2X0UA

Structure of the p53 core domain mutant y220c bound to a 2-amino substituted benzothiazole scaffold
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Toward the Rational Design of P53-Stabilizing Drugs: Probing the Surface of the Oncogenic Y220C Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x0uA00
3QYMA 4L18A 2IOOA 5AOKA 4GUQA 2BINA 4AGOA 1YCSA 3VD2A 1UOLA 2XWCA 4G83A 4L0ZA 2J1ZA 3D06A 3Q05A 2BIOA 2H1LM 1EAOA 4IJTA 4AGQA 4L0YA 4IBWA 2P52A 5BUAA 4G82A 2YBGA 4IBVA 3QYNA 3TS8A 5LAPA 2IOIA 3WTTA 1TUPA 1KZYA 3IGKA 2X0VA 2J20A 4A63A 3WTSA 5AOJA 4AGLA 2J1WA 5ECGA 4IBUA 5AOMA 2BIPA 1E50A 2X0WA 5AOIA 4MZIA 5AB9A 3US1A 2AHIA 1HJCA 4IBTA 4GUOA 5A7BA 3KZ8A 1CO1A 2J1XA 3EXJA 4IBZA 5ABAA 3WTUA 2J6WA 2BIQA 1EANA 3WTWA 2OCJA 4KVPA 3IGLA 3D08A 2WGXA 3D0AA 4MZRA 3KMDA 3D09A 1TSRA 4LO9A 3WTXA 3D05A 4HJEA 2FEJA 3VD1A 3D07A 1IO4C 1T4WA 2J21A 3Q01A 3EXLA 2AC0A 3WU1A 2IOMA 5G4MA 2GEQA 4IBSA 1CMOA 1GZHA 1H9DA 2BIMA 4QO1B 2XWRA 4IBQA 2ATAA 3US0A 3VD0A 5AOLA 2VUKA 3WTYA 5LGYA 3ZMEA 2PCXA 4AGPA 2X0UA 2J1YA 5G4NA 4IBYA 1HJBC 5G4OA 1GZHC 3Q06A 2RMNA 4LOFA 4LOEA 1EAQA 4AGMA 2MEJB 5KBDA 1LJMA 1HU8A 4XR8C 3WTVA 2ADYA 4AGNA
chains in the Genus database with same CATH superfamily
3HHMA 4LLUA 5C6PB 1TQUA 3QUXC 5C0ND 2HTKC 3FUHA 1P7KA 2DQJH 2OP4L 4JX0A 4EIZC 4C56B 4FFZL 3BAWA 5LN8A 2GK0A 5LVEA 3B3IA 3MV01 2PCFA 2HSIA 5AUMB 1X7QA 4YDJA 5B1JC 2X4QB 5AZ2L 1MWAB 3ZDYB 1UZ6F 5DR5L 3ZVVA 4YSOA 1MG3C 2AS5M 1AD0B 3ECQA 3R19A 4HLEA 2OLDA 3NSJA 1F42A 5C0CE 1I4FA 4PJGF 2OMXB 4QLRA 2W80C 2Y2WA 2GSIA 3O4OB 4GSDL 5AKTA 3RWFA 2P8PB 1X9RA 3QXDB 1K2DB 1TU2A 2UX6A 1QR1A 1IM3B 3IKCA 2FX9H 3EFFB 4YLBA 4Z9KB 3G6JE 3QRGL 4B9GA 4A2FA 4ETYA 1FYTB 2OI9B 4Y9EA 3LXCA 5IMOA 4HS6A 2NYYD 3CQQA 3H3PL 4U6VL 4TVPH 4YAQB 3SE9H 5EG6C 3DVNB 3K71A 4OLWH 4ZUVA 2KLTA 2A1WH 4Z7WE 3WFHB 2ZXEB 2NY3C 4P4RA 1EMTH 2DQEL 2MQGA 1T2QL 4WTQA 1AQMA 3S34L 3ZPDA 1VLXA 2AK4B 3KPRA 2MPAL 4ZMXA 3FSZA 1UWYA 2PW1A 2OR9H 1DN0B 5B39G 5INDB 4A2DA 2IFFH 3E6FB 2FYYB 3MRPA 4J3VA 3ZKQD 5EO1B 3O3BA 4TKWA 4KKBD 5IBUB 4HFUH 1G6RL 5ENWB 2E6QA 5GZND 4KV5E 4E9RA 5CCKL 3R7QA 3FQYA 4PRIE 4XNMA 4YVUA 1LEKB 3V0JA 3TURA 5KAQG 5ALCL 1H8SA 4ZFZB 1BYOA 1I1FB 3PJNA 4FS0A 1QW8A 4YGVB 2BZ7A 1MFMA 2PXYB 1Q38A 4EQ3A 2WLJA 4FN0A 1A9EB 4PS7A 5JYLA 3WS3B 3HC0A 3K6OA 1W8NA 2EIEA 3ULAB 4JFOA 3TJEH 4FTVE 1YEHH 1J8HE 3KWWB 4GJTB 2BFVH 5D1QB 2NOYA 1KGUA 3VW3L 2CGRH 3RGBA 2YLHA 2NX5E 1GCFA 5AVVB 1PZ5A 4LVHC 4Z77B 1HZHL 3FB7A 4ADGA 1HI6B 1Q72L 3RWDA 1BCIA 3F7YB 5A6IA 4GSRA 4CUCA 2RMNA 1ZT4A 1WCBB 5L9DL 3ELAT 2V3EA 3EH1A 3DO4A 1P1ZB 1XGRB 1CIDA 3WTVA 3EBGA 1E6JH 2YFNA 3NDYE 3S4SB 5CP3A 2ZICA 2AJ3A 4H0HB 1JOIA 4BH7A 3B9KD 4U7MA 1UWGH 3QJHA 2X3AA 1P5VB 1QLRB 3VXNB 3UTSB 5BPPA 4FQ1H 5D7KD 5JOPD 5L7XH 1O75A 4P46B 2AZUA 4X98B 5JW5B 4ZMTA 3E8UL 4JG0H 3UBXG 4G3YL 1VFUA 3MA9H 4G9FD 5DJ8A 3CLWA 2N0KA 4FQIL 3RPIA 2NW2A 3BVVA 3G3LA 2V17H 4IBVA 5C7XH 1AYRA 5I1GH 5DQDH 5AB0A 1F8TH 2GAZA 2VSCA 4ELDA 1TTFA 2Y36H 3LD8B 3QQ4B 1A9VA 1ITCA 5TGBB 2W9LA 3AACA 5J89A 1IJ9A 4PJCE 3GSUA 3KYKH 3QXAA 4DF9A 4GKNA 1F4HA 4PJFE 5EOQL 1VIWA 2VO8A 4HT1L 1BM3H 3QSKB 3RDTA 2NUPA 4I2XA 15C8L 3O6LH 3SOTA 3FUJA 1U30A 4M6NL 2AEQL 3NZ8B 4G1MA 1EJ8A 5I1IH 1AXIB 3NYKA 1E28A 2WPGA 4OZHF 3UJIL 4A6YA 2B2XH 4B6ZA 2H2SC 3ES6A 4MAYD 2CJSA 2VDRB 5HI3D 4TVPE 3BP7A 4K3EL 5AL0A 1BZ8A 3P2BA 4JPKL 3RDTC 1HOEA 1XIWD 2HKHL 2J5LB 1OCWL 1PIFA 4HGMA 2E8ZA 1J0HA 3WXVH 4WO4D 2HT4D 3K74B 2W88A 4Z3EA 1WIOA 2WWMC 5C0CA 4ES8A 3Q01A 4LHQB 2UZIH 1K72A 2J8OA 4MA1B 1REIA 5BXFB 1S7QB 1NFIA 1N7ML 2AEPH 1LMKA 3O8XB 3G6JA 2O5YL 4L8BA 2YGVA 3CLFH 5GGVH 1RHHB 3CH1B 4RNRA 3WIAA 3CBRA 4QYAA 2ATAA 4UT7H 3MV8A 3HN3A 2DKMA 3CDZA 5JW4N 3FONA 1P4BH 4BXSV 1QLFB 4ZO9A 4PSRA 4R0LB 4LLVB 4EI5A 4OV5B 3VMOA 4HJ0D 1Z9MA 3EO1A 1PQZA 4E9XA 2OP4H 5FR3A 1NJ9B 3OKOA 1CTNA 1WQVT 4JVWA 5D7LB 1XXFC 1LO2L 1FL3A 3SDXB 2DDQL 4XVJL 1HXMA 1JHTA 1VCAA 4PI2A 1AGBB 5B39A 1W0VB 4XZUA 2JCCF 3PWPD 2C3GA 4AEHH 5DR5H 3QR1A 4OW6A 4AVKA 3W9DA 5B7MA 2EEAA 1UC6A 4EI5C 4GSDH 4EZJA 4PY8J 2SODB 1ETB1 3O3EB 4FE9A 1WGOA 3V4PB 2NXZC 5FYLL 3QEGL 1C12A 2NY2D 5FYKH 1JZ5A 3GPEA 3X1FA 3GJFA 4GO8A 1HHIB 4QAWA 4YDIL 5C7ZA 3IEAA 1AACA 3H3PH 5DJYA 3EOBA 4Z5RB 4QJ5B 2WAHA 2UXGA 3NIDB 3WY4A 1VDGA 3NZSA 5GSRB 2PPDA 1PY9A 3D33A 1S9YA 2C9AA 2MNWA 4FQQB 3T71A 5I19L 3SBQA 2DQEH 4IBUA 3P0VL 5CBAB 3S34H 1GSMA 3BSHA 2BRQA 1NC2B 4OUUA 1TQBC 3PGFL 4P9ML 2D3VA 4JJHA 5FFLA 1Y18B 2WVUA 4HV8A 5GGUB 4G6KH 3FL7A 2WYHA 1G6RH 1E2ZA 2EJ1A 4CVXA 3E1F1 3LH8A 3RZCB 4RWYL 3TWCL 1WWCA 4MNGB 4CSTA 2CMRL 4OFYA 4X5WA 1HTYA 3PE9A 3Q9QA 4K71C 2BSBA 3IGLA 2AXHA 1JYWA 4CJ0A 3ARZA 4OFPA 2WUBL 3L3JB 2VDRL 2WTOA 4PWFA 3VQMA 3QDJD 4PSPA 3EOAB 4RAUA 2X4UA 1U6AH 3UBXA 1NFDB 4A7TA 3OG6B 4DN4L 3VD1A 3T2NL 3CU7A 3KLSA 4BM7A 1ZV9A 4IU2A 3VW3H 1EPFA 4IS6B 4PG9A 4O58L 1FO0B 1YQVL 3BAXA 4N2FA 3ZL2A 3MLTB 1TENA 4IBSA 1HZHH 1Q72H 3OPZL 4U7SA 2BZCA 5HVHB 4I85A 2JI3A 3QUHA 4YSRA 2XKNA 3LSOA 4XBPB 3NJLA 2JJWA 5ICXB 4LVNB 3VRJB 4O9HL 1RV6X 1ETZA 1EHXA 2VLLA 1RIVL 2A0LC 3QJUB 4OD3L 1YMMB 3RP1A 3OTTA 5T5FA 5G2NA 3VUAA 2F5BL 4AEIL 4PS3A 1ZHBA 3KL0A 3E8UH 1PPIA 4H25B 3TN0D 2AJXL 4FMKA 4FYSA 4G3YH 4XMUA 4TTGA 2RQ8A 3DARA 1LGVA 1TQCB 3VSUA 5CP7A 4M4PA 5EU5A 5GRYA 4I18B 1MWAH 1OXYA 1T5WB 4HXAL 4AQ1A 2ALWA 1FIGL 5J9PB 3OJMB 1ASPA 4LNVA 5EOQH 1J5CA 4M1DL 3V4PL 4L0YA 3BKYL 5CD5D 2DYRB 1GC1H 4HPHA 4CSPA 5AEAA 5DJZB 3L9YA 1F11A 2YJQA 5FYKE 2PO6B 2HVBA 5I6LA 2QGEA 1KXTB 3FU6A 1TQTA 5E5LA 4AQ1C 1AAJA 4D8OA 2G2RB 4MASA 2NXYD 3D52A 4IRJA 4K3EH 5DFWH 3IRPX 4I88A 5EZPA 5IQ9B 1UM5H 3V0AC 4U2YA 3CHSA 1ED3B 4JPKH 4PJ7B 5G5DA 2HKHH 4PVNA 4Z7OE 1YEWA 1KV3A 2F0CA 1A2YB 3GSOA 2X53A 4EI6A 1MCWW 2X88A 3WCYA 1DP0A 2H2SD 2NNAA 4C4KO 5E5MA 3EDEA 3WTUA 1G9MH 5KYXA 4FQHA 1WBZA 2C7UA 5AYTA 1N7MH 2WD0A 3RDTD 4IRJC 3A6CL 4N0RA 3KGSA 2IALA 1KGYE 1G4MA 4HGWA 4AW4A 1MHEA 1FFOA 1RP8A 5KSAA 3IDUA 2Z8VC 4C59B 2B8OT 3EHBB 5EN3A 4AYMC 1MFVA 1N3NB 2BP8A 3BQUD 4UNTA 4AE0A 2P24B 3PLYA 4P5KA 4IK7A 1Y07A 4WFFE 3DSNA 3C8HA 1FO0L 2CCLA 4WFEE 4FFYA 4AKOA 2W0PA 4HWZA 2E76C 1LO2H 1WWWX 5DCCA 3WKPA 4XMTA 1IM9D 4Z7VE 5KSAC 1U8PA 5C0CD 1UKTA 2D0GA 3P69A 3EO0A 3VXRA 4LSDA 2J1YA 3CVHH 5EC1A 3X17A 1JZ7A 3N6YA 1L5GA 5E1QA 3UZEA 5JPMB 4FQPA 3ETTA 4AJ0A 2O1AA 1HJBC 1M3IA 3IDYB 4JFWA 1D6EB 4MSWB 1IZKA 1NOLA 4FHBD 5EIQA 1KEMH 4X0KA 4BA0A 1PVHA 3V52L 4YDIH 2WO2B 1FNGA 2WUCL 1KIUA 1LO5A 3IXTB 4FG6D 1UB5B 4PW3A 4C56E 3LNFA 4CU8A 4ZFFB 2G0KA 3CLEL 1XF3B 4TLKA 5IFAL 3CX5J 5I19H 3C5SB 1Q1JL 1FL5B 2XICA 4LHUB 3P0VH 3UZEC 1B6DA 3WYRA 3D06A 1PW3A 1EEYA 3FCSB 2ZWNA 3PGFH 3Q6FA 2MJWA 4P9MH 1H5BB 3BUPA 1WUZA 3KPQA 1N6UA 3HMWL 2FEEL 2GBAA 3ROOA 1SQ2N 1PMYA 3Q2NA 1EHKB 4PRID 4TQEH 3BLKA 4RWYH 1VENA 2YFOA 4XB7A 2JLLA 2XWJB 3C6LA 3DPDA 3TWCH 2FJHA 5FKAB 43CAB 4B9JA 1E43A 4MXQC 3G5WA 2A83B 5I2IB 4F3FA 4Y4KB 4AM0A 1FYTE 3RUGF 2WUBH 4RGMC 3WFCH 4PEEA 2EUWA 4ZO7A 5AB9A 2EYTB 4QCIA 2WYIA 4FTVD 4ZJ9A 1I3UA 1XGPB 1J8HD 4XPTL 4FFZA 3AXIA 4DN4H 2LT9A 5CFAA 1A66A 2VE6A 2VJ8A 2YA1A 3H9SA 4AQEB 4I1PA 3BIKA 2TSAA 2AK4E 2NX5D 1HQRB 2VABB 3WHXB 3C6LC 4WUKL 1CR9H 4LGSB 4O58H 5IBUG 2EDMA 1OGAB 4PD4J 1X5FA 3MJ6A 5EU3A 3OPZH 1HXYB 4DGWC 1RHFA 1CVSC 1UZ8B 2GSMB 5TJWK 1JK8A 3LZLA 1ZWIB 1MIML 5DJXB 2IH1B 2NY6B 2OM5A 2LFEA 3HPLB 2DWDB 3TBVA 5F6HJ 4ZODA 4APQA 2J7LA 1D5RA 2WVVB 1R47A 3MRRA 1J88A 3PWJB 4OD3H 1EVTC 4BSVB 3HOGA 5FX3A 5KSVA 3PXJA 3QO1B 3T09A 2ITCA 1QFOA 3OLIA 2PETA 4QF1B 2AJXH 3P3UA 3S5ZA 1UASA 1AR1C 4ZOAA 3ZHFA 2N4IA 4A1RA 4BXVA 3S3CB 3NJXA 2BERA 1XBRA 3N91A 5BW7A 3UIYA 1QI3A 2RQEA 1RP9A 1P4IH 2DQUL 2Y7QA 2ZYIA 1PKQA 4HXAH 4QYOB 3VFVA 1RZIB 2V2XB 4APQC 1G6RA 4KRPB 1FIGH 5DJ6B 3WEXA 2Y1VA 3S4SG 5D1ZI 2Y06H 5C0GA 4FA7B 2A6DA 1RZJL 3P3YA 4YNYB 5D4IA 3V4PH 4HUUB 3BKYH 1CT8A 4Q4IA 4GRWF 4JFQB 1H6TA 3U4BH 1S78D 5F96L 3VFGL 3P30L 2A9AA 3UTSE 3PHAA 1JVLA 4IMLA 2V2WB 2JK5B 3N1QC 4TVPD 2ADFL 5HD8C 3DC0A 1D5BA 2QSVA 1OO2A 1QSVA 1AH1A 4IJTA 1G7IA 4NN5B 3REVB 2V7HA 2I60L 4FC3E 4OZ4B 1B3IA 1FJ1A 1PG7W 1O6SB 4X83A 3PL6B 1MHHB 2ITFA 5ES4B 5E0QA 3CSYA 1TJIL 4YWGL 3SPHA 3V5DA 2M1KA 2ZYHA 1FVDA 1S9XB 3KAAA 1ACXA 2VDKH 5GRJL 3UYRL 3QPQD 2KHAA 3W38A 1BXXA 3O6FB 1XF5A 4P99A 5AG9A 5HHOB 5D6DA 3A6CH 3L5WB 1IBDA 3QZWB 4LLMA 1N5YH 5K9KB 2D7NA 1DLFH 4Z0BL 1AP2A 1NPNA 3WN5B 1UCBL 1BQLH 4L8SB 4M3JA 3QJZA 3CK0L 1BZ9B 3KWXA 5D9SB 1E4XI 4GAGH 2MKLC 4OQTA 1VZGA 5BQDA 1O9ZA 1OM9A 4XMVA 3B4NA 3TFKD 1J11A 4IRJD 4L4TB 4UILL 3WY3A 3UTQB 3FO2B 5I5MA 1YNTB 2X4QA 2YARA 4GBXB 3JTTA 1AD0A 5D6DC 2J8UB 4PGDB 1JPTL 2VZTA 1DR9A 3FFDB 3MNVA 4M8UA 3UACA 5J1AA 4FAAB 1P2CB 5CZRA 1RVFH 3RPKA 4JGMA 3C60B 2P8PA 3FN9A 3HW7A 1LP9F 4F8PA 5I1CH 2CPCA 4GS7C 2WIMA 5CLYA 1IM3A 2J21A 3EFFA 1VGKB 4F7EB 4FQLL 1HK6A 2E27L 3KD4A 4P06A 5M95B 4GOSA 4P49A 4PCTA 4OIFA 3QR2A 3FH5A 5LXGH 3U1SL 4YAQA 3SCMD 4BK4A 5LBSL 3GQFA 3PDDA 2KQMA 3GNML 2DV6A 3WFHA 3MDJA 4WW1B 4J6IA 1OPGL 3O4OC 1V3KA 1KEGH 2R2CA 2YD9A 3SQBB 3VSTA 2WUCH 1CU4L 4PRDB 2AK4A 2LU5A 2DWTA 5DLLA 3M1BB 3I9GL 3QGVA 2OAAA 4JLRB 1DN0A 3BH4A 2J72A 2XQYK 3L6FB 3QFJB 5IFAH 4NSKB 4O4YL 4OCWH 4DZ8A 2CK0L 4IRZL 2FYYA 5KUMA 2ZCKL 3SDXE 4F20A 5EO1A 4YSQA 5DMGD 1ZJAA 4HQQH 2OI9C 5ENWA 4AGMA 1NBZB 1YN6B 1GMEA 3B9EA 4K5PA 1LEKA 3HMWH 3SOBL 4OCXH 4B5ZA 4H8WC 1NEUA 4NI3A 3KS0H 2Z0BA 4ZFZA 4KJQC 3WKML 4YGVA 1FVCB 4R8WL 3DSFL 2Y23A 3NP4A 1WLHA 2BNRE 3TYFB 1A9EA 1Q1PA 4G8GA 3UEZA 3WS3A 3QZOA 4NFBA 5A2JH 3KWWA 2XG5B 4LLDB 3KLLA 4NUJB 4RISL 1DJWA 3S48A 5D1QA 4ORZC 3NIDE 5DQ9A 4DZBA 4MMZA 3O3AB 1AE6L 1ZHNB 4D3CH 1Z5YD 4XPTH 3EFOB 2OK0L 1XCTB 3J7HA 4Z77A 1BVNT 1RZKL 5JOFB 3K3QA 2A9NH 3N40P 4N3TA 4Q97A 1FSKB 2WN2A 4WUKH 3ATEA 1ZV2A 1AGEB 3RGVB 3LQAH 1P1ZA 4DIXA 1XGRA 1JHLL 3HI6H 3MBWB 1P5UB 3MLXL 3QA3A 4NM8L 3WLBB 5E7FA 1NICA 2WY3B 4RH4A 1A4KB 3HG1A 2IXQB 4MNGE 1T7XA 5D1QC 3ZE0B 4MMZC 4LLYB 2G60H 3QIUD 1P5VA 1QLRA 4DP5X 2C9PA 1MIMH 2BM3A 2BOCB 2WCGA 3EYOA 3UTSA 4YSCA 3TGXA 4JHAH 4P46A 4X98A 5JW5A 1JNHB 3ARFC 2AEOA 3N44F 4YL9A 1CFSB 3N41F 1T83A 3GXPA 4LDOB 3V2AR 1NLBH 1JWUB 3FNKA 1XAKA 2WQXA 2XN9A 4KVPA 1NFDE 5E08H 3X14A 2AGJH 3ZOAA 1PD6A 4EN2A 1CDUA 3MOBH 2ZWSA 5IB1B 2BVPB 1AANA 3QQ4A 1YHPA 5TGBA 1G5GA 1QNIA 5HGHB 3SPJA 1BFTA 3E80A 3H9SD 5IQ7L 2Y2YA 4ZXBD 1AOZA 1DE4B 1S7SB 3JV0A 4ZW7A 4YSPA 4YE4L 4TTDC 4P46C 4FMFA 1GJIA 1EJOL 1TO5A 4W4NA 4NZUL 1T83C 3DVGB 1EERB 3FRPB 4G80A 5CEYB 2FCBA 4A7GF 1HHJA 1ZA3B 4RMQA 3DOIA 3HRZB 1AGDB 1RZJH 4PJ5B 6TAAA 1RLWA 1T04B 3QEQB 3NZ8A 5EZIL 3VNYA 5A2BA 5KS9F 3LD8C 3UG4A 1F5WA 5GRVK 5FYKD 3VFGH 3QFDB 2O6FA 3K2UL 1F4WL 4JKPH 3ISYA 3RWJA 2I27N 4B50A 1WPCA 3UGUA 4OAWB 2NW3B 4Y5XA 1ROWA 3KM2A 1XTLA 4B41A 4B9IA 3N1PC 4U6XB 5AVRB 2K3TA 1NCNA 5D55A 2I60H 4M8VA 3KWVA 5K1NA 1BZDA 3PP4H 5BXFA 5IQMA 4FJ6A 1TJIH 4MNQB 1T0PB 3H9HB 4B9PA 4WSGA 2HLEB 1MI5A 1JGIA 1RHHA 3NJJA 2J5LC 1SJHB 5C97A 1R33A 1GZPB 2QVKA 4Y5XC 1CJYA 1X7SA 4TPRH 1G7QB 2XWXA 2K4WA 4ZAKA 3ARSA 1HL9A 3ROLB 1QLFA 1TEYA 2HX7A 2XFXA 4LLVA 1IBGL 3DURB 4Z0BH 1JNJA 4OV5A 1O6VA 1HCFX 4MA1C 1NWPA 4LEXL 5F89A 4OKVA 2WXGA 1NJ9A 1D9KB 4M5ZL 4MJ5B 5E94B 3IMVA 5D7LA 4M6OL 4Z3GA 3SDXA 4WFFD 1LE5A 3N42F 4WFED 2DMCA 2EC9U 4L3FA 5IMMB 4ANUA 1W0VA 3WDJA 2KZBA 3FO9B 3G5XB 4K9EH 1TSHA 2V9TA 4BZ2L 4ZAKC 1USZA 1JPTH 1E67A 3IU3B 3KL3A 3QBTB 3ZE2F 2HKFH 4R7DB 2DJSA 2C9XA 1A6TB 3O3EA 3V4PA 2CKNA 4EXPX 2P9RA 3TBBA 1TTCA 4YFDB 1OE2A 2E27H 4ZI8A 1HE7A 2ZX7A 4QTFA 4QRQB 3FU0A 3D08A 3LTVA 1JE6A 1HHIA 3AWEA 1E4WH 4L2LA 3CVIL 4Z5RA 1NL0L 4JJOA 3U1SH 4B9CA 4KKZA 4TSBL 4KNUA 1CI5A 5GSRA 4HKZB 4XODA 3VRLF 5C0JA 3VI3F 5D71L 1U8QB 1OPGH 4C56D 1Y7VA 4NIYE 4WVRA 5CBAA 2FR4B 3C2SA 1CU4H 1NC2A 4GT7A 3E2HB 3G08A 1BGXL 4X4KA 3FJTA 2CK0H 4IRZH 1Y18A 2HUEA 2ZCKH 3IJ9A 5E8PB 3MOAL 5GGUA 5LG6A 5DEZA 1BMZA 3RZCA 2QQLL 2R4RL 4HUXB 2TRYA 4PP1D 3J8F7 4CN1A 2V7NB 3VSQA 5AOLA 3ZE1F 3SOBH 5I1HH 1AJ7H 1YN7A 1IM3D 1WA1X 4M4RB 2EKJA 4U0RC 4FXGB 3IETA 2UWEF 4ZZFA 2DRUA 1JG9A 2IV8A 2VQUA 3F58L 3L3JA 4PU2A 1UT9A 2HLAA 3EOAA 5EOCL 5ESAB 1T03L 5I15L 1FYTD 2GJZB 2HFTA 1NFDA 4JM4L 3DHJA 3SSGA 3IMSA 4JFZH 4RISH 1F1GA 4JZNB 2MCG1 2ARJA 2XV6B 3CPLB 4O51B 5LBGA 4ZNCD 3RZCC 2BJML 3DI2B 2EDRA 5F7AA 1AE6H 1ZPUA 4H2CA 2XWBB 3KW8A 1FO0A 3MLTA 2AK4D 2KPNA 2B4CL 3DK2A 4Z76B 1RZKH 4P2AA 1A7OH 3PG2A 4FNLL 4WNSA 3K6SB 3B2UC 1HAWA 2AQ2A 2KUTA 1LQSR 4PJ8C 1NCOA 2X42A 5IKCB 1ZV5A 2B0SL 1JHLH 4PPTA 4XBPA 1HT6A 2HG5B 4XGZB 1U8IB 3A0OA 3GBNH 1MFUA 1D2PA 3VRJA 1V7ML 5FDWB 5AYUL 2AEIT 1YMMA 2PXYD 1C5DB 4U1JB 3VX1A 2JKJA 1OSPL 4NKOB 3IGKA 1H3TA 2HJLB 1WA0X 4H25A 1PIGA 2C4XA 5HVHC 3LS4L 3T8XB 2OQJB 3AT0A 4XN7A 4HX1B 4Z7UF 1MFBL 4KO9A 5AOIA 4I18A 3T3MB 4ODTL 3MA7B 4IBTA 2O6DA 4LVNC 4DJMA 1T5WA 3MRGB 1VZIA 4LLWB 1A6AB 3O3DA 4WI2A 5KOVC 1IAOB 1OGAE 1A7RH 5TD4A 1M05B 1O6TA 1MNUL 4ZSOB 2ENQA 3GM8A 2IANB 1EJOH 5I1KL 1AZVA 4NZUH 1TVDA 2Z4TA 4NZRL 1MCFA 1PEZA 4UV7H 1U3HA 1WIPA 2G3NA 1TQCC 2ZXAA 4Z3TA 3O2VL 3ML8A 5EZIH 2PO6A 4I18C 4IYKA 3G5YB 3GSNB 1KXTA 4P2RB 1MRDL 3UTSD 3QXVA 3WLWD 1QPXA 1TJMA 1XMEB 2G2RA 4P46D 1F4WH 1R19A 4YLQT 2B3RA 3MYJB 4O02L 2Y22A 1EZVY 1FFPA 1FZOB 4R97B 1ED3A 5JLZA 4PJ7A 2X05A 1YNLL 5L6YL 1ZS2A 1A2YA 1DQMH 3OPUA 4YHIB 1U3HC 3HC4L 4PJEF 4M7LL 1JF1B 4UZUA 3LPPA 2DKUA 1N4XH 5DXWA 1AI1L 5SX4H 2PO6C 3CZFB 3FF8A 3MXVL 5J8OA 4YJZL 2C1OB 4YBLB 3F7VA 4YPGB 5MEPB 2R4SL 4H26B 3MRCA 2K7PA 4GQRA 4AW7A 1RJZB 3HI5L 2CG9X 5EU4B 1KJ2B 3LQZB 4MB5A 1DJZA 2ID5A 2DS4A 2O72A 2MEJB 3CFEB 4MAUL 5AALA 1C8PA 1IBGH 2BOBB 2K6WA 4XO3A 3T04D 3N9GH 4L1TA 2FSEB 1V3JA 2XKUA 2NR6D 3WDHA 2H1XA 2WXPA 4EN3B 4W9LC 4WLCA 4LEXH 3TH4T 2EXYD 4OI8A 2XSKA 2YD0A 1E3FA 3T0EB 2KDYA 4E41B 3EKCA 4WFHE 1CTMA 2YQ2A 2DICA 3M07A 2X1XR 3N3EA 1OB0A 2DWYA 4GO9A 4QXVA 1QFWL 5IROA 3V0GA 4BZ2H 3ZKMC 3QS2A 3MRIB 2IOIA 2ZCLL 3O8XD 3QZWG 4NP4L 3ECBB 5HHOE 5IESL 2VMJA 3TCXA 4PIRF 4MSWA 4A04A 4PLKD 2RA1A 1MOEA 2Y69B 1GCYA 1NC4B 2OV0A 3C08L 4X42A 4EVNB 3NTCL 2VDPH 3C87A 5GHWL 3H6JA 5J3HC 1R5IB 5AVZB 2CHXA 2X0WA 3CVIH 4DT2A 3IXTA 4PP2B 1J5OH 1UB5A 3LDBB 4ZFFA 2YD6A 2WZPA 1VFBB 2F68X 4M43L 3QWNA 4JG1L 4XP1H 4NO5A 1TVHA 2C3XA 4OF0A 3HHSB 4X80L 1JIBA 2JLPA 1FL5A 1OVZA 5D71H 3GZQA 4JDZB 4L4TE 3BC9A 4P23D 1RK1A 1RZJC 1SDAB 3IDYC 5DVLA 2J8UE 3V4VH 3ZKND 1Y0LA 2VGLM 3MOAH 5HJ3B 2R56L 4D0BB 1A6VH 5DEJA 2VO5A 2X4PB 4AYBA 2QQNL 3VCLB 1AR2A 4YDVA 2QQLH 2R4RH 3RB7A 2XWJA 4LRIA 43CAA 1M7DB 2QFPA 3BFQG 3P1VA 1IIKA 4G8EB 5A16A 2A83A 5I2IA 1IBYA 3GSNL 3DHPA 4YFEA 1MCEA 2DH3A 3KBHE 4LCCA 2BNRD 3S6CA 2AV1B 5JUEH 4ZMYA 1URZA 3AMKA 1T03H 5EOCH 3UCRA 3P40A 2EYTA 2P4AB 4IDLA 1XGPA 3L45A 4JM4H 1I85A 4TNGA 2XQBL 4HALA 2B1AL 2BJMH 2VABA 3MBXH 3WHXA 4H0IA 4LRIC 3B9AA 5C08E 1HAUA 1NC2D 1OGAA 1HXYA 4Y4FB 4FNLH 4LCCC 1OM3L 5KVGL 2E6JA 4AYID 3U0TB 3AGWA 1SMOA 3VB9A 1JGDB 1QBAA 1UZ8A 3F05A 3QR0A 5T1DL 1I53A 3GDCA 5G4OA 1ZWIA 2B0SH 1I85C 2IH1A 1KJ2L 1JVKA 3UH8A 1DUYB 1CDBA 2DWDA 5C92A 4H8HA 1MFDL 4DN3L 3QAZC 2WVVA 3QG7H 5IJVB 4QXWA 5HDOA 4BSVA 4KQ3H 3B2UD 5LBSA 2FZ3B 5CR8A 1OSPH 3QO1A 5HYIA 3OQRA 3AS2A 4X5XB 3LZNA 4YHYB 6PCYA 3IGAB 2WN3A 2JE8A 2YPVH 1JV5A 3TBYB 1MFBH 2X4SA 4K3JH 1ZDQA 2ETWA 2NY6C 4UQ2B 4IRZA 5BVPH 2AJVH 4QYOA 1RZIA 1YEJH 2V2XA 5DJ6A 3T65B 2HH0H 3IF1B 2D7MA 4DH2A 3MLPA 3FS9A 1MNUH 3NP3A 4HAGA 4PBDA 3KVPA 2ZNWA 4WJ5A 2EDOA 3QEUA 2IG2H 4HUUA 4DGIL 5I1KH 4KHTH 2J5WA 3PP3H 3ZL4L 4NZRH 3SODB 3U4AA 3ZE0E 1X6LA 5E1AB 3NIGF 5AZEL 4JFFA 2ZTBA 3ZW3A 2YSTA 1OV8A 3O2VH 3V4LA 3BMVA 5DFVC 1E5BA 2JK5A 1CE6B 3AWGA 5E4AA 2EDLA 5IFJB 2CA4A 1J1PL 1MRDH 3U6XA 1YMMD 1ZGLP 3IDMB 1PLGL 2Z0UA 2F74B 2GJ6B 3LRHA 5ESQB 5JHLH 2MQ3A 2RCSL 3HBPA 1SZNA 2Q20A 5DK3A 3GZOA 3REVA 1CGYA 1WA2X 5HHMB 2OCJA 1THCA 2GJJA 4OZ4A 4S11A 1A7NL 3UAJA 3VDAA 4AIZB 4ZMQA 5I6OA 1O6SA 4K5LA 1FC1A 1MHHA 2BHYA 5IB3B 5GRZA 4ERSH 5IG7B 1M6OB 1NBVL 1S6NA 2P8LB 4J28A 1S9XA 3NMEA 1AI1H 2E9WA 2IPUK 3KJ6H 3FRPG 1PAZA 1WAAF 4L2YA 1MEXL 2JF1A 4OFKA 4PW4A 5EUOF 4NJAL 1SEQH 3MXVH 2UZYB 4PAZA 4RA3A 3GXDA 5HHOA 4BUGA 2R4SH 3QZWA 4NN5C 2ZWZA 4PJ5E 5K9KA 3QEQE 3GBDA 3WN5A 1CYXA 4K7PX 1ZVHA 3UAJC 3D69B 3CSFA 4ZUWB 3HA0A 3MREB 2DQTL 4PCSA 3WMQA 4L8SA 5C3LD 4IK6A 5FGBA 3WFBL 4JY6A 4PGCB 4L9LC 1DJXA 4YFLI 3VDCA 4BGDA 2PMZA 4L4TA 3KE0A 2LLLA 3UTQA 1JTOA 2YXMA 3FO2A 5E6UB 1V8HA 5DJZA 3F6JA 1XT5A 3V0WL 4PJAA 4NPYA 2F58L 5AVTB 1SJEB 3SN6N 3FFDA 3WN5C 2LU7A 4CVZB 3ARUA 4IMKC 2NSQA 3C60A 3IGUA 5FA4B 1QFWH 1C5CL 1HKFA 4LKCA 4L8SC 1E42A 3NSDA 1KCVL 4MNQE 4AV5A 2EEDA 1VGKA 1W80A 4F7EA 2N7SA 4JPWL 1CFBA 1S7TB 2ENJA 1IU1A 2DEWX 2ZCLH 4NP4H 2FWSA 2H1PL 3F2LA 3AT8A 4POZC 4I77L 5IESH 3ILQC 3I6GB 3RG1C 3PJSB 3C08H 5JORB 1BG9A 3NTCH 4HBQA 5GHWH 5JIMA 4WW1A 1QHPA 4DWHA 3EHBD 1NDGB 4AGQA 3ZKMD 4LLAA 3SQBA 3C60C 4F92B 4PRDA 4GKZB 3M1BA 3P54A 4JLRA 3L6FA 4AYSA 5I1EH 3QFJA 4JG1H 1BAWA 2QTEA 4NSKA 1X5JA 4X80H 1RUML 2VQTA 3GO1L 4I0CC 4OQ1A 1BX2A 4LPVA 4LRNL 2O61B 3BD3A 2X12A 4GI9A 1NBZA 3MNWB 2PLTA 1YN6A 1MIEH 1OKEA 2EE3A 3BGAA 4OCMC 2R56H 5IROD 1UWEH 4ZUUB 2GBVA 2QQNH 3TFBA 2LGNA 2YRPA 2V0AA 2WM0A 2Z7ZA 1I8AA 3U0PA 3GS7A 3I6KB 3TYFA 1D6VL 2FH8A 3DVIA 2MHAB 3BWSA 4NC1E 3GSNH 2Q87A 4UUJB 1Q9KB 3AQZA 4U6TA 2XG5A 4LLDA 4NUJA 3VFNB 3D9AL 2I7SA 4FI7A 2P8MB 4JN1L 3SDCA 4F33A 5FF6B 3AB0B 35C8H 3O3AA 1ZHNA 5FM5M 2XZQL 5EEVA 1XCTA 5AVYB 4XPBH 3VYNA 2WNWA 2XQBH 5CCGE 5IWLA 1U21A 2B1AH 4X6FA 4GIOA 4W68A 5C0BB 4XOEA 3QZBA 3FQNB 3G6AB 3GRWL 5JOFA 2DKSA 5J12B 4LHUD 3ZO0A 1MRCL 1ECZA 1OHZA 3B6SB 3RGVA 5DO2D 1BMGA 4H1LG 4BZ2A 1NINA 5IT2L 3MBWA 1GYCA 4NNYB 3X1EA 1P5UA 2LE9A 1OM3H 4OZFH 3WLBA 1JUFA 3DXAB 1A4KA 2IVFC 4IRSB 5T1DH 3SDCC 4A2HA 3WXWL 1P7HL 4LAQL 1L6PA 4Y5YB 4LLYA 5IQLA 4X2UA 2BOCA 1KY7A 1G6VK 3ZKXB 1KJ2H 1KYUA 1M9WA 4N2CA 4YEFA 2EIZB 5IWLC 2VDQL 1JNHA 2KZ1B 3TT1H 1CFSA 2VUKA 4Y4KD 1L6ZA 3MMEB 5AKVA 1JWUA 3P4MB 3RGVC 4MLSA 4K7FB 1P5UC 4FQXB 3IXAB 2FJGA 4WEBL 3MGOB 5IB1A 3T2OA 3DIFB 5HGHA 1GGUA 2IH3B 4D8PA 5EBLB 2BX5A 1G7LB 2KQNA 4UAOB 5DHDA 1PDKB 5GS1B 3BI9X 1DE4A 1S7SA 3BZ4B 5HDLA 4BCXA 4NENA 1OGAD 3DVGA 3FRPA 1ZA3A 3HRZA 5ABDE 4TQHA 1AGDA 3GI8L 3L4WA 1QA9B 2XXMB 4PJ5A 4EKXA 4U1NB 1N9PA 1QHQA 2M26A 4FXLA 4R90L 2J8HA 2WNKA 2FLMA 5GRXG 2VM9A 3ZL4H 1OQOA 1EFXB 2NY6D 2R8SL 3QFDA 3L81A 4NKDB 4JVPA 1BP3B 1VFMA 4XAWL 3BEVB 1H6EA 1ETJA 3WE6A 4OAWA 2NW3A 3BRGC 1PLGH 2VWEE 3BCFA 1VEPA 2RCSH 4TSCL 4JANB 5CN3A 1ZEAL 2IPKB 1DFXA 4CADB 4MA8H 3MRJB 4U6XA 1H3PL 2VZOA 2KBGA 2Z9TA 3AREB 2CALA 3HRZC 3K6IA 5AVUB 4DQOL 5HDWA 3PHSA 4XMPH 3T3ME 1E4JA 5A1AA 1MHPL 2Q7NA 3U6RB 1IAKB 3HKFA 1IGFL 5IJBC 4MNQA 4KK6D 4ZSOE 4JM2F 2D7QA 3SD2A 2EDKA 4R7XA 4KRPD 2X7LA 2GTZB 4W9DC 1SJHA 2E74C 1GZPA 4NJAH 2FBOJ 2WNXA 1G7QA 4NQDA 1ZLEA 3ROLA 3ZIYA 2ZP8A 4F58L 3DURA 5JHMA 3HE7C 1DEEB 2B4CC 2OYKA 3HZKB 1SNRA 2DQTH 3KMDA 1JGEB 3V6BR 2GBTA 1E5CA 4CC1A 1TNMA 3U7WL 1D9KA 4MJ5A 3MR9B 5E94A 1B6UA 1ZLSL 3WFBH 4CDGC 1B88A 5E1GA 1J9CT 4QHMB 4OLUL 3MRNA 4N6RB 3FQXB 5IMMA 1AZNA 2P5EB 1UENA 4N2DA 3II2A 4WFHD 1XCWA 3I3BA 5E4IA 3UAJD 3V0WH 4RMTA 1AFVL 2F58H 1GSKA 3PL6D 4PR5B 3S3BB 2P44B 1NAKH 4UNIA 5SWZB 1YEIL 2MKWA 4OCNC 1XF2B 4K9JA 3TNNB 6PAZA 1A6TA 2YS4A 3OQ3B 2R1WB 5SV4A 4UT9L 1D9KC 2IWKA 1JWMB 2OYMA 3AXHA 5I0XA 2WBJC 3E6HB 1MDAA 3O6FD 2DQIL 4QRQA 4WW2F 3Q8FA 2ZYSA 1Q94B 5HHOD 1HWWA 2GIMA 2ZOLB 3SO3B 3F7RA 5HBBA 2H1PH 4IIZA 4I77H 4UIMB 2WLMA 4HC1H 1KCRH 1UKQA 3FHQA 3IPBA 2Y3NA 4QI3A 1LNUA 3OAZH 2AK1L 2GJPA 2FB4L 1XR9B 2V2TA 1YYMH 2WYTA 4Y2DC 3HUJF 4O02A 4XB8A 2FR4A 4MRBA 4K3DH 4BD4A 2F1BA 3SQOL 2GY5A 3MRHB 4OGQC 1AC0A 4V1DB 3RVVC 2AI0H 3E0GA 3T0EE 4E41E 4L4TD 4PHZA 2ZUXA 1RUMH 3GO1H 1A5FL 4ZUSB 9CGTA 3DTXB 3ILQD 2HPOA 4GBXD 5FYJL 4LRNH 1M56B 5I5IA 5INCA 4P04A 4KK5D 4H1LA 4AQ8A 3UBXI 4PB9L 3WL9A 4HUXA 4EI0A 2Z4QB 4FQJL 1M2OA 2V7NA 1SXBA 3C60D 3IE4A 3OKDA 4UTBL 4GP4B 3ZX1A 1I8MB 4N9OB 3LH2H 1MCIA 4M4RA 3SO5A 4FXGA 2JKRM 1KULA 4NCDA 3GLZA 4UQDA 5ESAA 2DQDH 2GJZA 4HK0B 1CFTB 4JY4B 3CTTA 1S7WB 1QSFB 3H7BA 1T0OA 1E65A 1ONQB 4FA6A 2FJSA 1G0YR 4JZNA 4AQ8C 4O51A 5FO9B 3S8WA 3TCTA 3Q9PA 4P57B 2PW2A 2XWBA 5C2BL 2X89D 2XZQH 2R0ZL 5DU7A 2WQAA 4ONHA 1ZIBA 4Z76A 3NT0A 3PAVA 4XOCA 3OAWA 4FXGC 4ICWA 5I6PA 5C08D 3GRWH 5KVMC 3K6SA 1QI4A 1MRCH 2XY2A 3I02B 1NCJA 5B1AB 5CKGA 3C8DA 5IKCA 2BS9A 2Q2LA 3GMPB 2CRMA 2HG5A 1NBQA 3P77A 4I1NB 6FABL 4NUQA 1VACB 2DIBA 1SMDA 1P1VA 5EUKB 3TJPA 3OB0H 4LAQH 5FDWA 3WHE0 5F0LB 4WI9A 1C5DA 5HXMA 1MN4A 3SDYL 1KNOB 4NKOA 4PRBB 2VN5A 2HJLA 1IFRA 3K4ZA 3OHXB 2I7OA 1P53A 3QZMA 3T8XA 4NPJA 4HX1A 5B38B 3PV6B 2VAAB 2DLFH 2MOQA 2XQ0A 8FABB 3O2WL 2VT0A 4WEBH 1FGNH 2TSBA 3MA7A 4J4PA 4DO4A 1NGYB 4KNTA 1R75A 5D2NB 3D51A 4KY1L 4LLWA 5LGJB 1RERA 4L5FL 1A6AA 3QHZL 2JNZA 1Z9LA 4AUYA 1IAOA 2AQRA 4EZMA 1M05A 4D2NA 2ZUVA 3QNYB 4TUKH 2DLEA 2IANA 2OMZB 2ZKWA 3OZ9L 4XOBA 3RGVD 2L4OA 1UD2A 3ULVH 1E9OB 2KT6A 4NQSB 4UV4L 2UUDH 1J5DA 2WTRB 3GI8H 4CC4A 2CD0A 4EQ2A 3BWUC 5KBKA 1F6AB 1QTPA 4R90H 3UERA 3AAZB 3G5YA 3LIZL 3OR7B 2VZVA 3GSNA 4J4PC 4P2RA 3VX0A 3QJSB 4ZS6C 2R8SH 4WJG3 1GMIA 1NCGA 4N8VB 3EFDH 3NJMA 1J05B 1S2EA 4IJ3B 2ZOOA 4L3CB 4K2UL 4P59L 5E1HB 5HJBA 3NDZE 1QRNB 1FZOA 4G59C 4BZ1L 5JA9A 3KYAA 4KGLA 1B4LA 5AAWA 3KPSB 4NWTL 4XNUL 4XI5D 4Z95L 4MJIB 4YHIA 4YS4A 1H3PH 3MLZL 1JF1A 1QWHA 2NY5L 2OL3B 3X12B 4CC4C 5I1AB 2H26A 1MQKH 3US9A 3CZFA 4Y19B 4R2GD 4G7YL 1IGFH 2C1OA 3TEUA 1L3WA 3WO4B 5MEPA 2JJUA 4H26A 3EJCA 3P2DA 2OPCA 3IE9A 1RJZA 5EU4A 1KJ2A 1MPAH 3LQZA 1DL7L 5AAWC 3VXMB 4C8XA 4PJ5D 3QEQD 3CFEA 3GJFK 1IFHL 2F9BT 4GAJL 2H32H 1JDCA 4XTRC 3CZKA 2VJXA 4F58H 4HOWA 5E24E 3P3RA 2FSEA 1OAUL 1J10A 4WFGE 1KFAL 1NANH 3V0IA 1YJDH 4EN3A 5BV7B 3SE8L 3US1A 1S46A 2GJ6E 5DGRA 1YVLA 2EXTA 3U7WH 3T0EA 4E41A 5MHSE 2ZAIA 3BP5B 3MRFB 3NH7L 5HHME 5L2JB 5CGYD 5HI5C 5E5UB 2H6PB 4OKDA 3D2TA 2Y2TA 3W11D 3QUGA 1LVEA 1AFVH 3PQYE 2COVD 3GMNB 4LPYA 2WXQA 5DD5H 2IDQA 1YEIH 1KN2L 3MRIA 4IU3B 4MNQD 4EN3C 4KFZC 2MCAA 4UIKL 3ECBA 5T33L 3G5VB 4UT9H 2L7UA 4L8CB 1WTGT 1SBBA 1AS8A 1B4RA 1QO3B 2GJRA 2K8QA 5KBNC 4EVNA 2XLLA 3EXLA 4XP4L 4AMWA 2XDHA 1T1WB 2IIJA 3ARBA 3S3DB 2W95A 5F1OB 4PP2A 1A0QL 4X0NA 4IBLT 2R15A 1VFBA 2AK1H 3DNKA 4KI1A 2FB4H 4U6HB 5I8OL 5BZWB 3HHSA 4U05A 3DBSA 3F7PC 1FV1B 1D9KD 3DGGB 4JDZA 4GG6E 4NFDA 4IKLA 3SQOH 4JVUA 3M8OL 4PJGB 5AAMA 1A1MB 2NSXA 2P47B 3AY4A 4BFJA 2IMMA 5HJ3A 4GXVL 2YOAA 4LNRB 1CLYH 2X4PA 3GHEH 4ZTOH 3VCLA 3ARBC 5K33A 3IFOB 4XE5B 3U2IA 4M7JL 4NBXB 2GI7A 1ACYL 1M7DA 4FQJH 4G8EA 3ULVE 4X4ZA 4UTBH 4ZUTB 1JZ8A 1LTXA 4M29A 1YSOA 1E5AA 1ADQH 3HCVB 3IK2A 2EVIA 5KOMC 1UYWL 1BIIB 1U3ZA 4U7KA 4XAKE 5J56B 4JRXB 5AAMC 2X40A 1MCOL 3AY4C 3JBG7 1DCLA 3JVGA 2NT0A 2Q7AA 3NJVA 1MVYA 4JE0A 2WKOA 2Z31C 3MTRA 4XN4A 2OL3L 4HIPA 1DQQB 2R0ZH 3RWIA 5SWQB 3MX0B 1KSRA 4KNSA 1N19A 3Q6GL 2DIEA 3TBWB 5K9JH 3U0TA 4WK0B 1JGDA 1NFKA 1Q9LB 2VN7A 4YGAB 3U7AA 4WUUB 2HTLC 3BIAX 4RDBA 3JVGC 6FABH 1DUYA 5FECB 4MS8C 2KS0A 4M1CC 2VQ1B 1KENL 5IJVA 1SFDA 4IW4C 3CCHB 4KKQA 2MOGA 3EH4B 3S8GB 3P9WB 4TULH 4MHHG 5DF0A 5BV7L 2FZ3A 3SDYH 4APXB 1U93A 1OWRM 3EADA 1M53A 4X5XA 3V10A 5HDBB 1CK0L 4JRFA 1MCWM 3PAUA 3IGAA 1XCXA 3O2WH 5EFIB 4I89A 3IM1A 3HMXL 1JHKL 3NABL 4UQ2A 5C0BE 2XTJC 1IQDB 2PCYA 4X9FA 1T6BX 2ZSVA 3MJWA 3OWRA 4FG4A 4L5FH 3IF1A 3QHZH 3T65A 1A47A 3KXFB 3VJ6B 1WAPA 4D0DB 1WH0A 1SXSA 4NLAA 4GMSL 3OZ9H 1WGVA 1M7IA 3MRBB 3DXAE 2B1OA 1NIFA 4U1HB 1JYVA 1OWWA 4FULA 3UZQB 4UV4H 4KMTL 1KXQE 5LCVL 4J8QA 1IBBA 3K72A 4KXCA 4GKSB 5FKPB 1MFCH 4OCRH 1DN2A 5IFJA 4Y5VC 2VZ1A 5AW4B 1A1OB 3IDMA 3N1GC 2F74A 2GJ6A 3OLGA 4PN6A 5ESQA 3U1PA 4NI6A 4NQCA 5IHBA 1SY6L 1MXGA 4P59H 5IUCA 1YMHB 4X7FC 4BZ1H 1I3GL 5M94B 2QHRL 4AIZA 3HG5A 2BVQB 1JGUL 4QHKI 4KXBA 5T1MB 1ZK9A 3ATDA 4XNUH 1KPVA 3VWKB 5IB3A 5MEOB 3GRWA 3MLZH 1M6OA 2P8LA 3LKPB 4X5LA 1SVCP 2ZE0A 4ZS6D 3D4GA 4PVBA 4I1RA 1LDSA 5DUPL 2JELL 2UZYA 3FAXA 1YPZE 3TM6A 2YKLL 4HULB 3BOVA 4OZHB 5JXEA 4AIEA 3CIAA 3FT4B 1X4XA 3HLKA 1CXKA 3D69A 3JWOL 4ZUWA 5SV3A 3MREA 3D1MC 1TZGL 4XE0A 4HD9A 1IGCL 4EXKA 1ZT7B 4HKXB 1HESA 1IFHH 3NIFE 4GAJH 4MXVE 4WHDA 3N06B 5DLML 3OZLA 4PGCA 5FGSA 1OAUH 4PG2A 3RA7L 4ELKB 4P3CL 1MSPA 3WBDA 2X28A 4IDJL 3PXLA 3V6ZB 4XO9A 2F7RA 1CD0A 3BN9C 5HGDA 4DK6A 4HHWA 3ZTNL 1AYOA 5F7LB 5JO5B 5C0RL 1SJEA 3CX2A 4M3KB 5C6WH 1GKOA 4XVTL 2VDLB 5FA4A 4GT0A 1L0QA 4WWOA 2L04A 1S7TA 5DT1L 1ID5I 1CGTA 1KN2H 2AJZB 4PG2C 5K39B 2L7JA 4UIKH 4JPVL 4NN6B 4W70A 5T33H 1FNSL 5FWRA 2IEPA 3BAJA 3OLDA 3I6GA 3PJSA 1TCRB 5JORA 2AQ3A 1QYGH 3GIZL 3GM0A 1H8OA 3VXOB 4XP4H 4XN5A 1NDGA 4DPBX 4AMXA 1I7ZB 4MB4A 3V95A 1TTBA 1WT5A 2R69H 3BPOB 1NEZG 4GKZA 1FFQA 1A0QH 3FU7A 3E7JA 3L3KB 4MD4B 5FA3B 5FW7A 3W2DL 5F7HA 1A8ZA 4EN3D 3DDFA 3P73B 3QQDB 2B08A 2Z8WC 3R06B 2ZWLT 5EZJB 1QPPA 1WHOA 2JCCB 4RAHA 3T0ED 3WTXA 1KB5B 4R5XA 4E41D 4W9EC 2XBTA 2FT7A 4I7ZC 2O61A 1BD2B 3M8OH 2DLGA 3KJ4B 5JR1L 5K59F 2VR4A 3SY6A 3ZHLA 4L5FE 1BV8A 4N0FB 4GXVH 5SWZE 1KMGA 4KZEH 4ZUUA 5E6ID 1AG0A 1HIMH 3E38A 3RVWD 3RNKB 2X6CA 2WOYA 3ZHNA 1WT5C 2D7TL 2HLFC 4XH2B 5DHVB 3FT0A 1ACYH 4YDLB 1DBJL 4HPOL 3WNOA 4BCYA 3I6KA 2APTA 3ZDZF 3LRMA 1TG8A 2MHAA 2X4NB 4PJ9B 4QUOA 4UUJA 1YLBB 1Q9KA 2KYIA 5LG1A 4UQCA 3VFWB 2HFFB 3VFNA 2ZXQA 1NC4D 2P8MA 2XPZA 5FF6A 5D4HA 3T0DA 2IAMB 2R0LL 3VFPB 3LAFA 3SIKA 4AG4H 3BSGA 2VL5A 5FIEA 1GAFL 3FQNA 3G6AA 4V1DE 5CZKA 2OL3H 5A2KH 3B6SA 1G9NL 1S5HB 3KHQA 3HG2A 1YQ2A 3QIBB 3Q6GH 4C55A 2B1HH 1SOQA 3ZT5A 4MVBC 5TF1L 3SKJL 2ZYRA 4HHAB 4R7NB 3H2WA 3AB0C 4RFEA 4XBEH 4Y5YA 1CF8H 2VITB 4Q2ZB 4UT9A 4YXLH 4KMLB 4KITB 1KXQA 2F61A 3ARDB 3U9PL 5E2TH 2D9CA 1BVKB 1DQJB 3R0NA 1VZHA 4FQCL 5J12C 3IDNB 4F7CB 2YAOA 1KENH 3P4MA 3MRMB 2FQGA 1W6LA 2VXQL 5BV7H 4ODWB 5BZZA 1X5ZA 4M6MH 4K7FA 3IXAA 4F7KA 3QNFA 3MGOA 5TQ2L 2HTLD 1E5ZA 1DANT 1DVFD 3BPLB 1P7BA 3EAKA 4Y5YC 4AGLA 3A23A 4OJEH 5IEHB 1PDKA 3H54A 4M1CD 4X7CC 5GS1A 1HS6A 1JHKH 2VDLL 3PWNB 1NMCB 4FI8A 3GK8L 3X11B 4BWTA 1D7FA 4J3OC 1ZAGA 1IGML 5EHFA 4Y4FD 2JH2A 4YZFE 5DJ2B 4ETQB 5DSCB 1OAZL 1QA9A 3MJ9L 4HLZG 4UTBA 3BUIA 5IJCC 3DJTA 1OAYH 3T4AB 1EFXA 3LN9A 1A65A 2BNQE 3DX9B 1GGCL 3K2MC 4TQIA 4UAOC 4W93A 5LCVH 5GS1C 3BEVA 2EXSA 1I75A 2IGLA 2QGBA 4HJJL 1F4XL 5B38G 4LK4A 1GTNA 4NRZA 1KXVA 4GB9A 2EC8A 1A7PL 2K9UA 3AG1B 3JZYA 2APSA 4JANA 1SY6H 4MGXA 3O6KL 2JIXB 4WCYL 3AW5A 3MRJA 3CE1A 3I9AA 4KKLC 3AREA 1KB5L 4HK3J 4NHUB 4ZYKB 3RVUD 4YK4B 2QHRH 2HVJA 3J27A 4M8RA 2FQDA 4LE8A 1BAFL 4F1ZA 1WZ1H 3ECVA 1ZE3C 3WNPA 1EO8L 3LB6C 5D2NE 3U6RA 2DQHL 3GZKA 3NG5A 4FOMA 3B7SA 3TEXA 4L4JA 2R59A 3FN0L 2GTZA 5KBPA 5DUPH 4EBQL 2JELH 1KXVC 1BFOB 2YKLH 4W9ZA 4OZGF 3AS0A 2CDEA 3AREC 1SVZA 2WOBA 1K4DA 3KGTA 2VSMB 1DEEA 1PBYA 3JWOH 4N8VG 1XHHA 3GMLB 3HZKA 4BFRA 1JGEA 2O5XL 3MV7B 2PR4L 4U1LB 4WFGD 3MR9A 1G9EA 4DFHA 1XH3B 1NMAL 1NEZA 3BUTA 3QXUA 3V7MA 2GJ6D 4S0HA 4QHMA 4P3CH 2ZOUA 1LJMA 4N6RA 3FQXA 2P5EA 3KPSE 5FB8B 2Z91B 2VLJB 2NY1C 2YEZA 1J48A 5MHSD 1S3RA 4MJIE 5HHMD 3BP4B 2G75B 4NQEE 5C0RH 4L18A 1UM6L 4MDIB 5JHDB 1QTYT 1QI5A 5SWZA 1XF2A 2F2HA 2QL1A 3TNNA 3DX6B 4Y19E 3PGCA 4Z7QF 1WFTA 2R1WA 3THML 5H35B 5FUCE 1JWMA 3VU2A 5C0AB 3E6HA 4XPHL 1MRFL 4X6DF 1JMZA 5DT1H 1Q94A 1A14L 2ZOLA 3QUKB 4JPVH 4UM9D 3VXME 1FNSH 2VH5H 4UIMA 5JXED 3LIZA 3RFRA 2C4FT 1TUPA 3Q13A 4J3TA 5IF0A 5ILTH 4ZX4A 4K73A 1EHAA 3EG9B 1KGWA 1XR9A 2CU9A 2GIXA 4ALAL 3B5HA 1TJHL 2H0FA 1OK8A 1SYVB 4BZ1A 4P2YA 3C5XA 4C4UA 3MRHA 4V1DA 4XOAA 3MLVL 1RKRA 4LCVA 4Z8FL 1ES0B 2ZF8A 1MG2C 3Q8EA 1AGFB 1HJCA 1CZ8L 3DTXA 5L4FA 3F6LA 4G7SB 3P4LA 3LXAA 1NMBL 3IGFA 3VD7A 1MCSA 2XX1A 2K9FB 4CC0A 3NGBB 1AQDA 3HAEH 5B3SB 5AYQA 3LZPA 5JR1H 1IJNA 1A22B 2Z4QA 3M17A 1XSOA 4QRPA 1MCJA 3VA6A 1R0AL 3TEYA 2EEBA 3VB8A 3F84A 3NCFB 4NKIL 5D2LB 2D7TH 3ULVD 1ZTXL 5CBEB 3BT2L 2NLJB 1M71A 1DBJH 3I50L 3CFJB 1UACH 4JR9L 3L3HB 2UVEA 4JY4A 1SHSA 1NUDA 1S7WA 4JJ5B 4XAKD 1QSFA 2BY0A 5GS2H 2NY5C 1KLUB 1A7BA 2Q3ZA 5FO9A 4OBRA 3SD5A 2R0LH 4GUCA 4U3SB 2HLFD 1AOHA 4BSWB 1OY3B 2OSWA 5K5YA 1UZ6E 2OJEB 3H53A 1FZJB 4HJGA 3SBRA 1GAFH 4PJGE 5AW5B 5TK4A 3I02A 1R3IL 4XO5A 2J73A 2GEEA 3GMPA 1VSCA 1MFNA 3MNZB 1GA2A 5TF1H 5F8QC 3NRQA 5EUKA 2YUWA 5I0VA 2A9BA 4UYQA 3RUGB 1OZTG 4NUMA 1HH9B 3U9PH 2BDNL 1KNOA 4FKHA 4PRBA 3L1OL 2X2UA 3FPXA 3OHXA 4Z18A 1CD8A 4WKXA 4X6CF 1B3JA 8PAZA 4WNQB 2FEEI 5B38A 1H8NA 3GGWB 3PV6A 2VAAA 5DQJB 8FABA 2C3VB 2CBMA 3QYMA 1X4YA 3OJDB 3GUFA 3L3IB 1NGYA 3L9RB 3JWDH 5D2NA 2ZX8A 4BFNA 4AK1A 2R29L 5LGJA 3CDFA 5C0BD 4BSJA 3QNYA 1NBYB 3VFOA 3H9YA 1V5JA 5ALBH 4IBWA 2OMZA 3GK8H 3ZHKA 3OHXC 3O45B 1E9OA 1G43A 4XNZB 2VYRE 4NQSA 4AITA 1FFRA 1OAZH 2WTRA 2DYSB 2WMPB 3DXAD 4IHBA 4IRSD 4ODHL 1F6AA 5DD0H 5BZXA 2J56A 3AAZA 3OR7A 4XB3A 5ANMA 3UROR 2Z65C 3UAFA 3AQYA 1Z2KA 5FO8B 1KOAA 5D2NC 3CDYA 5HY9B 3JWNH 4FXKA 4N8VA 2CDFB 1J05A 5JIDA 1MREL 4L3CA 4TRPL 5JIIA 2XPGA 1QRNA 5F3HA 5C0EA 5BJTB 5FPIA 1CPUA 1NIEA 2ISDA 4BQ6A 1WRFA 2IDFA 2NNXA 4LP4A 4NS0A 1A7PH 4WCYH 3WEOA 3SDAA 2Q3XA 3O6KH 4FQXD 1KB5H 3FUIA 3X12A 2OL3A 4NAJA 5KAQF 2XZZA 5IVXA 1BJ1J 2QSQA 3H4HA 4YEEA 4KU1A 1XDTT 4XVSL 1EO8H 3EGXB 3K6FA 4Y19A 5BRZB 5GGSY 3WOVA 3QDMB 1GJWA 4RIRA 3KXFE 4FXKC 5IUSA 2ZPKH 5FDYA 1MW2A 4IJ3C 5FYJD 2IDUA 2D0HA 1LE9B 4OJDH 1PNCA 3FN0H 2FYVA 5DHVH 3H7LA 1OQXA 2QKSA 3VXMA 3DV6B 2Z35B 2E4FA 2K70A 3EDKA 3SDAC 3AWFA 1OTUC 2WQRA 1UA6L 3LB6D 2FT6A 1EFXD 2YK1L 2W60B 4OZIB 1AHWA 3HIZA 2GEQA 3LKOB 4WQOA 3BHBA 2O5XH 3F5WB 2AJSL 2ZKMX 2F53B 2DMKA 4OFDA 5FUCC 2EE0A 3WIHH 1NMAH 2DEYX 3O2DL 3R4RA 3BP5A 4HSQA 5FC9A 4YXKL 5GGVY 1PZDA 2H6PA 3KYNA 3ARED 3HMXA 2HRLA 1OP4A 3HB3B 1G7HB 1CXIA 2UVFA 4S2SA 2OMTB 2KZKA 1UM6H 1ZT1B 3GMNA 4NEHB 3GPSA 5J13C 1AHWC 4AYDC 1XR8B 2B59B 4L8CA 1EGJL 3PRZA 1ZLWH 2DL9A 2NZ9D 1BDYA 2H3NA 1L7IL 1JTPA 1QBBA 2ROYA 4OZHE 4XPHH 1NOAA 2FO4B 2LU3A 5E2WL 5LCVA 2QADC 2F19L 4FNPA 1T1WA 5TE4L 5F3BB 3LIUA 1OL0A 5ITBL 4X8XA 4UMSA 5LN4A 3AS1A 1C16B 3MKGA 1U8HB 1TJHH 4ZQTA 1FV1A 1UFGA 3DGGA 1RUAL 4OSUL 1EHLL 4UCFA 1G0DA 1T7WA 3MLVH 4Z8FH 4PJGA 4C54A 1CCZA 2WO3B 1A1MA 2Y7MA 4TVSa 5I5JA 1ETA1 3UO1L 2QKIA 1CZ8H 2N3JA 1CN4A 1LP9B 1T1ZB 4LNRA 1G87A 2Z7YA 3MODL 3JV6A 3LCYA 1E0OB 4KUCD 1OB1A 5SWZD 3CN1A 1PS3A 1OP9A 1OHQA 4ZUTA 4PRAB 5LQBH 3HCVA 4P9HL 3HFMH 1RZGB 2WTPA 5D70H 4TNEA 5DHXB 4HW6A 4HOXA 1M9SA 2JI2A 1Y6KR 4M61B 1BIIA 1ZTXH 3BT2H 4TL4A 1HEJC 3JWNG 4JRXA 1FFNB 3F12A 1KCKA 4JR9H 1HKLH 3STLB 1NKRA 2QKIC 3JWNE 4TUJB 4RGOL 5JXAL 2CO4A 3ISWA 1HCZA 3JUZA 1L7TL 5FCSH 3IRZA 2P80A 1DQQA 1M6UA 2YPKB 3DOHA 3MLWL 5SWQA 1L0PA 2JCCE 2XJLA 3MX0A 3QEHB 5DC4B 4DW2H 4JRYB 4V1DD 5KSBB 1OGTB 5HDQL 1BVLA 4U3XA 3TBWA 4LPXA 5D4JA 3EJPA 1BD2E 4F8LA 4HIJB 1Q9LA 4JDEB 3D50A 4GQZA 3OC8A 1DSFH 4WUUA 2YGQA 4E42B 4A68A 2BNUB 2VXUL 1J0IA 3KPPB 2RTTA 4J39A 2UXVA 2XIDA 1U8JB 5E4EC 2VERA 3WO3B 1QRKA 2BIHA 3S2AA 2VQ1A 4S1DC 4MAYB 4XNQA 4Z7NB 3MCG1 3FTGB 3WNKA 3BDYL 2FJFB 5DI8A 2BDNH 4APXA 3PHQB 3UBFA 1SFHA 3L1OH 3FDWA 4JQIA 4YSSA 1U8CB 3V5HB 3DUHA 2XWTA 3D7PA 5IVNA 3WIIH 1DBMH 2PP8A 5EFIA 1WD9A 4AGPA 4F57L 4K5NA 5G4NA 1F00I 1IQDA 3MUUA 4N2IA 4DNLA 4K5MA 2EDTA 2VMDA 4N0UA 3MV9A 3ZTCC 1B4TA 1XO8A 1OK0A 3KXFA 4D0DA 2EDBA 2DH2A 4NZDA 4P5SA 3V9FA 1FPTH 3FQWB 5KANG 3N04A 3MRBA 2XIIA 32C2B 1B2WL 4GRMA 4GY4A 3MUY1 4U1HA 2XIBA 5AAPA 3UZQA 2WQSA 2PABA 4PWJA 3DYPA 5FKPA 3ASOB 4DPCX 1IE4A 1TMCB 2BNQD 1WEJL 1DJSA 4GXUN 4GSUA 5IP4A 4C4BA 3WJLA 1FORL 1HDMB 3DI3B 1YMHA 4LP5A 1F45A 4TRPH 2ZX5A 1N68A 2I26N 4IGBA 3VFSB 3PWPB 1MCPL 3VWKA 5D5MF 1GPOL 5MEOA 2J4WH 1UQSB 1IAIL 2EH8L 1FE8L 1E30A 2O6EA 4O2FB 1HEZB 3LXUX 4XVSH 1QPKA 2FGZA 3C5ZB 5TPWL 1HSBB 3ESVF 2BRRL 5FM4A 2IWGA 5I73C 4XPFH 1OW0A 5KS9B 3VFUB 2KDGA 3FT4A 5DVKA 2IPTH 4IGBC 4FABH 3K2IA 1ZTXE 3VWKC 3D4CA 1QP1A 4JO4H 1JZEA 1UA6H 1ZT7A 4HKXA 2E3VA 3CDCA 3RY5A 1G9NC 2FIKB 1WBYB 1UATA 1BFSA 2VXQA 2E7HA 2FLBT 5JW4R 2AJSH 1MW1A 1YEGH 4U0QB 5GGQH 1CQYA 3O2DH 5JO5A 3KPSD 4UOW0 5D4QA 5DZLA 1BF8A 1YNKH 1WWBX 2D03L 4MJID 2IADB 2O26U 5CLWA 3LRSB 2DLHA 4MBRA 2OJZL 3N0AA 3WELA 4NQED 4OY9A 1KELL 1ZSHA 3V9CA 2W5PA 2ZXBA 3MUJA 4P5TC 3U46B 2XBZA 1AZRA 2N7AA 1VFOA 3OR6A 4KDVA 5F8RC 3TYGL 4F7PB 4G5AA 4Y19D 2AJZA 1E9PB 1GOHA 5DMIL 4CMHB 4LBEB 3UC2A 3MJ9A 5I71B 1J9RA 3MRLA 4JO8A 2QPDB 1AY1L 2ENYA 1DHKA 2GQHA 2HT3D 4LGPB 5EBMB 5CFHA 5SX4I 3VXMD 4P48A 3B7RL 2OX5B 3VXOA 1I7ZA 4M7ZB 2WNGA 4KK8D 1MHCB 5ITBH 1SJXA 3L3KA 4MD4A 3KGRA 4JEGB 5BW7C 2NYZA 3HZVB 4AQAB 5CGBA 3N42B 3P73A 3QQDA 4UI2A 4KWUA 3BH9B 3R06A 4Q6YA 4XC3L 5EZJA 2Q6WB 5IJDC 4HFWA 3ATFA 2G9KA 1A6WL 1H3VA 2J57A 1KB5A 4HAFA 1RUAH 4OSUH 3UP6A 4Z23A 1EHLH 3GIVB 4NN6C 1BD2A 3NEXA 3ARGC 5E2VL 3UO1H 4N0FA 1HXKA 3OAYH 5IEKB 4J5VA 3JWNC 2XU9A 1CICA 1AS6A 5I24A 3MODH 3KH4A 2O30A 3RNKA 3K7UA 4Q6KA 4XH2A 1Y6NR 4M5YL 1JRHL 5DHVA 4BFGA 4PI0A 3E3QE 5C0AE 2Y7NA 1WG3A 4PJ9A 1YG9A 3B2DC 4P9HH 5FGCB 4Q9CA 1T1XB 3JZ7A 3IU4L 4HA1A 4M9PA 2HFFA 3TN0B 1FZMB 4K7PY 3VI3B 4Y0GA 5CIPB 3KJ4C 3NACL 3VFPA 2ZKYA 1TZIA 1AO7B 2R0KL 1JAEA 1CICC 3BUYB 4RGOH 4TOYL 1S7UB 4YR6B 3OX8B 5DHYB 3KPOA 4QRRB 1L7TH 2EABA 4YDLC 4L1SA 3M1CA 4DSYA 2XI9A 3U7YH 3NFNB 4PJ9C 3NJIA 3QIBA 5HDQH 1E50A 5C3IA 3QNZA 3VTAA 3ZE1B 4HHAA 4R7NA 4EDXB 1HWGB 4GRWH 2VITA 4Q2ZA 3WS6A 1MCLA 5KW9L 2UWEB 4BGLA 3ARDA 3BP6B 4X7TA 4ZD3L 4NQVB 1RZQA 1DQJA 1RU9H 3IDNA 3MRMA 3WAJA 3IWUA 4ODWA 4OTXH 3KYOB 1OE1A 2WVSA 3L7EB 3QIBC 5IBLC 3D2UA 3QH3B 4KY2A 4Z78A 5L0QC 3PFQA 2IBGA 3T77B 3WS6C 5IEHA 3CC5B 3RQ3A 5I8EB 3ARDC 3RWHB 4LPWA 2P80D 4XHJD 3TA3B 2OCCB 4Y2LA 4IKKA 1KBGH 2XKSA 1KT2B 3DVFA 2VXTL 5DJ2A 4ETQA 1FI8C 1XGZA 3DGDA 1WFJA 1UB6B 5I8KH 4ALAC 3L3DB 1MJ7L 4YSTA 3DO7A 2ZWYA 4EUPB 3WTYA 1NAMH 3RUGE 3WFEH 3BSZH 1RMFL 5B4MC 3BQUB 4QHNA 3QULA 3ZDYF 3MGTB 4EAEA 1L9OA 2E59A 5I18H 4JL2A 1I9RL 2GC4C 3F7KA 5GGRA 3V6OE 4H8PA 2CNZA 5CJOL 1FORH 2JIXA 4NHUA 4ZYKA 4HMEA 3L5XL 4KH2A 3KVDD 1VHPA 4MD0B 4PMEA 3OMAB 1GPOH 1FNEB 4HHGA 2ERJB 1IAIH 1S5IL 2EH8H 1FE8H 4NERA 2X87A 1YY9C 2CR0A 4YDKL 3KXFD 1N2RA 5TPWH 1KYOK 1QATA 3CPUA 4M7KH 2FHBA 4TNVK 1CB4A 5F1IB 4DCQB 1EK3A 1T20A 2APWA 4XCFH 4RFOL 1T7ZA 1X5LA 3N1MC 4KQ4L 4YK4C 2OXHB 3RVTC 1X9QA 3S88H 2QVMA 2Z92B 4GW5A 3MLYL 3O3UN 3MV7A 3WTTA 1GGIL 1KYFA 2JB6A 4Z7WB 2PUQT 5DMKA 2HRPH 2OMNA 5HJDA 4U1LA 5I0YA 3LN5B 4JGNA 1XH3A 1D5IL 5GS2D 5K9QG 3PWLB 1K8DA 1XTMA 2YZ8A 4PJEB 2Z91A 2VLJA 5FB8A 1U42A 1MJUL 2V8LA 3ZZSA 3ZDXF 4P2OD 3BP4A 1GGYA 3PFUA 5IM7B 4HWEL 2R29A 1OARL 5JHDA 1FAKT 1Q9WB 1YC8A 2YXWA 2OJZH 3B5GA 3DX6A 5BRZE 2XWDA 2HP4A 2EDYA 1INDL 5E8OB 1KELH 2HX9A 3QDME 3RWCB 5H35A 4PJBF 1H0DB 2QVIA 3TYGH 1CF1A 3FC8A 3BCDA 5C0AA 1ND0A 1J1OH 4OCSH 4GRWE 2ZCHH 2ROXA 3CUPB 3WTWA 3TT3L 2APFA 3QUKA 4XPAL 4X9HA 3D0AA 5IREA 3BKJH 4G6ML 4X99B 2DM3A 5M7QA 4K07A 4QWWC 1VFAB 2EILB 4UT6H 3EG9A 1J8HB 5C8JB 2DYPD 4X9YA 1JFHA 1SYVA 3N85H 3U0WH 2PCPB 4QHKJ 2NX5B 1TXKA 3I74A 1WF5A 4WV1B 2F53E 4JFPB 3WU1A 1QEXA 1ES0A 1T0MA 2N01B 4XC3H 5EBWB 2CPUA 5ERWB 5EU7C 1AGFA 1A6WH 4HLJA 4URKA 1XXDC 1RFDH 2EDFA 4OT1L 1KACB 5E2VH 3CJJA 1ID2A 2LLGA 4PJDA 2BHFA 1YYLH 5D2LA 4NKMA 4TM9A 1HNYA 2FRGP 1JRHH 3KPLA 4GIPD 1A1NB 3U1QA 3CFJA 2F54B 1NCBH 2V5TA 3L3HA 2BVTA 3FXIC 3T6ZA 4JJ5A 4XCYB 5CO1A 3IU4H 1QFWI 1KLUA 4WK4B 1BW8A 3NGBC 3MQIA 4KROD 1KCUH 2NNCA 1MH5B 4AV0A 2R0KH 4BSWA 2XN1A 1BXUA 2CDGB 2OJEA 3VD2A 1FNFA 2AVGA 3PXHA 4PJFB 4RX4A 1A9BB 2FUTA 2H1LM 1Z9SB 5IGXL 1BD2D 1LP9E 4L3EB 5DVOA 3JYBA 4E0RB 1RD6A 2XY1A 4OGZA 1PG7X 2W81C 3MCYA 2RAMA 1FLTX 3KLDA 1EGJA 1WZMA 4ODSH 1HH9A 1H6UA 4ZD3H 1KPUB 2BXZA 3U9WA 1OD7A 4G70B 4PWHA 2CGZA 4ELMF 4B0MM 5KYYB 5EEUA 2RFXB 1BPLB 2OTWB 4LKXB 5E99L 4WNQA 3GGWA 2E47A 5DQJA 3HE6B 1U58B 4NQTA 1F6FB 3OJDA 4ONOA 2IAMD 4XVUD 4D9RE 1KG0A 5GJSH 3CU1A 3GTTA 1WFIA 2FVNA 3QC6X 2ZT9C 4PVLA 4JRYE 1I1AA 3CFUA 3MRQB 1NBYA 5DFTA 2AXFB 1SM3L 2GYSA 3MHZA 2VLKA 1KB9K 5IHUL 2EIKB 4F24A 2EO1A 2OTUB 1IEBB 3VGDA 4ZFGL 3STZB 4AK2A 1FG9C 4K15A 3UAEA 4DK3A 5SX5H 3BKCH 1UOVA 3SJVE 2WQVA 1O7DE 3GSRB 1PCSA 1MJ7H 3MJGX 5GRUL 4Z0XB 3ARDD 2AJYL 2VTFA 4B27A 5HY9A 3JVFC 3CX5K 3FMGL 4D9LL 1E3ZA 4JFXB 4N5EC 1I1AC 2V33A 3QIWD 4N2KA 1ERNA 1ECYA 3FPYA 5I28A 3LPGA 1ACZA 4LCYB 1I9RH 1FHGA 4S1RL 3ZT7A 2YN5A 4O00A 1S8DB 1U95A 4XVOA 5H37H 3FFCB 4FZ8L 4GQ9L 4P9HC 4UF7C 3PAZA 5B4MD 5C0NC 3EGXA 3ZDWA 2W9DL 5BRZA 4DP2X 3GKZA 3QDMA 2MOVA 3V0VB 4LOUC 1S5IH 3A6BL 1LE9A 1IEAA 1L9SA 3WGUB 3WUWA 4YDKH 3KLAB 3NIGB 4FZEL 4TSAH 4PLOB 3PP3K 3DV6A 1U2HA 2Z35A 3HC3H 3V7AG 4BKLA 3MLUH 4M00A 3UC0L 2WLNA 1X6NA 3FB5A 2FL5B 1O9WA 1SLXA 4OZIA 1U8KB 5ID1B 4JZOB 5CIPH 5BOPA 4FKKA 3FB8A 3DBXA 4DVBB 1WVZA 3F5WA 3LEVH 4X5RA 2I9TB 4QEGA 3N1FC 1F3DH 2F53A 1AHKA 1B4JH 1CGVA 1AHMA 5JIQA 2ZUYA 3ZR6A 4GAYA 3Q3GB 2JIXD 2XT1B 3P9MB 4ADIA 1H3WM 1MJUH 2IJ0C 5GZNA 3VGHA 3RVTD 1JL8A 1U2YA 3TASA 3FBKA 2JKIS 1ZT1A 1NCDL 5EUOB 3WIFB 5HYFA 2C1PB 1XR8A 1NGPH 1O5DT 2ED8A 2B59A 4AQZA 3SGKA 1JYNA 1I8UA 5FFGA 2J1WA 1MAJA 5H94B 5KS9E 4WI5A 2FO4A 3TT3H 4TVPL 5ACLA 3WNIA 4L1LA 3WG7B 4G6MH 5GGSB 3T0AA 3ATBA 5F3BA 4U1KB 5K9OA 2QPFA 5GZNC 1BQ5A 3UYPB 2BCMA 4RETB 3HNSH 1EMTL 1HWHB 3L1FA 3RX5A 1C16A 2E7MA 1YDPB 2VSKB 1K5NB 5FM5O 3QYCA 3WJJA 4KO5A 2OR9L 4ZOCA 4YQXL 3VGAC 2ITEA 4HEPG 3SGKC 2F15A 4L05A 3PIQB 5IMLB 4HFUL 4JKNA 1LP9A 3G04B 1D2OA 1T1ZA 2YGOA 4QWWD 3GINA 4WWKD 4GP5B 3K8MA 4UM8B 4IIQB 1ZMYA 3QUZB 2AQQA 2R0WL 3GSQB 3MRKA 4OT1H 3NVQA 1R24A 3HHRB 3QIUB 3CXDL 5F9AC 1VB9A 4PRAA 4RDQF 3AG4B 1RZGA 3CFKB 3WJJC 3EIFA 1UVQB 4EUPH 4M61A 5C0AD 1IC7L 2GTQA 2ZQKA 2OKMA 1FFNA 5DWPA 1FVEB 1ORSA 3LN4A 1XEUA 2HN7B 2MTAA 4TUJA 2A6KB 3UEQA 2CGRL 3BH8B 5D96C 3FZUD 4V33A 2AQTA 3AG3B 5H37G 2YPKA 4AJVA 1W72B 4BWUA 2BH0A 3AUWB 5KSBA 3PWVA 3QEHA 1H3UA 1TZHB 1OGTA 5AKSA 3MBEB 4KKCD 3COOA 2ZXWB 2EEFA 4D9QE 4DHLA 1NGWB 3O81A 3TOPA 3ZE2E 1E8XA 3BQVA 1U2CA 2NDGA 2Y5TB 4JDEA 5IGXH 3GMRA 1T2XA 3FT9A 3QUMH 3QJXA 3KPPA 3T3PF 2CO2A 2BY2A 4ZK8A 5C70A 1UWGL 1KGCE 1U8JA 2WIIB 1T7YA 1IIIA 4FQ1L 1OANA 4MAYA 3RKPA 4BFEA 4JKLA 4PJ7F 3FTGA 2IOOA 3DGCR 5FGCE 2FJFA 2DI9A 4R96B 5IW1A 3A67L 4JG0L 3PHQA 3MA9L 5HJGA 3ZGIA 1U8CA 3MJ8B 4M62H 3UBHA 3VRLE 2VZUA 4HF5H 3VI3E 1NUGA 2V17L 5I1GL 5DQDL 5JMRA 4WO4A 4Z7OB 2G4EA 1AO7E 2YC1B 1KCBA 1O7DC 1J7VR 4ZMAT 5IIEA 3FSWA 4A67A 1N18A 2NT1A 1DDTA 3NZUA 1EXGA 4MAYC 1BM3L 5HI3C 1XB3A 4JMNA 3CZUB 3LJ3A 2OZNA 5DHMC 3FQWA 5DK2B 2K78A 3CQFA 3NJGA 4WSKA 5IHUH 32C2A 5CAYB 3O6LL 3ZE1E 1G9HA 4ZFGH 5B8CB 4PREA 1GYUA 2QFRA 1LK3H 3MCLL 5FK9A 4WO4C 1J0KA 1SN5A 2UWEE 2HT4C 4LU5L 2B2XL 2DWEA 3DPBB 4ODBD 3BUDA 1NPUA 1BPVA 5CEZH 1W2KT 4D9LH 1HDMA 3ILDA 4QRAA 2OZ4L 1H9VA 2UY6B 3U2SB 3L16A 3VFSA 1XGTA 1SGKA 1DSYA 3PWPA 4S1RH 4BFOA 5KJ7E 4MFHA 1P6AB 3HKZA 3DMMB 1UQSA 3K6DA 3RIFK 2UZIL 2WXHA 3Q8BA 4FZ8H 4U6YB 4GQ9H 4K4KA 3UX9B 1HEZA 1OAKH 3MUGA 4HJ0C 5J5EA 3C5ZA 4A7GA 4K0OA 4N5ED 1HSBA 1UURA 2NY4B 3W3BA 5GGVL 3A6BH 5KS9A 4S1QL 2JXMB 3VFUA 4EUPG 3MFFB 5DUBB 1N0LB 1R3LA 3UC0H 1L9RA 1A64A 3L9EA 5HVWA 2FIKA 2YGNA 3KS0J 1R3KB 5F0PB 1Q0EA 1NTDA 4LOUD 1BMWA 3H42H 3NEOA 2ZSWB 3C5ZC 4Z7UE 1WFNA 5KYWA 1W72L 5ICUA 2NY2C 4DP7X 1VGEL 1I9IL 4JAMB 4HEPA 4AEHL 2IADA 3FU3A 3LRSA 1X5AA 2G30A 1FF5A 1D5MA 3RIAK 4CKVX 3A4FA 1IV8A 3U46A 3B2VH 2XC8A 1TO4A 5BRZD 1NCDH 4QNPF 5JW4Q 1X5KA 3KNBB 1E9PA 3QDMD 43C9B 4BH8B 1SOSA 4PJXF 4Y9CA 5FYKL 3IJSB 1HN1A 4JN2B 1WYJA 3G7TA 3QDJA 4BFKA 5I17B 4J6RL 5EBMA 3P0GB 1HHHB 4P3DB 2OX5A 2BLFA 4MB3A 1JXDA 2QV2A 3GS0A 1K4CB 3SYOA 1CQKA 1MHCA 1XX9C 3GUTB 3M6DA 4AWJC 1AZBA 3POHA 3TIDA 4IM8A 7FABL 1U8MB 3HZVA 1MXDA 4XMZA 5LAPA 2Q6WA 4XN1A 3BH9A 2QPSA 1ZANL 2ZZUT 4L8DB 3SZKC 5H37A 4MJ6B 2F53D 2ENPA 3OKMB 2CQVA 4CMHC 4YQXH 3BWAB 3GIVA 4PJEE 5I71C 2Q10A 2YBRB 4G6KL 3BKML 5IEKA 1V55B 3HN5A 4DKTA 3HB3D 4MHHI 2OCFD 1NANI 1N5AB 2BC4A 3VYPA 3QZPA 4Y9BA 1J5HA 2R0WH 3WE1A 1F6LL 1UGNA 4WW2B 3CXDH 3NJKA 1N0XL 3S9DB 2DJMA 4LESA 1KV7A 1T1XA 4Y16B 4FNTA 1IC7H 3TN0A 4KTGA 1U6AL 3BZEA 3EYVB 3TU6A 3KEDA 1PZ2A 2FWLB 2W0FB 5CIPA 3FTZA 4UB0H 5C6TL 2ZD0A 1UEMA 5F6IC 5CEZE 1AO7A 2H3KA 1QG3A 4KZ0A 5T1KB 5DHYA 4UTAL 4QRRA 2B15A 5IV2B 3CHRA 3ZRSA 5I75B 3NFNA 2AABH 1XGQB 5FW8A 1KJMB 5EU6B 1Q9OB 3FO0L 1OPOA 3TN0C 3QO0B 4ZOBA 2QPUA 4EDXA 1ACCA 2APXA 3CVHB 3D3VB 4DP8X 4XWOC 4DUWA 2XV3A 4KTEH 2UWEA 3CDGB 1XEDA 3BP6A 3LNIA 4NQVA 3MACH 2QJDA 5HHQA 2JTYA 3TTYA 1WFMA 3OG4B 5EB9A 4CSSA 2F54E 5CLZA 3C09B 3VXUB 3F8UB 3A67H 3KYOA 3BAYA 3L7EA 4Y4HD 3T9WA 3L2NA 3PWUB 2Z7WA 5CD5C 3GSWB 3QH3A 3RHWF 1BXVA 3KDMB 3T77A 1MWAL 3JSSA 4W9KC 3IBOA 4D9RD 1Z3GL 2OMVB 5GS0L 3CC5A 5I8EA 5J57B 1BWMA 3RWHA 4QMEA 5GZOA 5LBVA 2EDXA 3TA3A 1L9QA 4NHCL 2XVKA 4JRYD 1JWSB 3MSPA 4Q58C 4LSUH 2NXYC 3RTLA 1KT2A 4BQBA 1GC1L 1THAA 4MMXB 4MJJA 4L3EE 4KXZI 1UB6A 2ADJA 1VRSA 3QT2A 3L3DA 1KZQA 3JUYA 3SJVD 4ESKA 4ODUB 3OB0K 4EUPA 2YAMA 2CLVA 3VXTA 1PZBA 3MCLH 3BQUA 4HISA 4LU5H 3WFDL 3ZYIA 2EVJA 3MGTA 5GZOC 3IVKB 2ZF9A 3TA3C 3K91A 4PJAF 1UM5L 3LPOA 3IDJB 1BQSA 3FQ2A 5FYJU 2OZ4H 3R4DA 3IJHB 2YRZA 2H41A 1M42A 1IM9A 3HJEA 3FCTA 1W91A 2D73A 1VERA 2OJ1A 4MD0A 2AXJA 1LEIB 1IC0A 1KTCA 4NO0D 4UTCA 2CGYA 3UTTE 1QNZH 2I5YL 1IQWL 2AQ1A 1U3JA 1G9ML 3BQUC 1CXFA 3CSPA 4JO2L 4WTWA 1J1XH 2DJUA 3CFIC 4AMKL 4DCQA 5F1IA 4NQUA 5I1JH 1MFAL 3P0YL 4S1QH 2UXFA 2BMKA 2OXHA 2DZEA 4U1GC 2MNJB 4ORGB 4P5MB 2P26A