPAA 2FL5B 5FUZH 3EFDL 1OAKH 3M17B 1UWUA 5DC4B 4N90D 5DUPH 4GRMB 4O9HL 5FAAA 5CZKA 5GSRB 3KLSA 3NFNA 2OWCA 3FQXA 3HI1B 2Q86B 3QCUL 2W38A 4QHUB 4H0IA 4XPGH 3LKRA 5KTEH 1AI1H 5D96B 1RJYA 2IH3A 1UYQA 4OIIL 4UTFA 5TGBA 5HYJE 4JCMA 4Y2OA 4OF8A 3WFCL 3WJLA 4HIXH 2YKLL 4Z9KB 4HGMA 1HIMH 3ZDZE 3BEWB 3W9DB 1G0XA 1W3KA 3LSOA 1F6FB 3HLAB 1BF2A 1YYLL 1T66D 1J83A 4GBXC 1OP3H 3VFPA 2R2BA 3C8KA 3VFWB 5IMOB 2F8OA 3HA0A 4GI8A 2HYXA 3MV01 4IIQB 4QXGL 4WI3A 2JCCA 4D6HA 3VRJB 5F7MC 4NRRA 3OV6A 2Y6HA 3DUHA 1OQOA 4RGNE 4HJ0D 3NCCB 1CTOA 1UZ0A 3JWDC 4Y4KA 2UYLB 1F2XK 2Y4SA 5BVPH 4L4VD 1S9VB 3VDBA 4G9DA 1HQRA 5A43C 4HBQA 2QKIB 3HRZB 4X6DE 4W7WA 1MCIA 4UT6L 1OF2B 1GJWA 2QTEA 1CFVH 3QOMA 1J0ZA 3O6LH 4P8VA 1D5XB 1K9EA 3UYOD 5I73B 4ZPTB 4Y4KC 4LARH 3O2DH 1QA9B 3SDXA 3ARUA 3NA9L 1ISZA 2ZICA 1E4JA 3WMCA 3BJ91 2AK1H 4LOUD 4NC2B 4JKLA 1EDQA 1ORQB 4BSVA 3MLTB 1DBJL 3L1OH 3N18A 1QFOA 2XY2A 2QQJA 2Q7YA 5EOCH 5TF1L 5IB5B 3FO0H 3TBSB 3MRCB 3D0LB 3KXFA 4XXDA 3TV3L 3MCKA 1FG2A 4MCYB 1V8HA 3WNMA 3RI5K 2DLFH 3EYVB 1MRFL 3MBXL 4OCMC 4OGYL 5DVMA 2ITCA 3BKYL 3X13B 2IPUG 1AIFB 4NQSA 4NM8H 4M5YH 1EXUB 3LZFL 5CS7A 1GONA 1MRDL 4UQDA 5DUBB 3JWOC 1MCWW 1AQMA 4ZFGH 4FG6C 4KMTH 4AYFA 1MCOH 3CH9A 2APXA 2V3FA 3A4XA 1RFDL 4PTUA 2H8PB 2FDBP 4MNHB 1KJ3H 4Q9RH 3VILA 5IVXF 2XFXB 2HLFD 3VMNA 3LY6A 1SBSL 3PXHA 4NP4H 4Z5RA 4TOYL 1HKKA 2R1WB 3C7OA 2D0FA 3BAXA 5DJ8B 1RULH 5JW5A 5MEOA 4K3DL 3ULVE 1UQZA 4YBQD 4FI9A 1WWCA 2GCYA 3WQBA 1CR9H 4ZSOA 3OHXB 3SBWC 1V08A 4Z7VA 3SCOA 1A6TB 5IVZB 1CG9A 1KT2A 1EAPB 4LVHB 3ACGA 3S98A 1B6UA 2NYYD 3EO1A 5C0EB 5F88A 4NNXA 4NQCB 1ZS8B 3EJZD 5F6HJ 4DOHE 4HK0A 4OZGB 3BKML 3EOBB 3RGVB 4HLJA 2E8YA 3IXTA 1LDPL 4BDVB 3OZPA 2Z4QB 1JUFA 1KIPB 4PV9A 4C57C 4K68A 3X3GL 2QQOA 2XM2A 3PL6A 1M7IA 1MREH 4U3XA 4U6VH 1FFOB 1AC0A 2WUCL 1XGPB 4KVNH 4IBLT 1SYVA 2XSAA 2Z31A 1UB5B 3G04A 5AYBA 5CMAB 1OTUC 3MX0A 2MQ0A 3PNWA 5D1XC 4G7YH 1PQZA 2PCPA 1UWRA 4GZIA 5FEBA 5BZDA 2GITB 2CK0L 3QI9A 1GPOH 5EO1B 1D6VH 1NMCC 3DURB 1GC1C 1YEEL 3K4ZA 4HIHB 5E6IB 3PG2A 5AZEH 2E7LA 1DQDL 4S10A 3B6SA 1I7TB 1XC6A 1IM9B 1IVLA 3VFMA 5E56A 3QI9C 3O6FB 3BGMA 3K74B 1QHZA 1FAIH 4LSPH 4BZ2H 5IHZA 4WI5A 5GGUB 4WTWA 2NY6D 5K9OA 4RAUB 3AU1A 2XPGA 1JI2A 5ENWB 2CBIA 2Y2WA 4XTRD 2WVVB 3V9FA 1FZJA