2X0IA

2.9 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with nadh
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
294
Chain Sequence
MKLGFVGAGRVGSTSAFTCLLNLDVDEIALVDIAEDLAVGEAMDLAHAAAGIDKYPKIVGGADYSLLKGSEIIVVTAGLARKPGMTRLDLAHKNAGIIKDIAKKIVENAPESKILVVTNPMDVMTYIMWKESGKPRNEVFGMGNQLDSQRLKERLYNAGARNIRRAWIIGEHGDSMFVAKSLADFDGEVDWEAVENDVRFVAAEVIKRKGATIFGPAVAIYRMVKAVVEDTGEIIPTSMILQGEYGIENVAVGVPAKLGKNGAEVADIKLSDEEIEKLRNSAKILRERLEELGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.9A Resolution Crystal Structure of Malate Dehydrogenase from Archaeoglobus Fulgidus: Mechanisms of Oligomerisation and Thermal Stabilisation.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
total genus 107
structure length 294
sequence length 294
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2x0iA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 2x0iA02
1H2BA 5JCXA 3CXRA 1ENZA 1MLDA 3NGXA 4I5GA 2B35A 4BNKA 1R6DA 4FN4A 1ULSA 3TQHA 5U4QA 2X23A 4ZQGA 5IXSA 1K3TA 4TZTA 1Y1PA 5U9CA 5B4VA 4WCDA 1YL6A 2EKPA 3E9MA 1KETA 4PLWA 2BH9A 4AJKA 4AL4A 3RU9A 5DDIP 5T6BA 5I8WA 2J3IA 5FF9A 1ZO8A 2EIHA 3WFJA 5A5FA 1YKFA 3AY3A 3SLKA 1PQUA 5A5EA 5G4LA 1CRWG 4DA9A 1ZEMA 2P5YA 3ZU3A 4NJOA 3ADPA 1HEUA 2DPGA 5K0ZA 4PZCA 1EUDA 1J5PA 3M2PA 1C1XA 1GAEO 5EQFA 4IS2A 2JFFA 1HYGA 1TEHA 3UW3A 4E6PA 2JL1A 1W4ZA 4A7PA 3PYLA 1QYWA 4LMPA 3NT4A 3JYOA 3PJFA 3RC9A 3D64A 1N9GA 2R2GA 2YFQA 4X54A 4BGVA 1ULUA 4W9NC 1HE2A 3ZWWA 4Y6RA 5BQFA 4XR9A 5I9NA 1E3WB 4D43A 2NVUB 3WYBA 1F0YA 1VLLA 1QYCA 3F4BA 2C07A 5KKAA 4DXHA 1PWZA 4L9RA 3O9ZA 2Y66A 3F4LA 3SXPA 1MG5A 1VM6A 5I7EA 5JO9A 3FTNA 2NTNA 4RF5A 4WGGA 3HWRA 4OL9A 4CM1A 3E8XA 4QSMA 1FDSA 4HADA 5L4NA 1SMKA 1U7TA 4UREA 1NPTO 4JIGA 1PJSA 1GY8A 3ITDA 4TQGA 1LBEA 4E32A 1N5DA 3LSYA 3PGJA 3TWOA 3LZ6A 3X2EA 4II2A 2IEBA 5HRUA 2BGKA 2R6JA 4J0FA 3OEYA 4JCOA 3GHYA 4M87A 1RYDA 3ONDA 5F5NA 3STHA 3NT5A 3JQ8A 2UUPA 3DHYA 4QXMA 5T57A 3NUGA 1GYPA 2IXAA 8ADHA 4QQRA 3JD3A 4M89A 4GVXA 4BO0A 4BNWA 1DC3A 2DPHA 3WGHA 1VKNA 2CD9A 3RUCA 3RFVA 3Q0EA 4TZKA 1WMAA 1ZFNA 1H6BA 2RIRA 2OXIA 2OZPA 4NK4A 1QYVA 3F9IA 3AI1A 1PZEA 5T64A 1FDVA 4DLBA 1OOEA 1MUUA 2O3JA 2YV3A 3TL3A 2PV7A 4LVCA 3GA0A 1FDUA 1GUYA 1NP3A 3W8EA 2P2SA 4BO5A 3HNPA 2I65A 1U8FO 4RF4A 4LRTB 1KC1A 4AJPA 1YBAA 1E7SA 3DMTC 1BHSA 4OMUA 5EQDA 1HDZA 4UVEA 1RKXA 5IXYA 1EFKA 5CDYA 4GQAA 5JW6A 4R01A 4RVUA 3ZH2A 1O0SA 4RLSA 2I6TA 2O3RA 1EDOA 1V8BA 1N92A 4Q3AA 2EF1A 1IHXA 1AE1A 5JDCC 4RDHA 1T26A 4I9UA 1YS4A 3OSUA 1YDEA 4ND2A 1JA9A 2H9IA 3R3SA 1WAMA 4TRNA 5EERA 3UGKA 3VDRA 3WDSA 4CM7A 4CMIA 4TKLA 3C1TA 1YWGO 3H9QA 1EUZA 2UDPA 3WJ7A 3HDYA 1XYGA 3IDSA 1I10A 4JBIA 5A06A 1GPJA 5U1PA 3PPIA 1A4UA 4UULA 3WWYA 1DIAA 1GUFA 3HJAA 3JQ9C 4LRSB 5GZ3A 5TC4A 1CJCA 4A10A 4WLFA 2VWPA 1AHHA 4MPDA 1IYZA 5BNTA 3AK4A 3U4DA 4CLRB 4LCJA 4YJHB 2VQ3A 3HDQA 2QYSA 2EERA 1QXSA 3DFZA 7MDHA 3WLFA 3AU8A 2BF7A 3SJ7A 4R68A 4UEJA 4RQUA 4M55A 2OGUA 4E21A 4WK6A 2A9FA 5ES3A 3AI2A 3IJPA 3HB5X 3Q3CA 4Q3NA 3ETEA 1YBVA 3NDIA 5HBRA 1DIBA 5JSFA 4CQMD 4XQGA 5LDHA 3FNGA 2Z5LA 1GFSA 3GRKA 4E2XA 1I5RA 4GWKA 5TJ9A 1JAYA 1CDOA 2VTEA 5KNLA 3QLJA 3T7EA 1Y9EA 1R15A 1YBMA 3RD5A 3PI7A 1NVTA 1I3MA 1N8KA 4HKTA 4IZIA 1D4FA 5JXWA 4Q3DA 3EGOA 3ZGYA 3F1KA 1C1XB 1Q7CA 1P1KA 1BWSA 1TT5A 3DTYA 1A71A 1G0OA 5L9AA 2ZJ0A 3VKUA 3WGTA 5ILOA 2GN8A 1P44A 1WXDA 3VH2A 4U7WA 2DUWA 2Q49A 1UH5A 1ZEJA 3K73O 3L0DA 3UF0A 3EC7A 1OBFO 3VTFA 3PHGA 4KTVE 4OQZA 2DTDA 2QRLA 2VTDA 4QO8A 3GVIA 1EBFA 1UR5A 1U9JA 2GASA 1PS0A 3PHJA 1KEVA 4YQZA 3PJEA 1DDOA 1R16A 4GVLA 5COQA 5C7LO 1XU9A 4QT0A 1MB4A 1JKIA 3I9LA 2FR0A 1ZCJA 3PWKA 2HAEA 1LEHA 2VRBA 1HSZA 1LI4A 2HU2A 4WASA 4NFYA 4BNMA 3G79A 2V65A 3B6ZA 1HRDA 1LX6A 2DBQA 4AJEA 3AJRA 1Q0LA 3DZFA 4JJGA 4NBUA 1MC4A 1J0XO 1V6AA 4OSOA 3SLGA 1B3BA 5BNFA 1E3WA 3WQSB 2FMUA 3GFBA 1F8FA 3JQ7B 4R1SA 4KZPA 1HYHA 3G1TA 3SJUA 3BMQB 4D0SA 5JC1A 5LC1A 2PKQP 5K6AC 4HNHA 3GQVA 1DPGA 1C1DA 1NQTA 3G17A 4DL9A 1LRKA 2NVWA 3JQ9A 4NK5A 3PQDA 2PD4A 2WYVA 4YAGA 4AVYA 1S7CA 2PWZA 1Z74A 3ANNA 1LLDA 1LUAA 4BNLA 4FIZA 1MGOA 3KEQA 1ISJA 4R1UA 4XDZA 5HTOA 4YJHA 3WXBA 3E9NA 4MKRA 3GC6A 1E7RA 2RH8A 1Z7BA 1SAYA 3DONA 3F3SA 4O63O 1ADGA 2HJSA 4QFDA 2NACA 1XA0A 2OFPA 5BT9A 4TSKA 3WOHA 4PZEA 3BMNA 2PFGA 2HKIA 2VT3A 2Q1UA 3DTTA 1VL6A 3TZQA 1X7HA 2YQ4A 1M66A 3CEAA 5ITWA 3FN4A 1EK5A 2ZQYA 4J4BA 3IL2A 3C8MA 4U0KA 5DOVA 4RZHA 4ALNA 5IJZA 3HN7A 4FSHA 2BFPA 3Q11A 5KVCA 1GV1A 4FR5A 1BXKA 3JQAB 4H16A 4R5HA 3DXFA 1H9AA 1IL0A 2AE1A 2PH3A 5IZCC 3U62A 4P8RA 4PG4A 1OFGA 1Y8RA 4IDBA 2FPGA 1EBUA 2B69A 4YT8A 3R3JA 4WE3A 2JCYA 3RUIA 3R0IA 4D0RA 2HSDA 2V6MA 1DLJA 5CPBA 1MG0A 3JQEA 2PA3A 2B4QA 4ZQEA 4EI2A 2VUTA 3RBVA 3COSA 3H3FA 4MKZA 3F47A 1U5AA 4PLZA 1DFGA 3UCXA 3HFGA 1KVSA 2ZIZA 4IS3A 1M6HA 3WGQA 4D44A 1KC3A 1SOVA 1YE3A 3RFXA 4AJ2A 4ZICA 1Q1NA 1E7QA 2VUUA 1Z82A 3U4HA 1O5IA 1ZK4A 4KWIA 2Q45A 4GPD1 3WQRA 2C7VA 4PVCA 1H5QA 4E2YA 1YH3A 5A9RA 2B36A 3EYWA 3ULKA 1PZGA 5C3MA 1VJTA 3O4RA 5H82A 1B2LA 5F1PA 1C1DB 1ZXLA 3N58A 2V6FA 4WNIA 3ZWCA 2GPTA 2D8AA 2I76A 4KQXA 2IDZA 1JLLA 4BMNA 3B20A 4IDFA 4XB2A 2I67A 4A2CA 3GGPA 2Y1DA 1NM5A 2FN7A 3ROKA 3BIOA 4OKIA 1EE2A 4OH1A 5CEFA 3SX2A 2P68A 1YL7A 2J8ZA 4W9NA 4AJIA 5IDQA 2VWGA 1NXQA 2DM6A 1E1NA 4G81A 3SBOA 5TLSA 4EITA 5CAEA 1ONPA 3I23A 4AJ4A 4NU6A 1PGPA 3E18A 4EUEA 3BMOB 4J1QA 4D42A 3P2OA 5AXBA 5ADHA 5JDIC 1ADCA 3DZHA 3H9EO 1T1SA 1KY4A 3DAGA 1ZKMA 3GGOA 4DIBA 3WGOA 1UDBA 1N2SA 3ZN2A 3DQPA 3DB2A 4JNKA 2O4CA 1ZBQA 4BIIA 1NAHA 4M8SA 2ZJ1A 3WNVA 2DVMA 5DT9A 4NBVA 1Y7TA 3RCBA 2EKLA 4TWRA 1HDXA 5L40A 1KY5A 1DJNA 2XAAA 3CINA 3P5SA 4RL6A 5A3VA 3WWZA 2OOSA 3F5SA 2W2KB 4FCCA 1HE3A 1DRVA 2YFHA 2B37A 2YJZA 4NIMA 3MJTA 2R00C 3W8FA 3I4CA 4ONEA 4B7CA 3DAFA 1MX3A 3AI3A 3IC5A 3O8QA 5G4KA 5TF4A 3FRJA 1O95A 3JQBA 4J49A 5JO0A 3WTBA 1F17A 4ALLA 3DZKA 3FBTA 1NWCA 3OJFA 4K26A 2PZMA 2W98A 1O6ZA 1GQQA 2OBYA 3JTMA 2IZ0A 4NI5A 3N74A 1CQIA 5IDYA 1LRLA 4PLYA 3NDJA 1UZNA 4JROA 3WSVA 1A4IA 3QQPA 5H81A 4WLNA 3AUUA 4PLTA 4GL4A 5AQ1A 3UH1A 1O94A 1H6DA 4HUJA 4CLOA 4HFMA 4HNGA 5L51A 4YT2A 2O48X 4LMRA 1AHIA 3D4OA 5IG2A 1C3VA 4R69A 3OBBA 4BO3A 2GNAA 2FPIA 3GNTA 3DEYX 1WP4A 3NJ4A 5I7SA 2VRCD 2WJPA 5MGBA 3EW7A 4E12A 3ZWYA 4GSKA 4RVFA 3G3EA 2JCVA 3GAZA 5I9LA 1KVUA 4XYBA 2FP4A 1B16A 3M1LA 3U4CA 1NVGA 1RM3A 3RUHA 4MIYA 2NVUA 4CUZA 2C5EA 1YDWA 3H7AA 2WYUA 5H83A 1DAOA 2YY7A 5DF1A 2G17A 2NU9A 3EDMA 1XGKA 4DBVO 2HUNA 4CMAA 1E3JA 1E6UA 3RQSA 1E7YA 4Z0TA 1U3VA 4R54A 4LK3A 1MFPA 4LSMA 1I36A 1K6IA 4W4TA 3TFQA 4CLHA 2BFOA 1KS9A 1B8UA 5JAIA 3KRTA 2ILTA 2PZKA 1CWUA 3CPSA 1KERA 3DC2A 5HWSA 1A72A 2QQ5A 2FR1A 1DHRA 3DR3A 4ZGWA 3TFOA 3WNQA 3NX4A 4GLOA 1WDLA 2C59A 2ZQZA 1UP4A 4H7PA 4FOOA 1LQUA 3NTRA 3RFTA 4DIOA 2PD3A 6LDHA 3ENKA 3DL2A 4HFRA 3RJ5A 4B7UA 1GCOA 2O2YA 3QP9A 2Q1WA 3IOYA 4RPLA 3UICA 4I1IA 2HMUA 4A0SA 2GUGA 4YR9A 2AQKA 4ND3A 3MJVA 4E5PA 1R4NB 3GPIA 4A27A 5B4TA 1NR7A 5L4LA 2C7GA 3CZMA 1BXZA 2XPCA 4J7CA 4TRJA 2O23A 4AJOA 2I66A 1LDYA 4FFPA 1UDCA 3U9LA 2I99A 4TRMA 2X1HA 4KUHA 4WEOA 1GCUA 1PTJA 2X5JO 5A04A 5JMPA 1E1LA 1KEUA 1XLTA 4CQMA 2GLXA 4CMEA 4EUHA 4BNNA 4MVJE 4WLEA 2JFHA 5G4KB 5EN4A 5A1TA 5JY1A 2FPPA 3ZV6A 4HXYA 2CSUA 1B14A 3QVTA 4XKJA 2VRCA 4FGSA 1E1MA 3C3XA 3UOGA 5DP2A 3PVZA 3L6EA 1E6EA 4MVJA 3L4BC 4DQUA 2AEJA 3TF5A 3K6JA 4B79A 4CLXA 4MVJP 1YL5A 2O3SA 4PCVA 1YB1A 4CL3A 4W7HA 3WGGA 2D2IA 4HY3A 2I9PA 4W7IA 3QVOA 3RAJA 2HMWA 1FDWA 3VOSA 3A4VA 1I30A 3ETDA 5G0SA 4QFCA 1ZMOA 2G76A 4J0EA 3E48A 1QKIA 4FBGA 3RBXA 2BMAA 1GQ2A 4DRYA 4BNUA 3AOEA 2X9NA 3D4PA 4ZD6A 4BGIA 2UVDA 1ISMA 3MEQA 1A5ZA 1ARZA 2HK8A 3RSHA 1LNQA 3JYLA 3IKTA 4BMSA 1LSSA 1T2EA 3BMCB 1K89A 4D41A 4XD2A 5THQA 4E5NA 1DB3A 1DOHA 1ZJZA 2EV9A 3V5NA 5A3JA 3TL2A 2D5AA 1EVYA 2GDZA 1KEPA 1GQYA 3D0OA 1HE5A 1E92A 2DBRA 2YW9A 5TS3A 3BMQA 1HTBA 3WGIA 4IJWA 1CF2O 2EEZA 9LDBA 1M6WA 5G0WA 5A9SB 3H9JA 3I9KA 1NFFA 3PGXA 1I2ZA 3WGYA 4DUPA 4E13A 3WYEA 1J4AA 3DZGA 3PP8A 2EGGA 1TVEA 3E82A 2X5OA 2PGDA 4KP7A 4FS3A 4MVJD 4R4JA 1PJCA 3MJ4A 4S3MA 1ZVMA 3PQEA 4EJ0A 4ZRNA 1X0XA 4WUVA 2VWQA 3LT4A 1X1TA 1EQUA 2BGMA 2OHXA 4R3NA 4R9SA 4EBFA 4CLRA 3IUPA 1BW9A 2UYYA 3FCOA 3M1AA 3U5TA 1U3WA 4BO7A 3VPHA 4Y8VA 4J1TA 4PZDA 1SEPA 4ZU3A 3U09A 1BG6A 2GRAA 3V1TC 1QLHA 3DZBA 1V3UA 1EZ4A 2WSBA 2SCUA 3GEDA 1MFZA 4RQTA 1V3VA 4CODB 2E4AA 2NUAA 2X0RA 1BGVA 4NBRA 1QG6A 1X14A 4B3IA 2CZCA 3ZWMA 2RH4A 4WKGA 2IZ1A 1I33A 4UUPA 4LISA 1DHTA 5ENDA 1E7WA 2J5RA 2G0TA 3CZRA 5K9ZA 3H8VA 2BD0A 1BVUA 1W73A 1U2DA 4HBGA 4Z3DA 2PKQO 2ZB4A 4F3YA 2J3JA 4U5QA 4PG8A 2Y67A 3K2BA 1CIVA 2DQ4A 2IZZA 2EP5A 4YXFA 2CY0A 1IPFA 3GMDA 1TA4A 1WDMA 4IM7A 1FK8A 3KHUA 5THKA 1HF3A 3BTSA 2HMVA 3KSDO 2NU8A 3AM3A 3LLSA 4I9HA 4CR8A 4D7AA 4FC7A 4ZN6A 4HX5A 4ND5A 4INAA 5T5QA 3BMCA 5L4SA 1PGJA 3A1NA 3GEGA 2IRWA 4J4HA 3ZV3A 3QWFA 5A05A 2CF6A 1E3IA 2VUSA 4XQ9A 3OFSA 4AJHA 2ZYGA 1VPDA 1NQAO 1EE9A 4ZRMA 3JQCA 1GV0A 1X7GA 1D8AA 5IZ4A 1Q0QA 3AOGA 1NR1A 1U1IA 4IJVA 4WOKA 1ENYA 4YWJA 3VZQA 5HA5A 3LLVA 3VAZA 3RROA 2HMTA 2WE7A 3K31A 3R6DA 1LDGA 4M86A 3KSUA 4A03A 2FRDA 4DMLA 3BXXA 2W90A 1RM4A 1DLIA 3GH3A 4B3HA 4BO4A 3RWBA 3JQAA 2X0JA 4D3DA 4N5NA 5CP8A 3WMWA 1YXMA 1YOVA 4NHEA 3QE3A 2OMEA 1Z7EA 4WLUA 3AUTA 2PKRA 1JW9B 2WTBA 2G82A 5JAZA 3E5MA 3QSGA 4QX6A 1CYDA 4LGVA 1PR9A 2E49A 2TMGA 1MV8A 1GEEA 1ONNA 4ALMA 1E3EA 3VTZA 2FY8A 3D3WA 2RBEA 2FZEA 1KBZA 2Y1EA 3PDUA 4PLCA 4UVGA 4J1SA 4P22A 3L4SO 2B0JA 1PX0A 3ZHXA 1LDNA 4R3WA 2D1YA 3KO8A 5EESA 3S2FA 5FWNA 5C7OO 1BVRA 2BI8A 4A5OA 1PGQA 2Q50A 1PQWA 1IULA 4MVJI 4NBWA 4YB8A 2RHCA 4BGEA 3IIEA 4GKBA 2AE2A 3K8ZA 3GDGA 4PG7A 5G0UA 3IMFA 5JDIA 4YAIA 1P3DA 1DIRA 4UEKA 2HK9A 2D0IA 3EVNA 2I3GA 3H9UA 4L76A 5HS6A 1C0KA 2AEFA 4BNXA 4P4NA 1JQBA 4DQVA 3H5NA 3GVXA 4Y98A 4E0BA 1LDMA 1PJ4A 5L7TA 2BGLA 3KTDA 1VRWA 3WTCA 1BSVA 1E5LA 3GPDG 1L7EA 2VHXA 4WCFA 3ZWBA 2O3QA 4AG3A 5CHEA 5JAQA 4ZQFA 5LDGA 2DFVA 1LXCA 1WZEA 3B1KA 2H5LA 1ISIA 2OL4A 4K28A 5B12A 5A9TA 3WIDA 4NMHA 1R4NA 1BTOA 2FSVA 4Z0PA 3BAZA 1SB9A 3D3WB 1SPXA 3MWDB 4RDIA 4AICA 2UV8A 3P7MA 1NFQA 3ZHYA 2JHGA 4N5MA 3PRJA 3JQFC 3GR6A 4CUKA 4P4GA 3I5MA 2ZKLA 3GHHA 4CL8A 1ZH8A 5KJEA 2HDHA 1LSOA 3H3JA 4GWGA 3GGGA 1G6KA 4BS9A 3DZIA 5EJ2A 4CM9A 8LDHA 3JQBC 2EHDA 3D7LA 5G2OA 3VPSA 4CMBA 1Q0HA 3W4KA 5C5IA 5EMHA 1ZMTA 2QX7A 2R00A 1B3RA 5JMWA 2EW8A 3JQ8B 4YAJA 1ONOA 4JXKA 4XYLA 1UAGA 2VWHA 3FPLA 1GUZA 1SOWA 2EJWA 3KSZO 2J5KA 4NH4A 1T2AA 1VL8A 2H6EA 1XHLA 4MVJH 5DULA 1UAYA 2BLLA 3O8QB 1VSVA 3LT1A 4ALJA 4BVAA 3NRCA 1XKQA 3FNEA 2YQ5A 3PWZA 4UUNA 5G0TA 2I3AA 3Q9UA 3QVWA 2F00A 4FDAA 5JAMA 5TIIA 2JD2A 5F1OA 1M75A 1PZFA 4BUCA 5JPIA 4XJTA 2VHYA 2ZTVA 3C1AA 5EIOA 1B15A 1GDHA 4D45A 3ZWPA 2NSDA 2UAGA 2OORA 3IP1A 4CQLB 1HDCA 1PR3A 4RF2A 2ZB3A 5F5LA 1SEVA 3HQ4O 3FD8A 3U4IA 4GH5A 4IDGA 1I24A 1IZ9A 2NLOA 5ENVA 1B26A 3DBLA 4IIUA 4J43A 1NHWA 1LDEA 2BI7A 3GNSA 4Q3EA 3H5RA 2X6TA 2BFMA 2Z95A 1QR6A 1BXGB 3DAPA 2J3KA 3KYDB 2FHSA 4UUMA 4IIVA 1VJ1A 5AYVA 3MOIA 2X9GA 2Q2VA 1A7AA 1WDKA 4J7UA 3LT2A 4YRDA 3FBGA 3OIGA 3JQFA 2VOJA 5DCYA 3JQGA 2A92A 3JCZA 5KJ6A 2C5AA 4XA8A 1U4SA 2IYPA 2A4KA 3OHSX 4FGWA 2C20A 3PLNA 3A28A 4CUJA 5K6AA 2ZTMA 4OQYA 4JBGA 1HDYA 2Q2QA 1PU2A 4EDFA 3JSAA 3ZNNA 4BOYA 3G49A 1W0CA 2B83A 2WD7B 1D3AA 1HE4A 3SEFA 2Q46A 1ZIDA 2CFCA 4JBHA 3IS3A 5BR7A 4DPMA 5JS6A 1VL0A 3NV9A 3C24A 4PVDA 4ZQBA 4BNTA 3BTOA 3ZWOA 4Z0HO 1Y6JA 5B1YA 1A27A 5JBIA 3IUSA 3I3OA 4E31A 5EPOA 3ICPA 3QRWA 5A4DA 3W6UA 3KYCA 1MXFA 1LSJA 1UP7A 1ZK1A 1R37A 1HT0A 2IXBA 1A7KA 5COAA 2QIOA 4F46A 3MZ0A 3FNFA 1ZUD1 1NPYA 5JYDA 1WMBA 4M1QA 1P31A 1T25A 4I08A 4TMFA 3DO5A 4UVDA 1UXKA 3ZHBA 1NVMB 3VVCA 5I7VA 3A14A 2HCTA 3VH4A 4FFOA 5CDGA 2CNBA 4RV9A 1NYTA 4XQEA 1HSOA 4YRBA 4FFMA 3IKVA 4BQPA 1R4MA 2LDXA 4XJSA 3AWDA 1DBVO 5GMOA 3RIHA 3KXDA 3N7UA 3ANLA 1DC4A 1I0ZA 1NAIA 4JQCA 4KUGA 3ADOA 3L9WA 4KQWA 4ESOA 5KOIA 4MP6A 4MOWA 4CQMB 2P4QA 2W4QA 5L53A 3L6DA 3OQBA 3TOXA 2HRBA 4PLVA 3PQFA 3KM0A 3KYBA 1E1KA 2BKAA 3IP3A 2Y93A 2AQIA 1U3TA 4R51A 4II3A 1ADFA 2P9EA 3JYQA 1Y5RA 3MJCA 4GX0A 5FI3A 2VNAA 4RVGA 4CR7A 1M2WA 3WG9A 2X7HA 4RPGA 2Q3EA 5TQVA 5DZSA 2PGLA 3QA9A 3RBZA 4CLOB 4QO7A 2JAHA 4XYMA 3NGLA 3VH1A 1H94A 4MVJG 1PGOA 2QRJA 2FWMX 3NAQA 4E2ZA 2CDCA 1Q2XA 4ZQHA 4B4UA 1J49A 4K9DA 4OKNA 2UUOA 3LVFO 4Q3CA 3ANMA 1AXGA 2V6GA 4PLFA 1PJLA 4BO1A 1LU9A 3VPXA 1YOVB 3UAGA 1N7HA 4B8WA 4IINA 4R1NA 4BNIA 1SB8A 1HLDA 4DBZA 3CH6A 5CG1A 4UUOA 1BXGA 2D5CA 3QV1A 3L6OO 1NHGA 4IGEA 2DUUA 3ITKA 4GGPA 4CV3A 4XQCA 1TB4A 3UKOA 3ENNA 2JD0A 4BNVA 3ZWAA 4CM8B 1K6XA 4GKVA 1YO6A 3H65A 2Q1SA 1B0AA 3GUCA 3DWFA 2DT5A 4WNCA 3OA0A 1YQGA 4ITUA 3GLQA 2CDAA 3O26A 1XELA 1Z75A 1XQ6A 3G0OA 1ZSVA 3A06A 5IDXA 2D3TA 4BL5A 4GX5A 5BSHA 1KVQA 2OP0A 3GDOA 1XSEA 3QWBA 1DFIA 2WD7A 4E30A 1EVIA 5LCXA 3NTOA 5JDCA 4IXWA 2DTEA 4Q39A 2DKNA 2E48A 5T8KC 3GDFA 4F45A 1HLPA 1RM0A 3BMNB 3GUYA 3W6ZA 2G5CA 2IODA 4KMSA 3JD0A 1EMDA 1HKUA 1SCUA 2GZ2A 2EJVA 4BB6A 1GPDG 2POQX 1VE9A 4GSLA 4KOAA 2PK3A 4ZVVA 4LW8A 3MTJA 1ZSYA 2GF2A 2W8ZA 1E3LA 1JTVA 3KVOA 5KWEA 4OJNA 2WD8A 4O6VA 5TJHA 1Z45A 1IE3A 2GGSA 4J2HA 4FD3A 3P2YA 1VC2A 4JJIA 3UVEA 4CMGA 5I9MA 1XQ1A 2EWMA 4FFNA 3SC6A 7ADHA 3OEWA 2X0IA 2XXJA 1ML3A 1NQ5A 2CVOA 1SZJG 5ITVA 2PR2A 3BA1A 2VZ9A 1L7DA 1ID1A 4GAEA 1DSSG 4BO8A 2VYND 5TNXA 3HHPA 4RVDA 3TN7A 4EZBA 5A03A 1WZIA 4GMFA 3GVHA 3GZ4A 3PFFA 4I5DA 2B5WA 2PLAA 4RGBA 4J1NA 1UDAA 3DBVO 4JX8A 5ILGA 4BO2A 3MJSA 4YYZA 2PZJA 1GZ6A 4OO3A 1S6YA 3NTQA 4JLWA 4AJ1A 5L3ZA 4D79A 1HZZA 1ORRA 3QJ5A 3RUEA 1TI7A 1LLQA 1CQJA 2RHRA 4U8GA 1W8DA 4EEXA 1NNUA 2CVQA 2PGJA 5KJCA 4YQYA 5TX7A 2AA3A 1VKOA 3M6IA 4NQZA 2ZYAA 1DJQA 3I9JA 1I3NA 1P1FA 4YVFA 4IDDA 2VOEA 3AOEC 4R41A 2YUTA 3KYCB 4Y9DA 3VZRA 3HB4X 2E37A 1GTMA 2NM0A 3VZSA 1Y8QB 2EKQA 1JKFA 3I83A 3S1LA 5KKCA 4L4XA 1HDGO 2VN8A 1LTHR 1IPEA 3HDHA 3QY9A 2A94A 1PZHA 3H2SA 3GF4A 3W4IA 3QIVA 1WNTA 4E4YA 5BSEA 3GT0A 4DGSA 4J2OA 4J3FA 5CDSA 5CDTA 1I3KA 2ZTUA 4DVJA 3BHMA 3LYLA 1FJHA 1PJ2A 2P9GA 3DMTA 3E1KA 5AXCA 3AM4A 1ZK0A 2BRUA 2NTVA 4CMEC 1BDBA 1BDMA 3ST7A 1P0CA 3WX0A 3V2HA 1QORA 3OP4A 4L75A 2DU8A 4HP8A 2BELA 1Z6ZA 2B5VA 3VC7A 2QRKA 3JYPA 4FJ0A 5HM8A 3RU7A 1FMCA 2OBNA 3OETA 2Y1CA 4IQGA 4YJGB 2IEDA 3TZKA 3PEFA 4IMRA 3AW9A 5DBFA 3GMSA 4IDEA 3VPFA 2X58A 4Z9FA 2O7QA 3OJEA 3ASUA 1HYEA 2DFDA 4WEQA 3PXXA 2D4AA 4W99A 1RYEA 3I4FA 5AOVA 4HV4A 4N7RA 1AN9A 3KZVA 5IFLA 5ICMA 3PYMA 3S2GA 1GYQA 5KTKA 4H3VA 4I9NA 1F12A 4UVIA 1ZK3A 1QSGA 1X15A 1LSUA 1T24A 1P33A 3WBFA 1XWFA 1R66A 5KVQA 2FZWA 4IMPA 3IJRA 4WCFB 4EJ6A 4D3SA 4TVOA 3GN1A 3JD1A 4TKMA 4J7XA 5AVOA 1Y5MA 5CEEA 2Y1OA 4L4SA 1PJQA 5CFZA 2CUKA 3DOCA 3RC1A 4DLLA 1LLUA 4CM4B 2DTXA 3PYXA 3I52A 4DWVA 1IHYA 1NASA 3PTZA 2H1SA 4UAGA 1JKJA 4YPOA 1H9BA 2HLPA 4Q3BA 1MP0A 1PS9A 3Q2IA 4BKQA 4C7JA 5IF3A 1GZ4A 3WYCA 1YRLA 2QW8A 4U6SA 4IBOA 3I1JA 3H5AA 2VZ0A 4PLHA 1LC0A 4D46A 2VNSA 4JK3A 4IPTA 2D59A 1N7GA 1PJTA 3KETA 2EP7A 2PD6A 5T8KA 4LVUA 4XWYA 4F6LA 5F21A 4IJUA 1YONA 3FSRA 3UCFA 2NTJA 1DAPA 5KVVA 2JFGA 2PH5A 3Q2KA 3INGA 5I7FA 4PIVA 4DMMA 3KYDA 3UCEA 4LN1A 5G0VA 4KUEA 1X0VA 1DRUA 3OQ6A 3IAHA 1ZJYA 3I9OA 3ORFA 4L0QA 3ZHZA 3HADA 4MP8A 1DC6A 2PY6A 3DMYA 1IY8A 3QWIA 3HFSA 4NR0A 3UFXA 2W2LA 2C54A 2H63A 4MKXA 3BHJA 4QEDA 1SNYA 1PJBA 1WWKA 4GGOA 1FXSA 1VSUA 3FNHA 4LSWA 3RASA 1LA2A 2O4UX 4DYVA 2V6BA 1NQOA 4CLDA 4OYRA 3W8DA 3WMXA 4E5KA 3FPCA 4BGUA 4FJ2A 4G5HA 3UHAA 3CIFA 1YVEI 4CV0A 2VYNA 2CF5A 5A9SA 5CG2A 3JD2A 3PLRA 1SBYA 4YEDA 4DREA 1T2DA 1EVJA 3K30A 3ZV5A 3B1JA 2YDYA 4TVBA 3ZNOA 3ASVA 3CUKA 1DC5A 1A9YA 4U6QA 3KLPX 3LF1A 3LU1A 2CMDA 1BMDA 2YYYA 1OI7A 2ET6A 3FF4A 3PZBA 1EVZA 4NDNE 4EGFA 3D5QA 3GZNB 3BTVA 1IOLA 1V9LA 4CM9D 1JWBB 2GO1A 2O50A 4M49A 4BNYA 4KWHA 2BFAA 3FWZA 3VDQA 3ZU4A 1GD1O 1ISHA 3AFNA 4OGWA 4FFLA 3QHAA 3TDKA 3C85A 4MDHA 3V1YA 1QMGA 1Y9AA 1N9GB 4RJTA 3DBHB 1C14A 2ZATA 3INRA 4MVJF 1JAXA 2VYVA 5DBIA 5TT0A 3W1VA 3EHEA 4BKOA 3WQQA 4B7XA 2VHWA 2YHIA 4RORA 4HFJA 4KDFA 4XR4A 4YRAA 3INTA 3ROQA 3W4JA 4E3ZA 3ZCXA 4B4VA 4G2NA 1LLCA 2O7SA 3H2ZA 4KTTE 1PS8A 4ZJUA 3FI9A 2WWRA 1UZMA 1EFLA 4MIEA 5CPFA 3RI3A 1E77A 1T4BA 3V8BA 4DLAA 2NNLD 4AJNA 4BKUA 1RPNA 5GY7A 3V2UA 5DBGA 4ALIA 1P1RA 1UXIA 3ICCA 3OMLA 1AUPA 4PGFA 2JCXA 3C7AA 2EW2A 2HMSA 4GX2A 4Z6KA 3PK0A 3GNQA 2FOIA 1DIHA 3AUAA 3G1UA 3QWHA 1XG5A 1XU7A 3GVCA 4TRRA 4LCEA 1U4OA 4YAKA 1NFRA 2AG8A 3S2IA 2JHFA 1EDZA 3DDNA 4Z9XA 3SVTA 1KEWA 4YCAA 5F1KA 3SC4A 4AFNA 3MCVA 1XR3A 1QRRA 4WLVA 3OQ1A 3CMCO 5T67A 4CM8A 4DYDA 3V2GA 4J9UE 1D1TA 1X1EA 3WB9A 3ZU5A 1XDWA 4J16A 3NT2A 4OIMA 2GR9A 1IZ0A 3AU9A 3MWEB 2C2YA 4CR6A 4BO9A 1R12A 4OXNA 3PHIA 3VVBA 4K6FA 3WR5A 3ZW9A 4CMJA 3TNLA 3ZI0A 4RF3A 5EINA 2W2LD 3JQAD 1T2CA 4ILKA 1W6UA 5A02A 4XYGA 1WVGA 3DBRB 4ID9A 3PJDA 3JQDA 4R5MA 4P38A 1C0LA 1Q7BA 4YJDA 4YT5A 5FYDA 1QYDA 1I32A 2TMDA 3TSCA 4Y67A 1LDBA 1KVRA 1EUCA 3I6QA 3OF2A 1LQTA 2B4TO 4GI2A 5DN9A 3RVDA 3K2EA 3H4VA 1HZJA 4DPKA 3ZU2A 2J5QA 4U0JA 3KB6A 3LC7O 1TT5B 1H6AA 1XEAA 5DCWA 4FQ8A 2E82A 4XDYA 3T7CA 4PFJA 1N1GA 1KYQA 2B4RO 4XEHA 4XX0A 4BNJA 3BMOA 2Y99A 1A9ZA 4EEZA 3DHEA 1H6CA 4E33A 3E03A 2HRZA 5GZ6A 4BB5A 3BHIA 3RJ9A 5JFOA 2AG5A 4Z3KA 4GBJA 1F8GA 3PJGA 2JJYA 2HQ1A 4YBZA 2X0NA 2Y05A 1U28A 1UXJA 4NPCA 3ABIA 5DCUA 1PIWA 2HK7A 3WSWA 2FSSA 1M67A 4YT4A 4AJJA 5KVSA 2Y0EA 2YZ7A 4MINA 3UUWA 4XGKA 5C7IO 3VH3A 1HDOA 3FHLA 2BHLA 2WDZA 3ZWNA 4BHTA 1V35A 2X86A 3F1LA 4E5MA 4BNGA 3WICA 3C7CB 5KJFA 2YV1A 3LK7A 1YQDA 2P9CA 1Q7GA 4WPGA 1V3TA 2GD1O 3KV3O 4J6FA 3DBLB 3ZV4A 2X22A 2E6UX 1IB6A 1GR0A 3FR8A 4O1MA 3WS7A 2AQHA 1P0FA 2LDBA 1PWXA 1F14A 4B3JA 1P74A 3GG9A 2AEMA 3VPGA 2AHRA 3AFMA 1UZLA 2C29D 3GG2A 3PHLA 3V1UA 4M54A 1E6WA 3OA2A 3QW2A 3TJRA 2YV2A 5TT1A 3RUDA 2C82A 1NPDA 1BRMA 2Q2WA 3JQGB 4NJMB 1C0PA 4GLLA 4PN3A 2NQTA 4YDRA 2GYYA 1F06A 2WM3A 3C7DB 1HXHA 3CSDA 4WOJA 1T2FA 2GN4A 2NWQA 4YA6A 1JN0A 3S2EA 4RPKA 3B1FA 2IE0A 1WPQA 4R9RA 3X2FA 4YJGA 1PEDA 3I9NA 1K6JA 3ONEA 4IGFA 9LDTA 5KIAA 3ZWVA 1R0KA 4PG6A 4BNZA 1GL3A 2RCYA 3HN2A 2V7PA 4JP2A 3QWAA 5JYEA 3OICA 1WLYA 4H15A 3D5TA 3NKLA 4JP3A 4K6CA 2XF8A 5FFFA 1U2GA 2ZCVA 1PJ3A 1MC5A 1IUKA 1U5CA 2OP1A 2DBZA 1UJMA 1DIGA 1ZNQO 4HFNA 4JGBA 3UXYA 4NJMA 1P1IA 2PNFA 1PGNA 4O0LA 2HJRA 4PLGA 4BNHA 1JVSA 1YB4A 4BKPA 5HS4A 1D1SA 3AY7A 4URFA 5TRTA 1CERA 3K9QO 1HWYA 2IYOA 4C4OA 2QZ9A 3EK2A 1OMOA 2Y0DA 3GEMA 2EXXA 4DQXA 3VHRA 4FW8A 2YHIB 1AGNA 1ADBA 3F5QA 2WE8A 2Y1GA 3PDJA 4IQ0A 1QP8A 2O2SA 3S55A 1ZZEA 3DHNA 4E5YA 3HG7A 5IN4A 1NWHA 3KEOA 4CLEA 3WGZA 1UXGA 3DZJA 4FFRA 2NVBA 2XOXA 1FF9A 4ROSA 5DP1A 2X4GA 4XCVA 4CV2A 1Y8QA 2EG9A 3OJOA 1U7HA 2FR8A 1PL6A 2DLDA 3EMKA 1KOLA 3KOUA 2XXBA 4CJXA 4ZHSA 1YB5A 2O3UA 5JCJD 3H9GA 4E2WA 2Z1MA 3GZNA 3P19A 5IN5A 4CMKA 1P45A 1H93A 2RAFA 1R4MB 3TZCA 1ENPA 1K5HA 2O3TA 4OM8A 5L45A 4XGNA 1EEHA 4EYEA 4L4RA 3PIDA 1H0KA 1P9LA 4IDCA 2ZYDA 2X5KO 4I8XA 5JCJA 2ZK7A 1I2CA 1R0LA 1UP6A 2AMFA 3PFWO 3NEPX 3Q6IA 4B4OA 2PZLA 4WLOA 4B4WA 5IAAA 1P77A 4FC6A 3K92A 3I9MA 3GFGA 4IDAA 3O38A 5B4UA 3CTMA 2AXQA 4NG5A 2P91A 4DTIA 1CEQA 4DIFA 1U8XX 1J6UA 2VYVD 2WMDA 4FJ1A 3PIIA 4N5LA 3EY4A 4BNFA 1DFHA 3UN1A 4QTZA 4XB1A 2CVZA 4A26A 4XRGA 5JLAA 2QHXA 2YHUA 3RUFA 3ZW8A 1SC6A 3BTUA 3HE3A 4EJMA 2VHZA 1QV6A 3B70A 3DBRA 5KJ1A 3GK3A 3GVPA 3JQ6A 1HETA 1ISGA 5B37A 1I3LA 4IJKA 3PWSA 5BNIA 3CKYA 3ROPA 3OIDA 3D3EA 3T4EA 4ND1A 3QVXA 2NV6A 3TOZA 1P1JA 1QLJA 3BZUA 3U49A 1EQ2A 4CQLA 5JE8A 3F46A 1Y81A 1N1EA 3AUSA 4BKRA 3E6AA 3VKVA 2OUIA 3KBOA 4R16A 1DXYA 1KIFA 5ER9A 3VZPA 1BW9B 3U0BA 2Q4BA 4W82A 3OJLA 5AXDA 3GAFA 1L1FA 4NFSA 1B8PA 2GZ3A 3OM9A 4YJFA 2CDBA 2DBVO 1E3SA 3E5RA 4J90A 4RLHA 4B8ZA 4W6ZA 1B7GO 4OSPA 4QUKA 3GOHA 5TGDA 3ZNQA 2ZB7A 3KLMX 1ZK2A 4IXTA 5FI5A 1ZW1A 1EK6A 4G65A 3ZZNA 4NZ9A 3DOOA 1V0JA 4EUFA 3EUWA 4N18A 4MVJM 3EZLA 3OH8A 1ISFA 3E9QA 4RVHA 3AY6A 3OECA 4K1LA 5BSFA 4PRLA 4BV9A 3BYZA 2GERA 5ER6A 3WJAA 3CE6A 1G1AA 4RO0A 1TXGA 3Q1LA 2QG4A 1T1RA 1JDJA 1UUFA 4CM3A 4RPJA 2VZ8A 4NBTA 4UVHA 3L07A 4CMIB 5L95A 4PG5A 3ON5A 3ZDFA 2DC1A 3C1OA 5DOZA 4L73A 1HDRA 5F3RA 2Q99A 1YQXA 1O89A 2YDXA 4OHUA 4WECA 4XIJA 4CV1A 5J23A 5C37A 1B8VA 4BV8A 2JKVA 4XGIA 1O8CA 1XIVA 5L7WA 3LC1O 3EAGA 3S8MA 1ZSNA 1TLTA 4PRKA 4TROA 3LT0A 3TZHA 3I6IA 3IQDB 4ZA2A 2X9VA 3PHHA 2P5UA 5IZCA 1X7DA 2Y1FA 3DOJA 4OOFA 3ZWXA 3MJEA 1GZ3A 4O5OA 4JN6B 3HDJA 1PL7A 1VI2A 2NADA 5I8ZA 4CM6A 1OAAA 2I5PO 3ETGA 1PSDA 2DAPA 2Y68A 1RWBA 3L4BA 4QECA 1X13A 2NQ8A 3LC2O 4OXYA 5KCZA 2ZTLA 1NX6A 1PQPA 3D1LA 2GN6A 3HUDA 5MDHA 2OO5A 6ADHA 5JC8A 4MIOA 1T4DA 3K96A 3FR7A 1H2HA 3RC2A 1JU9A 3NYWA 2ZB8A 2QZZA 4XIYA 3T4XA 2JD1A 1JWAB 1QV7A 3HSKA 1GU7A 1OC2A 1P1HA 2Y0CA 5BSGA 5TSDA 5IDWA 3TPCA 1MXHA 3AM5A 3PZRA 2J6IA 4RZIA 1DRWA 2F1KA 3LQFA 3WBBA 1GADO 2VT2A 4L74A 1E7MA 1U3UA 3GY0A 4MJLA 3DBHA 5ICSA 4RCVA 2VCYA 3K5PA 3A9WA 3F6YA 2ZCUA 1AXEA 1YJ8A 4I5EA 3JYNA 4DC0A 4DC1A 2WYWA 4N54A 4KDEA 1PL8A 1C0IA 1I2BA 3U3XA 4IUYA 2JAPA 1TT7A 2Q4EA 2GN9A 2NU6A 4XYEA 2AW5A 1QYXA 4FOSA 4IY1A 5JNLA 2VHVA 2EGHA 4RPHA 2AQ8A 3CMMA 3EZYA 1KVTA 3R1IA 3JQ7A 4Y6PA 3EVTA 4NFHA 4NU5A 4AJLA 3KUXA 2A35A 3DFUA 1O9BA 4OOEA 1K2WA 1HL3A 2P4HX 1Y8RB 2WEKA 4BO6A 2W2KA 3TRIA 4PLPA 3OJ0A 1I8TA 4Q9NA 1OC4A 5EL0A 1LRJA 3NJ8A 4HWKA 1YGYA 3JD4A 3RUAA 3TZ6A 3O03A 5CDUA 2GCGA 3RKUA 1R0SA 3L9XA 4ND4A 4GMGA 4EW6A 4MP3A 3LF2A 1G0NA 3WIEA 4A73A 1I01A 4P4LA 3JV7A 4FB5A 3OIFA 3ROMA 1GYRA 1YJQA 1E0DA 2C0CA 1OZAA 3H6KA 4C7KA 1K0UA 4F6CA 4GX1A 4DPLA 3LDHA 2G1UA 4CMCA 4CM5A 4S1VA 2X8LA 2QYTA 1RM5A 2J3HA 4L8VA 4WCFC 4ALKA 4UEOA 5CEJA 4J4TA 3MTGA 4XRRA 4CM4A 3D4NA 3ZNPA 4OAQA 1SO8A 2GZ1A 3L77A 3NDRA 4JJFA 4YAEA 1VJ0A 4XZ3A 3ONFA 4OXKA 1GEGA 4BMVA 5L7YA 1E5QA 3RC7A 4FPXA 4R1TA 1NBOA 4YACA 1DEHA 4YJFB 1JVBA 4I5FA 3FTPA 4CMHA 3GRPA 4Y6SA 4J91A 1D7OA 1Z73A 1ENOA 3WLEA 3MOGA 2HO5A 2NU7A 4YTEA 1RJWA 1ZXBA 5COBA 2PTGA 1FDTA 4WJZA 5DNAA 4IZHA 3GN2A 3QVSA 4O59O 1M76A 3RKRA 2Z1NA 3Q9NA 5AXAA 1LJ8A 1WW8A 2C2XA 1UXHA 3FWNA 4IQ8A 5FEUA 4Z9YA 2Q1TA 1LC3A 1XCBA 4CPDA 1MA0A 3HZZA 1DO8A 3M2TA 1NTOA 1CETA 3WFIA 2GSDA 4BQRA 4D3FA 4MO2A 4J9VA 4NNJA 4RVSA 5JY6A 5GZ1A
chains in the Genus database with same CATH superfamily
1H2BA 1X87A 3CXRA 1TIPA 1ENZA 1EWRA 3NGXA 4KAFA 1CHNA 2YN4A 4HAUA 1F38A 2A5FA 4PANA 2WPDA 3RS8A 1NNEA 3BFPA 2GSWA 4KCGA 4ER0A 1ULSA 3Q5EA 4LXTA 1UJ5A 2QY9A 3HP1A 1JKMA 4G5QA 1QRDA 3ZOKA 3OT4A 1L5NA 1QIHA 1Y1PA 4E3WA 2IX9A 2AD5A 4XD7D 2CNWD 3WWCA 5ITZA 4WCDA 1X94A 3D5EA 5E6SB 2PL9A 1T3GA 4HNAA 4PLWA 3V9AA 1C8BA 2BH9A 4AJKA 2OM6A 3NR2A 4TKUB 1XZ8A 1G8SA 1AQJA 3GI1A 4DJAA 4E7PA 5I8WA 3PC6A 5FF9A 2UU9B 3WFJA 4HRVA 5A5FA 3FGPA 2XMQA 1TCUA 1GUDA 1TJNA 4MW7A 3PL1A 2I1QA 4MROA 4MYUA 3THRA 5CTAA 4QBIA 4TQAA 2QN2A 4NVRA 4NJOA 1BE0A 4PX5A 1CQIB 1HEUA 1MC8A 2CJYA 2GS9A 2EZ9A 2B2NA 2WHXA 2ZSJA 5K0ZA 1X1RA 3ACCA 4RLQA 5EQFA 3IP7A 2HA4A 4DSNA 4HEQA 2QLBA 2UVQA 3EIXA 1F3LA 2ZSEA 1T5OA 3KOMA 4IS2A 3WLHA 4CGYA 2JL1A 1CEEA 1W4ZA 3BWYA 1KI1A 5A3QA 3SIWA 1HOXA 1N9GA 3KQYA 1UZUA 1FFSA 3B13B 1ULUA 3IR5A 4TLEA 4W9NC 1HQDA 3FFXA 4FLEA 1EDEA 3RIEA 5BQFA 5IJ9B 2QBYB 5BYKA 1E4EA 1MT3A 2ZJ8A 3R5SA 1UIMA 4XR9A 5KWIA 1AA9A 4D5EA 1TECE 4JXJA 4UDYX 1F0YA 2PSEA 4OP3A 4G23A 4DIMA 3LTNC 4DXHA 2V9CA 4EW2A 4E08A 2C2GA 1T3ZA 3S5UA 1U0HC 2Y66A 2YRFA 2L69A 1Y5NA 3B36A 5J5CA 4US1R 4CF4A 4NXNB 3PUZA 1OI2A 4FHEA 1XA3A 1B00A 1BE6A 4HO1X 5LQJA 5FPQA 2ZRAA 1KOGA 1SXJE 4F5DA 2D2VA 5I48A 4HZGA 3RS0A 1A97A 1FDSA 1YF3A 1SMKA 1XEXA 1GDDA 4MB6A 3GXBA 1NPTO 2H57A 3EQ8A 3DHVA 2TRSB 2Z6AA 1U99A 2VPXA 1U3CA 5CVTA 2CNDA 3ESDA 1VKRA 2ZXFA 3S44A 1ZJWA 5I7WA 3SR4A 3TWOA 1V7ZA 1HZZC 3MRVA 4BBZA 4LWZA 5ERXA 3GHYA 1GG9A 2Q5LA 1RYDA 2G77B 3MAGA 4HGPA 5F5NA 3STHA 3DXYA 3A1SA 4BIMA 1YB2A 3NT5A 4DAEA 1K8QA 3OT1B 4QXMA 3DHYA 3T9CA 2GCNA 4TYWA 2VAMA 2IXAA 3FIUA 8ADHA 2FEKA 4XFDA 4B71A 3L0IB 5KOYA 4PYNA 3OFJA 1GTL1 4DV5B 1CW2B 1Y9JA 2F43B 1Y98A 2ABWA 2GAJA 4X64B 3KCNA 4TN1A 1DAEA 3X1ZA 2OZPA 3ZVRA 4DS3A 1XYYA 3KJEA 3L18A 4JJZA 4DZZA 5J63A 5T64A 1FDVA 2BPOA 5DNYB 4CE6A 1ETHA 3MTBA 5JD3A 2JW5A 2YV3A 3GYGA 5C32A 5JFTA 2PV7A 4TV8B 1FDUA 2O07A 4RGYA 1XV5A 3GJSA 1GUYA 4LAFA 2UYOA 5DNDA 2P2SA 2V4ZA 3W6OA 3ZCTA 4BO5A 3S8YA 4OP2A 3EPHA 3EIFA 1U8FO 4FD2A 1DXOA 2E85A 3S2YA 1LS1A 5BO5A 1SRQA 1Q0SA 4IQ4A 4L27A 3SXJA 1YBAA 4JJ8A 1U02A 2O8NA 1E7SA 2PQMA 2ZSUA 4FYVA 5EQDA 4BN0A 4BCCA 3NNDA 3KOYA 3C45A 1RKXA 1CZNA 2VPYA 3LRTA 5CDYA 3O74A 1Y48E 4MV3A 3IHWA 5ALKA 4RVUA 3HU2A 2C95A 1W52X 2PZFA 4Q7KA 2UVPB 4XAQA 3IT2A 4RLSA 4BTLA 5KNBD 3B3GA 2I6TA 1KK1A 3Q7PA 3DNFA 3I01A 3IR6A 4ZARA 1G41A 1N92A 3HNOA 5CBKA 2EF1A 5HF8A 1U0OC 5JDCC 1F7UA 1CBUA 4UMVA 4RDHA 3TEMA 1GPKA 1PR5A 3MMPA 4I9UA 3CC8A 2XCTB 4RC9A 2BGJA 2ID7A 1YDEA 3PEVA 4WY5A 5EERA 2NPFA 4TRNA 2PLRA 5A1JA 2KQUA 3OE4A 4TKLA 3C1TA 3CF6R 2PWAA 1EUZA 2BV3A 2HL6A 3H9QA 3PQ8A 4Q4CA 4ZZ3A 1I10A 1OXMA 2HPZA 2GJ8A 4JBIA 5A06A 2WUFA 3IPXA 2A0WA 4BCBA 1A4UA 1Q0TA 1CUGA 4UULA 3Q4GA 1FNDA 1GUFA 3HJAA 3WWYA 3C97A 4GZ6A 4LRSB 1QZ3A 1XTSA 3IPLA 2VWPA 4OXRA 1YDMA 4WLFA 5T4FA 3AUJB 4MPDA 4I1YA 1IYZA 2BBOA 4KWEA 4JP8A 3SQMA 5BNTA 4K86A 2GEDA 4GBGA 1QHFA 4C6HA 1G6HA 3U4DA 4WXEA 1GQRA 3QU4A 1Z6TA 4HTAA 4TQ9A 4YJHB 4YMIA 5HZMA 4ND8B 1DP4A 1F9AA 3CCFA 4B35A 2EERA 3IVMA 1XC7A 4HH3C 4HZUA 4LDPA 3QY0A 4ON9A 4P80A 3PQ7A 2AK2A 2DBYA 2I1VB 3TS1A 7MDHA 3RSQA 2BF7A 1FPMA 1GLVA 1XF9A 4M55A 2ZPTX 2HSWA 1B76A 5ALZA 2OWDA 5ES3A 2B1QA 2V45A 1FTWA 4KQKA 4Q3NA 2PBFA 3ETEA 4HS4A 5AUNB 1Q0UA 1V4BA 3DQZA 3PVCA 1C4WA 2X13A 2XZTA 3AQIA 3NDIA 4M8LA 5HBRA 5JSFA 4XQGA 4Z53A 1ZXXA 4QXAA 4R2WA 1GFSA 3THWB 1QTNA 2B6NA 4ZHQA 3W2FA 2CNLA 3MWLA 2XB4A 4G5SA 5HEKA 4HZIA 1CDOA 2F64A 2LKCA 5LMCA 4GDFA 4RSHA 1ODTC 1YBMA 1XZLA 1XTQA 4HKTA 2VC2B 1QS0A 1F51E 4K9NA 2WSSD 4FUTA 4Q3DA 2PM8A 1QYRA 1U8CB 4FKBA 1N0HA 1LPAB 1Z4LA 1UODA 2WJYA 1CQWA 1P7WA 2AR7A 3DTNA 4WXMA 4D4KA 3L7MA 2ZI6A 1BH6A 1AGYA 1UFRA 1EJ2A 3T1VA 3EN0A 3OZIA 1CFZA 1TT5A 1IBSA 3MILA 2RH9B 4NATA 5FBWB 4Z3OA 1LVHA 1DL5A 3PDWA 4KBFA 5BQPA 4MGKR 3RYFB 1QC5B 2VKTA 4ISCA 5I3CA 5ILOA 1WXDA 1KIMA 3VH2A 3IFSA 4IIYA 3DLCA 2DUWA 4U7WA 1YZFA 3ZQ4A 3M5DA 1UH5A 1ZEJA 3L0DA 3NETA 3UF0A 3E15A 4CIDA 3LUBA 5LDDC 3UGJA 1OBFO 3HR8A 3BXFA 3B52X 4INOA 1R8XA 4MDYA 3TKLA 3HXOA 3I3SR 5IVKA 4MKIA 2JJQA 4QO8A 1MVLA 2BL4A 2Z2YA 1UR5A 2GASA 3TK1A 2OXFA 4WXPA 3HH8A 4EECA 5T7BA 3OFKA 3WSTA 4KLCA 1KEVA 3FETA 5FKJA 2JEYA 2XUHA 5C7LO 2WR8A 2F1RA 2ZPUA 4RCZA 4QT0A 5A7GA 1E2DA 4YK7A 2WDPA 3H9BA 3JALB 1E6LA 3SQLA 1K6EA 3QX9A 2HU2A 4D02A 4I8IA 3G8YA 1N32B 2B8JA 5HGJA 5BXYA 3KQKA 4QUDA 1DJPA 1YMQA 1U1GA 2FUKA 2B2XA 2V65A 3B6ZA 3H11A 3OFND 3BWXA 5FLKA 4ARUA 3MLEA 4RHFA 1Q0LA 2C4WA 5SYAA 2NP7A 5EIBC 3HCOA 1MC4A 1E94E 3WAJA 2F3PA 2BN4A 2UYQA 5JJBA 2P2DA 1I0LA 2XUDA 2ZU0C 3KELA 4OHFA 3NBAA 1Q0PA 4QJIA 2PPLA 5F51A 5FBZA 2HCFA 3WQSB 3EUAA 2XMRA 3G85A 4ZT3A 2IUFA 2H4FA 4OHKA 2QTWB 4TLLB 4KZPA 5C4GB 3SJUA 2HWKA 4D0SA 3PC4A 3FDJA 2XZOA 2AR9A 2QRZA 2WLSA 3UUEA 3G17A 3KKLA 2QMEA 3TLJA 3JAWB 4U7PB 1LRKA 3UTCA 2YWEA 3JQ9A 4NK5A 3RGGA 1SR8A 2AYZA 2LWIA 3FJOA 4YHHB 2WYVA 3AB7A 4IHAA 5K0LA 5I4IA 2KPOA 3G0GA 3SBDA 1GNTA 1VHDA 2I4RA 1SKQA 4KYUA 1AKNA 2P6OA 3BE8A 3ANNA 3BJEA 4CDNA 1EUQA 3EDOA 1L0BA 1ZVJA 3V1MA 5ALSA 3KEQA 4O02B 1ISJA 1Q14A 3R6WA 1E2QA 1N0UA 1U6IA 4XDZA 1EESA 4EUSA 3A0UA 1R6BX 3WXBA 4CNBA 3E9NA 4MKRA 5FJJA 3W7VA 3GC6A 3QFTA 2RH8A 4UHKA 1Z7BA 3DUWA 1NBEA 2EFHB 2GHTA 2HU8A 1P0IA 4GNRA 4O63O 1ADGA 2NACA 1L5LA 3AW8A 4Q4HB 1D07A 1FNNA 1EZZA 4IDPA 4PZEA 3BMNA 1OYYA 4MEJA 5BN4A 2NSJA 3JZAA 1ODKA 2JKZA 2XVXA 2D5LA 4KK4A 3I1FA 4EJSA 4ZI7B 2GAIA 3IRVA 5ITWA 3RYFA 4TS9A 3KSAC 4X63A 4YRCA 2LZ0A 1EB9A 2ZCJA 1VLQA 4IP0A 2QXYA 1CDDA 1VZ2A 1GT91 3LHIA 3RHSA 4JBYA 5GM2A 1JEAA 4FSHA 4X3OA 1WZNA 3VJMA 3Q11A 2AOTA 5KVCA 3TPFA 3Q12A 1GV1A 1Z47A 2B3TA 4R5HA 4WW0A 3SP1A 1H9AA 2IQIA 1IL0A 2E55A 3F71A 4N40A 2AE1A 2PVPA 3D8HA 4AYXA 4UTRA 4PG4A 1OFGA 1Y8RA 4ZT5A 4IDBA 1XEFA 3R3JA 4J0CA 3PFKA 2ISSD 3N07A 2VF5X 2PX4A 4PZUA 2PX6A 5AJVB 3RUIA 4D81A 1NQXA 4D0RA 1DLJA 5CPBA 3K16A 1G5RA 3Q9SA 4KMRA 2QL5A 4BQSA 2BFFA 2R7AA 2KM1A 5E3JA 1TQ4A 3CG4A 5EJEA 2YFYA 3RBVA 2OXRA 3W2HA 4PLZA 3O0TA 4CKZA 3UCXA 1DDIA 3BGSA 4QU5A 1I7QB 1RI4A 4G4JA 1KVSA 2H16A 4IS3A 4JEIA 1M6HA 1MAVA 1P61B 1KC3A 4J7AA 4L6AA 5B1DA 4AJ2A 4D44A 2M98A 3BG5A 1Q1NA 2DZDA 1R6UA 3ESQA 4DWJA 4C04A 1O5IA 4WAUA 2Q45A 3DE1X 4GPD1 4K40A 4WBNB 1LBIA 1DKNA 5SZIA 4PNPA 1YULA 3ZXUB 1J22A 4BVBA 2ZIGA 5J58A 2PKYX 3K0HA 4LRYA 1DBIA 2B36A 3ROTA 1CB0A 2D00A 1QVAA 2VQSA 1KWKA 1A1SA 4RA9B 5F1PA 1ZXLA 1ADJA 1VFNA 5LFAA 2I76A 4JA2A 3IGFA 5CRIA 4A23A 1Y6ZA 5C53B 2NO6A 4U7HA 1A2QA 4B4DA 3KPYA 3W5CA 1O96A 4N4AA 1KK0A 1GTZA 2COEA 3GFVA 2Z5FA 1EFTA 4Y2TA 5D01A 4BMNA 4BWGA 4O1HA 3AETB 2VYFA 2H3EA 1XCLA 4V3BA 4BX2A 2XI4A 1CK4A 1AQNA 1PEYA 2WM8A 4MUFA 2VEDA 4C7OB 2QR3A 3FVRA 2FJUA 4GU5A 5F7XA 4I4LA 3SX2A 2P68A 2YOFA 1YL7A 4K46A 4EI8A 3LXMA 1ZOSA 1IRXA 2X3UA 3CT4A 2DM6A 1XPRA 3VBEA 1RD4A 4FMPA 3SBOA 3ABRB 1GAXA 2VBFA 3T7DA 4IEIA 3QSYA 5JNTA 1VSTA 2B8EA 2C2WA 2F90A 3M1YA 2X0FA 1PGPA 1D1PA 1J8MF 5B6PA 4HDRA 4P2GA 5C35A 1UPUA 1XZJA 1JQEA 4NJEB 1T1EA 3DV0A 1NNSA 3D2LA 3LA6A 1GRVA 1OYVA 4J75A 3DAGA 4R0VA 3A05A 4EUKA 4O0MA 1JFTA 4XTCS 1J56A 3LP6A 4DIBA 3SU8A 2GXAA 3OC0A 5CT8A 3ZN2A 4KFCA 3DQPA 3EFHA 1TYBE 4JNKA 2O4CA 4TUYA 3NCHA 4UNNA 4MV9A 1NAHA 2KHZA 1TAUA 5LPNA 2V3CC 2ZJ1A 4I3HA 3WNVA 4JZYA 5DT9A 1OUMA 3JARA 2V7GA 3RF7A 1FTNA 2WQ7A 4L8GA 4DR6B 2YZKA 3T61A 3HBAA 3L1UA 1WUKS 3W3AD 4JLAA 2HJ9A 4J0DA 4TWRA 1AHPA 2FSFA 1CRLA 3T7RA 2F9MA 1I4EB 1O87A 4CXMA 2IXTA 1PP4A 3OO1A 1IEQA 2XAAA 2X0KA 1GG8A 2VP2A 3CINA 3FMPB 3P5SA 4LI0A 4MZDA 3QFSA 4RL6A 5A3VA 3FUXA 3NATA 3WWZA 4EF5A 1SVOA 1GGNA 4F97A 5L3QB 2W2KB 3UJCA 4ZCSA 1UWLA 1S2DA 4NIMA 3MJTA 4S0ZA 3RT1A 4B9AA 3I6YA 4RMIA 3DAFA 4CRWB 2NVOA 4AD8A 3OPQA 5G41A 2O7VA 2A86A 4J49A 3UWKA 1FSZA 4I5IA 5JO0A 3PD7A 4J3JA 4KYVA 3QE2A 4W5NA 2XQVA 4JVNA 1M1ZA 2A5YB 1HT1E 5FR2A 2C7RA 5DNUA 2WJGA 2AGVA 2Z43A 3OJFA 2LV8A 1RRMA 4MQEB 1FX0A 4J8PA 2IUEA 5CK4A 3LOPA 1R10A 3GD7A 5D3ZA 1PT5A 1E2JA 1O6ZA 2B25A 4FOLA 1BO6A 4FX5A 1R0WA 5CYPA 4NI5A 3N74A 4QPNA 5CFNA 4EO9A 1P19A 3PF8A 3F97A 1PTKA 1BROA 4P81A 3K70B 4Q34A 5CM9C 1ORTA 4PLTA 4QJ3A 4Y2YA 5JTUA 3KJGA 3NWOA 4CKCA 1MTOA 3MK31 2G9RA 4HFMA 4IVNA 4WZAA 3VQTA 5JBQA 4LMRA 3CX4A 4DZRA 3DCYA 3D4OA 1C3VA 2VYQA 4O3MA 3OBBA 3WGVA 4BO3A 5D8DA 3C3AA 3DTVB 1AG9A 4UAVA 5LXTB 5I7SA 3X1DA 3HB1A 2FF7A 1BZYA 2VRCD 2ZJ6A 3MWDA 1Q2UA 2G0NA 4EIWA 1ZESA 3ZWYA 3J7AC 4EHHA 2QDKA 4RVFA 3FDZA 1T5TA 4DWWA 1GG2A 5B30A 3GJ0A 1YZNA 1FMJA 1BXRB 1D6MA 3DFFA 4KE6A 4KDRA 5AKYA 3RUHA 2NVUA 3U4CA 5AK3A 4CUZA 2OXEA 3NH9A 3OCXA 3UBTA 1KE2A 4TYPA 1B93A 1NVVR 1SHZA 3ZV3A 3AHIA 2WYUA 3TI7A 2P2ZA 3EMDA 3PNMA 4INJA 5D6NA 1QJCA 2YY7A 5H83A 2XRZA 3EDMA 3WK7A 3HU3A 3KT8A 4LFCB 3IAS1 1LPNA 1YE8A 2HDOA 2Y1XA 4G36A 4HDSA 4RJLA 1GFIA 1R5BA 4CMAA 1E6UA 2WJWA 3ZDBA 3AL0C 1U3VA 1FP7A 2IZ5A 2ZDQA 5JCZA 2C9MA 3M9LA 1OTHA 1K6IA 1IN4A 1KFKB 5JHGB 2CCGA 3TFQA 1C50A 4CLHA 4NRDA 3SHFA 5BV8A 1L5VA 4QJ5A 2ILTA 4ZO9A 4B75A 2HWWA 3CPSA 1DAKA 5HWSA 2QQ5A 2HC9A 3AJ9A 2FR1A 2JKYA 3K6SB 1O54A 3DR3A 2E4WA 3F8TA 3IXMA 3TFOA 3NMUF 3NXKA 1KZ9A 1Y3AA 2B4KA 3BB3A 3NX4A 4GLOA 1ORDA 1MZVA 5KHAA 4WBNF 2PD3A 3FZYA 4KQ2A 3DL2A 5IJ9A 3CJTA 3KQUA 1GZUA 1Q21A 2DHQA 2O2YA 1B1AA 3NB0A 3IOYA 4X44A 5DXFA 5IP5A 4A0SA 5DH9A 4LWOA 1HFWA 4DQ0A 4ND3A 4YR9A 2G7ZA 4X7RA 1NXVA 1R4NB 3IAM6 3RJTA 3KPUA 1VCMA 2J9ZB 5ELMA 5HQTA 5L4LA 4B6SA 3IILA 2PLNA 5KTRA 3KZKA 1CUDA 2XE8A 1WCV1 4TRJA 1E6KA 1TMGE 2I1WA 2OO7A 3LUJA 1XTPA 4FXOA 2VP3A 2E6KA 2E4XA 2O8EA 1U5BA 5BW5A 3A9TA 3IO5A 3U9LA 5LZ5A 2I99A 3M4ZA 4FOPA 2IHVA 4OAOA 2YXLA 4WEOA 2ZE6A 2X5JO 5BPHA 3NVAA 3FMIA 2PUVA 1FE8A 2FEPA 4FEGA 1QO9A 4HI0E 3F5DA 4CQMA 5K51A 3PE6A 1M0SA 1BFUA 2GLXA 4FSXA 4M99A 5F98A 5A1TA 4Q1EA 2C00A 2FPPA 1WB6A 3KKEA 3ZV6A 1ILEA 4HXYA 1B14A 2HQRA 2BEUA 1RBMA 4Y2RA 2CBZA 2PEZA 5B7QA 2XNHA 1HUQA 3C3XA 5CXXA 4ZO8A 2G67A 3SZGA 3UOGA 5FAKA 4HJXA 1Z88A 3PVZA 3MPUA 2AEJA 3B3FA 3MCZA 2PUHA 3VGJA 1Y6RA 3TF5A 1JDBB 2ONCA 2GZDA 2XBUA 4ZXFA 1Z0ZA 4MVJP 4B79A 2Z6UA 4BRUA 4PCVA 5J4YA 1DUIA 1YB1A 1DG9A 4IVPA 4CL3A 4KXLA 1XTBA 2I9PA 4K6MA 4W7IA 2HMWA 3AETA 3GA7A 4M60A 3OPVA 2R8XA 3VYUB 4BBJA 4LKRA 5FHRA 4FYKA 1B6TA 4BFXA 2CNKA 2G9UA 2G76A 3NRBA 4MS3B 4YUXA 4R8MA 4OATA 1RTTA 4ZO4A 1S8FA 1ZM4A 2Q7DA 4DRYA 1KFBB 1K1EA 2N1BA 2X9NA 4QOIA 4BWVA 3E1GA 3AI7A 2BRUC 4G85A 3W8NA 4EB8A 5HIKA 1X8LA 3MEQA 3SYKA 3WJ2A 3G8DA 1NJ1A 4WKOA 4M9XA 2RG1A 4JI8B 1OXSC 3JYLA 4RK5A 1RLIA 5C80A 3QLUC 4K05A 1IONA 1E32A 1LSSA 1OAOA 2EG5A 5E38A 3A6JA 3ANSA 2J7KA 1KJQA 2OFXA 3FNRA 1JAZA 3L7IA 4KQ9A 5LBTA 5KMGA 2UVPA 3NOVA 2Z9BA 1Y1TA 4ADSG 4NMLA 4IHJA 1KEPA 3DDWA 3IE2A 1HE5A 1RKQA 2F1JA 1IJKA 2DBRA 1YIDA 1ODIA 2YW9A 2ZJOA 3CNLA 3O1IC 4LZAA 3BMQA 4GT1A 4MV6A 1KI6B 4F85A 4JCCA 1AQIA 2BMFA 3OZFA 3P2EA 1M6WA 4WK0B 1S9DA 9LDBA 5A9SB 2ZXEA 3H9JA 3LV8A 3GGSA 1W5AA 2C61A 1NFFA 1WPXA 1M54A 5K8IA 2PGOA 2X2PA 3FJYA 4QWWA 4S24A 5EWMB 5B64A 1Q16A 3PP8A 1K8YB 3OWOA 3K0FB 4TSFD 3DPIA 3TJMA 4PPQA 3TLYA 4BLSA 1WE2A 5FWYA 2PGDA 1KHHA 3DOFA 4JFRA 2BJHA 4RCYA 1SC3A 1KOJA 3DL7A 4OHXA 1A8QA 3CLUD 3Q8WA 3MJ4A 4S3MA 4NQRA 3THXB 5F4ZA 1WS6A 4DW8A 3Q7QA 4FFSA 2ZRPA 3KZXA 2C2OA 5J4LA 1PFKA 1VHQA 4WI1A 2BGMA 1E8DA 1GGFA 1R50A 1XCOA 1DZ3A 2H1HA 2JAOA 4MR8B 4V0SA 3IUPA 5ED0A 1BW9A 3LAWA 2VL7A 4BO7A 2M6LA 5JQGF 2HCJB 1KPHA 4Y8VA 3ZEAA 8GPBA 5DGDA 1CJBA 1JDNA 2R62A 5CCDA 1IN6A 1J5XA 2GRAA 2PGNA 3HJUA 3KQTA 4U7GA 2HV8A 5T3YA 3DZBA 3V6LA 5AUPB 1DRKA 2ACVA 2I2CA 1MGPA 2YWFA 4RQTA 5AVUA 2PMCA 3MJFA 2X0RA 5DSZA 4MXDA 1JR4A 1MR3F 4NBRA 4YRGA 3VR2A 1X14A 4OQFA 4C4XA 3T9FA 1QK3A 4FR2A 5H1YA 4A82A 2CV2A 4L5IA 2V7XA 2KYRA 2WTXA 1E5XA 1E7WA 2Y92A 2ZRIA 5J59A 5K9ZA 1CC1S 1W73A 2ISCA 1FUKA 3NHAA 1UJCA 1WLSA 2H9YA 1G63A 1YRQA 3EIUA 3LXUX 2RE8A 4C0QC 1KDRA 3NP7A 5JVDF 5DM60 4C07A 4U5QA 4PG8A 2DQ4A 2XQKA 3ZDQA 3W5HA 2CY0A 5LMUB 5LZ9A 1IPFA 2FTKE 2PRIA 4FK8A 3HEMA 5SICE 3UWSA 5EJ4A 1TA4A 1NVKA 1W0KD 3A8TA 3NASA 4NAHA 1T0PA 4IM7A 4TL7A 4KBGA 4UU1A 2ZBEA 5B6IA 1RBZA 2WWGA 1IEWA 4REQA 4KODA 1TA9A 4P3OA 1MIOB 4QYIB 2JLXA 2HMVA 3VMFA 1R9JA 4TMXA 5BNZA 3IQGX 3LUHA 5JCPA 1EK0A 2EHJA 1T8PA 1JG3A 4KU4A 5FEMA 5T5QA 3A2KA 1FUYB 3TCNA 4V0OA 5T6MA 3Q8LA 4KBYA 1PGJA 4HDQB 5AIBA 2IYQA 3WNBA 4H0NA 4KRFA 3QWFA 2W8BA 4TYMA 4YP5A 2GWRA 1RADA 4XQ9A 3A1TA 3OFSA 3MFYA 1GGHA 1G20E 3H5OA 1VPDA 1ZLYA 2BIFA 3LQRA 3SHOA 1W0KA 3HEAA 3JQCA 2H1VA 3Q5DA 4ZVPA 1VYTA 4B4KA 2WB2A 1D8AA 1V11B 2CUZA 3K4HA 1KKLA 2W2XA 4F0JA 1U1IA 4NENB 2P2NA 4RVNA 2NXEA 1Z18A 1KDZA 1FYXA 1DVRA 5FTLA 4I55F 3U9SA 2ATXA 5MFZA 1WVIA 3OI7A 1SCDA 3OMXA 3OZEA 3S1AB 2FE1A 3JX9A 2WG0A 1IPHA 3R6DA 5TS2A 4M86A 3V4LA 4D8VA 5LP6B 4OJYA 3FMOB 5HM6A 2OG2A 3FXAA 4GE0A 2XZDA 5ELLA 4DMLA 3ND8A 4PYIA 3GH3A 3KU1A 1DLIA 2XOKA 2FMFA 2IIBA 3L0CA 4I99A 2PYIA 4I55A 1K7YA 4IR7A 4NE9A 4UM9D 5AJXA 4PSUA 3K5WA 5BUSA 1BYUA 1JUDA 4C88A 2CLSA 1GWNA 2C98A 3EDRA 1YXMA 4FMBB 5CP8A 5C8YF 2IX3A 1L7XA 2G1AA 2QVXX 1BFKA 1FU8A 2XYQA 1P2VA 2PKRA 2YV4A 5CJPA 5BV1A 1J0EA 4S1OA 5JAZA 5JZMA 3E5MA 1SHLA 2LE0A 1CYDA 5CAEB 3PPXA 4LGVA 4PPGA 4E51A 3COVA 4QBGB 1N78A 4IRMA 3HXTA 4F12A 1MV8A 3L4EA 1GEEA 3RVRA 4ZK2A 1T6YA 2XZPA 3VTZA 1YKGA 4MWOA 2BFNA 1H8ED 1KBZA 1P9NA 2Y1EA 3ANYB 4IFTA 3ASZA 2OOKA 1R8QA 2B0JA 1PX0A 2W2NA 3L4SO 1LDNA 4LSGA 4R3WA 5EKXA 2D1YA 1WB9A 4UE3S 1WM1A 1YZYA 4RXMA 1NDUA 1WXIA 3MD0A 4NP6A 3ADDA 1OGJA 4XIIA 3DE3X 4KAJA 2ZIVB 4A5OA 1PGQA 1DQNA 2WUGA 4NX2A 1E9SA 4EX6A 4D9NA 4L2IB 4DG5A 3AVUA 3K2QA 4MVJI 1O97D 3HL4A 4NBWA 3PFBA 4JOCA 1BN7A 4YR7A 3NBFA 2AE2A 3EQ9A 3K8ZA 5GGYA 3HVUA 1OX5A 1SOMA 4P3NA 9MHTA 4MHTA 4DA6A 1JHAA 3C43A 4YAIA 2C1EA 3UJ7A 1P3DA 1KORA 5EZYB 1ULAA 1RXVA 4NBSA 1WP9A 3EGXB 3FB4A 2VG8A 5DK6A 3RJMA 2ZLBA 4E0BA 1LDMA 1PJ4A 2BGLA 3T99A 1VRWA 1CRPA 1BSVA 1E5LA 4EJSB 1ORIA 3ZWBA 1MQ8B 2JASA 2H0RA 2I6SA 4GMKA 5DX0A 1IC6A 5KQGA 2I6XA 2R4TA 3LQ2A 2XZLA 3GP5A 4Q9LA 4Q4HA 5CUQA 3T34A 5C3MA 5BWBA 2EFGA 1WUTA 4QREA 1M5RA 4K28A 4P83A 2AJTA 1U31A 5ISMA 4MS3A 3ZZUA 3LKBA 2D2EA 3L0PA 1SB9A 3D3WB 1QH8B 3P2IA 4Q9DA 5C1PA 1L5QA 1P5JA 4DJJA 4PYQA 4RFSA 5DTRA 5BP7A 5IT9A 2G4VA 3KR2A 3I6BA 2I80A 1U2ZA 5JEDA 3PRJA 3V4VB 4E70A 3Q87B 1BKDR 3N8KA 2GHRA 4GW3A 2P3OA 3I5MA 4DG8A 4HK4A 1Z2CA 4N8EA 1YR9A 2NYVA 4W5WA 1LSOA 2JH9A 1T9GR 4DJEC 1NOKA 3IEKA 2I87A 4H1UA 2EATA 1C5KA 2ICAA 1OIVA 2N42A 1T1JA 1FFHA 3DV9A 4ENUA 16PKA 1I7LA 4QG3A 3P4UA 3A4NA 2GQ0A 2PSSA 8LDHA 3UFBA 3AFIA 3KDPA 4CMBA 4NDZA 2I2WA 3IE1A 1JG4A 1Q0HA 1Z5PA 1GXSB 2VDWA 3KJQA 2R00A 5JMWA 3N0WA 2EW8A 5A4FS 2JVKA 4XYLA 3V4PB 3DUFB 2C3OA 1EFCA 1YCGA 1L6IA 1RKVA 1SOWA 3KSZO 4NH4A 3H86A 2QAIA 1VL8A 3BE6A 5T4BA 3NBQA 3EGEA 1XHLA 3DNPA 3EXHA 3GCGA 4MW6A 4RKEA 5DULA 2BLLA 3AMVA 2F3UA 4ALJA 5CA1A 1BGWA 3E5HA 4AN4A 2QP4A 1XKQA 2WFLB 2WYIA 2YQ5A 3COZA 2DUNA 3PWZA 1GZVA 4JYPA 3A1CA 4ANFA 5DHTA 3QKRA 3LO5A 4FDAA 1GUAA 3JARB 4FHZA 4HPWA 3OZ7A 5GP1A 4WOBA 1M75A 2GH1A 2IY8A 2IYAA 4V0KA 4XJTA 5FDFA 1VCHA 1OXKB 2ZTVA 1OXUA 1PG5A 2LTAA 4KFUA 1B15A 5J2UF 2Q5CA 3CF2A 3ZWPA 3X44A 1V7QA 5TPZD 4FVTA 2CL6X 3DUFA 5AW9A 1TCCA 1M2VA 4RF2A 5CH3A 2QYHA 5EZQA 5F5LA 3SDBA 1K7EB 1MTZA 4FBMA 3HQ4O 4JLJA 3USES 5MGNA 4RHEA 1WXGA 1WMDA 2O2IA 4B6JA 1IZ9A 1ZNYA 4PGAA 1U0SY 5ENVA 3DBLA 4IIUA 4J43A 1SY7A 1AF4A 3K4QA 4N12A 3RYCB 5I45A 5FPKA 3EF3A 3L49A 5DK4A 2V0NA 5LD2C 2X8JA 2RHMA 5D5PA 3IT3A 3R5TA 4I3GA 2GVZC 3TB4A 2W6PA 4F4IA 1OWPA 2FHSA 3LP8A 3IH5A 1Y6QA 3CRVA 2ZITA 3PNKA 4TUYB 3WDMA 4EY5A 3GRCA 4XWWA 2Q2VA 3DVRX 4H6WA 1SOAA 3LPAA 3O4GA 1CY7A 4G37A 1QH1A 1D9ZA 3OIGA 3KDAA 1DC7A 5J1TB 4ES6A 1E1YA 1J2EA 2PA0A 3EBLA 3JQGA 2PX8A 2IYEA 2F55A 2WIDA 2NZ8A 4FGWA 4CU2A 2B1JA 1OLXB 3PLNA 5DBOA 5KC9A 1M0WA 3A28A 2ZAYA 3ADKA 4OUDA 2WAMA 5LKAA 3HZRA 2VJDA 4GM4A 1Z15A 3KQPA 3U6BA 1SQFA 4YCDA 4Y2UA 3R7WB 1Y1KE 5DISB 4BOYA 2ZETA 5AOAA 3J80A 1D3AA 2GESA 4RH1A 3GEPA 5BSMA 1ZIDA 2R1TB 4AKHA 2QS9A 1PYOA 2BHTA 2L18A 2WZBA 3IYLW 4AURA 2Z2XA 2DFLA 3NV9A 2A9RA 4M0LA 1TM1E 4TV9F 4ENTA 4PFSA 4R7TA 2RSLA 3DBIA 2HHAA 3BL5A 4FFVA 4UNQA 3ZWOA 3AVOA 2CXRA 4WFQA 5B1YA 1AA6A 1UBSB 3I3OA 1KRHA 3EF0A 1H85A 4L50A 5EPOA 2PKCA 3ICPA 1XBTA 1L4LA 2G5TA 1YR7A 4TS3A 3ORYA 4W7SA 4F4JA 1F48A 1MXFA 3DE5X 2OR3A 1KJIA 3OQIA 3VSBA 3EPKA 4E2FA 1ZWLA 5BY2A 3ESYA 1R1DA 2EJCA 3MZ0A 4RJKA 3V7WA 3SF0A 1OBOA 3MGCA 3JVUA 1KBOA 2P6UA 4QIHA 3W1EA 3P0FA 4EG5A 5JYDA 2CZQA 4Q1BA 2WU1A 1V6SA 4M1QA 4UVDA 3UOWA 1YR3A 1R8SA 3VVCA 3A14A 4CFSA 5BVGB 1HYBA 5BWCA 4JNCA 1H05A 4IFIA 5C31A 3P26A 1T6BY 2WWTA 3FMFA 3GFRA 3L7JA 3PPYA 4BQPA 2X1LA 1TZ2A 3C8DA 3MMXA 4BN5A 1JJIA 4V0MA 8ABPA 1R4MA 1Z3CA 5GMOA 2C04A 3AWDA 2IS1A 3KXDA 3ANLA 3GLUA 1S3IA 4K6GA 1RLOA 3H19A 4JQCA 4N9QA 1O5TA 1QGYA 2SBTA 4MP6A 1IN7A 2A6PA 1OD6A 2QNBA 1YGPA 3IDAA 2W4QA 4MOWA 4CQMB 3L6DA 5L53A 3UIEA 5SZHB 1VE3A 4UE2A 2JS7A 3CNNA 4KXYA 4OYLA 3IP3A 2Z8YM 1U3GA 3N5KA 5HMLA 1FTQA 1IDOA 1U3TA 2G72A 4ARAA 4D80A 4R51A 3IX7A 4YV0A 3OUTA 1ADFA 1PK7A 2NTEA 4X1OA 4BX3A 1Y5RA 3ACBA 2JK1A 3DL4A 5K5EA 5KQMA 4RVGA 3MRXA 4TPKA 4CR7A 2FK8A 4NZOA 2Q3EA 4BLRA 5DZSA 5EP4A 3E8MA 3HYCA 4G5GA 4KEAA 3NGLA 2CGEA 3T54A 4R2JA 4MVJG 1EFAA 1T43A 1TM2A 2ZI3A 3EXEB 5BV2P 1Q2XA 1QHYA 1NRWA 1CNEA 1SG0A 4LXHA 3LVFO 3TLEA 4AB1A 3NYRA 1WUHS 4Q3CA 2NAPA 3O47A 1FXWF 4UTXA 1QQAA 1KK3A 3BWMA 5SZJA 3CEMA 3VPXA 2IS2A 2ECKA 4PFQA 5H02A 3O95A 4CZ2A 3CONA 1JFSA 4B8WA 1I7DA 4IINA 2J5XA 3I2KA 3PCRB 5BW4A 3A2MA 4YS6A 1MJGM 4IV8A 4LX8A 2VQFB 2XOKD 4UUOA 1K5DA 1BXGA 1FZQA 1YCDA 3EVGA 4O29A 3QV1A 4UUAA 5CCXA 2PSJA 5FO0A 2V7QD 2GDJA 1NHGA 4WBSA 2NQ2C 4IGEA 5EVJA 3OZRA 1PFGA 1Z4NA 2DUUA 3ITKA 4GGPA 2C3UA 4TYQA 1W59A 4XQCA 1TB4A 1O6BA 2TS1A 3VSEA 3ENNA 4YJ3A 1JXAA 1PFVA 4IHQA 1CUJA 1A50B 1DKPA 1SXHA 4GKVA 4OHZA 1JKXA 4ARSA 1GKYA 5DBHX 2W0MA 3SYNA 4ZMSA 3AVTA 3FTCA 2FR8C 1ZCFA 3SSOA 2Z8ZA 3GLQA 5P8WA 5A0VA 4RMNA 2YVLA 5HOEA 3KSBC 2GZSA 5IDXA 4JDUA 1MOSA 1OA0A 5A4MS 3NOQA 2B61A 3BUSA 4K2HA 1TTHA 2JHPA 4I4TF 1XSEA 2CLFB 3K2IA 3NHWA 3QWBA 1Z29A 4PICA 4RIFA 1VE1A 2F8SA 4YUVA 5KNDD 1ZISA 4KWCA 2DKNA 4Q39A 2E48A 2I4TA 2PL3A 4UC0A 5T8KC 3L82B 5JANA 5DTQA 1RYZA 2X0EA 2W6JD 3L6UA 1EFPB 3ZCVA 2IDKA 1N33B 3VKGA 5L6LB 3WQBA 1JG7A 1G8AA 3EVDA 5HE8A 3JD0A 5IM4A 2FLVA 4IIJF 1RXEA 1Y7PA 3OX1A 3TLGA 1Y7HA 1Z5UA 2EJVA 2VK8A 3RSGA 3A4MA 3K53A 1MEOA 2B34A 1ZIOA 4L02A 5LA6B 1FW6A 1NRXA 3HJCA 5KPJA 2VATA 2XMDA 2CK3A 2V8BA 3A1DA 1GUBA 1TAGA 2IELA 1AUXA 3JRXA 4OJNA 2HFJA 1QQTA 4OKSA 5TJHA 3OURA 4GF5A 1VC2A 2QL9A 4W1PA 1KMQA 4FFNA 2ZBGA 4WV3A 5C7YA 1ZD3A 3OTQA 1PSWA 3DEFA 2VRWA 2DP4E 4NZZA 3WB1A 1NMEA 3OQJA 3WIVA 4BWFB 2IDJA 2GXUA 1G1MA 2CFIA 1ML3A 2VTVA 4NCKA 2G88A 5CNMA 5TPZA 2PS0A 4AECA 1HO3A 1OW3B 1U7DA 4M7WA 3EB9A 5LYJF 3UKJA 4M1EA 2C4TA 1GTG1 4D4MA 4GAEA 1DSSG 1PN3A 1HNNA 4TM8A 2VYND 3TCXB 5TNXA 1JU4A 3HHPA 3TN7A 4B1FA 1WZIA 1A7JA 4MMXB 3GVHA 4I5DA 1E60A 1UDAA 5ILGA 5KOJA 5IJ0B 5DIZA 4Q9AA 2GARA 1K98A 2MSCB 2PZJA 4YGXB 4RAQA 5D1HA 1S6YA 1CJKC 2CXXA 4ZVKA 2ZROA 3OQPA 3H6GA 1VMDA 3RUEA 3W34A 4X90A 1TI7A 2IHZA 2RHRA 1D2NA 3H2HA 1I5OA 1IUNA 1UM9A 1IJBA 2FN8A 3QLUA 3IKJA 1J1ZA 3TW8A 4NL4H 4LGYA 4YQYA 2ZIFA 1E4OA 2AA3A 1N1MA 2PMBA 5TX7A 4YLYA 4OFXA 5AWFC 3ZVMA 1DJQA 3OVMA 3Q98A 2PMWB 5JS1A 3RSZA 1SVLA 4MCAA 5CXSA 3G88A 1L8XA 4IUCS 5FOTA 4IDDA 3AOEC 4QUGA 3TL6A 3KYCB 3AEUA 4YRKA 1N2JA 4OBEA 3VZRA 2GBLC 3HB4X 4KIWA 2NM0A 4EFMA 3EJWA 4HQ0A 2EKQA 1I1NA 3X2SA 4HGZA 1ZRSA 4Q15A 1QHIA 3A6HA 2Q5HA 4RK0A 3DZCA 2VN8A 3BRWD 1PEAA 3F96A 2NIPA 1LTHR 1IPEA 2AFRA 3HDHA 5F12A 1UEXC 4H7EA 4GP7A 3SIRA 1MRSA 3IVGA 5DNVA 1Z63A 3QBDA 1R4ZA 3LH5A 1ULBA<