2X0IA

2.9 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with nadh
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
294
Chain Sequence
MKLGFVGAGRVGSTSAFTCLLNLDVDEIALVDIAEDLAVGEAMDLAHAAAGIDKYPKIVGGADYSLLKGSEIIVVTAGLARKPGMTRLDLAHKNAGIIKDIAKKIVENAPESKILVVTNPMDVMTYIMWKESGKPRNEVFGMGNQLDSQRLKERLYNAGARNIRRAWIIGEHGDSMFVAKSLADFDGEVDWEAVENDVRFVAAEVIKRKGATIFGPAVAIYRMVKAVVEDTGEIIPTSMILQGEYGIENVAVGVPAKLGKNGAEVADIKLSDEEIEKLRNSAKILRERLEELGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.9A Resolution Crystal Structure of Malate Dehydrogenase from Archaeoglobus Fulgidus: Mechanisms of Oligomerisation and Thermal Stabilisation.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
total genus 107
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x0iA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x0iA02
4O5OA 2J5KA 3EY4A 4KMSA 3EVTA 2EP5A 3SLGA 3C7DB 1E3WA 4UVDA 3V5NA 3ROMA 2FR8A 3RASA 3WS7A 2ZYAA 1GUFA 3OEWA 5DP1A 3QWAA 1XELA 2ZTLA 3E18A 5FI5A 1XSEA 5KJ6A 3LT2A 2OMEA 3JYLA 4XGNA 2XF8A 3NAQA 4A2CA 2VNAA 1QG6A 4XYMA 1NNUA 2DU8A 4ND4A 3W8DA 1DLIA 3ONFA 4BUCA 1DRVA 1LSJA 4QEDA 4URFA 3W8FA 4F46A 1I3KA 3AOGA 3CXRA 4QO7A 1AXEA 5EERA 1F8GA 5JO9A 2O3UA 3OM9A 2DUUA 3IQDB 4OXNA 2E49A 2O23A 4OMUA 4QQRA 4J0FA 3QA9A 1ZZEA 4CL3A 3LT4A 3M6IA 3NT4A 2AHRA 1XU7A 3GQVA 4J7UA 4NJOA 1UP4A 1RKXA 2HU2A 1V3TA 3O8QB 1SBYA 5KWEA 3DOCA 3KEQA 2A92A 4MP6A 4OL9A 2OXIA 1ZFNA 4CR6A 3IS3A 1EQ2A 3SVTA 2UDPA 3I9KA 3E82A 5G0WA 4G5HA 4YJFB 3VZSA 1X7DA 3S2IA 2HUNA 1YVEI 3MJVA 1Q7GA 1GL3A 4HFRA 1I3NA 4EUEA 3WIDA 4R54A 3ROQA 3WNVA 2X8LA 4HKTA 1IZ9A 5KIAA 1XIVA 2C54A 5CG1A 1BDBA 3EZLA 5G0VA 5LCXA 3FD8A 4GLLA 4DVJA 3LVFO 5JBIA 4AJNA 1TT5B 1DIGA 1ISIA 4K6FA 1V35A 3BMQB 4AJHA 4FFRA 3W6ZA 3QLJA 3GPDG 4AG3A 1C0KA 1VE9A 1KVUA 1E77A 2HKIA 1DFGA 1MG5A 5ENVA 1Q0QA 1PR3A 2NACA 3RJ5A 1U9JA 4AFNA 1NAIA 4YR9A 2Q1TA 3K5PA 4YXFA 3IKTA 4BO2A 3PGXA 4JIGA 1GYQA 2OP0A 5JDCC 2QZZA 3KYDA 1DC5A 2CDCA 3U4IA 4YPOA 1Y8RB 3ETDA 4HFNA 4MKXA 1L1FA 1KY5A 2SCUA 4L75A 2X86A 4QT0A 3VZPA 4W99A 2WDZA 3VZRA 4FS3A 2GZ1A 5I7VA 4JXKA 3CIFA 3DFZA 3W4KA 3GK3A 4XDYA 2BI7A 3E9MA 5COAA 3I9MA 4DLLA 1UZMA 2VOJA 1LSOA 3ORFA 4CM6A 4OIMA 1WP4A 4J7CA 4A5OA 4E0BA 4RORA 2D3TA 1CDOA 3BXXA 5EESA 3AUSA 3SC6A 4E2ZA 2Y0DA 1RWBA 4YT5A 4J1SA 1EBFA 5HRUA 3G49A 2IEDA 4MP3A 4NQZA 2JFHA 4QSMA 1ZVMA 3JD2A 4EJMA 3HSKA 5I9MA 3ZDFA 4E21A 2VHZA 1T2EA 3WQSB 5CFZA 1P1KA 3ON5A 4J4TA 4LW8A 2PZLA 1M6HA 2I65A 4BO8A 1BTOA 3DTYA 5KTKA 2OBYA 4TZTA 2HMTA 1C0LA 2PA3A 4L8VA 1C0PA 4RVGA 3ZN2A 1NVMB 1I3MA 4XYLA 4BNMA 4J90A 4EZBA 3QP9A 1A71A 1EE2A 3C8MA 4ALIA 2DUWA 2QW8A 4LCEA 4BKUA 3BMOB 2NTVA 3O9ZA 4YJHA 3HWRA 4B4OA 4CMGA 1FDUA 4A03A 3BMQA 3D0OA 3HNPA 5DF1A 3TZ6A 3OQ1A 1GTMA 4WASA 1PJTA 4IS3A 5JLAA 3RU9A 1YOVA 1BRMA 3VH2A 4BO1A 4NIMA 5G0TA 2UV8A 1F17A 1HZJA 2Y93A 4HBGA 3SEFA 3HDJA 2Y99A 4IBOA 1ONPA 1UUFA 2BHLA 4GMGA 4IJUA 1HDGO 1HDYA 3WMWA 5T5QA 3TZKA 1OAAA 2QYSA 3DZGA 1HSOA 4MVJD 4HFMA 5A9SB 3FPLA 3LU1A 2ZYDA 3IUPA 5IXYA 3D4NA 4ZA2A 1LC0A 3ZWCA 4AJ2A 3Q9NA 3QV1A 5TIIA 1Z75A 1YB4A 2D8AA 1HDOA 4DPLA 2AG8A 1E1NA 5IN5A 3GC6A 4DGSA 1P33A 1EVYA 1ZJZA 3IC5A 4FD3A 1BXGB 1U3UA 2PH5A 4J6FA 4DUPA 2W90A 2IZ0A 4OQYA 5KVVA 1B3RA 3JQ7A 3AW9A 4R16A 1KEWA 3K30A 4MVJP 4YJGB 1UAYA 1EBUA 2EW2A 3QVSA 4EEXA 1I01A 4E5NA 2GSDA 3EVNA 3OP4A 1LNQA 5C7OO 3EHEA 3H9UA 4OOFA 1SO8A 2EJWA 3JQBC 4KUHA 1ULUA 1FDTA 2O7QA 3OSUA 3KXDA 4U0KA 3QVTA 1W8DA 2BGMA 2GDZA 4AJOA 5GZ6A 2HSDA 4IQ8A 1LRKA 2Q46A 3I6IA 3X2FA 1R15A 3UVEA 4D0SA 1FF9A 3PLNA 4BKOA 2O2SA 2RH4A 1E1MA 2ZB8A 3F4LA 4GI2A 4Q39A 2WE8A 3OH8A 2VOEA 3BHIA 2FOIA 2HO5A 3GNSA 3D4PA 3OIDA 4FIZA 2DM6A 3G0OA 1JKIA 4AJPA 2PFGA 5FFFA 1KERA 2Y0CA 4W9NC 4CM8B 5JY1A 3WFJA 5L4SA 1GADO 4XIYA 3LF2A 4ND5A 4NJMB 1YL5A 4FSHA 2GYYA 1IPFA 4F3YA 3TN7A 1T4BA 3FNGA 5L4NA 1KVQA 1G0OA 3GVHA 1WLYA 1ISGA 2RHRA 2ZYGA 2DTXA 2Q1WA 3ZZNA 3NJ8A 1ZKMA 1HETA 2YHIB 3S2FA 2YYYA 3B1JA 5TLSA 3FWZA 1J49A 3L6EA 4R69A 1E3IA 1PWZA 5C7LO 3WIEA 5AXCA 4RF5A 3HHPA 4NBRA 4DIFA 4BGUA 3V2HA 1I24A 3E9NA 1UXJA 2FY8A 3GHYA 3GVPA 2C2YA 3O4RA 5F1KA 1HDZA 1LJ8A 2P9GA 5CG2A 4K26A 2C0CA 1ISFA 4JBHA 5BSHA 1R66A 4MINA 4D3SA 4EI2A 5H82A 1LDMA 4IM7A 3PLRA 3IIEA 1EFLA 5MDHA 3AUAA 4MP8A 5G4KB 4R51A 4FB5A 2BFAA 1D3AA 2BFOA 3FCOA 3KYDB 4D79A 2IZZA 3W6UA 1ISJA 1PJ2A 1T24A 3I4FA 3Q2KA 3RUFA 4RZIA 3G3EA 1Y6JA 3PIIA 4OSPA 2DC1A 3KB6A 4XYBA 5LDHA 3HB4X 1E92A 4XKJA 2JFGA 4RVHA 4ZQGA 4WLNA 5CEEA 3VTFA 3A1NA 4B8WA 2YV1A 4FC6A 1YQGA 1FDWA 3IMFA 3H2ZA 3BMCA 3ANNA 4M87A 1KY4A 2OGUA 1KC1A 3I9LA 3UXYA 4NR0A 2DPGA 3MJEA 2GN8A 4FOSA 1NYTA 3BMNB 1KC3A 1PEDA 4BNWA 1N9GA 1LLUA 3A14A 3A4VA 3QY9A 1U3VA 3OA0A 1YO6A 5KVSA 1P45A 4M89A 4ND1A 3JQ8A 3L6OO 5CDTA 2NTNA 2HMWA 3NDRA 1KEVA 1EVZA 5JAIA 3F47A 3ZU5A 1CYDA 4XRGA 1R4MA 2EP7A 4ND2A 1FK8A 3D3WA 4PLHA 5LC1A 3SX2A 5TQVA 5JNLA 5L7TA 2IDZA 2DTDA 4YYZA 3BYZA 3ZH2A 4KP7A 4II2A 1OOEA 1XG5A 1K3TA 2ZB4A 5IN4A 1HE2A 5JAZA 4EDFA 1Y5MA 3DZKA 1FDVA 1JTVA 1F8FA 1Y1PA 2JJYA 2BD0A 2Y67A 4YAIA 2BRUA 1UDAA 2VT3A 4PVCA 3UCEA 5I7EA 1GYPA 3HG7A 2B4RO 1CWUA 1Y7TA 3IUSA 1YOVB 3JSAA 1YWGO 2AEFA 1DJNA 2PD4A 3NRCA 4RPKA 4ID9A 2YDXA 1XYGA 1YB5A 3QIVA 1WXDA 1NWHA 4A10A 1PL6A 1BGVA 1E1KA 1S7CA 4XJSA 3H7AA 3WGOA 2VQ3A 4PG4A 4KDEA 1U2GA 1VM6A 2JL1A 1BXKA 3GLQA 2P9EA 2Q2WA 3JQDA 2YJZA 1T1SA 3FHLA 3JQEA 3JQGB 1DFHA 3WWYA 3ZHBA 4AJ4A 4NJMA 4Q3NA 2HK8A 1HE5A 1QSGA 1HDXA 5ICMA 2IEBA 3NTOA 1UJMA 1ZBQA 2QRJA 5I7SA 3KTDA 1P74A 3RC9A 3FNFA 3DAGA 4LN1A 1I3LA 1L7EA 3TL2A 2IYOA 2P2SA 1SC6A 3OIFA 1VC2A 2B36A 2Y1GA 4UVIA 2YHIA 4PN3A 5JO0A 2X7HA 4NBWA 2JHFA 4N18A 1N9GB 1PJ3A 4DBVO 1G6KA 4KQXA 3B70A 3KLPX 3VZQA 3GY0A 3CINA 3SBOA 4BNVA 4GX2A 2O3QA 1QXSA 2FMUA 2VWQA 4N5NA 1ZJYA 1ID1A 4D44A 2NVBA 4CUZA 3EK2A 4BNTA 4IPTA 3P2YA 4W9NA 5HTOA 2OZPA 1SMKA 2IE0A 4BGEA 2EKPA 3HJAA 1GPDG 1NASA 2NVUB 4CLOA 2YV2A 2H5LA 3JQ8B 3M1LA 4GGOA 1LQUA 1NHWA 3HUDA 3FBGA 4CQLA 3HN7A 3PK0A 5TT0A 4BOYA 4PLYA 1Z82A 2QYTA 4QO8A 5JDIA 2G5CA 2WYVA 4L9RA 1KEUA 1KYQA 3PWSA 1X1TA 3STHA 2E37A 3KSUA 2X4GA 2Q4EA 2DQ4A 2YZ7A 1HL3A 3DZHA 1DJQA 4IJWA 3UW3A 1Y5RA 4DLBA 1YQDA 2WEKA 1D8AA 3IDSA 1KBZA 4DQVA 4J0EA 3CZRA 2PGDA 2DT5A 2VYVD 1LU9A 2C29D 4ROSA 4CM4A 3FNEA 5F1PA 2VCYA 3F9IA 4J4HA 5T57A 2WSBA 2YHUA 1YB1A 1BXGA 4UREA 4LRTB 2NQTA 5A9SA 9LDBA 2W8ZA 2WTBA 4CPDA 3AY7A 2Q2QA 2EIHA 3JYNA 3OIGA 4N7RA 1PJCA 2Y0EA 1UDCA 2HAEA 4TVOA 2D0IA 3WG9A 1HSZA 4AJ1A 1IHYA 1B16A 3PZBA 3KHUA 3L4SO 4YACA 2FZEA 4XWYA 3WGGA 4BHTA 1D7OA 2J5RA 3MOIA 1JVSA 4NFYA 4J43A 2FR0A 5IZCA 4BGVA 4M86A 2NSDA 1I2BA 1ZK3A 1U5CA 2G0TA 4RF4A 3DAFA 4BS9A 2WD7B 3I9OA 3L77A 3GVIA 4E6PA 3JQ9A 4I1IA 2PGLA 2EEZA 2ZJ1A 4IDFA 4K9DA 1U3TA 4G81A 2OP1A 2EJVA 3DZIA 3R0IA 1F06A 3PDUA 4R9RA 1E3JA 3T7EA 1PGNA 4J1TA 5DBGA 1WVGA 4MVJF 4FBGA 4PZCA 5EMHA 3ZWBA 1R0SA 1VKNA 3UF0A 4XR9A 4J9UE 4R1NA 4RVDA 1S6YA 5JS6A 1PU2A 1NM5A 4EBFA 1SEPA 3GG2A 2V65A 3DB2A 1LDBA 1CF2O 1Y8QA 4OXYA 1E5QA 2VZ9A 4AJLA 3IJPA 2A9FA 1WNTA 1I8TA 2QRKA 3C7CB 2OHXA 3M1AA 4BQPA 3ZNOA 2E4AA 1RM3A 3OF2A 5DZSA 2B37A 3PP8A 2D5CA 4BO3A 5CDSA 3ZI0A 1BMDA 1P44A 1HKUA 4BNNA 2FSVA 4WOKA 4FJ0A 1UDBA 3NYWA 2NU6A 1ISMA 1H93A 2BLLA 3OHSX 1O89A 3RC1A 1PX0A 3L4BA 1GUZA 2WD8A 3JD4A 4RF3A 3AFMA 3H5AA 1N7GA 3U4HA 2DBZA 1JLLA 3VVCA 3W4IA 4MIEA 3HFSA 3NX4A 4UVHA 4U7WA 3KZVA 3PQDA 3WGZA 1U4OA 4D46A 3DOOA 4DQXA 3H5RA 1R4MB 5B1YA 1M6WA 5TS3A 4PLVA 1JWBB 4PLTA 4XGKA 4MVJH 2BKAA 1UXIA 4ND3A 4UAGA 4BNUA 1XGKA 2C7VA 1JQBA 1U8FO 4IQ0A 1UR5A 2PH3A 3CTMA 1E0DA 5AVOA 3CMMA 1X7GA 4QFCA 1E3EA 4YT2A 2GGSA 4ZICA 4WCFB 1VI2A 3LSYA 2EV9A 3WGHA 2D1YA 5TF4A 3RKRA 4IS2A 3D7LA 4JQCA 5L53A 4I9NA 2FN7A 3CH6A 5AXDA 4NBTA 1WW8A 2ZTVA 1DSSG 1Z45A 4NI5A 5F5NA 3FI9A 3GF4A 4Y6SA 2EKLA 1PIWA 4CUJA 1MXHA 3U49A 2C82A 3L0DA 1PS8A 2NNLD 4KQWA 2O4CA 1ENYA 1FJHA 4I5GA 3RAJA 3V1YA 4UUMA 1W0CA 2QIOA 3GOHA 3QWIA 1XR3A 1WWKA 2Q99A 3EW7A 5FF9A 4HXYA 2FWMX 2AXQA 1GUYA 1M75A 1TB4A 5B37A 1YH3A 4YDRA 3ZWYA 5BQFA 2WYUA 3E5RA 3PYLA 1QYVA 1MLDA 1QORA 1U8XX 2V7PA 3ROPA 1LDNA 1E6EA 1F12A 2PZKA 1GD1O 1Y9EA 4J9VA 2X9NA 2O4UX 3IKVA 3MEQA 2Y68A 4GAEA 4EITA 4FC7A 1IB6A 5I7FA 2AEJA 3KRTA 5JC8A 1IE3A 4AICA 1TLTA 1YBMA 3Q0EA 4MIYA 5LDGA 3S8MA 4A73A 4DA9A 2I3GA 4K1LA 5CPBA 5IXSA 3A06A 1U5AA 1P3DA 3H6KA 3MTJA 4MVJI 2JAPA 3KOUA 4PVDA 1A5ZA 1ZH8A 4BNXA 1NQTA 1NVGA 5FWNA 3LC1O 3FBTA 4DXHA 5IF3A 5L3ZA 1P1RA 3ETEA 3N58A 1KIFA 5G0SA 1ULSA 1W6UA 4GVXA 1DHTA 1Y8QB 1GY8A 3RQSA 3WMXA 4P4NA 1H94A 3PHLA 4YAKA 3PGJA 2X6TA 2GN6A 3R3SA 5I9NA 4L4SA 3SJUA 1BVUA 3AM4A 3GFBA 3ITDA 4R5MA 3NGXA 4KOAA 4JROA 3VAZA 4Y6PA 1WMAA 2G76A 2GD1O 3ABIA 4R41A 4RVSA 4YA6A 5CPFA 4E5MA 4ITUA 3RSHA 4QFDA 5T8KC 3DBLB 3G1TA 3OJ0A 1HE4A 4Y67A 4UUPA 1K2WA 3DEYX 2VT2A 3ENKA 5ICSA 5TT1A 3ROKA 1A7KA 4NBUA 1UP7A 3EYWA 3PFWO 4WPGA 3WYCA 3DOJA 3F5QA 3PI7A 4PRLA 1DC3A 4PG8A 4R1UA 1X7HA 1N2SA 3MJCA 1LDGA 1P1HA 3TF5A 1KETA 4P4GA 5THKA 3ZV6A 5EIOA 1EFKA 3F1KA 2YQ5A 3K96A 2C7GA 2W2KA 3VH4A 4LISA 4FW8A 4NMHA 2Y1CA 4BNLA 3BTSA 2HMVA 4GL4A 3LLVA 1YS4A 2FPPA 5ER9A 4CQMD 5DCYA 3E1KA 3H4VA 3P7MA 1ONOA 2GR9A 3JQFA 4FFMA 5IG2A 3E48A 1XQ6A 4GX5A 3I1JA 1AUPA 1XEAA 3WQQA 3GMDA 2GNAA 3TFQA 1Y8RA 4WLVA 5IFLA 2CF6A 4Y9DA 3WNQA 3OFSA 1PQWA 1BG6A 1MFZA 4DLAA 2NWQA 3VH1A 4F6LA 3PXXA 1QMGA 1GYRA 1DXYA 1NR1A 1F14A 4U0JA 1BW9B 1ENOA 4L76A 3WBBA 2CF5A 3HB5X 2NU9A 3DBRB 2WWRA 1UAGA 3PJGA 3GVXA 2VZ8A 1P0FA 3GEDA 4JK3A 4RVFA 6ADHA 2HJRA 4IMRA 1VLLA 2H9IA 2JAHA 3ZNQA 5GZ3A 4W7IA 3UOGA 4DC0A 4C4OA 1GV1A 5EL0A 4GBJA 3H9QA 1SNYA 1V3UA 3R1IA 3RD5A 4XD2A 3MZ0A 1C1DA 3R3JA 3PJDA 3LK7A 2VZ0A 4E5PA 4OKNA 2PD3A 3VPHA 3PRJA 1I2CA 7MDHA 3AU8A 3MCVA 4J49A 4RDHA 4E33A 1B14A 3F1LA 2VUSA 5DULA 1N1EA 1Q0HA 1TVEA 1LA2A 2R6JA 4RPLA 4CV1A 3RFVA 3ZHXA 1PJ4A 4M54A 4BKPA 1N5DA 4M49A 3UICA 1A9YA 1DIHA 5GZ1A 3HDYA 4OGWA 1LDEA 3BTOA 2UYYA 4LRSB 3RWBA 5IJZA 2O50A 4L4XA 2O2YA 3BAZA 1IYZA 5KJCA 2GUGA 4WLOA 3LC2O 3BIOA 4BNIA 4NPCA 2HCTA 1GCUA 1TXGA 3D3WB 3VPXA 4MOWA 1Y9AA 3DL2A 7ADHA 2EERA 2GASA 4Z0PA 3WQRA 3I6QA 5DDIP 3JCZA 3AM3A 2CD9A 1IY8A 1QV7A 2BF7A 2BGKA 2ZTUA 5J23A 1R4NB 3PTZA 1G1AA 4WEQA 3BHMA 2X0NA 1EQUA 4GGPA 5G0UA 2IXAA 3L07A 2B0JA 1AHIA 5EQDA 1EK5A 2OORA 4FFPA 5C5IA 2G82A 3DMTC 1EZ4A 4IY1A 1A9ZA 4WCFC 1PL7A 1MC4A 1K6IA 1PWXA 1MV8A 1QP8A 3HN2A 4WLUA 5AXBA 3D4OA 4BL5A 4W6ZA 1B0AA 1ZMOA 1OZAA 2Y05A 3F6YA 1KVSA 1QYDA 3VC7A 3GGOA 3JQAD 3Q11A 3TFOA 4IDEA 3AM5A 4EGFA 3WXBA 1HLDA 1SB8A 3MTGA 3GT0A 3LLSA 1CEQA 3FN4A 1ZXLA 4FQ8A 2X23A 1I2ZA 3ICPA 5KOIA 4YBZA 4UULA 4I9HA 1Z74A 3PDJA 3C3XA 1RJWA 2OOSA 4ZHSA 2PY6A 1RPNA 5MGBA 3JQAA 1T2FA 3E5MA 4ZRMA 2AQKA 2VTEA 5I8WA 1QLJA 3W8EA 5B4UA 1PGJA 4YRAA 1J5PA 4LCJA 4RLHA 2GRAA 1T26A 3VOSA 4D41A 3CUKA 3AFNA 2Q1SA 1BSVA 3RROA 1OC2A 4F45A 4TKMA 3ZU4A 1YL7A 2PNFA 3D3EA 4ZGWA 5A5EA 1JU9A 1Q1NA 1PR9A 1NFQA 1VJ0A 2DLDA 2VYNA 1H9AA 4G65A 4U5QA 5L45A 4CMBA 1CQJA 1WZEA 4ZQHA 3ONEA 4ALMA 3EC7A 4IZIA 1U7TA 4EEZA 3JQ6A 2VHVA 4H3VA 2NLOA 1H5QA 2P4QA 3C1OA 3O26A 3ZWWA 2BFPA 1N92A 4EW6A 1GQ2A 3U9LA 1A4IA 1H2HA 1GZ4A 1LI4A 1LDYA 3B20A 4OYRA 4UUNA 5BSGA 2NV6A 4WE3A 2IZ1A 3A9WA 3A28A 4HFJA 3WTBA 3OJLA 2CNBA 2A35A 3F46A 2Y1OA 4IDDA 3HDHA 5KVCA 4JNKA 2XPCA 4BMVA 4ALKA 3NDJA 2DFDA 4CMHA 1EK6A 3OJEA 1XLTA 2I5PO 4TQGA 1WDLA 1H0KA 2LDBA 1HT0A 2DTEA 1FDSA 4QX6A 1EMDA 3PYMA 4NDNE 4PGFA 3AY3A 2W2KB 5A06A 3C7AA 1NPYA 3WWZA 4PZDA 1LLDA 5H81A 4YQZA 5JXWA 1R12A 3S55A 3DFUA 4WECA 1QKIA 3WFIA 3KETA 1R6DA 2O48X 4OM8A 2VHWA 4B4VA 5K6AA 2VHYA 4GMFA 1PJBA 2CFCA 2D4AA 4JX8A 3SC4A 4DC1A 2WYWA 2X0IA 3DR3A 4IDBA 1EDZA 4XQEA 1XKQA 4E2XA 1BDMA 2B83A 4R68A 4N5MA 2H1SA 4Q3BA 1ORRA 3D5QA 4IIUA 2PD6A 4KDFA 4PFJA 3ZV5A 4GKBA 1NAHA 5AQ1A 4DL9A 4XX0A 3DBLA 1ML3A 4TRJA 4E32A 4MVJE 2PKQP 2BI8A 2Y1DA 3ZCXA 4FGWA 1AGNA 1H6CA 4CV0A 5DBFA 3BMNA 2Z1MA 3GN2A 1ZUD1 1RM4A 2ZB7A 4NBVA 2EWMA 1EUZA 2ZATA 3MWEB 2W2LA 1LLQA 1PJQA 1LBEA 2P5UA 3LC7O 4UVGA 3UCXA 3HZZA 1TI7A 1XWFA 4GSKA 4XYEA 2HMUA 3FF4A 1MGOA 4BQRA 4RVUA 1H6DA 1R0KA 3GDOA 4BB5A 3P2OA 3LT0A 3UAGA 5BSFA 4RO0A 3OETA 4Y6RA 3FNHA 2Q2VA 3DZBA 5K6AC 2VNSA 2JFFA 4RPJA 1E3WB 4GLOA 2HLPA 3ZV4A 2AE1A 2VRBA 4PZEA 4IGEA 3JYQA 3COSA 4OKIA 3VPFA 5TC4A 3TJRA 4FFLA 1GQYA 2YW9A 3WYEA 4IINA 5ER6A 4XB2A 2CZCA 1DEHA 3QRWA 4P38A 3JQGA 4Z3KA 2Q50A 1DAPA 4GQAA 4XA8A 2Q3EA 3RCBA 1SCUA 4XQCA 1PZHA 1QYCA 1ZIDA 3U0BA 4Q3DA 1QV6A 3KYBA 4EJ0A 4FR5A 5L4LA 3OJFA 5G4LA 5L95A 3AI1A 3OA2A 1GEEA 5DOZA 3VVBA 2CVOA 4Z9YA 2QHXA 3RJ9A 3ASUA 2HMSA 1YKFA 5CEFA 1VL0A 4RF2A 4B3IA 2NM0A 1IULA 3G1UA 3F3SA 4MKRA 2CVZA 2CDBA 4CM8A 3M2TA 5THQA 4DBZA 4INAA 3JD1A 4UEOA 1R16A 4AJKA 2W98A 4MO2A 1R0LA 4ZRNA 4DYVA 4HV4A 4GKVA 5JY6A 2VHXA 3TDKA 4CV3A 3KBOA 3Q6IA 5DCUA 1QR6A 3KM0A 3GA0A 3K6JA 1E7YA 5T64A 2HDHA 4YRDA 3SJ7A 3V2UA 1J6UA 2ZQYA 3DBVO 2JCVA 4CMAA 4B7UA 1SAYA 3C1TA 4UEJA 3IP3A 4BNJA 3AWDA 2B5WA 2O3SA 1ENPA 5IZ4A 4JBIA 4QUKA 1WDKA 1R37A 4WJZA 4CQMB 3C1AA 1JVBA 1BWSA 3K73O 1MX3A 5U1PA 3UUWA 3CMCO 3T7CA 1ZMTA 2H63A 3PHHA 1J0XO 1M67A 5HS6A 3DONA 3VTZA 3WGTA 4E13A 3INTA 3N7UA 4CODB 4CLRB 4IDAA 5KNLA 4U6QA 3INGA 2DBVO 3EGOA 3GNTA 3GN1A 4DQUA 3PIDA 4LGVA 3QWFA 4NH4A 2GF2A 5I9LA 1HYEA 3KYCB 2O3RA 4AVYA 3DMYA 5A04A 3WYBA 1C14A 4UUOA 2XAAA 3KLMX 3TL3A 1XCBA 3PEFA 1R4NA 3QHAA 3V2GA 2RIRA 2AQIA 4WNCA 3EMKA 1YJQA 1DO8A 3I23A 3SLKA 5HS4A 3K2BA 4A7PA 2GZ2A 5ENDA 3RUIA 1YDWA 2FR1A 3M2PA 5ITWA 1DIRA 2GLXA 4HADA 1C1XA 3GEGA 3JYOA 2ZK7A 3H8VA 2Z5LA 2F00A 3H9JA 1X14A 3JD3A 3RBVA 3GDFA 3JD0A 1DAOA 1DOHA 4JN6B 5JSFA 3TPCA 4BVAA 3TRIA 2YUTA 3GNQA 3K9QO 4L4RA 5EN4A 5L7YA 3RC2A 4FCCA 1V9LA 4JCOA 2P91A 3LT1A 4MDHA 4D42A 4PG5A 1LUAA 4ZVVA 3WGYA 1SB9A 2C20A 1MA0A 4R5HA 4CJXA 4YJDA 1LRJA 4J91A 5F3RA 2TMDA 1H6AA 2X0RA 3PFFA 2FHSA 3H3FA 1LXCA 4RGBA 1CIVA 2J6IA 3PWKA 4HP8A 4CR8A 4M1QA 3JQAB 3PVZA 3GHHA 4FN4A 2A94A 2WJPA 4IMPA 5KJ1A 2CDAA 3RVDA 4ZN6A 3HADA 1J4AA 1ADGA 2P4HX 4O63O 3KEOA 2NADA 3F5SA 1M2WA 3PPIA 1DRUA 3DMTA 1IPEA 1B15A 3ZWVA 3LYLA 3ICCA 4II3A 5TX7A 4O1MA 3I3OA 2YFHA 2VWPA 3RIHA 2EKQA 2Q45A 3KYCA 3DO5A 1P31A 2C5EA 9LDTA 1MP0A 3N74A 3RUHA 3WJ7A 4RPGA 4YTEA 2NU7A 2I9PA 2BGLA 2I76A 1SOVA 1XA0A 4O0LA 4CLRA 1SEVA 2VWHA 1XQ1A 3GUCA 4R1TA 3SXPA 4JBGA 1Z7EA 2V6GA 1NXQA 1QRRA 4D0RA 1C1XB 3NDIA 4IUYA 4E5KA 4BNGA 1ZCJA 2PWZA 1V6AA 1NVTA 4E12A 3LQFA 3I5MA 1C3VA 4I5EA 4B8ZA 2P68A 4BO9A 5T6BA 5FYDA 4EUFA 1X1EA 2EGHA 3DBRA 3C24A 4ILKA 5A3JA 3FR8A 2B5VA 1LQTA 1MFPA 2Y66A 1X13A 1XHLA 4TKLA 4XDZA 5CDUA 1IUKA 3U3XA 4XGIA 3UH1A 2WM3A 1A27A 1AHHA 4AL4A 4JP2A 5JCJA 4JGBA 4EUHA 4YJGA 2B4QA 4R1SA 2J3HA 1BVRA 1NHGA 5JFOA 3JQ9C 1B3BA 2ILTA 3CPSA 2D5AA 4YAGA 3ANMA 2AMFA 1T25A 1JN0A 4WOJA 3WLFA 1NQ5A 4J3FA 4MPDA 4WK6A 1ZXBA 3WDSA 2Q4BA 1I0ZA 1ONNA 4GSLA 1HF3A 2YFQA 4PLPA 1N7HA 2J3IA 5H83A 3DWFA 3ZNPA 3OMLA 2R2GA 2HRBA 4J4BA 4YJFA 2QG4A 3TOXA 5COQA 4GVLA 3TZCA 4ESOA 5FEUA 5U9CA 4MVJA 4BO5A 2FPIA 4RLSA 4CM4B 3E9QA 4P22A 3EDMA 1HZZA 2YQ4A 1VJTA 4W4TA 4HNHA 4XQGA 4GX0A 4BNKA 3PJEA 4NZ9A 1LTHR 4BMNA 1A72A 1UXHA 1WDMA 3NV9A 1P77A 1JAXA 1ZK4A 3U5TA 4CLEA 1EVIA 2PLAA 1VL8A 4TVBA 5L7WA 4BO4A 3PZRA 4WEOA 5JPIA 5A9RA 1GPJA 3DTTA 4BGIA 4HWKA 2QRLA 5IAAA 4BB6A 4D3FA 3DAPA 2EGGA 1O0SA 5DCWA 5KJEA 1U4SA 4GWGA 3RU7A 1RM0A 1XDWA 1V0JA 3AI2A 3TZHA 4I5DA 3RBXA 3VPSA 3ONDA 3RI3A 3WJAA 1I32A 2PGJA 1ADFA 5C37A 4E5YA 5BNTA 5JCXA 5KJFA 4NHEA 1N8KA 3KSDO 1D1TA 4KTTE 4TMFA 3B1FA 3IP1A 3QQPA 4Z9FA 4CM3A 3GGPA 4E4YA 3JQBA 3WSVA 1K0UA 1LSSA 4OOEA 2R00C 5EPOA 2V6MA 3PQEA 4B79A 4K6CA 4CM9D 3AOEC 2XXBA 2FP4A 2G1UA 1K6XA 2ZCUA 4YEDA 2ZCVA 3KUXA 2I3AA 2DBRA 3O38A 1HEUA 2B35A 5A4DA 1B8PA 3RUEA 4DPMA 1ZSVA 4DPKA 3GMSA 4OO3A 4Z3DA 4CLOB 3EZYA 3GH3A 2O7SA 1TEHA 1GV0A 2CMDA 3OEYA 4DTIA 1ADBA 4H15A 4OJNA 4LSWA 4KUEA 1PQUA 1KOLA 3RUAA 3PHJA 1U1IA 2RBEA 3AUTA 4Q3AA 5B4VA 3PWZA 4E2YA 1E6WA 3IAHA 3FSRA 3KV3O 4BKQA 8ADHA 3QVXA 3VHRA 1O8CA 5CDYA 2VRCA 3X2EA 1NPDA 4RJTA 2POQX 1B8VA 2GN4A 4Y8VA 4BV9A 1FMCA 1NR7A 5T67A 4YCAA 2V6BA 1LEHA 3W1VA 4FJ2A 4AJJA 2DAPA 3VDQA 1E5LA 1JWAB 4S1VA 4DYDA 4R3NA 3VKVA 2R00A 3AOEA 4OSOA 5HM8A 3DHNA 4H16A 4YJHB 5EJ2A 1O5IA 2YV3A 3CEAA 4R9SA 4RZHA 4N5LA 4K28A 1ZW1A 3LZ6A 4CMKA 1NFFA 1NX6A 2VRCD 4OH1A 2JD2A 1VSVA 1ZEMA 3ZGYA 4J1QA 1Z7BA 2X5OA 4GWKA 4LMPA 1UZLA 4LK3A 5JAMA 3UHAA 1P9LA 4JP3A 4XEHA 4L74A 2AG5A 1ENZA 4A0SA 4YRBA 2X1HA 3EAGA 1DRWA 3H65A 4Z9XA 1PQPA 4BNZA 2VN8A 1GDHA 3IJRA 1DC4A 2I6TA 3U4CA 1RYEA 2UVDA 3GPIA 3ENNA 5CHEA 2JHGA 1B2LA 1JAYA 3C85A 4S3MA 5ILGA 1VL6A 2Q1UA 4XCVA 3UGKA 3PHIA 3MJSA 4NFSA 1X15A 3FPCA 1YBAA 3FRJA 3P5SA 5KVQA 1WPQA 3L6DA 4XRRA 1DIAA 4TRRA 3U62A 2ZQZA 5C3MA 4DRYA 1YONA 4JJFA 4EJ6A 4U8GA 5JMWA 4AJEA 3D64A 2LDXA 4B3JA 2CUKA 3GDGA 3E8XA 4PLCA 4RQUA 3JQ7B 1GR0A 3ASVA 3MJ4A 1LX6A 1EDOA 3ZV3A 2GERA 1D4FA 4MVJM 4ZQEA 3ULKA 1ADCA 4IXTA 1E7RA 1MB4A 2C59A 2J3KA 1I33A 2NQ8A 1P1FA 2ZTMA 1C1DB 1T2DA 5A9TA 3VKUA 3VPGA 3H9GA 3WB9A 4F6CA 5JW6A 4KWHA 1XU9A 5TNXA 4A26A 1YXMA 5K0ZA 2O3TA 4B3HA 3NUGA 1T4DA 2XOXA 4CLDA 3S2EA 4D3DA 5EQFA 4IDGA 3NKLA 4TRNA 4TWRA 2DFVA 4RL6A 1WMBA 3IOYA 4ZD6A 4Q3CA 3FWNA 5EINA 3QVWA 1BXZA 1FXSA 3NTRA 4FDAA 4HUJA 1GQQA 1X0XA 3QJ5A 4I8XA 3G17A 3H2SA 1OC4A 3L9WA 1VSUA 3I52A 3S1LA 3U4DA 3OQBA 3CE6A 2PR2A 3LF1A 5CP8A 4ALNA 3K31A 5F5LA 3JYPA 1K89A 1NPTO 3JQFC 3MOGA 2HJSA 4NFHA 3AY6A 4XIJA 2AEMA 5AXAA 1ZK1A 3CSDA 2J3JA 4AJIA 4BO7A 2VYVA 3PQFA 4CM1A 3P19A 1O95A 3NT5A 3AI3A 5GMOA 5KKAA 1W73A 4EYEA 3B1KA 5F21A 4WCFA 3BTUA 1CQIA 2FRDA 3GUYA 1CJCA 2O3JA 4FPXA 5FI3A 3ZNNA 1H2BA 5IZCC 1IZ0A 4HX5A 4C7KA 4BNYA 3E6AA 1VPDA 1QLHA 3GAZA 1PL8A 1QYWA 1OBFO 4YAEA 4B4WA 1WAMA 5KKCA 1Y81A 2B69A 2AA3A 1JW9B 2EXXA 4DMMA 2PV7A 3ZWNA 1T2CA 1K5HA 1AXGA 1YL6A 3DZFA 1HTBA 2JKVA 1NP3A 1VRWA 3ITKA 3HDQA 1LRLA 4NNJA 1B26A 4JLWA 1PGQA 1PJSA 3U09A 1U2DA 3I9JA 4IJVA 2CSUA 2RHCA 4CM5A 3RKUA 4YT4A 4J2OA 2BELA 3V1TC 4UEKA 4KZPA 3ETGA 3Q1LA 3WLEA 1PZEA 1M66A 3ANLA 3TWOA 3BA1A 5JYDA 3I4CA 3K8ZA 3FR7A 4JJIA 5ITVA 2RCYA 1GCOA 3WTCA 3OICA 4CQLB 3DHYA 3QVOA 3RBZA 1O9BA 2EW8A 1JA9A 2V6FA 3KSZO 5TSDA 1ZSNA 3NGLA 2GN9A 1PGPA 3I83A 3JV7A 2CVQA 1V3VA 3IL2A 3Q3CA 4MKZA 1DHRA 2H6EA 5JCJD 4QXMA 3DXFA 3UKOA 2E82A 3KO8A 1HRDA 1P1JA 1ZEJA 4CM7A 2VUTA 1E6UA 1KVRA 1NQOA 3OECA 2OBNA 3L4BC 4H7PA 3HE3A 2F1KA 4XQ9A 1E7WA 4Z0TA 1UXKA 3NEPX 1SZJG 1UXGA 4RPHA 1VKOA 4PCVA 1YDEA 1LLCA 3GFGA 1H6BA 5JAQA 5A05A 5BSEA 4O59O 3AU9A 5L51A 3MWDB 2Z1NA 3RFXA 5DBIA 3G79A 1TA4A 3ZWXA 1MUUA 4IDCA 1F0YA 3S2GA 3WX0A 2OL4A 5JDIC 1ZSYA 2AW5A 4DREA 1IHXA 3DBHB 4WNIA 1PTJA 2B4TO 3ZW8A 3GR6A 4TZKA 3GVCA 1MC5A 1DLJA 2Y1EA 4I9UA 5CEJA 2NU8A 4R4JA 3TOZA 3WGQA 2PK3A 2PKRA 2FPGA 2IYPA 2FZWA 3BMCB 1D1SA 4CMEA 1KVTA 1Z73A 1UP6A 1HE3A 4PLFA 5DN9A 5AYVA 4D43A 1EVJA 2G17A 2A4KA 1Q7CA 4RQTA 1PSDA 3TNLA 4CLHA 5DNAA 4LSMA 1CRWG 1N1GA 2IODA 5BR7A 4IZHA 2IXBA 1A7AA 2OUIA 3QWHA 5BT9A 2GO1A 3OJOA 1YBVA 4BNHA 4ZU3A 4FJ1A 1A4UA 3O03A 5A02A 2DVMA 3CZMA 4PLGA 1HDRA 1DPGA 5ADHA 1HYHA 2ZB3A 4NU6A 4B7XA 4P4LA 4BO6A 3T4EA 3GZNA 5A03A 5DP2A 5IDWA 2OO5A 3DHEA 5L40A 4GH5A 4IJKA 4YT8A 1AN9A 1MXFA 2J8ZA 4Y98A 4OQZA 3GGGA 4L73A 4MJLA 3K2EA 1EE9A 3Q9UA 4D45A 4Q9NA 1DB3A 2VWGA 3EUWA 3VH3A 1YE3A 4ALJA 3ZW9A 2JD1A 1PGOA 1YJ8A 1JKJA 4U6SA 1T1RA 1DDOA 1E7QA 3D5TA 3HFGA 4PLWA 3GRPA 3Q2IA 4XJTA 5F1OA 1Q7BA 4UVEA 5HWSA 2Y1FA 3ADOA 5CAEA 4PG6A 4CR7A 4LVCA 4B7CA 2PZMA 3MJTA 1HDCA 1GZ6A 4YVFA 1SOWA 4FGSA 3ZWMA 1NQAO 5B4TA 4ONEA 5BNIA 2WE7A 2DBQA 3AUUA 5KCZA 3NJ4A 1KEPA 1B7GO 5I8ZA 1BW9A 1E3LA 2DKNA 2HQ1A 1H9BA 3F4BA 4PIVA 3H9EO 3ZHZA 3VDRA 5L9AA 2X22A 3LDHA 2JCYA 3L9XA 2ZJ0A 2AE2A 2C07A 3FTNA 3HQ4O 4G2NA 3WR5A 4E30A 2NVUA 1EUDA 2OFPA 4Q3EA 2YDYA 3PYXA 2HK9A 2VTDA 3OQ6A 4WGGA 3QE3A 4HY3A 1NFRA 5AOVA 4NK5A 1TT7A 2W4QA 5TGDA 1OMOA 4BKRA 4HNGA 5JE8A 3GAFA 4X54A 1E7MA 2HRZA 3ZWPA 2I99A 2GPTA 5U4QA 4OAQA 4JJGA 4MVJG 4XYGA 2BH9A 2VYND 4ZQFA 2AQ8A 3H3JA 4IXWA 4NK4A 3DDNA 4B4UA 5COBA 1MG0A 3DQPA 3BHJA 4CL8A 1DC6A 2NVWA 4KWIA 3RFTA 3WICA 3AK4A 2IRWA 2FSSA 3K92A 4FFOA 5HBRA 4W7HA 3QW2A 5G2OA 1ZNQO 4J1NA 1U28A 1YQXA 5CDGA 4CMIA 1V8BA 4A27A 4O6VA 4CMJA 4YWJA 4WLFA 2E48A 1YGYA 3T4XA 2UAGA 2X9GA 1CETA 1RYDA 1I36A 4QECA 3R6DA 4ZQBA 5IDYA 2PTGA 1CERA 2EF1A 3OBBA 1W4ZA 1NTOA 4PG7A 4J7XA 1PZGA 1GAEO 3INRA 3V8BA 1IL0A 2Q49A 1UZNA 2QZ9A 3D1LA 3WSWA 1I30A 1M76A 2E6UX 2YY7A 2ZIZA 4OHUA 1Z6ZA 4J2HA 5ILOA 2J5QA 4M8SA 1P0CA 1DIBA 3PJFA 4Z6KA 2RH8A 5G4KA 5JMPA 2D59A 1GFSA 3DC2A 4BV8A 1B8UA 1X0VA 4TSKA 4D7AA 2I66A 3NT2A 4RV9A 3RC7A 1HLPA 2C5AA 3ST7A 1HWYA 4GPD1 2WD7A 4PRKA 4BO0A 3ZU3A 1ARZA 1PZFA 1GU7A 4M55A 2PKQO 3JQCA 4YQYA 2EHDA 2BFMA 1WZIA 4ALLA 4ZJUA 3WBFA 4BIIA 5A1TA 1EEHA 3BTVA 1OI7A 1ISHA 2TMGA 4R3WA 1AE1A 2NTJA 5HA5A 2JD0A 5ES3A 4CMCA 1ZK0A 4I5FA 4PLZA 1P1IA 3RUDA 4C7JA 1VJ1A 2CY0A 4YAJA 3UFXA 4DIBA 1HXHA 1T2AA 2ZKLA 1NBOA 3WGIA 1PS9A 2X5JO 1Q2XA 5DT9A 3JTMA 1RM5A 2X58A 4IIVA 1BHSA 3ADPA 4N54A 5B12A 1UH5A 2X0JA 2W2LD 4GX1A 3H5NA 1E3SA 3GEMA 5A3VA 5K9ZA 1E7SA 2ET6A 4CV2A 1E1LA 3O8QA 1EUCA 2PZJA 1ZO8A 2RAFA 1DBVO 4RCVA 4P8RA 3E03A 4WKGA 4RDIA 3V1UA 4E31A 3KVOA 2BMAA 3GG9A 4L0QA 2QX7A 3DZJA 2P5YA 2X5KO 1NWCA 4BMSA 4WLEA 2GCGA 2GZ3A 5IDQA 3AJRA 1C0IA 1JDJA 2HK7A 2I67A 4FFNA 2UUOA 5JYEA 1Q0LA 4I08A 4DMLA 2DPHA 3QWBA 4MIOA 3ZWOA 3ZWAA 4CMIB 5A5FA 4XR4A 3UN1A 5GY7A 1OFGA 2VUUA 4OXKA 3BMOA 1O94A 4CQMA 5TRTA 2QQ5A 8LDHA 3I9NA 1K6JA 3B6ZA 4CM9A 1TT5A 5JDCA 3QSGA 4LMRA 5TJHA 1QYXA 1O6ZA 4YB8A 2P9CA 4QTZA 4KTVE 1KS9A 3TSCA 4NU5A 5C7IO 1YRLA 1DFIA 4E3ZA 3UCFA 3W4JA 2AQHA 4WCDA 2NUAA 5IDXA 5TJ9A 5BNFA 4DWVA 3GRKA 1ZK2A 2EG9A 3TQHA 3TZQA 4CUKA 2XXJA 5JC1A 2WMDA 1PS0A 3GZ4A 4BNFA 4W82A 1GZ3A 1I10A 4CMEC 3FTPA 4WUVA 5DOVA 1G0NA 1L7DA 3GZNB 4DIOA 4IGFA 6LDHA 3BZUA 1IOLA 4CLXA 1PJLA 3NTQA 3ZU2A 3WOHA 3PHGA 4J16A 4IQGA 2X9VA 4TRMA 2Z95A 2JCXA 4R01A 4XB1A 1U3WA 4Z0HO 3ZHYA 4NG5A 3CKYA 2UUPA 3DBHA 4KUGA 1GEGA 5T8KA 4FOOA 3RUCA 1LC3A 1LSUA 4XZ3A 4TROA 4E2WA 4LVUA 2C2XA 1I5RA 1U7HA 2D2IA 1SPXA 1HYGA 1JKFA
chains in the Genus database with same CATH superfamily
1H05A 3G5AA 5HDQA 2X7JA 1VJ5A 4C0HA 5K6RA 1XT6A 2I6GA 3L0BA 3SLGA 2NSYA 3D8RA 5IC4A 2HJHA 1DI0A 4BP8A 4H18A 4KRFA 3RASA 2ZLBA 1PK7A 2ZBFA 3A05A 1N1MA 3DOFA 3QWAA 1GQFA 3E18A 1KJWA 1TQ6A 1XSEA 2JATA 2HY7A 2OYRA 1KK3A 3FOCA 2QT9A 4IIYA 2C7BA 4AD8A 3PICA 4EATA 1HRKA 3REFA 1CF9A 1RNLA 1QHIA 3IOEA 3LRPA 4QD3A 2FF7A 1Q6ZA 1V16A 2G40A 3RAGA 4V1CB 3IMGA 1Z0FA 4ND4A 3TM5A 1J7JA 1GNVA 4P1ZA 3Q5DA 2RSLA 2BEKA 3OIYA 1DRVA 1LSJA 1N3YA 4IL5A 2BSAA 3CXRA 3ZVMA 1F8GA 4X8LA 2J0UB 2O3UA 2OHIA 3GIDA 4R83A 2IDKA 5KDDA 3PNBA 3QLUC 4KO2S 1G19A 4OXNA 3V97A 4AKTA 2VRWA 4OMUA 1KJ9A 3I73A 1ZZEA 4J0FA 3A8TA 4E4TA 1DO0A 1GGJA 2WG0A 3UA3A 2WKSA 1L3IA 2QR5A 2XGSA 1TRHA 3NWBA 1SC4A 5FOUA 3EWIA 2BM9A 2UYQA 4F3CA 2AHRA 1XU7A 2LVBA 3I1FA 4YCMA 2BGIA 2PWAA 3JQQA 1HUQA 2HU2A 3L93A 3O8QB 4IF6A 1SBYA 4HZUB 3HZRA 4OL9A 1WEHA 4MP6A 2P69A 2GCOB 1SCNE 1NIPA 1WQ3A 3F8WA 1MH9A 3LL7A 4D9EA 2ZR9A 1U9IC 5MHTA 1JSZA 5B30A 5CR9A 5IYZA 3UANA 4F7DA 2I8LA 3A1WA 2P9FA 5EPEA 1X7DA 4C6RA 3U7QB 4M7RA 1N25A 2FE4A 2ZITA 4RABA 4BX8A 1YVEI 3WLIA 2XT6A 1E4YA 1I3NA 3QLVA 4G8BA 4R54A 3SNHA 2WJZB 3ROQA 1S2DA 3WIDA 3L8EA 2FWRA 1CKEA 2VJCA 3IPLA 3LPDA 4XVHA 5CG1A 4HLDA 1WHTB 3GEIA 3FD8A 1F0KA 1ZC4A 3M4JA 1Q0UA 1WRBA 3ZCVA 3LVFO 5DX8A 4LVNA 4WACA 2IPLA 4AJNA 1TT5B 2CUNA 3GJZA 2PL3A 1V35A 3VPAA 3BMQB 4AJHA 3KL2A 3KZ1E 3CLUD 4LDAA 3IGFA 2AG1A 1DFGA 3OP1A 3GLHA 4KXYA 5AW9A 4FCVA 4GO1A 3DUFB 4UM9D 4GLFA 4AFNA 1NAIA 1X8LA 4JT9A 2Q1TA 3DVRX 3AZOA 3H0KA 3KWFA 2J48A 2OVFA 4ND6A 1RPJA 4MR7A 4OY3A 1LK7A 2KM1A 2QZZA 1Z07A 1VIVA 1L5NA 2DWQA 2AFVA 3U4IA 5DX1A 5DMHA 2J0SA 1Y4SA 1KHHA 2WC1A 2ZI7A 3JPWA 4HFNA 4G86A 4MKXA 2LZ0A 1ZWKA 2SCUA 4M0EA 2Q5LA 4NU0A 5JH7B 1CRPA 5J40A 3VZPA 1X7YA 1H4QA 1OXUA 4FS3A 1JEJA 2GZ1A 1QHHB 2R87A 3IEUA 5J3JA 3CVYA 4K2HA 1JFSA 2QNIA 3DFZA 1R7RA 2O2CA 1BDIA 3GK3A 4DLLA 1V16B 5CH8A 5FLKA 2AX4A 3INNA 4BFYA 3UKDA 1THTA 4RFLA 4FEAA 4J7CA 3WAKA 3IQXA 3UZUA 3EW9A 3R9IA 4UM8B 2BHNA 2D3TA 1YDHA 3MAGA 4GDMA 2GXQA 3B3AA 1QV9A 4NJEA 5EESA 5K3DA 1RWBA 2EGUA 2IHJA 3UTCA 1W30A 5HK8A 1FFXA 4AUEA 1WXWA 5EXDA 1U11A 1ZH4A 1CUZA 4ZVQA 2AFHB 2IEDA 4NQZA 4UNSA 2P2LA 3VYTB 5EMNA 4B0OA 5AW1A 3U4MA 3BOSA 2HRCA 1P2SA 2X14A 4A0RA 1MRZA 2VHZA 5FO1A 3BFPA 1TTQB 4BDTA 4Y18A 5HIMA 2K5UA 1T34A 1U0TA 2JGIA 2QTNA 5CFZA 1OQAA 3ON5A 4UCXA 2P0EA 2PUFA 2I65A 1G7SA 2V3VA 3TTYA 1UKYA 1Q1AA 4TZTA 2BGTA 2HMTA 4EJSB 4D9MA 2UYGA 3NAMA 2EDCA 1K8XB 1I3MA 2OAP1 1TK9A 3LO5A 3OOEA 4DY6A 2YWXA 4J90A 5DTJA 4AS2A 3C8MA 4L8GA 4LY9A 5DI3B 2DUWA 2QW8A 4RH3A 4D4MA 3ZJUA 1RADA 1TYEB 3EEBA 2IIQA 3LIIA 3MTIA 1N4AA 3CF4A 1K88A 1BXRA 4R8KA 4A03A 1MW8X 4YMVA 5K0TA 4ISBA 4PGHA 1CY0A 5H3CA 3TZ6A 1NW5A 2Q8PA 3ENVA 2I4OA 4TYWA 5EOVA 4ZT6A 1GTMA 1YB2A 4QXPA 4WASA 1PJTA 4ZVMA 4PSCA 3RU9A 2R6AA 4D9KA 3TLYA 1F17A 3DWEX 4DDTA 4HBGA 1UQUA 2QD3A 3RSFA 2ECKA 2Y99A 4IBOA 3STUA 2YXLA 5EKXA 1L4GA 4KR7A 2QTCA 4IJUA 1K98A 3BJRA 3PNLA 3ENQA 3KJQA 5T5QA 4F0JA 4DOMA 5BWLA 3L7YA 1HSOA 1L6RA 1E3DA 3FH0A 2I4NA 5EIFA 1M74A 4GPEA 4F3TA 4HFMA 1XMQB 4BBAA 3FPLA 4B0PA 2PM8A 4WDQA 3IUPA 4BYGA 3HB1A 4R9UC 2G1PA 4GM4A 1K3FA 2V98A 5E4TA 3SYRA 2GZHA 2ASVA 5FR1A 5C80A 5FR2A 3OLCX 3HJFA 3WJ1A 5B2ZA 2AI1A 1G42A 3WKDA 3ZWCA 4D8WA 3BHNA 3NOQA 1HQCA 1N3LA 5JXJA 2J59A 3Q9NA 1TRKA 1W4RA 4I6JA 3ESXA 1O6FA 5EUBA 1C3XA 1BHJA 2D8AA 4Q4LA 1EDDA 2CL5A 5TS2A 4BFVA 5IN5A 3GC6A 5GONB 1HNXB 1UXOA 4PSVA 2G9QA 4KPYA 2OC9A 1K63A 4KQ9A 3KQUA 4KQMA 3LPMA 3GJ7A 5GVSA 2PH5A 2B1QA 2QI9C 4PYIA 4PZZA 1F7VA 2IZ0A 3PR3A 4OQYA 4R40A 3S8YA 3DC7A 4ZZIA 5K4GA 4R16A 3AW9A 5JNUA 4DQDA 5KKNB 3ROFA 1B6RA 1E2PA 4LTNA 3WA6A 2B7CA 4PAOA 4XIGS 1Y6QA 4GUDA 1W47A 1AM4D 2GF0A 4J29A 3HO8A 4BVBA 1B41A 3EVNA 3H5VA 4EJSA 2INGX 5C7OO 2IX3A 4A6DA 5CAEB 2DEUA 4OOFA 4KUHA 2O7QA 4U0KA 2NUAB 3KXDA 1SCQA 2CXPA 4K6HA 2JJ1D 3O4GA 3PR2B 1LTQA 4RDCA 4WVLA 4FZRA 4EOGA 1QP4A 2R6HA 3LBNA 1ULTA 1F6DA 4NYIR 5FV4A 4RTOA 1DBWA 2HF7A 4GI3A 3SSNA 4WQMA 1TK3A 3I58A 3O8NA 1R15A 2AZXA 1WKVA 4LC1A 1Z5OA 2VK8A 3VR3D 4CKYA 5HQJA 2YJTD 1Q0TA 4ZMSA 5G1NA 1XF9A 2X5XA 2Y4OA 4J0GA 1N33B 2G25A 1EU1A 2XX3A 2O0LA 2QDKA 3QHQA 5HJEA 3OH8A 4LXGA 1V8PA 4J94A 2GX6A 2JF0A 3G6KA 3KR0A 1UPXA 1U7ZA 2PAFA 2FWNA 5LA6A 3H17A 4MR8B 1XRJA 1PFVA 4DC9A 1JKIA 4AJPA 3VJRA 3WLKX 2PFGA 5FFFA 3PXBA 1USWA 2FEMA 1KERA 2Y0CA 4RH1A 3EGDA 2GK3A 1Q7TA 1XN4A 1E0AA 2H7VA 4RE6A 4DYHA 1O1YA 1L5LA 5DH9A 1JR3D 4NJMB 1YL5A 1IPFA 4IYRA 3UV3A 4QODA 1ZNWA 2IEYA 1JPVA 2V74B 3T6KA 1G0OA 2JH9A 3IMCA 1EEXB 4G01B 1NT2A 2PX8A 4US2R 3T1NA 3AT1A 5EGSA 4Q6BA 2RFLA 3V9PA 2RHRA 3EIQA 3FOZA 1XKTA 2P65A 2Q1WA 3RHFA 2TRSB 3AEKB 2A58A 3ZY2A 1H3EA 2PGXA 4FDLA 4L6CA 3E7FA 1GKYA 1YRQA 3B1JA 5SICE 3S2FA 1ZGCA 2J6CA 4ZDJA 1J49A 2YXEA 3IP6A 4ER0A 2WNHA 3PXCX 3DDHA 2O8EA 2C9CA 3AVXA 2QY9A 4RF5A 5DGCA 5IKOA 3UJ6A 4MA4A 4BU1A 3G0IA 2H18A 3A6JA 2ODBA 2GTHA 4A23A 4FLFA 3U7RA 4HB3A 1UXJA 3TR6A 1EJBA 4XM2A 4M83A 4MUEA 1C81A 1J90A 1LJ8A 2VH1A 1M83A 3IBTA 5AM5A 5HJ2A 1DE0A 1UJ5A 3OTQA 1EVKA 4GXNA 2FWIA 4IQ4A 5D85A 1XN1A 1ZNXA 2H1LA 3QYAA 4V39A 4AQ7A 1PR1A 5ARCA 4XM0A 1PV1A 5MDHA 3AUAA 10MHA 1X1CA 3V6MA 2J3MA 1FXWF 2G9RA 4YN3A 2BFAA 1A2OA 4L5YA 2BFOA 3KYDB 1RDFA 4F9FA 4A0HA 2IZZA 3OX2A 3H16A 1E2MA 1JEQA 1H8ED 2IVZA 2H1VA 5E8RA 3PIIA 4O08A 4NC9A 2BFWA 1KAEA 2WT8A 4U7GA 1I7SB 2DC1A 3KB6A 1YHZA 2RKOA 3AHCA 4JEHA 1V8DA 1L5MA 3R3UA 4UE6A 1DINA 3VTFA 5CEEA 2QM0A 1RJ9B 2K87A 3A1NA 3TVTA 4AECA 1V4NA 4ZVUA 4B8WA 1E6CA 4F4JA 4FC6A 3FOEC 3IMFA 3IE2A 3H2ZA 3BMCA 3ANNA 3OCYA 4M87A 4B31A 1DTWA 5EHGA 4ZI7A 3FLMA 3UXYA 1YJ5A 2DPGA 4NR0A 1HR0B 4LRQA 2YVLA 3FPSA 3T99A 2HCJB 4HOYA 4IZ6A 1FDIA 1HG0A 2A14A 2VDWA 2EJUA 2CE2X 4P2BA 4X6LA 3MSCA 3RYCB 4KYVA 1PR0A 1YHNA 1ZGAA 4TSFD 1N9GA 3RTGA 1WY7A 2PT6A 1UEXC 4C76A 4CBVA 1U3VA 3OA0A 2I34A 4KHZA 4RXMA 2GXAA 4ND1A 4ON9A 3JQ8A 3DAYA 3HSYA 1U2EA 2ZIEA 2HMWA 1YAJA 1KEVA 2XBLA 3NDRA 3OZSA 4P6VF 4ZI5A 5JAIA 4TTJA 5C4MA 1KYYA 5L3SB 3FLEA 4M3NA 1ZVKA 4L5BA 3CHYA 3U4GA 5HK9A 1S2MA 4EYOA 2RGDA 4R7GA 1S4QA 1PNTA 5LC1A 3PENA 5EKUA 1A9OA 4ZVTA 3N0RA 1G21A 1C4WA 2FPGB 1FUKA 2YZMA 2R7NA 3ISJA 5TQVA 4PCLA 2DTDA 2NUTA 5L7TA 1BD3A 3KT0A 5FB3A 5JSZB 2D1QA 3ZH2A 1KHTA 7ABPA 1OOEA 1XG5A 2FB9A 4GOLD 2ZB4A 3E5HA 1V39A 5REQB 1SXGA 2C4UA 3DZKA 3WWOA 4EO7A 2P1ZA 5CVUA 3GLGB 4D96A 4CETA 3AR7A 3O4JA 4QHSA 2ZRAA 1GTL1 2XTZA 4HN2A 1U3DA 2VT3A 4IMIB 3T7AA 4ZYUA 5B6PA 3V4VB 1A97A 5DNWA 2ZJYA 1ZITA 2GZMA 2W6MA 4QUAA 5D00A 3JZFA 2QRHA 5TB5A 1TC1A 3AG5A 2HFJA 4ZCRA 2ILVA 5CFNA 1FTQA 2AEFA 3EMDA 3L8MA 3RRYA 5FNVA 4KQCA 3VV3A 4DDUA 4UD6A 3UMSA 1NWHA 2WU3A 1E1KA 3RK0A 1V8ZA 1ZN8A 1ILWA 4FILA 4CGYA 1VM6A 4NJEB 3NTLA 2PNJA 1BXKA 3GLQA 2KJQA 3ETHA 4YMTA 3ZVNA 2Q2WA 2XB4A 3JQEA 2CNDA 1RYYA 3U6KA 1DFHA 1W2GA 1YIAA 2E4UA 1WP9A 3JY6A 5J9FA 5A3RA 3F3KA 1ETHA 4ZKDA 1E8MA 1FSSA 1DBSA 2J3EA 5A4AA 4L02A 1C8KA 5ICMA 1OIXA 1SXIA 2AB0A 2X6RA 1YS7A 2ZRCA 4P0QB 2YCLA 5T3UA 2C2OA 1D2MA 1P74A 2XMRA 4N7JA 3E53A 2X13A 4MVXA 4Q3LA 3R7WB 3UHPA 1XD2A 1RRGA 3K1JA 1SC6A 3OIFA 5DXFA 3S4YA 2B36A 2Y1GA 1KFCB 2R751 4UVIA 3CE9A 4PN3A 4MW6A 5JO0A 1Q1BA 1R5JA 3I5AA 4N18A 1W93A 2R5NA 3WDLA 1N6KA 1LBQA 1PJ3A 1G6KA 4QICA 1Q92A 4EB6B 3A9VA 3VZQA 3GY0A 4K9LA 3SBOA 1E4EA 2GKSA 5HGXA 2IP1A 2ZJ3A 1QXSA 1V26A 2VWQA 4HQRA 1ZJYA 1ID1A 2C2GA 3WC4A 1K92A 4JLNA 1C3OB 1K5GA 1XP8A 2FMFA 2ZDQA 4HVAA 2NVBA 3UMVA 4F4CA 3EK2A 2ZI4A 5BYBA 3LLUA 1KKMA 3PUXA 1SHKA 4IPTA 1KDPA 3B3QA 2YR0A 3D2CA 3NBXX 2IE0A 3WLPA 3WRXC 5KI6A 3SJBA 1NZDA 4J0CA 4CI0B 4YP7A 1SUIA 1NASA 2I78A 3DTVD 3R3VA 4IUDS 5DNCA 4CTJA 2R79A 2YV2A 3JQ8B 3W34A 3C3YA 3ZE0B 4B6OA 1LQUA 2RGNA 3LXXA 2Y0BA 2YXPX 4S35A 4Y1FA 3O74A 2QE6A 4E94A 3PFBA 3PK0A 1H0SA 4RKRA 2QYTA 3URMA 3A3OA 4MH0R 2WYVA 1YMUA 2QUBA 3H2KA 4L9RA 4AAYA 3VYWA 13PKA 2CL7X 2VP5A 3KSUA 4I36A 3TEJA 2X4GA 2Q4EA 4L9AA 1UWVA 4IJWA 2EQAA 3DZHA 5FNZA 3RJZA 5FOVA 4EUKA 2I6QA 3NCTA 2COEA 2ZS8A 3K1YA 4HVLA 3SF0A 5JD5A 4YJ2A 5FTKA 3W3AA 3MHTA 4KREA 3HUEA 4DQVA 3OZRA 3G2NA 1W36C 4EKEA 5IC6A 3KQYA 2DY0A 1QTNA 3CRNA 2IH4A 3FSGD 1ZR2A 4QU8A 1M8PA 2BR4A 1XLTC 5C1IA 4LJSA 1H8HA 3EVDA 2DRIA 2WHPA 3PQ8A 1AKWA 4KJZA 6CHYA 4RHUA 2X77A 4HNTA 4W9RA 5HP4A 2XB2A 1BYIA 4V02A 4K0KB 1TZKA 5AHWA 3ZE6A 1HNWB 1QGAA 4P5DA 2WTNA 1NN0A 2W8ZA 5G1OA 1N0VC 4G4SO 4F12A 1HE8B 2QG6A 2ZJAA 3AY7A 1IRIA 3O2QB 4WAUA 4IW3B 2C9OA 1OZGA 1IB0A 2P9YA 2Y0EA 4LSGA 1UDCA 4FK8A 1BJRE 2VXOA 3P2MA 4UHEA 1HSZA 1TAQA 3WG9A 1B16A 2QN2A 3L4SO 2YY6A 1MIHA 2FZEA 2WPNA 3NYIA 4LBZA 1I6LA 2J5RA 4GKJB 2DQYA 3CC8A 1T2UA 2VPIA 2QGNA 3JALB 4NFYA 1BMQA 3D6JA 2X0EA 2BMDA 2CZGA 2VBIA 1T9KA 4XX0B 3U3KA 4DFDA 2FR0A 2GT1A 1QC5B 5GONA 2NSDA 1M8FA 4K6OA 1UDXA 4JGGA 1UMDA 3BJIC 4OHKA 3U7FB 3LUHA 2D8MA 3I9OA 1LI5A 3GVIA 4DJ5X 3JQ9A 4I1IA 5LQUA 3LCCA 4TLBA 2ONKA 5DCLA 3G23A 1OD6A 4G81A 1OT3A 2JZCA 3R0IA 4R9RA 5HJ5A 3MLEA 3UG7A 4J1TA 3NUQA 3JWPA 1XTRA 3DT8A 4MVJF 4XD7A 4DRXB 4W5WA 1OZ0A 1MJNA 4K88A 4KE7A 5EMHA 5F2NA 4IRXA 3CUWA 2A9OA 3IKMB 5CW2A 5KUTA 1UOOA 2PBRA 1RPZA 3G0GA 3ETLA 3UFXB 4UDXX 3LKZA 3ISVA 3AL3A 3IR7A 2XCUA 3O8DA 4QTYA 4HNAA 5LUBA 1Y8QA 2C2BA 4XGQA 1BWRA 4M36A 4TWZA 4AJLA 1EE1A 2A9FA 1WNTA 1Z25A 2YXNA 3ZBPA 1EWYA 3RC8A 3QXXA 4IWNA 3M1AA 1YS6A 1M6VB 2HJWA 4O1HA 5FHRA 4JKIA 1FVFA 2HMYB 1RM3A 3L79A 3OF2A 2ZYVX 1Y1TA 1V2HE 2BP7B 3BDAA 1XZLA 5DZSA 3TTXA 3W3AH 4QLOA 3ZV7A 4BY9E 1K4KA 1W4BA 4GR4A 4JXZA 1R8XA 1KFKB 3UC9A 3HXQA 2EDAA 3AJAA 1BMDA 3TSZA 2YZ2A 1GSOA 4BNNA 4CIDA 1GPMA 3P71T 3D6HA 1UDBA 2ZAOA 4FJ0A 4AS1A 2NU6A 1AB6A 1GKKA 1H93A 2BLLA 1G8KA 2JIQA 3LXRA 2KB0A 3OHSX 4AWXA 5CFQA 1SU6A 3KDPA 4HZGA 3WDMA 3L6UA 2CGEA 4FNMA 3AFMA 3Q1KA 3TUZC 1N7GA 1TIPA 1QVWA 2FW7A 4YHBA 1KSGA 2O0MA 3GU3A 2WT9A 4KYTA 2WZQA 3W4IA 3HFSA 3CB4A 1QF6A 4UVHA 4LZPA 4U7WA 1JFTA 4NH0A 4MGKR 3X1ZA 3WGZA 5KQGA 1YVRA 2I87A 1X1QA 4KGDA 1CRLA 3AGPA 3QNUA 3AW8A 4GNRA 4L0MA 3CIOA 1W4AA 4CV0A 2VS1A 3KELA 5TS3A 3ONVA 3SLRA 1XMPA 1US8B 1DXHA 2AYXA 4PLTA 5IPFA 1GTRA 2P5TB 4UAGA 4LWQA 2C7VA 1JQBA 3TTWA 1UR5A 4HZIA 1M9NA 5ERXA 2HW8A 4ME6A 3THWA 2Z2IA 3LHFA 4YT2A 1X7GA 1RHQA 5IVHA 4NNPA 4Z1MA 5I3ZA 3TLAA 4HQNA 3JATA 5K8CA 4H3SA 1DL5A 1EWTA 1VRVA 4WCFB 5BNWA 2B2XA 4LYFA 3QFRA 5E8JA 2XMDA 3MGCA 3K1AB 4DLSA 1X38A 4RANA 3RKRA 4IS2A 4JQCA 2ROQA 5C46F 1AMUA 3A6KA 2A86A 3AVOA 1MRSA 1GU0A 1YCHA 2AOXA 1JH9A 4XFDA 1PZMA 4W1PA 2R1TA 3KQWA 1DSSG 1P39A 1Z45A 3FKJA 4NI5A 2PH1A 2ZPTX 3FI9A 4Y2UA 3FX2A 4OUDB 4CIVA 1MXHA 4R84A 2C82A 3CWCA 4XVUA 3L0DA 2GZAA 1QCZA 3KZXA 1BMFA 2O4CA 4UUBA 5CVCA 4M4SA 1ENYA 1FJHA 5C52B 4GE0A 1THGA 4G9BA 1NJ6A 1XR3A 3I9FA 2WAOA 1QR2A 3M34A 2FKAA 4PZLA 3EW7A 3K0AB 2WYHA 3E9YA 4LOJA 5DLEA 2ECFA 2IS4A 3WJ7A 1C30A 3GLGE 4B81A 1AX9A 2WSSA 2FWMX 3KD3A 1NDQA 1M75A 1TB4A 3VVMA 5A4FS 4YAUA 3QEBZ 4N48A 3ERCA 2WYUA 3E5RA 2W22A 1QYVA 1JJFA 2E21A 5HF9A 3DE4X 4CKWB 3ROPA 1LDNA 1E6EA 4OD0A 1M34B 2GHRA 4JUDX 4PWZA 3ZS8A 4XDGA 3EGXA 4DSUA 1U94A 4WZBE 3IKVA 2Q0HA 2Z56A 5EMKA 4JUBA 4GAEA 3V8MA 2CCKA 2GVNA 2YNMD 2GVZC 1KO8A 2ZROA 1N2CE 1U8CB 4FC7A 4RGYA 5FJJA 3NRBA 2I0FA 4QPZA 3D4IA 4LE2A 1IE3A 3VRHA 3NHFA 1T9HA 3Q0EA 4DA9A 3RTCA 3NH6A 4K1LA 4YASA 1D09A 1OGYA 4N8SA 1IWOA 3D4BA 1NUHA 2JHPA 2LKDA 1P3DA 2HMAA 3NKFA 3MTJA 3D1VA 1JL3A 1KZGB 3PBKA 4CYMA 2JAPA 3EXHB 3KOUA 3FGZA 1DKNA 1X42A 3LLCA 4BNXA 1NQTA 4NMMA 3TGPA 2XUKA 3FBTA 1Y0BA 4QJIA 3E3MA 2DLNA 5FUVA 1P1RA 1U2ZA 1RXUA 4RY0A 3N58A 1A8QA 3AHEA 4RYLA 2NZJA 3FPHA 1L4YA 4WADA 1ULSA 4WZBA 1L5YA 3G2HA 3MB5A 4UDYX 1ZUIA 2WWHA 3WGVA 2I33A 4MS1B 1NUUA 3IDQA 2Z3WA 3WMXA 3K71B 4P4NA 4QVGA 4HAUA 4TMXA 1H94A 1Z35A 4HJXA 2X6TA 5B57C 3MS7A 4NHOA 4NPAA 2QP9X 2FDXA 4TZ6A 4GRDA 2RGAA 1DJOA 3AH8A 4KWEA 3ND8A 3QU5A 2BZSA 3O83A 2QTVB 1ULAA 2W6OA 1ZNZA 3QU7A 4I55F 3LDAA 4WCVA 1O6CA 3ABIA 1N0IA 2GD1O 4R41A 3ZDXB 5DGXA 4X95A 4UU8A 3D7MA 1BDHA 3LQQA 3OMWA 1TOAA 4NG4A 5T8KC 2DR3A 1RZ3A 3ONNA 1EFRD 3I6YA 5FA6A 4JUFA 2ZSHA 1H3FA 4UUPA 1VP9A 3DEYX 1C7IA 2VT2A 3MINB 4YP5A 2N1MA 4JOCA 4PBTA 4MR8A 2XD9A 5LMZA 2ZYTX 2RJOA 3N2ZB 4WPGA 3MUOA 5DIFA 3UMMA 4PRLA 5IJ9B 4MYRA 1X7HA 4K2AA 5IVDA 4A8JA 1TYBE 1BS1A 1EZZA 5BW4A 721PA 5KTRA 1DBRA 1CG6A 3GYGA 4PNHA 3TF5A 1XVTA 4OTZA 2BR3A 3K5WA 5H4GA 5IAEA 1OXMA 3RU3A 5GQSA 5BN5A 3R20A 4EG5A 2BYTA 1EFKA 2H7XA 1J0EA 1XD2B 2WTEA 2LGJA 2W2KA 1ZM9A 4YBRA 2P6UA 4IFEA 2DBYA 5JATA 1ECCA 4FW8A 3WLAA 3GMTA 4G0OA 1U3CA 2WJIA 1JHUA 3R5SA 1L4BA 2B61A 5GWXA 3VAYA 1ONOA 3C8ZA 4YCNA 1VA4A 1ST3A 3JQFA 1YV9A 5IG2A 4DMUB 1XQ6A 2WUWE 3I1JA 5FFNA 1OLSA 3WQQA 3C5EA 4CCYB 1TYZA 1Y8RA 3CG4A 4QULA 5BXYA 4Q6WA 2W83A 3G8AA 4QOJA 2ZWMA 4CHTA 5IFLA 2O8CB 2CF6A 2FPLA 2EL9A 3BGWA 1CR2A 3LBHA 1MFZA 1KQPA 3OFSA 5T4FA 4DLAA 4Z7NB 4F6LA 3HBMA 3W5CA 3PXXA 4X6UA 5HBGA 4D97A 4KR0A 3GAAA 1DXYA 3LT5A 1ENOA 2HI0A 4ZEOA 2B30A 2H07A 4C7XA 1RXYA 3HB5X 3GRZA 2WWRA 1UAGA 3B9BA 3GVXA 3PJGA 1P0FA 3GEDA 3QUAA 3T1OA 3ZGLA 4ER7A 2F1JA 4DCVA 2HJRA 4IMRA 4M0PA 2CVFA 4RK7A 1FJXA 3SC3A 2EFEB 2PO7A 5K0BA 5EXTA 3U19A 4C6TA 5GZ3A 3UJHA 1SD2A 1MB0A 1U0FA 2O5RA 4WMLA 5M2QA 2FFAA 3BGIA 2EZ8A 1SNYA 5DM2A 3A4TA 3GP5A 5C3MA 1C1DA 1IVYA 1VPLA 2Z09A 4HL6A 2PD3A 3K0CA 1BZYA 4P4UA 4TV8B 4BWVA 1YR9A 3AP1A 5EMMA 1B14A 3B6KA 4E33A 4EELA 3FFAA 2VUSA 4MYUA 1P7PA 1ZVJA 1FS6A 2OT3B 1AK2A 1TVEA 4L51A 4RSRA 4UBKA 3TBKA 1QVRA 4D2IA 4EIWA 2WINI 4URYR 4M22A 1C7JA 5EIEA 1YS9A 3ZHXA 4M49A 1W581 3OM0A 3LKDA 1Q50A 2UYYA 2AH5A 1FZQA 3QLTA 5EMLA 5CT8A 3WE7A 5BR1A 2XUHA 4C4SA 2IH2A 3V7UA 1JYEA 5FWXA 3CPHA 2WFZA 2DQZA 4UFOA 4CCSA 1WCYA 4JI6B 1DZIA 1GCUA 1TXGA 4LK2A 1OX4B 1IDOA 2J0UA 2BBOA 3DL2A 2HC9A 1DV1A 4HNAB 4WESA 2GASA 3I6QA 2BHRA 3KD2A 2CD9A 2V7UA 4IHJB 4XEUA 1E18A 4HTFA 3UMRA 1QDEA 3H2HA 3KPWA 2YJ3A 1LWNA 3QKSA 1JIIA 1UZUA 1LBIA 4BP3A 1G60A 2ERYA 3QBJA 3PTZA 2AKYA 5LZ7A 3P9IA 4GGPA 3U39A 4F4IA 3EPKA 2PFKA 4BRUA 1EK5A 4V3CA 4HEQA 4FFPA 5C5IA 4Q19A 5HHTA 3L92A 1OREA 4Q01A 2G06A 3LY9A 3M8KA 4RZQA 4I9FA 4LJKA 5JRDS 2IHKA 2PQ6A 3D4OA 5A4IS 1B0AA 2I4RA 3KQQA 3F6YA 2G4LA 2R9VA 1KVSA 4GOJA 1O4VA 3VC7A 4O4LF 4CKCB 3TAHA 5KYKA 2XIJA 3CH4B 3TFOA 5CA1B 2G4CA 3WXBA 3SYMA 4EGFA 3L7NA 5FUXA 2P9HA 2VP2A 3LLSA 1YKSA 3FN4A 4BE9A 4FQ8A 1VSQA 2O57A 3P9YA 1U81A 2VG8A 1DJPA 4U3JA 5EPUA 3SM9A 1QQAA 3CH7A 5KOIA 2CE7A 1P5HA 1RJWA 3G2JA 4ZHSA 2Q1YA 2FPPB 2PBLA 2PX5A 1QAOA 1BX3A 1OLOA 2P4UA 3U1BA 1H85A 1TO1E 2J7KA 2PY6A 5FQNA 2R4QA 2E4YA 1A96A 2FW9A 5F9MA 2M6LA 1T1EA 2B3DA 3M3DA 5LM3A 2EC5A 1VJCA 3AF4A 4DEXA 4EB6A 1D0IA 1XTSA 3W04A 2AQKA 5I8WA 2ZCJA 2QUIA 2C7QA 1IBLB 3OZAA 1FIUA 4PN7A 4LCJA 2VDVE 3FF1A 3QKUA 3HXOA 4D9HA 4QTUB 3CUKA 3AFNA 4IIDA 1EVLA 3RROA 1XNRB 4M46A 4HGRA 2OSBA 1AK1A 3L7BA 1JU9A 2O20A 4IHQA 3AKEA 1JR3E 4WOCA 4LOLA 2DE0X 2F3QA 2VYNA 4RZUA 1H9AA 1L8XA 3PC2A 3JATB 3TLZA 3TQTA 1NOJA 2FPUA 3T7TA 4D0NA 5BXQC 1EHYA 1CQJA 1WZEA 4DHEA 2Q3DA 3HEMA 4FR2A 3EC7A 1B73A 5B6JA 3JRNA 1OR8A 4M76B 3HRHA 1JAZA 1PT8A 2NLOA 1Z0JA 1H5QA 1V6SA 2P4QA 3BFJA 1OPXA 2VPYA 4B43A 2A8YA 3F6CA 1A4IA 5AICA 4UM5A 3QKSB 2QEQA 2Z98A 1GZ4A 1LI4A 3VDXA 2NYAA 2R7MA 1MD9A 2PGIA 4U7DA 3EXIA 3T0GA 3IT0A 4UUNA 4M1KA 5BSGA 1X7ZA 4WE3A 5LIPA 1IMJA 1E3TA 3A9WA 1SK8A 4QGGA 1AC5A 2ZE8A 4HFJA 3WTBA 3D8HA 1YIDA 4FB4A 1NVUQ 2CNBA 2C2KA 2CHEA 3F46A 2FG5A 2VKQA 1VFNA 5DNEA 3RRFA 4ZIRA 1Y6FA 3MCTA 3KAKA 4KFUA 1XZKA 4BMVA 2DSTA 1RIFA 4G1CA 2YIMA 2ZQ5A 3ZXIA 1KL7A 2V55B 1SXQA 4B6QA 2PJUA 3AZPA 5A1JA 4CMHA 1EK6A 2B94A 2CXTA 1XLTA 4TQGA 4NQRA 1WDLA 2UVPA 3DMGA 4FFBB 2X0DA 2LDBA 3QZUA 1FFHA 1FDSA 4QX6A 1JXMA 4MEBA 4FXPA 3S2YA 2C1ZA 3A10A 3CLHA 3FROA 5I9TA 1UT6A 1TX4B 1Z37A 1W46A 2GQ0A 3FA2A 4XVQA 5DRYA 1X8JA 2ZU0C 5JXWA 2LPMA 3OCXA 4Q4JA 5BWNA 2IHVA 3PC4A 4AMBA 3VYVA 3DFUA 5IEBA 3WFIA 1BVHA 1JTFA 1RS0A 2EARA 2QU8A 3WHPA 2V1XA 1UT8A 2I1LA 3ORYA 5K6AA 1O0CA 2V5UA 4M53A 2YIJA 4IDBA 1M2VA 2DCUA 3VR1A 5LN1A 4DILA 3BX1A 2GARA 1SUBA 1F3LA 1K9VF 2A1UB 3EZGA 1DDGA 2J33A 3Q6NA 4PFJA 5BYJA 3RFCA 1PUJA 4GKBA 4C5CA 5AQ1A 4B9EA 1ML3A 2A30A 2JLXA 1KH3A 2BI8A 2Y1DA 3EQ7A 3P9XA 3WRYA 3HEBA 1BIFA 1V41E 1AGNA 1H6CA 1KZYC 1OT5A 1RJEA 1BA3A 4LC0A 4TTTS 3BMNA 2Z1MA 5DBFA 5P21A 1KRHA 5KSYA 4RTJA 2V0CA 3ELBA 3BRWA 3C3PA 2V4ZA 1BQ4A 2I6XA 3KQMA 2B25A 3TPFA 2ZATA 3GRYA 1PJQA 4UVGA 1W8IA 3CN9A 4KFCA 3G9QA 1FVXA 3S7TA 4GSKA 4D9BA 4XYEA 3FF4A 3UC5A 1T0HB 3C6XA 3K9GA 2P5SA 2RDMA 1U2QA 3KU4A 1Q3HA 3H5TA 5IT5A 3HGTA 1WIWA 4KXQA 3P2OA 4BB5A 3LT0A 3RV4A 2JZOA 2QTBA 2J85A 2Q2VA 4OU5A 4WN3A 5EWLB 2XOEA 3UUEA 1YZNA 1L7AA 2Y0PA 4L95C 5J4VA 4TZ0A 4M9CA 4L6AA 1RJGA 1ZH0A 3COSA 4HGNA 5F9FA 3RRMA 5TC4A 2E55A 1PEKE 3WYEA 3DYBA 4IUBS 4C4XA 1E5VA 3HZHA 4YAFA 1T9BA 4XB2A 3QRWA 1LKZA 3GCDA 4TTAA 1WMDA 4BTEA 1W87A 4F5WA 1CS0B 2A0KA 1QVVA 4GQAA 2IWHA 1X1SA 2AOTA 4HRVA 2CXUA 2OR3A 2Q9CA 3R5KA 1TM7E 2GKOA 1E9AA 1ZIDA 2GN2A 2WM9B 4AP5A 4LG1A 1G8HA 3KB8A 3ZHOA 5K3EA 4ZOBA 3GUZA 3KYBA 4FR5A 5L4LA 1TVCA 4E5SA 5IS2A 4ND8B 3OCVA 4G0NA 2VZLA 1TYDE 3VU0A 3OA2A 1E6KA 3QELA 4Z9YA 2QHXA 4X41A 3CM0A 4DG8A 2HMSA 4X1KB 1XXHB 5CEFA 4JMLA 3OU6A 3K0BA 4JUIA 4N3BA 4F2HA 2ZSUA 4G0QA 4PO3X 2YRFA 4Q15A 2G0AA 4YP1A 1IULA 2MYUA 1VCOA 4HMOA 5BURA 4GZ3A 3AIMA 4L85A 1DEXA 5CB4F 1TJ4A 1XZPA 2OE2A 5EP2A 1Y7IA 3K1AA 3JD1A 1CB0A 2A1IA 2CWWA 2X2PA 4UEOA 1GO2A 1R16A 3H75A 3DQZA 4AJKA 5CYGA 1TM1E 3D7KA 3DUFA 4ZRNA 2VHXA 1ECFA 1N9KA 3JPYA 5EWMA 3HR7A 4RV4A 1QR6A 5DTRA 3KM0A 3LCMA 2ZBUA 4ZAGA 3KR2A 3DJYA 3K6JA 1C1YA 4GM1A 4BJHB 3QXGA 2Z9CA 3SJ7A 2AFIB 3C5WP 3V2UA 2A1UA 7REQB 5KEIA 2I7DA 1OYOA 3ZWQA 3UM9A 4CMAA 1XRQA 4UM9B 4UEJA 3A4MA 4FGKA 5KNBH 4BNJA 3NYRA 4LI0A 3K4QA 3KEMA 1WDKA 2OZVA 1MKYA 4QUKA 4WJZA 5FOQA 5JQGF 1PNOA 1SHTX 3VOTA 3ZXYA 4FZ5A 5HOQA 2P41A 3K73O 4Y2XA 4FWTA 1KP2A 4TYYA 4HDRA 3QYPA 2JCSA 3PHHA 1J0XO 1KK2A 1M67A 3WHIA 3DONA 2XWSA 4NPHA 1C9YA 2ARKA 2WWVD 1KXJA 4O25A 3AQ4A 4CLRB 5JR3A 4FT4A 4OK5A 3GNTA 4KXUA 4PGAA 4QT4A 3QWFA 2G80A 3EGXB 4QGBA 1FX1A 3KYCB 3FDZB 4AVYA 3LUFA 3V32A 5D3QA 5ELXA 4KNYA 3ROXA 2XAAA 4L5AA 1XCBA 4P5EA 1H42A 2AQIA 3USCS 1X70A 1OJLA 1RHMA 1WD5A 1A5SB 5HS4A 3K2BA 1E5TA 3DGEC 4XX1A 3RTAA 2FPMA 1KZ9A 3O4FA 4D9JA 3M2PA 4WRRA 2CLDX 2RK4A 2YQZA 2JGLA 2JPDA 2QV0A 2XWQA 2AOTB 3AHGA 4U5XA 5A6VA 5JCZA 5E2IA 3B2NA 2ZTHA 5T4HA 1LFDB 1C1XA 1DX4A 3ABSB 3ZVRA 5JZMA 1W7AA 3I92A 4TTRA 1T29A 1M2JA 1W9MA 3DOIA 4KO1S 4LYEA 4YCBA 3LDUA 1V1RA 3GDFA 3JD0A 4FDMA 2W2PA 3C3JA 3QBDA 3P9QA 1DOHA 2PZAA 5FKJA 4RJLA 1XMXA 3TPCA 4AS3A 4F85A 2ZYHA 3BXFA 3OZVA 1AUOA 3GFVA 1A2BA 3GNQA 3K9QO 4DV6B 1SXJB 1P1CA 2ZUEA 1PYDA 4EY8A 2WRZA 2QQFA 4MUJA 3ILHA 2P91A 3LT1A 1GN9A 1LUAA 3Q7TA 4EGCB 3Q2OA 2QDXA 4QBKA 2C20A 1PV2A 4MWCA 1YE5A 1FQKA 3ZGVA 2IX9A 4KAXA 1ORWA 3DMPA 3H2BA 4LF5B 2OHJA 3QVLA 1OYVA 3HWSA 4M38A 1LXCA 2R6ZA 4LTMA 1D8TA 4RGBA 3PWKA 3FLBA 2FMIA 3DDZX 1D4ZA 1POXA 4IDHA 2AI3A 3V4FA 5KJ1A 3D8SA 2FSUA 5GV8A 4A91A 4ZN6A 3WRXA 6Q21A 5FBKA 4O63O 3K35A 4HPJB 2ZJOA 2NADA 4YV2A 2ZRIA 3EOAI 1RI5A 1M2WA 1ONBA 2YS6A 3CX6A 3QJGA 3G2PA 3I2HA 3GJ3A 4KNWA 5EJ6A 4P3PA 3N0VA 4O1MA 2I6FA 2YFHA 3K32A 5CLJA 4UZSA 1Z0IA 2PMDA 4Z4GA 4LGMA 3KYCA 4ZAXA 3AHIA 3DO5A 1P31A 3N0WA 4V0NA 5D6OA 3ZI4A 3OQNA 3NCHA 3NH9A 4G4JA 3N74A 1V2GA 1IU9A 2PS9A 1XBTA 2QG9A 1IZ7A 1ZI6A 3IFSA 4PHHA 2NU7A 1T5TA 2B6HA 2BGLA 4AKGA 1SOVA 3NDPA 3TW4A 2JFWA 2CHFA 4PHGA 4AK9A 4GW3A 1BOFA 1XQ1A 3LA8A 4JBGA 4NONA 1J25A 1Z47A 4Y9RA 3THXA 1TJ5A 5JXGA 1IBMB 1KOGA 1O97D 1QZXA 4G0UA 3SKVA 1BROA 2H9AA 3VR5A 3KQSA 2B4KA 4KAAA 1P73A 1EA5A 4D0RA 1C1XB 1S8NA 2B8JA 1Z17A 2J7PA 4AF7A 1H1LA 2ZJBA 4IUYA 4UTPA 2JBAB 2WF6A 5K8LA 3ER8A 1THZA<