2X0UA

Structure of the p53 core domain mutant y220c bound to a 2-amino substituted benzothiazole scaffold
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Toward the Rational Design of P53-Stabilizing Drugs: Probing the Surface of the Oncogenic Y220C Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x0uA00
1T4WA 5LGYA 3KZ8A 3WTSA 3VD0A 3WTUA 2BIOA 2BIMA 1YCSA 2BINA 3QYNA 4AGMA 4AGNA 3EXLA 3D05A 2XWCA 2X0WA 3ZMEA 2VUKA 2BIPA 4LOEA 1GZHA 2J21A 1KZYA 4G82A 2H1LM 4IBYA 4L0YA 2PCXA 2IOMA 3D06A 4G83A 2X0UA 5KBDA 3Q06A 4IBSA 2OCJA 3D07A 4LOFA 2P52A 4AGOA 2WGXA 3IGKA 3IGLA 4LO9A 4IJTA 1EAQA 4MZRA 5G4MA 3US1A 4GUQA 2J1WA 3WTVA 4IBWA 4AGQA 2FEJA 2XWRA 3VD2A 4L18A 3VD1A 3D09A 1EAOA 1EANA 5A7BA 3Q01A 2ADYA 2X0VA 2MEJB 1H9DA 4IBUA 4IBQA 3KMDA 3WTTA 3QYMA 3Q05A 3US0A 4IBVA 5LAPA 3D08A 2IOOA 3D0AA 2IOIA 1HJCA 1LJMA 5ABAA 5AOMA 5G4NA 2YBGA 1TUPA 2BIQA 5AOJA 4HJEA 2GEQA 4A63A 1UOLA 3TS8A 4KVPA 4GUOA 5AB9A 1CO1A 3WU1A 3WTYA 1HJBC 5AOIA 4QO1B 2J1XA 4XR8C 1TSRA 5AOKA 5AOLA 4L0ZA 3WTWA 4MZIA 4AGPA 1E50A 2J6WA 2AC0A 1CMOA 5G4OA 2J1YA 2ATAA 2J1ZA 4AGLA 1IO4C 2AHIA 2RMNA 3EXJA 5BUAA 4IBZA 3WTXA 1HU8A 2J20A 1GZHC 4IBTA 5ECGA
chains in the Genus database with same CATH superfamily
4HWZB 1IC1A 1GGCH 3GSNB 2NLJA 2IAMB 2WK2A 5JHMA 4PJFA 1G94A 4KKNA 1G1OA 2VDQL 2ZYSA 3AG4B 5DYOB 3CVIL 1OTSD 4QHNB 3STLA 3WNKA 1AG6A 2ZKXA 2HTKC 2R59A 3OJDA 2XKNA 1MQKL 1ET7A 3F7YA 4ZK8A 3K4DA 1V8HA 4BH8A 2DIAA 1H6FA 4R7DB 1QATA 1QFWI 4TULH 4XGZA 4HIIA 2VAAB 3MBXH 1AI1H 1IV8A 4MS8C 4UDUA 3FU7A 1EBAA 5TK2A 2HLFC 2WLHA 2XZCH 4UQ2B 4XI5C 35C8H 3C09B 1FO0A 4RIRA 2RIKA 4UOZA 5HYJD 1K85A 4BDVB 2FT6A 3US1A 3A67L 3OMZA 3QC6X 3QDME 1DQLL 4G1MB 4XNBA 4ZYKB 3MYZA 5B22A 3JTTB 5IB2B 2AITA 4OLVH 4XAKE 5IIEB 3B5GA 4Q6IC 5JTWA 2ZWLT 4FMVA 4TNGA 1DVFB 3EFFA 3HJ0A 3DMMA 2G9HA 1A1MB 1M7IA 3OKOB 2OSXA 1PGRB 2XWBB 5FA3B 4WHCA 3P2DA 2VR9A 1SHMA 1IC4H 4ZO6A 3PGFL 4PLNC 2HFGH 3Q48A 2O61A 5TH2B 4XNQA 3KCPA 4F8OA 4JFDE 4FKHA 3E6HA 1J0HA 1OY3B 3VB8A 4S0HA 3QORC 2I85A 3NTCH 5AW8B 2CNYA 2VDNB 3LQMA 1R3IL 2Q3AA 2Y36H 4G80B 3BO8A 1I8MB 5EU7E 1D9KA 1SXNA 2C3HA 1PPIA 3A5VA 1X4YA 4OLWL 4O02B 3NJMA 4KKBD 2RCSL 3PYCA 5EU6A 3NSJA 4D8PA 4F37F 4NN6B 2FGWL 4QWWD 1MXGA 5KVEE 5C0EB 1CT8A 2PPFA 3B8SA 1F3DJ 3FCTB 1V10A 3EYOA 5DI8B 2X9YA 5C71A 3HE6C 4PB9H 2A6DA 3MJ7B 2AHIA 3EXJA 4P2RA 5F88B 2ZSWA 1ZGLP 4NPYB 1R0AL 4HUUB 3BYTA 2VLRD 4R7LA 2APVA 4JAMA 4OGQC 3L5XH 4QD2E 4TTGA 1L6XA 1UA3A 4PRIE 4TSCH 2XRAL 3ZKMD 1BMZA 2XWJA 3W9EA 4B9PA 4MMYA 5DF0A 4HEPG 1DVSA 2ZX8A 3VXOB 4HU8A 1JF1B 5FO9B 4X8GA 5D2NC 3W0WE 1KBVA 1RJYB 2X41A 4F8NA 4JE0A 1FJ1A 3IJHB 1JSYA 4PJ5B 2KT6A 4NP4L 5D7EA 2Y06H 3DGDA 3BAKA 2JB6A 5JPNC 5I1EH 4LASH 4ZD3L 1CD1A 4G9FE 2FYVA 3AXLB 4XCCL 3H55A 3L1OL 4HKBB 2V5MA 4KO5A 3GTNA 4WGKA 1MFAH 3WLWC 4HEPA 3BN9D 4AL8H 4AV4A 2BNUB 4AKOA 4JY6B 2ORBL 1TZIB 4QUOA 1D5BB 3TFKC 2P5ED 4AT6B 5K39B 4ZMVA 1YMMA 4LGPB 3N6YA 2BXZA 3ARDB 3PL6A 3LNEA 2YOAA 4Z23A 1XF5B 3ZOAA 1J1XL 2Z92B 5KANI 4NQDE 4NKMB 4N6RB 1F3RB 1CDIA 3SOTA 2H32B 3MRPB 1U42A 3PUCA 4QOKA 3RWFB 4X50A 5CD3A 2J8UA 1OAYL 1HHGB 3O81A 4MJIE 5LDUA 2ADYA 2MHAA 5IG7B 1I7ZB 2DWDA 1OAQL 1FFPB 2J4WL 3OAZK 1WAPA 2CM5A 4ALAH 1QA9B 1RZIA 8PAZA 4HGWA 5JXAL 1AR1D 2TSBA 2N1KA 3ELQA 4DP6X 3IEAA 3RUGE 5I1HL 1QFWH 4F20A 4JRLA 1X7QB 5I71C 4NSKA 4JO4L 2ED8A 3P0YL 3VXSE 1AYRA 1QQDA 3RWIB 3A0OA 4NKIH 3IWUA 5DUBB 3ZBMA 1ZT7A 2AJVL 3B2MA 4Z7UF 1GC1H 5ITBH 4PJGF 3LIZH 3MRBA 3O0RH 3L3DA 1XL6A 3EJRA 4A38A 2CJ3A 4KVPA 4XZ4A 3UJTH 4OUUA 3RWEA 5KS9E 3JZYA 2Y5TA 4PJHE 5KYYB 3H42H 4ODUA 3WEAA 1YZZA 1U93B 5JOEA 3HHMA 4QCIB 4P8QA 1UM4H 3E1ZA 5JOPD 1WTLA 1F2QA 3QEHB 3CFKA 4YO0B 3T3MF 4MHHG 1JYVA 4M6OL 1MDAA 1LWRA 3WHE0 2E9IA 1H15A 2O6EA 2VZ3A 3GI8H 2WTPA 4TVPD 4R97C 2P8PA 4D0BA 3TL5A 5DWPA 2PR9A 4K23H 1FFOB 3BGFC 3OC5A 5FX3A 3DIVA 5IP4A 2CJTA 1TF4A 4O00A 5LQBH 4H8WL 4GSDH 3IMVA 1DQMH 1OSZA 2WM0A 2C7UA 3P3YA 3P4NA 2FLRT 1VB9A 1FC1A 2CBPA 4MD5B 3K8LA 2X4QB 3MBEB 3VGEA 5KSBE 2BIMA 4QHMB 3DYMA 3WFHB 4YS4A 5I6LA 4UQ9A 4DEPB 3K46A 1QVOB 1IGMH 3KWVA 1C16A 4LFHD 4PM1A 5T1DH 5IQOA 2FZ3A 4LNVA 1PNCA 2YJLA 2ZUVA 5DEFB 1W0WA 1CTOA 1CK0H 3O3AA 4P2OC 1KBWA 3QWRD 5CSZA 2XA8H 1NPJA 3WDJA 1KPRA 2BLFA 2JCCB 3HZMA 3OKMB 1CFNA 3Q06A 4MAUH 1BYPA 4PRPB 2G3MA 1IEBA 1FE8L 4O9HH 5I5MA 3I02B 5DZPA 3DXAD 1AQKL 4JFDB 4MZRA 1K9TA 2WN2A 5DA4A 5CN3A 2HLAA 4I0PA 2O5ZH 2IO5A 3BGMA 3NESA 1LD9A 4KHTL 1TXKA 4LQ1A 4OJFH 5E23A 4BZ1A 1EFXA 5CLXA 5GQBA 2OMBA 1SGKA 1H0DB 5IVXE 2F15A 3Q3GB 2NUTA 4KK5C 2DKUA 1P4BL 2OULB 4RX4D 3V0GA 2XHNA 3VI3A 4UTBA 3TM6A 4GW1B 5J11B 2AK1H 5IM7A 4K5OA 4J3XA 2FJGA 3R0MA 5KSAC 3O8XB 5LBSL 1GKOA 1XGTA 3DURB 1FDLL 1JGEA 4WTWA 4MA8L 3MPCA 5EH1A 2CXKA 2NY0C 5L4FA 3MRIA 2WLLA 2NZ9D 4YFEA 3RWHB 2I32A 3S8FB 1MCOL 2AANA 1P84K 1EUUA 2V17H 3UTTD 5D1XE 1RUQH 5FYJD 3PGCB 4RGOL 1RU9H 1T1WA 2HVJA 4QGTA 3ML8A 5T1JA 4UQAA 4G7SB 1E8YA 2DB8A 1ZA3B 1P1ZB 2LTQB 1LVEA 3ISYA 1FC2D 5IBUB 1WFNA 4YGVA 4KPHH 3ZDYB 3TEYA 5GZNC 2B1AH 4KJQD 2QADD 3F62A 4PJEF 3N2JA 1BXAA 3WFBH 1Y07A 5IESH 1HKFA 2XVLA 4G9FB 4MBOA 4JFOA 2DICA 1M7DB 4NFCA 4J3TA 5I5IA 5IEKA 2E9JA 3CN4A 4L9LA 3T0EA 2A9NL 5DVKA 5CEZD 1F18A 4L0PB 1E8WA 4MJ4A 4P59H 2AZUA 3HG1E 3FAXA 2ZYRA 3GI9H 5LB1A 4ODSH 4BE5A 3N42B 3CSTA 4WHYH 3WMPA 1CLVA 4JVWA 4J3SA 4N2KA 4NQDB 3G6DL 3AGWA 3GMQB 5F7MC 4JUTA 3BUTA 3QUXD 2H6PB 4PMEA 1XIWA 5A7EA 4JQIL 5JZ7C 1JS4A 3UYPA 1XGPA 4WO4B 5FA4A 4EN3D 2BSTA 1NMCB 4MB4A 4NQEE 1L5GB 4S10A 3ZUNC 3OAUL 4RBPH 2Y2WA 5HI4D 4YDKL 2L7EA 2VM9A 3DROA 3W3BA 2Y22A 3X1FA 3P9LA 2DQDL 4U3SB 3NZHL 2C9VA 3BMWA 5C7ZA 3DOHA 3WFZA 3CSBA 3PWPB 2XTJC 4QIRA 1PYWA 4GKSB 4UZSA 5DD1L 3WD5L 4X4YA 3QFJB 5D7IB 3V2AR 2QPSA 2WZAA 4M7ZB 5D4IA 2KS0A 3WUZA 2XPGA 4OJCA 1YNKH 4G6ML 1CD8A 1OD9A 1WZ1L 3GLEA 3G08A 2OL3A 5KS9B 1I3RB 3HG5A 3WXVL 3LAFA 2NXYD 5IUCA 1YYLL 3LDBB 4GFTB 4O2EB 1ED3A 3BP7A 1GAFH 2B20A 4OTXL 2R2EA 1IIKA 3VXQB 1YEGH 3AG1B 2HXAA 1FNHA 5CR8A 1DLHA 1E7VA 2JI2A 4XPBL 4Y8DC 3KJ6L 1HS6A 1JHKH 3KLAA 2QKIB 1SJHA 3PHSA 5B1JA 3P73A 1JD9A 3V55A 4EN2A 4H2CA 1CYXA 1GH7A 5FAAA 1T03H 3FQRA 3F05A 3OKDB 1ADWA 1TG8A 1N5YH 3HHRB 5I1DA 1WWAX 1FZOA 1VFAA 3MOAL 4HK0A 7PAZA 1JZ2A 1TZ8A 2GBUA 3EW3B 4MA3A 4PBXA 3G6JF 1ZLEA 4NO0B 5F7EH 3E6FA 1XZ0B 5C7XH 1E90A 4DP5X 4KKCC 4WV1B 2LVCA 5JHLA 4MJIA 3MV7A 3D4ZA 3RZCB 3U7WH 1I7RA 4JRYB 1IBHA 4S1RL 4AG4H 2ADJA 1INDL 4YHLL 1JZ3A 5TTRA 3UAJD 3AY2A 1JWUA 3X14A 4Z77A 1FFTB 5F89A 3CH1A 5ADPH 3RUGA 1I4FB 3CLFH 3LQZB 3ZKND 4LCCC 4UINL 3LKNA 5EPMA 3GIVA 3CFIC 2J6EA 2BK8A 4XN7A 5G4OA 2R83A 3VXSA 3VYPA 4UILL 3LNGA 1MFEH 2FYYB 3CSFA 1LO0L 4GIPD 1WCQA 1QMUA 1U3HC 1VFOA 3GINA 2XXMB 2E27L 4S1QL 5T8IA 3BT0A 2A74B 3EH5B 3VNZA 3DVNB 4MMXB 1XGQB 3D5OF 2WOYA 4L4TB 3HB3B 4QT5B 4NZDA 3FHEA 1H3TA 3B83A 4HKZB 2PTVA 5FKAB 1FA4A 2KZBA 3KYNB 3Q2WA 1C1EL 2YK1H 1UYWL 1TENA 4RGNC 4PLJD 2W9DL 1BQSA 3RKDD 3QJTB 3TEUA 3RY6C 4R4FH 5HHNA 4D0CB 4QNPE 1TEYA 5CILH 1DSYA 3G7TA 5DDHB 2Z8VC 5CUSH 1RZ8A 5L7XL 2VL5B 1N8ZA 4EUPG 3V6BR 4LDEB 5IFHH 1O6TA 3O6KL 4G8IB 5KSVB 1XQ4A 3S4SB 4H0IA 3VFVB 3C5ZA 1H8NA 1DFXA 1QTSA 3M88A 3K7UA 3GRWA 1R3KB 2QSCH 3DMMC 3NIDF 5EG6C 2D31A 2YC1B 2HRPL 2E75C 2CUHA 1LK3H 3C6SA 3HVNA 3LD8B 3Q1EA 1MVFA 2BP0B 3IDIB 4UI2A 4DERA 2NY4B 4EUPA 3N44B 3FOMB 4CBZA 1FNEA 2YPLE 2XJLA 4NM8L 2ZUTA 1WEJH 5AUMA 3BVVA 4KQ3L 1RFDH 1DJWA 3FUFA 1AIZA 1X9UA 4KH9A 3WIFB 2UZYB 1PIFA 2ZCZA 1PQZB 3IRZA 3LHPL 4MDIA 4ZAKA 5CZVH 3SDYH 4CRPA 1XCXA 3JWNE 1E4XL 4W81A 5GGUB 4AENA 1D9KC 3IJEA 4B7LA 3BPNB 1Q9KA 1X5ZA 3PQYB 4OGAC 3CDFA 1F4AA 1T5XB 4L2LA 4AX3A 5IMMB 2L3BA 1BF5A 3MUUA 2X4NB 3Q8AA 5DJZB 4OM0L 2CM6A 4PWEA 4HH9A 1RIHH 3QRGH 2ZUWA 2GUOA 4LSRH 5IVXA 1S3KL 5D2LE 5HYFA 4J3BA 4EI0A 4HXBL 3EYVA 4KO6A 2Z4TA 3MUHL 1N26A 2VDOH 5IJCC 3HZVA 4DZBB 4ZX6A 4IGBD 4NQSA 3GSWA 1IQDB 2E8ZA 1Z9MA 1GY2A 5IHLB 1ILUA 2GBTA 2ICWJ 4CN4A 3CPLA 5J12C 1GOGA 3MNVA 3T65B 3N0AA 2LW3A 1E27A 5H94B 4BSWB 2R1XA 1F58H 4MS6A 2A9AA 2HKAA 3O2DH 4XVSL 2WZPD 1CDUA 3WE1A 4F8LA 5ICZB 1K4DA 1KC5L 1OB1B 4NQCA 3FSVA 4Z8FL 5JMOC 3CFNA 1T5WB 4GKZB 2QHLA 2EE6A 4HYTB 4K5MA 2PO6A 3CXDL 1HT6A 4X5QA 3O6FC 5JPMB 1KPVB 4PIRF 2DEXX 3PDDA 3IGUA 1NC4D 1PCSA 4XHJC 3OAYK 4OLXL 1ET5A 5AWNH 3GPEA 5JXEC 2CDEA 4PY7A 3QWQB 1Z2KA 1DANU 1RKRA 2H1LM 3WY3A 3KWXA 3PL6C 1HCVA 5IREA 2JI1A 4X0KA 1BJ8A 3GJFK 5FFOA 4WUUD 2OXGA 4RFEB 2BSEA 4LAQH 4OLYH 4PWFA 2LE9A 3HG1A 2ARJQ 4V2BA 1U8HB 5LO7A 5AW1B 4UQ3B 1SDDA 4WW2B 4PGZA 4B97A 2X4RB 2YD2A 2MCMA 4U7KA 3D69B 3ALPA 4ONOA 4Q74A 1I1AD 1S9WB 1FFNB 2H0EA 3RA7L 4PJBF 3QI9B 1ZS8B 3WY4A 5F8QC 5D7KD 4PS4H 3MFFB 4MQXD 4X6DF 1JV2A 2AERT 5BS0D 5A6MA 3CZUB 3QXDB 3ARGD 5H37H 2VN5A 4JG9A 3A4DA 1HHKA 3NFNA 4KH2A 4BINA 1A64A 2ZF8A 3JV5A 4L5FH 2WVVB 4XRCB 4IHOB 5HHPB 3GSQA 3V0AC 4DGYH 2HT2C 5EEWA 5GRYA 4KK6C 4MKMA 4X5XB 4F58L 1A9EA 4C4UA 2VTFA 2QPFA 4NYLA 1EO5A 3ULVD 2E7HA 3EJZC 1WBZB 4NI6A 3CE1A 1ZMYA 2K9FB 1SQ2N 5EU4B 3ARED 1FH5H 3NRFA 1YRKA 2YMXL 1IAOA 1T22A 4I48A 1LEKB 5IVNA 2X5PA 3BOVA 5D1ZI 4D7PA 3FCUB 2QZQA 2X4SB 5SV4A 3F7PC 2WLIB 4X6CE 4EBQH 3JYCA 4FFTA 4K3JL 2R0WH 1PCXA 3KDMB 3MV11 4FD0A 3MV8B 2D9QB 1MLCB 4I1PA 4QXTA 3QIBB 1MJ8H 4JMXA 3PGDB 2Y4SA 5E8PB 3WKNA 5AOKA 2OJZL 4P57B 4KZEL 1J5HA 3GSUB 4C8XA 5JNYB 1TLKA 1OV8A 1KENL 2XIDA 3PRZA 1G7PA 1GS7A 2XC8A 1OPGL 1QYGH 4EI5A 4UV7L 4P4KD 4UNTA 3ZKXB 4NB7A 5B39B 1W0VB 3IFNH 4CKVX 2FCBA 1Q72H 1MCPL 1WBYA 1NZRA 4YR6A 5J6HB 1MJUL 1ETJA 4HD9A 3MCKB 4JFEA 4P99A 2GTZB 5HHOE 3VFWB 2YAFA 5DRXB 4HC1A 3TBYB 3RVXC 1IEAB 2JIXB 2X6VA 4FLQA 3D2TA 4OQTL 5GGVL 5FFGA 4LZKA 4FABL 1TCRA 4XNMA 3L2LA 2BRRL 1DUZA 1VIWA 1UWGH 2AV7A 2YPLB 5DMYA 1MW2A 4ORGA 4XE5B 3SGEI 1MW1A 2NUPB 4G7YH 3TO4B 4XBPB 4G82A 4IS6B 3F01A 1NCOA 5D55A 4OI9A 5C0FB 4I0PC 1IKFL 1X5XA 3TCTA 4OKVB 1JERA 3SDCB 2Q2EB 1MKFA 3ZIYA 4CNIB 1I1FB 1SEQL 3DVGB 2N0MA 3DOSB 4GSRA 2BNQB 4GO6B 3JWDL 4JFQA 4TS6A 3HUJA 1SOKA 4HS6B 4YNYB 3UTSE 5IKCA 2H1PL 5CGBA 1JP5A 1CYGA 2DQIH 2HUEA 1XF2A 2EDKA 2DEWX 3KPNB 1JN6A 4MA1B 4OJDH 5DEGA 5AVSB 5J1AA 4D9QD 2DQGH 1I3GH 1GCYA 3QEQE 4ZZFA 3D8MA 4U0QB 3QRBA 3MRHB 5FUCC 3TT1H 5CZKA 5SWSD 1FPTH 3N85H 1U8KA 1QX1A 3GMNB 2PTTB 3HFML 3KPPB 4PV8A 1AHMA 4LEXL 5E99L 1KGIA 2DD8H 2AXGB 1SDAB 5F8RC 1RZQA 2JJTC 1YQ2A 1X4XA 4K9JA 2CKBH 3CDZA 1TQBC 5JW4R 3LEVH 5CINH 5AZ2L 4HLZH 1F45A 1FL5A 3UGEA 1G87A 4P06A 2B39A 5TDPA 1PG7W 3H6JA 1DBAH 3O6LH 3HMXH 1WBXB 3T1FA 3VI4F 3GBML 3KPTA 1SXSA 4U1LA 4FE9A 3HZYA 3IJYA 2BS8A 2WUBL 5AVZB 3QORB 3T0EC 4M3KB 4CILA 4JZJA 3BW9B 3NP4A 1A4AA 3MRCA 3PV7A 4YK4B 1HHIB 1JGDA 3O9WD 1MAML 3PDOA 1CN4A 2MJWA 5DQJA 5F9JB 3RB5A 1BZ7B 3Q6GH 1IM3D 4F7MB 2Y3AA 5I2IA 2WYTA 1QLFA 2Z91B 3NIFF 1BSIA 4R96B 3RE0A 1CMOA 1NGZB 4FFZA 1EVTC 3ZQWA 2G0LA 4DO5A 1U8NA 1G1YA 1NGQH 3QDHA 1HINH 2AS5M 1G7MB 4GEIA 5EOQH 1T20A 4NHCH 1JNLL 1NEZB 1XIWC 4JKLA 4ZRGA 1IGJA 1LGVA 3RDTA 1VAHA 3HE6B 2Z1KA 3GNMH 5ANMB 3GWJA 4Z95H 3HBPA 5IROC 3QIUB 4OB5H 3MRKA 3KGSA 3T0XA 1JF6A 1MXDA 5D2LA 2CDGA 3QJQB 3OR7B 5FKPA 4A7VA 2QEJA 4M4RB 3LXAA 4MZ3A 2A9MH 5E00B 4H8VA 5DRZB 5AW3B 2EYRB 3M6DA 2CIKB 3ZYIA 2ZXBA 2YGVA 4UTAH 4QI3A 1TQVA 3R1GH 1OF2B 1W15A 5D2NB 3ZMEA 1R4XA 4V1DD 1F8TL 1SN0A 1JPEA 4PP1D 1ZV9A 1WRFA 1F00I 4MAYA 3UO1H 5DJ8A 5INDA 3IU3B 4ZO9A 3WN5B 2OXHA 4XPGL 2IAND 4L1BA 2YPVL 1JGVH 3BI9X 4PGDA 2ZF9A 5DGQA 3T2OA 3IGKA 4RZCA 3LMJH 2UZIH 3CHQA 1C5CL 5ID0B 5I0DA 3KVQA 5GRZA 7PCYA 5DJDB 5J3HC 1EEQA 2WYIA 5B1JC 4X6CB 2K4WA 5E03A 1KIRA 1TZHB 1UKQA 4E36A 3QFDA 3HC4L 4TUKL 4P5SA 1G7LB 1XR9A 4I2XB 4HPYH 4O51A 5DWUH 5KVGL 2WINA 4HJGB 2GJ6A 2ZICA 3T08A 3TTYA 1Q9OB 3BN3B 4ETQB 3AQZA 1XF4B 3VGDA 2ITCA 3ZE1E 1FVCA 3LRSB 4NQVB 4WVRA 1BX2A 1B90A 3EDEA 3KL0A 3OQ3B 2WVUA 4YHZH 3KW7A 4QRSB 4Y4FB 4LQFL 3MNZA 2GT9A 4HS8H 5I71B 4HH8A 3CBJB 5HHOB 5GGSB 1H3XA 5C0IB 1FIGH 3CC5B 4UOQA 1VFMA 3H9SD 1A47A 1W72A 2DWEA 2X9WA 3UPCA 4JX0A 3I6KB 5AG8A 4LXFA 2X1WL 4NCC1 5DJCB 2KL6A 3D25A 3PWVB 1OVZA 2R8SL 3GKWH 4UIMB 5TDOA 1H5BB 3PXHA 1E50A 4KDWA 2YD1A 4UU9A 1R24B 5KSUB 1BD2E 1YJDL 2HFTA 1MLBB 1ZD6A 5KG9B 3F12B 1M42A 2MWCA 3BMVA 3LKQB 5DQ9A 5ISZA 3DK0A 4G3YL 3HMWL 1CIUA 3S6CA 1B3IA 4J6IA 4R97B 3UTSB 3VSVA 1BFSA 4YHNB 4KUZH 2G3NA 4Q2ZB 1Q0XL 5AKSA 4BSVB 5IFJA 1QACA 1UXSB 1ASPA 3BGFB 1BF8A 3QEQB 4PJGA 5KW9L 2C9XA 1KV3A 5E08L 3WE6B 43C9A 4EO5A 1UJ3A 2SEBB 3DX9B 3SGDI 4A2GA 4P5KB 3IFOB 3FT2A 5HHXH 1G7IB 1THCA 3RNKB 2GI7A 2MPAH 1ZEAH 4FLSA 1GVIA 3Q9QA 2EUZA 1YEDA 4K15A 4Z7WF 3LKPB 1T6WA 3VXUD 1F4YH 1MJ7L 1FZJA 3MXWL 4BRVA 4P2OB 3MREA 2EZ0C 1LO4H 4DP7X 1NL0L 1NFDB 2EDMA 3BPOC 5BZZA 3SKOB 1OAKL 4XBEL 3IDGB 5JW3H 5HP5A 1KT2B 3G5WA 2F7QA 4O58L 2VQ1A 4LCUA 1NUGA 3LHAA 5EDSA 3RVWD 3VFRA 2E74C 1FLTX 5DXWA 3K1KC 4O4YH 2HA1A 3BRFA 1KCVH 2BMKB 5DZNA 2ICEB 1PZSA 4KI5D 1KNOA 4H26A 3FQYA 3DRQA 1RZJC 3VD1A 4GAJH 1DBKL 3MNWA 3BD3A 6FABL 4Z3JA 2HWZL 1E9PB 1JPSL 4HFWB 4IK6A 4Y7OC 1AQ8A 3EG9B 4OVUA 4YSRA 5E8OB 2Y5QA 2VQ4A 2QHRL 2XWXA 2OBGA 5ID1A 5C70A 3GPSA 3HOGA 2E9GA 3AQYA 4FOMA 3K2UH 2OMXA 2VABB 4M43H 3O3UN 4ADIA 4I85A 2VE6A 3ZDZE 3MV9D 4P46D 4ZOCA 4QAMB 4GG8B 5INCA 1YPZE 3WNPA 5TF1H 1INQA 5BRPA 1JUFB 1U95B 2PNDA 2LABA 3CIQA 3APFA 1AOHA 1LXMA 3O2WH 1KMGA 4FQCH 4BKLA 3G5ZB 5E6UB 4AC2A 5BNXD 4U6XB 3C5SA 1MZYA 3AMKA 2D3VA 3L95B 3AWFA 3BWUF 4JVPA 1NIDA 3EFOA 4XNMB 1TQUA 4G6KH 4UYQA 2FVNA 3UZQA 2Q10A 1OCWL 1T0NA 1KIUA 1QR1A 1ICTA 4JKMA 4NUPA 5CGMA 5DRWB 1RJZA 5MEOB 1S5IL 2ID5A 1I85A 2H2SC 3RFZA 1U92B 2B2XL 1BFOA 3KEHA 4C4KT 2Q87A 4NENA 2EH7H 1OSPL 1SOSA 3CN3A 3UPRB 1EFXD 1NAMH 1XHHA 5KVGE 3VTTA 2ADIB 4FX5A 1ZK9A 3Q2NA 4ODTL 1X9RA 3V4UH 2NRDA 5HYQB 5IGXH 1PZDA 4XMXA 5IHUH 2EEXA 3MO1B 3SE6A 2FHCA 3QEGL 3SPVA 4MKTA 5LGHH 5JHDA 5DHYB 4OIIH 3MRRB 1KEGL 5E24E 2EUWA 5EU3B 2FJHA 4E2OA 4PJEA 5BRZA 2F8XC 2WYHA 1ZRUA 3BUPA 1R5WA 4IW4C 2ENQA 3Q8CA 4HFUL 2PPAA 4G8GA 2WLKA 4NP9A 5D72L 3U9WA 3D4GA 3UC0L 4JHVA 3ZE1B 1F4XL 4HISA 2WVSA 5FGRA 4EDXA 2TSAA 1GOFA 4OFQA 1KBGH 4GPVA 4X4ZA 4QXVA 1AD0A 4YQXL 3QDMD 3T04D 4XPTH 3QCTL 4PY8J 4YLBA 1E2WA 3MC0A 5DCCA 4W70A 4XAKD 3BSHA 1UUNA 1U2YA 1ZVSA 2XFXA 2XTJB 1F97A 5EO0A 4E9LA 4X9GA 2ZOTA 3QWNA 4YDZA 3LZFL 3D85B 2V2WB 5IBLC 1A7RH 3WIHH 3VQLA 1OARH 1Q94B 3VD9A 1JI1A 4LNRB 2RJMA 4PV9A 1S7SB 4PJAE 3SGDH 2Y5EA 4P2YA 3LV3A 4AI7A 1AIFA 4L8BB 4N0UE 4NAMA 5K9OB 4NDMA 3RWGA 2VH5H 3EJJX 25C8H 1BD2B 4BFRA 3S88L 1IFRA 4FQIL 1JWMA 2BRQA 2AV1B 3QG6B 4Y16B 4JFDD 3VG9C 2IDCA 3ARBA 1CLZH 1Y18B 3S5LA 43CAB 3V6ZB 4GS7C 4NZJA 5AZEH 2IF7A 4P3WA 4W9KC 4DK3A 4LPYA 1WCBA 3VQMA 3SOBL 3C6LA 4X7TB 2X2HA 1CDBA 4KJPC 4MA7H 4UCFA 4AYGA 1MI5A 1DZ0A 3UBFA 2P47B 3EYSL 3MLYL 4XB7A 4XVUC 1OK0A 2FIRT 3LPGA 3G6AA 3AWEA 5FO7B 3EYUH 4FG6C 5D7LE 5K9QI 3S36H 5E5LA 2Q76A 2K7QA 1GRWA 2XJKA 4XO5A 1UEYA 4MCZB 4QLRA 3KVDD 3O45B 5HDBE 5EA0L 2A38A 2F54E 5HVWA 2J6WA 4IRZL 4H13C 2NY5L 5EF2A 1M9WA 3A6BL 5AOZA 1CE1H 1O7VA 1MIMH 2ATAA 2I27N 4LCCB 2P7TB 1U0QA 1A6PA 2DQJL 4LHUB 2EDQA 4TOYL 4FZEL 4PRID 8CGTA 7TAAA 4F37K 2VSKB 4LBAA 2EEAA 3W0WD 4POZD 4WI7A 2N4IA 1PG7L 5T1KB 1U3HB 1PVHA 3LZRA 4K7PX 3VVVA 4UBDD 1MRFL 1QBBA 2GITA 2F8IA 1TEFA 1TTAA 5KBMA 3F7YB 2R4SL 1V7MH 3FHQA 2BCKB 3RGVA 2E7MA 4KK9C 2IADA 4G9FD 3P77A 2HPTA 2BOLA 4JPIB 4UDUB 1DSWA 4OZHF 2FK9A 2Y0SA 3HEIB 4FNQA 4EQ2A 1BZDA 4FG4A 4K8RD 4RIRB 5CCGE 4ZSOA 2DY2A 1M7UA 2I5YL 4JDTH 2IC2A 1T1XA 2ZNXA 2XVBA 1ZPUA 1KBBA 1U8IB 2Y1VA 5E4EC 4CAGA 4DKFH 2X4TB 4EKJA 5T3ZL 1UZ8B 4WK2B 4NQDD 3NSCA 5HJDA 4MRCA 2C3XA 2VLKA 1I9RH 1EBPA 3FO2B 2HSIA 4R2GC 4WFGE 3ZYOA 1YPZB 1S9XA 2CR0A 3ARFD 3B9AA 2G9HB 3PHOA 4H5SB 4MJID 4U2YA 3WO4C 2QZ5A 3DA0A 2OJEB 1N7MH 2FEEI 5GJSL 1FAIH 4PJDE 2IQ9H 4EEEA 1BZOA 2HJFA 3ESMA 2P5WA 1GIGL 4NWUL 1WZKA 1ZY9A 1HXMB 3T09A 1EJFA 2VDPH 5D9SB 3KPRE 3WAKA 1IL1A 1RZKH 1BJ1J 2E47A 5FDYA 3WUWG 2YSTA 1EJOL 3HE7A 2PXYA 3CIAA 3ES6A 1WS7A 2N59A 4ELKB 3E6HB 3VXSD 3IPFA 4EI6A 5AD0A 2A7BA 4MNGA 2B0SH 1HZHH 1KIQB 3MLUL 4JZJC 4D9LH 3QUMA 1QKZL 3OBAA 4NC2B 4LSUH 3VGGA 1F3DH 1J5CA 5FEBA 2VLLA 2WJ7A 1V05A 1X6LA 4GYBA 2WXIA 2ERJB 2DMKA 2IGTA 2L04A 2XYCA 5DJ0A 3VW3H 3BFOA 3WUWA 4WFEE 3LXCA 4OF6A 1U3NA 3UIZA 4ANXA 4NI3A 5EU6B 4D8PB 3QEUB 4FNUA 2G2NA 4UANA 1R46A 3B56A 2LHAA 3KAAA 4ZFQA 3EYOB 3R8BB 3RDTC 4AW7A 3BRGC 2EQDA 3V0JA 1A7OL 4E9RA 3MA7A 5EOCL 1OGAA 2WBJB 3LXBA 4ZG1A 2HG0A 4KROD 1RJCA 3E8UL 3BQUC 3F3HA 2E7DA 3C5ZD 3W9EB 3ZL2A 3TIDA 4IMLA 4N8PA 4Z78B 4WI5A 3NOIA 3L4UA 1FJ1B 5AALA 1GGBL 1E5AA 1N59B 5DD5H 4YHKH 5ECGA 4C4BA 1WWBX 1DYZA 3PG2A 5FYJH 4MAYC 5LDSA 1FBIH 1VESA 3L4TA 5E1GA 4QHKI 2JB6B 4YHYC 2PCPB 2RALA 4D94A 5ESQB 4OZIF 2C1OA 2F8OA 4CC1A 4IEFA 3PV6B 2BVQB 1AP2A 3O6FB 1KACB 4QRPE 5DT1H 5EZPA 4B53A 1MRCL 4QJ3B 2LU3A 3L9YA 3UABA 3BZ4B 5C08E 1I8UA 3DSNB 1RLWA 4N0UB 4Q9BA 2DW5A 2EKJA 4XP4L 4ZAKD 3VD4A 4WWKC 4C59B 3IDXL 5IJVB 1HCZA 1EHLL 1JPFB 1A4KA 4MNQB 1QBAA 2Y7OA 4NZTH 2FJUB 1QBLL 3QIWA 5CEZH 5FYKL 1KXHA 3OMIB 1BG9A 3WFCH 4N25A 5DLLA 2OSWA 1A6AA 4PG9B 1S9VA 2QT6A 4CVWA 2WKOF 3ATBA 1DJXA 3V10A 4X4MA 4NNXA 4QOKB 3I6SA 2J8UB 1WQVT 2YXVA 2MHAB 4L29A 3AU0A 4OI7A 4M5YH 2DWDB 3CVHL 4KKLD 4N86A 2IWEA 2QFRA 2VDRL 4M6MH 1NLDH 3VSTA 4HGWB 2WSPA 3S9DB 4ZUTB 4ZTEA 4Z7OF 4GXVL 1Z9NA 3ZTNH 3NCCB 1U8QA 1KDJA 5HDBB 2F54B 4PJ7E 5AL0A 3EBAA 4AYMC 4UZUA 4WEEA 2VITB 3BT2H 4QRUA 3WGVB 4TQEH 4ZBJA 4HQQL 4JL2A 2UWEE 5D1XD 4KMTL 1U36A 3FN0L 5KVFL 4B0MB 4NQTA 3S2CA 4B60A 2Y5TB 4W4NA 2PO6D 2R56L 5D1QA 4PJXF 3DUSA 3KW8A 2NY4D 1QWHA 3WEMA 2EIKB 2QV4A 3I2CL 4XCYA 2WQXA 2QSTA 2YKKA 2EDEA 3E8VA 1CL7L 1JMZA 4PJAA 4H20L 3IJ8A 4HIXH 4X6DA 3UX9B 2BM3A 1S7RB 2EO1A 4JFYB 5DVOA 4IRJB 3V95A 2GJZA 4A66A 3FH8A 2Y1YA 2P8PB 2GG1A 1E4HA 4XVTH 1OM9A 1RUPL 3M45A 1XDTT 3NQKA 1X7TA 2WQVA 3VFMB 4GW4A 5DS8A 3HG1D 3W56A 1HILA 4UT7L 2C7UB 3IGAA 2PPDA 3EUDA 1L4IA 3UACA 1FNGA 2E3VA 2LU7A 2Q3ZA 4JY4B 4NJAH 2BC4B 1RIUH 2RQEA 1F6FB 5GIRA 2W1NA 3BP6B 2BVUA 2EILB 1GZQB 2CBQA 5ACLA 3KHQA 2BVYA 1IGFL 1BPVA 2CLZA 1W0WB 3DPBA 3Q8EA 5D7LA 5DK3A 4PGJA 1H6EA 4J4PA 1BWMA 1JTPA 3A4AA 4NQED 3N41F 4NQQA 5E6ID 3BDXA 4YX2L 4WGWB 4HW6A 4X5RA 3QDGA 1IE4A 1A0QH 3B2VL 1S7VA 5A6IA 5CP3H 2ZNWA 1IEBB 2VL4A 4FXTA 3OG4B 2F19L 1NFIA 1FGNH 4XP6L 1ZE3C 3V5DB 1FFRA 1B2WL 4FA8A 2R0LL 4I0PB 5DURB 2BNRA 3OPZH 3BPCA 1MAKA 1KLGA 2CGZA 3AB0C 3ROLA 3ZMRA 1I9EA 5T3XL 3B2XA 3S3PA 5CIPA 4G7RB 4MWFA 2FHFA 1NKOA 3F8UB 1PDKB 1IGCH 4BIKA 4MD0A 1KGUA 4OR1A 1OK8A 3GJFB 1MUJB 3PWLA 4W4OA 4WKZA 2ARJA 5FFLA 2Q20A 3VI3B 5A7BA 3M1BB 2C34A 4TTDC 2NY6C 3ZDXF 4HULB 3L54A 4ORZC 1BOYA 2FJGB 3JUZA 2R27A 2CIIA 5GGRY 1H9DA 3DO7A 1JZGA 1JGEB 4HALA 2VSCA 2JNZA 4P5TB 3T71A 5D6DA 4G2AA 1A7QL 5B1BB 2BIIA 4ZQKA 4EI5D 4OCSL 5CZXC 3BH9A 5IEKB 2WZ0A 3G5YB 1U4FA 1Y6KR 1WGOA 2VJ8A 3EADA 2KLRA 1FCGA 4LSQL 2YRPA 3DJRA 4NRXA 5DK0B 3QH3A 4YGVB 2WXFA 4UT6A 4CSTA 3MLZH 1OQOA 3AS3A 3C9NB 4PJDA 5KBLA 1TETL 2JJUA 2O30A 3NCWA 2Z7WA 3VXRE 3SY0A 5CD5D 4JFOB 5GS2D 1PZ3A 5E8EB 1HL4A 3TH4T 1H19A 1ZVHA 2JSFA 5FYKE 5A2AA 3S7GA 3KPRA 3LN4B 4BZYA 1GPOH 1RPUA 5T33H 3NPSB 1I85C 2WWMC 3RFZC 5C08B 1HHJB 2Q86A 4PGCA 4NXKA 1UASA 3ESOA 5IQ7H 2WKLA 2DIEA 3MX0A 3X3FH 4W9ZA 3EJYC 1TJXA 2G2PA 1MCRA 4W9IC 3J07A 5FM5M 3CFBB 4LSSH 1JK9A 4NNPH 2JKTM 5LG1A 3X11B 3B2PA 1NBVL 2XXGA 4KUCD 2F7RA 3KPOB 5C0JA 2MOVA 1AGCB 4PVBA 1FG2A 1LP9E 3EZJB 4EZLA 1TVHA 2EXYD 1JVOA 1F56A 1XGPB 3AABA 3VI4A 1UVQB 3QQ9D 5KJRH 3VRLE 3CFDA 1M6OA 1ZDQA 2FLMA 3QIBD 4UDTA 1BVNT 1EMTL 1M4KA 1SPDA 3I9GH 3DROB 2LV4A 4NNYB 5KVFE 3PPSA 4N8CL 1KDIA 5E2JA 2V2TA 1DL7L 2JH2A 1VF5C 1O9WA 4BZ2L 5MP6L 1RUAL 4YSEA 3A6CL 1E8ZA 5LBVA 1PYWB 2CJUH 2IPTH 2DWSA 2VXVH 5TQ2L 4LT7A 4AYID 2JTDA 4PJ7B 3QJUB 4H8QA 1IJ9A 4X4YB 2ICWI 1IAII 4UUJA 2FX9L 3DBSA 3HA0A 1Q38A 1X6NA 5MERB 3S34L 2KC0A 3FRUA 4DAGH 3DX7A 3IXTB 1E9OA 2JIXD 4OVVA 2L7UA 1XGRA 4R4BA 4F9PC 3MLRL 5E56A 1ED3B 3P11H 1MVUA 5BRQA 3BP7B 5E4AA 1RUKH 5FO2A 1FNSH 2OQJB 2YPLD 3AROA 3CGTA 3MLTB 3ARBC 5J7CC 3T4AB 3D1MC 1YNLH 5D5ME 4JY5L 4HS3B 3T0WA 4HIHA 2W9EL 5EORH 3SDDA 5KZCD 2F7OA 1CTNA 1L6ZA 1KTDB 3SDCD 1XGUB 2BFGA 4UT9H 1C12A 1U8OA 3NMEA 3C6LC 2F74A 1FLRL 3R4RA 4P48A 1BFVH 4PJCE 1FZOB 4YDIL 4HK0B 5GSVB 2O5YH 2PW2B 4J27A 2HFFB 4MA3B 2KLSA 4WF7A 5SX5K 2CPUA 2JKWA 4GBXB 4WO0A 3E6FB 1EPFA 3RDTD 2Q8BL 2FX8L 1R5IB 4DPCX 1BBDL 3TZVA 3B7SA 1VJSA 5G4NA 4OCYH 2RTTA 3V0IA 4APQB 4YSCA 1S7XB 1OWWA 5F89B 2PP8A 1MSPA 4N2OA 1AACA 4N9GB 3RI5K 3LZPA 5A2IH 2G9KA 1FN4B 5HDOA 3PXJA 1DVTA 1ZPLA 2VZTA 4OFKA 3MLXH 2BW4A 2NYZA 4M7LL 4YGAB 5T3XE 4NS0A 1PZAA 1CIDA 3DX0A 4KQ4H 4PWIA 4K2UH 3VM5A 3OXSA 3BD5A 2J5LB 3NCXA 2LQRA 5DVMA 1HOCA 4N2HA 2UWEA 5TFSH 4FFVC 3RGVC 2EXTA 5MEPA 4H0LC 3U7AA 2H3XC 3QUKB 4URTB 1RUML 4NT6A 2B1OA 3B43A 3TCLA 3LN9A 5E8NA 2ITEA 5ECJE 1E28A 3W2DH 2PUQT 5ENWA 2LOEA 3U4BH 3BISA 4KTEL 1ND0A 3IDYC 4RISL 4LOUD 4U1KB 1XMEB 1YDPA 3KM2A 1JHLH 3CLWA 4LPUA 4PFEA 4HPHA 1FZMA 5FW8A 3ZZ1A 1CICA 5HD8C 3GJEA 5M95B 5ANHA 1LYQA 3ZTEA 1A7NL 3VD7A 1AMXA 3BAXA 4LEEA 1J87A 3R0NA 4HT1H 4XODA 4MXQD 1Z5YD 1NCAL 4NQXB 5IV2B 4L9DA 3WFDH 2DLFH 2NY7L 2UYLA 3QNXA 4UV4L 4L8CA 3L5HA 5AW6B 2CHZA 1F41A 2X42A 5KANG 5D7JA 1OB0A 4BFIB 1L7TH 4FQ1H 1WP6A 3C6SB 3QIUD 2J72A 2ATPA 1N4XL 4DKAA 4XWGH 3BPOB 4EUPB 1PF3A 2IQAB 2FQDA 1PFOA 3IFLL 3WHXB 3HE7C 4ES8A 5T1MB 1PW3A 1YY9C 1CFQB 4AZUA 5GGTH 1TFPA 4RCAA 3O3DA 3KYKL 2DI8A 3U83A 4PRBB 3QVAA 1D5IH 4QXUL 1BGXL 3B1UA 4HETA 1TJGL 4WHYG 1GW0A 4XZUB 2AEQH 4YL4A 3AACA 1XCTA 3CVHB 4PMFA 1A7BA 3BWSA 3C2AL 4Z7WA 1IAIH 1QWNA 1UXMA 5KYUB 4FYQA 4M7JL 4Y2OB 1OCCB 2GUOB 4ZDHA 5F7HA 1EZUA 1LEGB 2M8XA 3QWOA 4FFYA 4BH7B 4OD1L 4ZI8A 4A2EA 3WXWL 4ZFZB 1BLIA 5F7FA 1PNDA 4ZUSB 1E3XA 4G9DB 1E6JH 5HDQL 3MCLH 2G75A 1P4LB 3ARQA 4RMUA 5E1AA 3CJJA 4GAGH 4OZGE 5FK9A 2ZG1A 1A6WL 4XWOD 4NPJA 5FXCH 2XY2A 4Y5XA 1MIEH 1AY1H 1SYVA 3B6SA 1K4DB 4NQCB 1E5CA 4FCAA 4Y4FD 4N2FA 3AY4A 2DQEL 5L2KE 5HHOD 4LF3B 2FWOA 2HP4A 2OI9B 2CGRH 5JYLA 2IXQA 1VRSA 5J56B 3FQTA 2W0PA 3D2UA 1QZNA 3VXRA 4HJJL 2VRAA 1NCCL 5ETUB 2R2BA 5BQ7B 5DQDH 3BPLB 2XWDA 4LEBA 3WO3B 4F8PA 3QIWC 3ORJA 5E7FA 1G7HB 1KY6A 1MW0A 1RURH 5D5MB 3V4VH 4HBQA 2A83B 3OGOE 1KGYE 1QBML 4YBLB 4U1GC 5AB2A 5DC9B 3UPAA 5DJYA 1AMYA 3TJHD 1EDYA 4RLDA 3RRQA 4Q7DA 3GHEH 1AXTH 2UXVA 3MJ8B 4LOFA 3UEQA 3UTSD 1O6SB 5A40E 5TE4H 1WHPA 2QV2A 4KXZH 1LP9A 1DEDA 3M17A 3QEQD 4UQDA 1OW0A 3L9BA 2E4TA 4KAQL 4Z7VF 5MEQA 3HAEA 3T3PE 1NMAH 1T04A 1NGPH 5KUMA 1RIVH 1BYNA 2ZWYA 2F58H 4TNFA 3SCMA 5A16A 5CBAA 1HHKB 2JVUA 1ODAA 3GZQA 2JK5B 2M26A 2N56A 5FLVA 3W5MA 3I9AA 1VA9A 4P5MA 5TJWK 2ZWNA 4AYDC 5F9WC 3RKPA 3O4OC 5EEVA 1A9EB 1IKNA 2XQ0A 4K3GA 5D1QC 5EIVA 5FPIA 4UMSA 3KBEA 4K3EL 1D5MA 3QGVA 1VPOL 2IBGA 2D0HA 1IAOB 5CGTA 1FORH 1NOFA 2GSGA 4F27A 4KQ0A 4AIXA 3VG9B 1DR9A 2WJ5A 4GS7B 1UM6H 1D5XB 2ESVE 2MCPL 3GIZH 3BUBA 3X1GA 2OS7A 3VVWA 3DX4A 1ZANL 1P84J 4OLEA 4JN2A 4QXGL 4AZ8B 1Q8MA 4TN9A 2XOTA 4XP1L 5KVDE 4NX0A 3TVMA 5I1JL 1KULA 1IQWL 4JANA 5EC1A 2DEYX 5LCVH 1MHCA 4PJCA 1Z9SA 5SWZA 3V5KA 5AAWA 2CH8A 2QDVA 1PZ5A 3BEWB 1BVLB 2DM3A 3HC3L 1FH2A 3DI2B 3M1CA 2W81C 3P0GB 4QO1A 4C56A 4X4XA 4OFYA 1JNNL 1RPKA 4J4PC 4XX1G 5C2BH 1HL8A 2ROYA 3AXIA 4DN4H 3ZRSA 3VXMB 1G9MH 2PLTA 1JDDA 3AUWB 4NN5C 5E2TH 4Z7NF 3F85A 2EH8H 1XBDA 1JRHL 4Y19E 5D7SL 1I1RA 1Y6NR 4IOFD 4NRYA 4PGEA 4NUQA 2XV0A 1RZFH 4LIQH 4YVUA 4M8UA 3VFOB 3ZGHA 1Y0LA 2F2HA 3CDYA 3KR3H 2IDTA 4ELDA 5I8CA 1TZGH 2M83A 3B9KC 1G1CA 2WXQA 2R29L 1AGFB 1DLFH 1YNTB 1OP4A 5TGBA 3ZQ9A 3KBHE 4AY0A 3QUYA 2L0DA 1DN2A 3VTMA 1AGBB 5F7NC 2PYEE 3ZE2E 1XF2B 5DFWH 3PHQA 5DEGB 4JPKL 2ZAGA 3N0PB 5J1AB 4R90L 4W4OC 3BWAA 3CN0A 3LJ3A 4HWBA 1YEJH 3H6AA 1KTBA 4ONGL 3BKJH 4PRAA 1T5KA 5E4EB 1V7NH 1P1VA 2D7TL 4L4VE 3DX2A 1ZLWH 3N43B 5D6DC 4AWJC 1MJJA 3K2MC 3VH8G 3T3ME 1MZZA 5I1GL 3JV6B 3CDZB 2MTAA 4XHQA 4TUOA 4IBQA 1FL5B 1NANI 2R0KH 3MACH 3CQFA 4OZGB 3UBHA 5I16A 3FOLA 4I13B 1DQVA 2HVKB 2C8NA 4OZHA 1ZGLB 4XMVA 3L13A 3T1FB 1BOGB 2I07B 5EEYA 2VDMH 1P4IL 4HDIA 4HZLA 4DO4A 5AG9A 5L2KB 2P44B 4HHAA 1SRDA 2X1XR 5CNHA 3VH8A 4XNDA 2AQ3A 4KZDL 2QQLH 4ZX5A 1R1CA 4ZTOL 2XU9A 3MRCB 1D5ZB 1F1GA 2IGFH 3O2DA 3X13B 2DL9A 1JGDB 3QHFH 4EJ1C 4BGDA 1QI3A 3ARUA 5LUMA 4Q14A 1SMOA 2AABH 1JFQH 1QLFB 3POCA 5DRNA 1SJXA 1RVFL 4QRTB 3MXVL 3T2QA 4X9YA 1A3ZA 3ZE0E 5A43C 2FR4A 3FT4B 3CFCH 2XX0A 2JXMB 3RX8A 4ZXBA 2OSLA 1BD2D 4NO2A 4Y16D 1G9NC 2FECI 1TO4A 3NCEB 4X9FA 1DUYA 3VE0A 3L3KA 1O0VA 1PKQB 3DETC 4OGZA 4LCYB 4LVOC 4MXVF 4TPRH 1NGWB 5IFAL 4YWGH 3BQUB 1DDTA 3OXRB 4M1DL 4F7CA 2CDFB 4B96A 3T3PB 2DDQH 3HLAB 4FNLH 4FP8H 2WIIA 1T4WA 1CLCA 2H32H 4K71C 5CHNA 1VKXA 5HI3D 1HI6B 1OAUH 2BIOA 2KZKA 2NXZC 5DLML 1TIUA 2DBLL 5GRXG 3QYNA 3GSOA 1SXAA 4ALAC 2Z31B 1MHPL 1OL0A 2XKSA 1EX0A 2E6PA 4MAYB 2BIHA 4AJ0A 4YHYB 4A7SA 2ENYA 1M2VA 1NCGA 2A6JB 1VADA 1U91A 2PXYD 3D39E 4LLVB 2J2ZB 3BUYA 4AE1A 4XNUH 1NBYA 1ACYH 5BZWB 3GFUA 2EEDA 1GC1C 3FQXA 4LCIL 2ZD0A 4LARL 3RX5A 4BV1A 4WWKB 5ITBL 2JE8A 4WWID 5I6XC 4KC3B 3QW9A 5T1KD 2G3ZA 4X9BA 5B4MC 1H6TA 2X87A 4OZFB 3NDZE 1UOVA 4AEFA 2WMPB 3SDDC 3UAAA 3WNOA 1AD9B 4LSVL 4HUNB 3IXAA 5DUPH 3ZK0A 3GQFA 4IMKA 3UJIL 3T6QC 3OMNB 3LEXA 3QUZA 4ZMLA 5FO8A 4XNXL 5ALBL 2QPEB 1DE4B 2Z35A 3BVXA 2XWRA 3IETB 3VD2A 3K6SB 1S7UA 4ZZKA 4S1DD 2XXFA 3V6FA 3NJVA 4U1NB 2GJ6B 3UBXB 3LSOA 1A5FL 3TV3L 3MGOA 5F97E 4F33B 1G6RH 4DQOL 3CHXA 4OKDA 5L2JA 3TBVB 4KXBA 1AS6A 2I60H 2OZ4L 3FFCE 5ITFB 3TZVC 1M7XA 1HWGB 4UTBH 3U30C 4F7TA 2F5AH 1V55B 5E8DL 1B0GA 3LEYH 3A47A 3MNZB 5HYSG 3FO1A 2DJSA 2WOBA 1XF3B 4AEHL 5HGBA 2EUVA 3ECWA 1NKGA 4N0CC 4OF8A 4RBPK 4XPHL 2DWEB 2GPZA 3KLHC 3BDBA 3MNDA 3ULSB 5ABAA 2MKWA 3FPXA 1EZLA 3CFEA 4HXAH 2VDLH 4FQLH 4JEGB 5AOJA 2WKOA 3ATDA 3SJVA 2EVFA 5DFAA 3H2QA 5TDOB 3EBHA 4G8EB 1SHSA 1HHHB 1AGDA 1Z6JT 2D03L 3HKZA 3ZTDC 1A6ZB 3P4MA 1HXYA 5HYSA 4B9YA 1N64L 5E9NA 1LL1A 2AFNA 3OKLA 2Y7LA 1NBZB 1YMHA 3TBBA 5DQ9B 5J6GA 5ISZB 4JHWH 4J3OD 3L6FA 4FJZA 1NANH 4X7EC 4A6YL 5L0QB 1ETZA 2ZCLH 1UWFA 3OKNA 4OIFA 4YE0A 1IUZA 5E6YA 1F13A 3X1NA 1F3JA 5IFJB 2JELL 4Z7UB 4KDTA 2EVHA 4PJGB 5BV7H 1X5HA 43C9B 2Q7NA 5DMGD 4N90E 3L4VA 3NA9H 5I17B 4U6TA 3MODH 2NNRA 4AXWB 4Y2DA 1Q0YL 4ZO8A 2NW2A 1B0IA 3FT2B 4TRPL 5LGYA 2BHUA 3HI6H 3VD0A 4PJXA 1SYSA 3MQIA 4JLRB 1JZ6A 2MCAA 4L1SA 4ERSL 4JPSA 4DKEH 5IB3A 2ENPA 5J9PA 4LEOA 3T3MB 4HLZG 2QELA 4HJUA 4OFPA 4XP9L 5I19H 4R5TA 4JBSA 2GW5A 32C2A 3TNNA 2WBJD 4HCRA 2YA1A 4OGYH 3TOPA 5KVEH 3W39B 3MNMA 2Z8RA 4NAJA 4BWWA 1KCRL 1TMQA 2V5RA 1MCWW 2R4RL 3F00A 4ODHH 2HJKA 5BO1H 1GL4B 1GHFL 1F4HA 4Y5YC 3SQOH 3VJ6B 4NQUA 2VW4A 2CMRL 3A23A 4MQSB 4E41A 3VFRB 3TONA 2OMTA 2NQCA 3ML9A 4Y19A 4J5VA 1WIUA 1HNYA 1GOHA 3CDGA 4FQ2H 3DRQB 3AB0B 4XOEA 2N0KA 2VJXA 4LKXA 4P2QE 2XZQL 4JRFA 3VGAC 3HMXA 2OL3H 5I0XA 5LAXA 2DH2A 3K71B 2MRYA 3NZ8A 4M7KH 1XGZA 1LMIA 4QJ4B 5C09A 5AKVA 3ZGIA 3QB7C 4M4PA 4MNQD 1IAKA 3W11C 4JG1H 4AC4A 1CXKA 3BH4A 1BVKA 3DNKA 2NY6B 3WDHA 4TLSA 3MLSH 5B3JF 4K8RH 4OD2B 4XB8A 4ODWB 1WO2A 4D3CH 4JM4L 4PRHA 1OT2A 1AZVA 3D48R 3ILQC 4W6YB 3ZSTA 2A0LC 3QXTA 4ADGA 1HJCA 3P9MA 2XG4B 2WLNA 1YEIL 2ZUUA 3DX6A 4PYGA 3UTOA 3NJXA 5HGGS 3QPQD 4Y5XC 5D7LD 5LGJB 1D7DA 3S98A 4BKLB 3P2TA 1ZHNB 4X99A 3CK0L 5BMFH 2XZCL 35C8L 1WWWX 1F0LA 2F54D 3ZR6A 5L4IA 5IT2L 3D12B 4GQ9L 5D1ZA 5L6YL 1T0NB 1N67A 2EADA 3WTWA 4MZIA 2VDQH 1Q1PA 1RJZB 3D39B 4UTAA 4LBEA 1DEEA 2E9BA 3H9YA 3TEZA 3CVIH 1SOXA 1BQUA 5T1LA 3SGKC 2VXUH 1NMBL 1CVSC 3NIDE 1MQKH 3G04A 2V2XB 1AO7B 4LCWA 1SMAA 3VD5A 1JZIA 1OAZL 2XIBA 4I9XA 1OTUD 2Y9RT 2ZWZA 3QISA 1NDTA 5IUSA 3NFSL 5CGYC 1SM3H 3B3IB 2WKGA 2NYKA 1UWXK 3NIGE 3X12A 3VA6A 4IRJD 2HFGL 1G9HA 2ALWA 2GB2A 2B5IC 3TYFA 4G8FA 4WU5B 2V5YA 3WEBA 3BWUC 4LSPH 3MRJB 4FQQB 3IMUA 3IFPB 3A67H 4JPVL 3OB8A 1ACXA 1DQLH 3T77A 1KFGA 1OW0C 4GP4B 4XBGA 3ZRFC 4CADA 4EDXB 3FFCB 3TNMA 4OJAA 3BZDA 5D70H 1AAJA 4JRXE 4YDVB 5DO2C 2F18A 3ARRA 3SCMC 3TASA 1BXUA 5EO0B 1LILA 1L0QA 3QFGA 5EZJB 3J27A 3IJSB 4WFGD 2OMYA 4G70B 5IZ7A 1IKNC 4PV9B 3RPKA 4DTGL 3PGFH 3L3HB 5EB9A 4AGQA 5BOZG 3LV3B 3S8GB 5JQ6L 3QXAA 1QNZL 1G4RA 1ZHKA 4GJTB 4PB9L 1TYJA 4FI6A 1UACH 4NDMB 3B4NA 3RWGB 3KPRD 1WT5A 2NX5A 1JWMB 3D0VB 3L5XL 5SX4I 5ERWB 3ARBB 3RIAF 2UV3A 4IU2B 2DOCA 1IFGA 1R3IH 4LLYA 5DJ2A 5CMAB 2GJPA 2WQSA 4NUJA 4YSDA 1G7QB 3H3BC 1PAMA 4HX1A 5F3HA 1NCBH 4N0YL 2P3YA 3AADB 2ZUQB 4RFNC 3FZUD 1KB5A 4LDOB 3QP3A 4J6RL 4ZPVA 4DO6A 1VERA 3V4PL 4HJ0D 5I73B 5IR1B 2RCSH 4LU5H 3TVMC 2FGWH 4GRWE 4YLCA 4WFED 1J5DA 5AAWC 4JCLA 2EEBA 4PG2A 3S96A 2VN6A 5B7EA 2ZOLA 2NR6D 2X6AA 3AITA 4K5PA 2H0PA 4M8QB 5E6RB 4AL8L 1R0AH 1ONQA 3BEVA 4NBYB 1LE5B 3MGTA 3TBSB 4OT1L 4P5TD 1F11A 2XRAH 4UYPA 1RK0B 4WI2A 5MENE 2E6JA 4U0RC 4BUGA 4G6JL 2A77L 1GS8A 1NDMA 2A6IB 1QAWA 3IF1A 4N9OB 1KEML 1SHWA 4KKAD 4BQCA 2ALAA 4MCYA 4QY8A 1MCFA 1GW6A 3OWRA 4NP4H 4E0RA 3IM1A 5EOCJ 1UZ6F 4UB0L 5F9AC 4C83B 5FR3A 2J55A 4ZD3H 1TYEB 1YN7B 2GITB 3FTZA 1FG9C 3VQ1C 3G6JB 2IH1A 5HVFB 4XCCH 3L1OH 4ZS7L 2IADB 2DAVA 2P8MB 3CU1A 3TJPA 3WG7B 3QUYC 3U0TA 3KZ8A 4JFFA 2ZYIA 2HKFL 1SQMA 4P2QB 3NJIA 1ZA6A 4QRPD 2ORBH 3ECQA 1NGXB 4R84A 4ANUA 3BKMH 5JMRA 1JK8A 1ZLSL 5C08D 3IDYB 1L9SA 1A21A 1NEUA 2OMWB 3NZUA 4FFWD 4G11A 4NKIL 5E5MA 1JOIA 4ZSOB 1E30A 4PVNA 4HOXA 4DUXA 2YR3A 4AQ1B 1GC1L 1GKEA 2V33A 3SBWA 3LIZL 3P30H 1J1XH 3EHBD 1JHTB 4Y1AE 4K7FA 5IB1B 2HKHL 1IGYA 4ADJA 3HI1B 3KXFE 2V7NB 5I24A 5EZOL 5KBDA 4ISVA 5BVJA 1DSFH 1OAYH 3BXNA 3FFOA 2KMWA 4ELMA 1KPUA 4RAHA 2X10A 1UM4L 2VLKB 2X6MA 4Z6AT 3PAZA 1UB6B 1RULL 2XBZA 4GEJA 3H9HA 5JXAH 5C0GB 4FHBD 5I1HH 5I75C 4GUQA 2HJFB 4KHXL 4PJIE 4NO3B 3DX8B 1UATA 5IJKA 2DQMA 4GSQA 1AKJA 4IOSD 3NH7L 4D2NA 3P0YH 1J8SA 4PJFF 5HYJA 4CDHA 3FQWA 3TBWA 3HE7B 2AJVH 3KLHD 1EJ8A 3JV0A 5HJBA 4HF5L 3BCFA 4NAQA 4GSDL 2DQCL 5CEXA 5AD0B 1GGTA 1BCIA 4MNGB 1O5DT 3AT9A 3QUMB 5E9DB 4Z76A 4JPWL 1TU2A 1HSBA 4A2FA 1WE5A 3MRQA 4ZODA 5JOFB 1NCWL 2VLLB 1P7QD 1TTGA 3APMA 3VXTA 3V5HB 2IJ0C 3NIDB 4M6OH 5DJ0B 3APDA 3EF4A 4G1EA 4I88A 4BWTA 1J11A 1INEL 1S78D 4ZXBC 2XA8L 3P4OA 3TWYA 4Z7QF 2CLVB 4W6XB 4DGUA 2ED9A 4UAOB 3QQ3B 3NIGB 4X83A 5FCUL 2ZXCA 3AG2B 4FC3E 1CICD 4BXSV 6CGTA 1USQA 3U9UA 1H9VA 1OGAB 3H3KA 2YKLH 3OG6B 3L3JA 3ROOB 4IHBA 4XVOA 3OX8B 5SX4H 3RQ3A 4OJFL 2I9LB 2EIBA 2IALA 1K2DA 3SDXF 2GK0B 2LT9A 1XEUA 3AS2A 4GBXD 1G7JA 5EBWA 5D7JD 1MCQA 2WWKT 4PV1C 3U0WL 5IMLB 3FSZA 4KNQA 3FUJA 4YDNA 5I6PA 2EYSB 2NSQA 5F96H 3WV0A 1UG9A 3QNZB 1OP3K 4CBPA 1RY7B 4AQ8A 3UG4A 3RILA 3WAJA 4HC1H 1BXXA 2AK1L 4MYPA 1S7QA 4A6YB 3DGGA 3K6DA 1BAFH 1RSFA 3L4CA 1FE8H 2VKXA 2VLRA 4CVXB 1I1YA 1AQKH 5KYWA 4JKKA 4QGYA 3H0TB 4KK8C 4H7VA 4WI3A 2VERA 3H7BA 3LS4L 4TYUA 5GS2H 5DJAB 1KXQA 5DZAA 4F2FA 1M1SA 2Z0BA 1A4KB 5IHZA 2E7LA 2V17L 1ZJBA 3EYFA 5I30L 3WL9A 4IMKC 1CZ8L 1A6AB 2GY7B 2JJWA 3QUZC 5BOPA 2KYIA 1CTMA 1Q1JL 2OYPA 3I50L 2B1AL 4I4WB 1P4BH 3MJ9A 4FTDA 1KLFB 1MPAL 4WSGA 5IESL 2K3TA 1WK0A 3R06A 2OP4L 2DI7A 3KPSE 3MROA 5IW3A 3DHPA 5K1JA 3KJ4B 5LBSH 2FO4B 4H88H 1FDLH 2P5EA 3MOBL 5GXBB 4WAFA 2W60A 3CWGA 3P2BA 2EDFA 3DX1A 4GW5A 5AYUL 3S35L 3GMMB 4K0OA 2DQ6A 3ECVA 3IAPA 4PHZA 1BAGA 3S3JA 3K6OA 1MCOH 2BVOB 1OANA 3GI9L 4A39A 3GUTA 1R3LA 4A55A 3NACL 4RGOH 2KERA 3STZB 5F71A 3OWEA 2CU9A 4JRXA 4KJWC 2ZE0A 5F9WB 3IMWA 3O4OB 4LPVA 4ONHB 2CKNA 1N0XL 5IB5A 5D1QB 4LRIA 1QLRA 3F6LA 4H8HA 4RAVB 5C9JB 1IX2A 2ZCKH 4ZMXA 3M07A 2VLJB 5D96B 4P05A 4PJBB 2LAAA 3C75A 1BIIA 1MCIA 1H8LA 1BQKA 4HK3J 2A9NH 3H2PA 4PCTA 4Z7VA 3L3IA 1NIBA 4L37A 4E9YA 1QRNB 5FYKD 4U6YA 4Y2LA 2K6ZA 2DL2A 2JKIS 3I6GB 2VWEE 4FXKB 4NLHA 2K6WA 3I75A 3G5XA 1T1ZB 4H2AA 1ZWIA 2WW8A 4CU7A 4KDTC 5ESAA 1MFNA 5T5FL 5DS8B 1DVQA 4Y1AB 3AQDA 4FGMA 3EIFA 3G6DH 4QRQA 2EKSB 3WYRA 3UO8B 1YNKL 4Y2DC 5ACZB 5JW5A 4MSWA 2FUTA 3JWNH 4KGLA 4JQIH 3GHBL 4RMWA 5GIRB 1RP9A 2AK4E 3OF6A 4W9LC 3A4EA 1HH9A 5C0AE 3MMEB 4Y8AA 3OAUH 2CLZB 4YDKH 4LFHG 4W9DC 2OTWA 5IEHB 3FN9A 2DQDH 4PJIB 1JHKL 1I8IB 4X8XA 5DFVC 3SKJL 3V0WL 1E4XI 4RQQA 5AVQB 2P28B 1C9SA 4Y4KB 5EIQA 4RAUA 3FT3B 1PAZA 4OZ4B 3SODB 5DD1H 3WD5H 1T03L 2YD9A 1X9QA 1B88A 3IBEA 3LQAL 4KI5F 4I5BB 1N5YL 3GBDA 2XN0A 5FYKU 5PAZA 4WJG3 1HYRC 4G6MH 1KTLA 1WZ1H 2BNRB 2XV6B 3BPCB 3VSUA 4KNTA 3WXVH 3B9KB 2DQFB 3AM8A 12E8L 1A1NB 1MCEA 3U7WL 3JXAA 4AG4L 5E70A 4I77L 4Y5VA 3QWRA 1N10A 1URZA 3K0YA 4JS7A 4MB5A 5CEYA 2WO4A 4XVJH 3R7QA 3HPJB 1QTYT 1IC7L 4KDVA 5G5DB 5ADPL 4OCNC 5KVMC 1JJUA 3CLFL 1BM3H 4N5UA 4XPBH 3KJ6H 4WKZB 1CB4A 1CLOL 3PAVA 1BQ5A 4F92B 4DETA 4JO3L 1U8JB 2CA3A 4WHTB 5TQ0L 3BAIA 1XB6A 1A6TB 1QFOA 4KWUA 4U1SA 2AZAA 1QSEE 1ZIBA 1ZAGA 3MOAH 2BOCA 3KWUA 1L6PA 3GZPA 4XCNA 3BH9B 1U8CA 4L3EE 3RWCB 5I0ZA 3LVEA 4C4KO 1X5GA 1OO2A 4S1RH 2YK1L 4NKDB 2ZPKL 2FHBA 2HTLC 2ZOOA 3KBFA 4IU3B 1R3HB 3HS9A 3QH3B 4NRXB 4JM2A 4RX4A 2Y25A 4A68A 5DC4B 3SE8L 1L0YA 4UINH 3WKPA 2KHAA 4JE4B 3W38A 4RMVA 3WNJA 5K9QG 3GK8H 5D1ZC 1QI5A 1I8AA 3PP3H 5IFHL 3AFLA 3QS3A 1HKLH 4HA1A 4UILH 3V7AG 3JVGC 4PTUA 3QDJE 4M48L 1ZOXA 3TA3C 5IB4A 3JWOL 4PGCB 5T3XD 2Q86B 3W9DB 3UTTA 2E27H 3CSGA 2RAMA 3IT8D 2H7WA 4S1QH 5DMKB 1X44A 3BYYA 5CJXA 5HY9A 2K1MA 2P26A 4NWTL 5DJXA 1KCBA 1LK3L 1FNLA 1C1EH 1BREA 2BP5M 5TE6H 3MOQA 1VZIA 1X9LA 5JORA 3GSXB 4RNRB 5HGDA 3FRPB 1TVHB 1ITCA 1U58B 1WEJL 1WFMA 4HUXB 4EAEA 4WFHE 4FLHA 3NPZB 4PWGA 5LBGA 5L7XH 1OCZB 1CFTA 4FA6A 1EO7A 3VFSA 1P6FA 3O6KH 3VWJB 2NTFA 3VXPA 2W0LA 2VNCA 1PLGL 3SDYL 4FMFA 4O2FB 4YAQB 1YCSA 1UFGA 2OTPA 3BLBA 1MAJA 4K71B 4JDEA 4G6AC 4KZCA 4X98A 4XPAL 1K8IB 5DK2A 2NXZB 2HRPH 3NIFB 4UUJB 2BO0A 5JIKA 4HIEA 3QUXA 3DV4B 1NSNH 4N8VG 5CXPA 5BJTB 3RL2B 2J3SA 1SJEA 4P5RA 2AQ2A 4EN3A 3QRGL 1FV1A 4LSRL 3C8KB 4NM8H 4ZT1A 3WGUB 5AB1A 2HX8A 3VWKC 4L3AA 3HC0A 3REWA 4HV8B 4KQ3H 1MVUB 4R4NC 1ID5I 2PWDA 1ADQL 2QGDA 3APCA 3ZJAA 1Z32X 3WELA 2YZ8A 3QJFB 5DMJB 1LQBC 5DVLA 5C0CE 3GLDA 3LHPH 4WSKA 5LHDA 3L7EA 1J0YA 1EUTA 4XAWL 1U8MB 2JKNA 1UD3A 4HIHB 5LXVA 3SDDB 2X70B 4N8VA 1E4XH 3R19A 3WY2A 1UA7A 2R2HB 3V4PA 3A3YB 3ULVE 1ZXKA 4YPGB 1UH2A 3NFPB 2CLRA 4FL4B 2X0VA 2W94A 2V3EA 4OV5A 1O7DC 4ZTPL 3OQRA 1H3WM 4OM0H 5C0BE 1ES0A 2HMID 1CG9A 1QFPA 3MUGB 3AAZB 1S3KH 1A1OB 3EGDA 4PG2C 1T4KA 5LJYH 1T7XA 1U8LB 4HXBH 4PI0A 1YEKL 5FECB 2FEDD 2AK4B 1ODUA 1XCQB 3TZVB 1E2ZA 1KFAL 1Z0NA 5CJQL 4FQJL 4PEEA 2NDFA 3KPSA 4UM8B 1SF5A 5FS5A 4LGSB 2IOIA 5EUKA 3BP4A 2DYPA 1YQVL 3BCDA 1MWAA 3L1GA 4UOJA 1A02N 3WNIA 1G1KA 1KGJA 1T3FA 4IRSB 1B4RA 1UUSA 5FB8B 2WXJA 4KFZC 4LAQL 2FIKA 3PIQB 1KC5H 4Z8FH 3BKYH 1UD2A 2E8YA 2J88H 3AG3B 3L3OB 3U4AA 1HOCB 3CXDH 1J8HE 4KVNH 1SBSL 4PUBL 2AJSL 4UWQB 1QWUA 4TLUA 5A2LH 3RTQB 4D0DA 2FSEA 2IH8A 2K45A 4PS4L 5MEPB 1FZKB 5L2KD 3RWDA 3F7KA 1N6QH 2YAEA 2H9GA 5E8NB 4OLXH 1LEIA 4YHML 5HSFA 1UOWA 4K3DL 1HFUA 1ND0B 3Q8FA 4XMLL 3C60B 4HP5A 4WTZG 2ATKA 3NJNA 3ZTCC 4L5FL 3SBWC 4JQVC 1E0OB 4CKQA 1A6UL 3BVNB 3NABH 1JVKA 3FCBA 4EIBA 5ACMA 1OTSC 2HVBA 3CSYA 5B1AB 3U4EA 3KLQA 3E3QE 1TOXA 3FUNA 2PCFA 3RNQA 4JFSA 4QRRE 4DEUA 2XWCA 5TF0A 3GT6A 2YBRB 3BHBB 2Q7YB 2UYLB 3O3BA 4JO1H 3QNXB 4GP8B 3RA7H 4R9HA 4L8CB 3GUFA 2FJFA 2FBJL 4DJMA 4L3EB 3FL7A 1KZYA 2YA0A 2HRLA 3L08A 4WTZA 3RUGF 3BX7C 4WY7L 3N06B 2ATPB 5EHFA 5CBEA 4N5ED 5IJKC 5C0AA 2X38A 4UOW1 3GMPB 4OCMC 4J2XA 3MSPA 2P42B 4TUJA 1AZBA 2B59B 4Y5YB 3OAZH 1GTNA 1P7KB 4MQ7A 1DQDH 3NVQA 5CCHE 1A9BB 2WAHA 4MX7A 4F58H 3A4FA 3O3DB 5EZIH 2Y07L 5BW7A 3QDJB 5KS9F 4O02L 4PJHF 3UMNA 3VFUA 5B8CA 1N70A 1QTPA 2XTLA 2YMXH 4LHQB 2EJ1A 4WIQA 3LRMA 3BE1L 3Q9PA 2YFOA 4DGIL 1Q0EA 5LN4A 2BS9A 4ZDHB 3LYRA 4JFWA 4NIYE 3QWOB 4GI9A 3FKUS 3CNKA 4XPFH 2ESVD 4Y0GA 2OJZH 5CR1A 2WXGA 1JF5A 1A4JB 1QHOA 3FB5B 1KENH 3G3LA 3T4YA 5C8JB 3MLPA 1RZ7L 3Q6FA 1MFDL 1OPGH 2COVD 3U0PB 2X2IA 4UV7H 5KSBF 1OT4A 3NCMA 2Y7SA 1GA2A 3O11A 3QJHB 5FK9B 1MCPH 4CVZB 5AB9A 4GUOA 3FTSA 3CFJA 4KKBC 1MHHB 4YZWA 1KTJA 4NCC2 4QWWC 1ZIAA 4I87A 3SKNB 1FYTE 2F1BA 4R5VA 4OQTH 2VXSH 2A9BA 5GGVH 5C07E 1GMEA 3REVA 4AQ8C 2FWOB 5K1VA 2UY6A 2F53E 3ZVVA 4E42B 3EGXA 2IXQB 5GRJL 3TT1L 1EDHA 4MJHA 4IGBA 2Q2LA 5BXFA 3VAEA 2PMZA 3O41A 1RHHB 1SBBA 3ZKMC 2W0FB 5C6TH 2R2BB 3SYCA 4YUEL 5DTFA 2P8LA 2E7LC 4WUKH 4M61A 3EBGA 5JYMA 4AMXA 5C86A 5C0CB 2NY3B 3EGSB 2GC7C 1HXKA 2CKBL 4XOBA 3WSQH 2YFNA 1N0LA 2WZPA 1KELL 1OD7A 3JWDH 4PWKA 5GS3A 2H1PH 1SF3A 3BLPX 1WA1X 1TPXC 2OA9A 3LN5B 4GSXA 2I7SA 5DJYB 2GSIA 2RQ8A 1DBAL 1PLCA 3IDMB 4YC2B 2F7PA 5IVXF 1E4WL 4DVRH 4GQRA 4LOEA 4X6BA 3U9PH 2PCYA 2PYED 1D7BA 2EDNA 1NC4A 3DO4A 1KZQA 4E5XG 5JLZB 3BN9C 4HKXA 2IAAC 1OCOB 3M17B 1J8KA 4PGBB 3FQUB 2A6KB 3HFMH 4NBXB 5GSRB 4LEXH 5E99H 5FWRA 3SE3A 3DRTA 3PF2A 5FOBA 3PY9A 3IGLA 4L4VD 1WPCA 3SKMA 3SCMB 3BZFB 3MBWA 1H6UA 1BA9A 2V7HB 4L23A 5HVHC 5AZ2H 1JGLL 2NNXA 3CZEA 3OR6A 4FZ8L 4P5MB 5L8KB 3S37H 4EKXA 2Z8WC 4E5XA 3WBDA 4NHCL 3MRFB 1XX9C 4LRIC 1I1AA 3BUIA 3UTZA 2GFBB 1AR1C 3VTAA 4JCMA 2O5XL 2Y7QA 3QBTB 4O2CB 1RXLA 1AGEA 4JK0D 4AVIA 2IFGA 2DRUA 4MYWB 4PREA 2NY1D 4GXFA 4IIQA 4AIZA 2GSGB 5BS0A 3AJ7A 3ARGA 1MAMH 1U2HA 5TK4A 2V9QA 1E43A 1T21B 3K91A 2L8AA 4GMTL 1CE6A 3T8XB 4YBHA 2EVGA 4JN2B 4RFNB 4JW3A 3U4KA 5C0RL 2EUXA 1BQHG 4OZIE 4L3FA 3QZBA 3TVMB 1YLBB 1VACA 2NCEA 1JNLH 2O6PA 3N9GL 2E76C 1MHCB 5SWZB 1Z9SB 1F1DA 1CBJA 1JGVL 3AREA 4QRRB 4MASA 1ERNA 1VFUA 4XN1A 5D93B 4KOCA 1PY0A 4L3CA 4QO1B 4YJZL 4HOMA 4XNZB 4CN1A 1RCYA 1DDHA 5K33A 5F7DB 1UA6L 4U0RB 4X8JA 3FUMA 5AVTB 2J1YA 4HVBA 4B9IA 2TRYA 2UZXA 1N2RB 1NC2B 5GS0D 1SXBA 3ILPA 1F8TH 1HL9A 3ZMNA 3TBTA 3ME0A 4TKWA 4I0KA 1A6VH 1NJ9A 1TDQA 3TPUA 4N2IA 1BV8A 4HPYL 4P4KA 5DWUL 2NNCA 4GG6A 2YQ3A 2DIBA 4M9OA 4XPGH 2NY2D 1ZHLA 1RD6A 3AM8C 3KYMA 2YPVH 1UWEL 4Z7OE 1T89C 2AI0L 3GEWB 4CC0A 4MLIA 1GGYA 3TN0A 4LP8A 1C5CH 4EZMA 4Q9RL 3D39D 3P4LA 2ZCHH 5KTEL 1AHWB 4HS8L 1UQSB 4I3GA 4DVBA 1YYCA 4PJ5E 4LP5A 1KWGA 5GGTA 3HZKA 3BWAB 3EO0A 4YL9A 4J3OH 3TF7C 2OTUB 2R69L 1PMYA 4J1UB 4MDRA 2EO9A 2YEZB 5F1KC 4GKNA 4TUKH 4AM0A 3QPXL 4XNYL 1OOAA 2ZX9A 4R0LB 4PRNA 1I53A 5KVGH 1OT1A 2ICWA 4JHUA 1VCAA 2EINB 1MREL 2FNBA 3FF8A 3QZWG 5I75B 2ZOKA 4XMKL 5AYQA 1AOZA 1COBA 1E3ZA 3BH8A 4XCFL 5KYXA 2G60L 3AVEA 2IDQA 3FFCD 4JM2C 2WXNA 4OLZH 4OZHB 4PJ8D 4FQXA 1P0SE 3QQNA 1K4CB 4OGXL 1S5HB 3O3EB 4DZ8B 2CUMA 3OL2A 5SWSA 3CXFA 5F3BA 3ABLB 3OJMB 4HHAB 2IH3B 2ZX7A 1I8LA 3VH8B 4WJ5A 1QW9A 1RV6X 1W8NA 1ZHBA 2R8SH 2NZ9C 5C97A 3Q05A 3IJ9A 2J44A 3QZWA 1EERB 2HLEB 5CJXC 2OYLA 3EYQD 5D4HA 1MELA 3JTSA 3IKKA 1YJDH 4ZUWA 3VU1A 2ICCA 4HU2A 5CF3A 1XXDC 4CMHB 1KIPB 4G3YH 2D4DA 3HMWH 1NM4A 4KJQC 2QADC 2HG5A 4KZ0A 5JQHC 1UURA 4JR9L 3L3KB 1N19A 1Q0XH 5JW3L 1LE9A 4QNPF 1FRGL 3QO0A 1OP5K 4DN3H 5LXGH 2FO8A 2CE6A 5HGHB 1KF9B 3V4VA 1TVBB 4XMWA 2AC0A 1KCVL 3K3QA 3O9WA 1NGYB 4F7CB 2FL5B 5C0ND 4N90D 3VRIB 1IIIA 1IM3A 1E5UI 2WIIB 4A67A 4AK2A 3N55A 4KVCL 3VDAA 3PWNA 1O5PA 3I9IA 4FG0A 1I7UA 5I23A 1MJ7H 3MXWH 3QUXC 1ORQB 2G5RA 3HPLA 1AKJD 5GRUH 2W92A 3BWZA 1NL0H 4HOZA 3NCYS 4DP9X 2WXPA 2ZSVA 4EN3C 3KL5A 1VADB 1OAKH 1U91B 2HH0L 1ETB1 1IBZA 2Z93A 3AU1A 4H44C 4U6VH 4XBEH 1A9VA 4ODXA 4WNQA 3PJSA 5HI4C 2VR6A 4O58H 1YG9A 1FYTA 5C07A 4M5ZL 4PP2A 5DD0H 4KU1A 2XWTB 2CO1A 3KWWB 2ZP9A 3IB4A 1JZEA 2XQYG 3HS0A 4N68A 2FX7L 5AVRB 2D9CA 3EUUA 2IDSA 4V1DA 3SDXA 1IILE 1NCJA 2AXWA 4YVNA 3ARXA 4GLRI 3IXAB 6FABH 3VXNB 2CNZA 3GXUB 2AQSA 2FNWA 2AKRA 1BVOA 2HWZH 2JCCE 3LEXB 1JPSH 1W91A 3B3BA 2B4CC 3ZL1A 3V6OE 5I66A 4PRPE 3TEXA 4P2QD 4XC3L 5CIPH 1S7UB 1M71A 3ARZA 2J1WA 4MJ5A 3S36X 4PR5A 3V6FB 1P5VA 2IANA 2FGZA 3HW7A 2NXYC 3TWCL 4AOFA 4OZIB 2IIJA 4ABWA 5EC2B 4HWZA 4ZFOB 2VRKA 3GSNA 3MGOB 4G6KL 2YN3A 2FEJA 2XQYA 5D2LF 2FSDA 3IVKB 1JPGA 3PWUB 3P3UA 1VFBB 3FTGA 1B0GB 2IWGA 1A4BA 4QHNA 1P6AB 2DLTA 5DYOA 4OBRA 3KWTA 1JZ4A 1J5IA 1WH0A 4PS3A 3O6ML 1MHEB 4JFTA 3KYOB 1NAML 2QTVA 15C8L 3US9A 4BCXA 4R6UA 4O5LH 4R7DA 2PR4L 3RIFF 3V4UL 3ZW3A 2GCYA 5GZOA 5I76A 2VAAA 5LCVA 4LVHC 3B2UD 3SJVB 4JHZA 3BIBX 3QXWA 3RJDA 2LGNA 3UTQB 2PYFB 3PAYA 1BWWA 2XLLA 3D0AA 4TSAL 5HJ3A 1AZRA 1TZOA 4UT6H 3P4MB 5CLTA 4FEMA 1OCWH 1KTRL 3D0LB 4G1MA 3UAJC 3WCYA 2MKLC 3SZKC 2YJQA 5J6GB 1KJ2L 2P80D 4Z7OB 3L6FB 4JFZH 2OR8A 3C08H 3QO1B 2Z7ZA 4APXB 5IB2A 5F1OB 5IIEA 3ZKNC 3WU1A 4XPTL 3H9SA 1DVFA 3Q2CA 4ZS6D 2IGLA 3UG5A 4HHWA 2E9WA 1QP1A 1A1MA 3BDYL 4ODTH 3ZDYE 2R0ZH 3QZMA 5IK3B 2C9AA 4NGHH 3WIHL 2XWBA 5GJTL 5I1KH 5FA3A 4XCEB 4TNVK 3JVFC 3VG0H 3QEGH 3HBZA 1NKRA 3OAYH 1XMWA 4FNPA 5AAMA 4ABUA 1KEGH 5F0LB 2AMGA 4S2SB 5TH2A 3VD3A 4ZNEA 5FGBA 1G9NH 5J9PB 4EIUA 2BSBA 2VH5L 1SLUA 4BFOA 4NKOB 1AXSB 4HFUH 4PLJC 5D72H 3I74A 3UC0H 1WFIA 1F4XH 3RKDC 4UAHA 4YQXH 5EN2B 2Z4QB 5C3TA 3IGFA 3L7FB 1OSYA 1BQLL 2WP3T 4OF5A 4BXVA 8FABA 1U21A 1I8MA 1J18A 2AQRA 1JIBA 4JRXD 3LZFH 4E41B 2WTRB 1RMFL 2CKBB 3BP5B 2B7DT 3GO1L 2P48B 4F9LA 3MJ6A 3S3BB 3CDGB 4KJYB 3FUKA 2LLLA 3EYUL 3VFTB 4BQ6A 3FCTA 5DI8A 4NZRL 3L17A 2BVTA 3FMGL 3M46A 4PJ9B 4LKXB 3VXUA 2DMBA 5F88A 2H3KA 2VXQL 1HDMB 3QC5X 4NPYA 4HUUA 2H3NB 2IVFC 3HBGA 3PWPE 4N0RA 1N9PA 3D30A 2X7LA 3N41B 1MIML 3QFJE 5D7IE 3NK4A 4DPRA 4GRLD 3VXOA 5LNDA 4X6CF 1JF1A 5FO9A 1IAKB 4P23B 4NOFA 2I69A 3GM8A 1RJYA 1IM9D 4FHKA 3IJHA 5D4JA 3Q01A 4PJ5A 1AE6L 5EIIB 5GGVY 1MNUL 1MY5A 1P2CB 4MD4B 3SOBH 1T0PB 1QSFE 2XG5B 4PRHB 3S48A 3EYSH 3MLYH 3U1QA 3QAZB 5I1AB 3AXLA 3OF6D 1ACZA 4HKBA 1JDAA 4P0DA 1CGVA 4XXCA 5IMKB 3MRLB 1T83A 5J57B 1ROWA 3KLLA 3Q1SH 4GLRH 3BSZL 1J5OL