2X0UA

Structure of the p53 core domain mutant y220c bound to a 2-amino substituted benzothiazole scaffold
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward the Rational Design of P53-Stabilizing Drugs: Probing the Surface of the Oncogenic Y220C Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x0uA00
2J1YA 2GEQA 4IBWA 4AGQA 4MZRA 2XWRA 4A63A 3US0A 2IOOA 1YCSA 2MEJB 4L0YA 1UOLA 1EAQA 5ECGA 5BUAA 4L0ZA 5KBDA 3WTVA 1E50A 3WU1A 2J1ZA 3QYMA 3WTYA 1CMOA 2AHIA 4GUOA 2X0VA 5G4MA 4IBTA 5ABAA 1EANA 1LJMA 4AGNA 4G82A 1GZHC 3D05A 1EAOA 4AGLA 4LOFA 3D06A 2XWCA 3WTXA 2BIPA 2J20A 4KVPA 2YBGA 2J6WA 4IBQA 3VD0A 4QO1B 1H9DA 3D09A 2BINA 2RMNA 3IGLA 1T4WA 5AOJA 3WTSA 1TUPA 4IBSA 1GZHA 3TS8A 3QYNA 2FEJA 3D0AA 2J1XA 5LAPA 1HU8A 4IBYA 4HJEA 3WTWA 2IOMA 2VUKA 5AOIA 5AOKA 5A7BA 5LGYA 2BIMA 2P52A 3D08A 2WGXA 2BIOA 2H1LM 3VD1A 3Q05A 2J1WA 4IBZA 3US1A 1KZYA 4AGPA 2ADYA 3IGKA 1HJBC 2X0UA 1TSRA 3Q06A 4GUQA 4IBUA 4IJTA 3Q01A 3EXLA 4AGMA 5AB9A 4LO9A 2OCJA 4L18A 2AC0A 5AOMA 1HJCA 4LOEA 5G4NA 3D07A 5AOLA 2PCXA 3ZMEA 2J21A 4XR8C 4IBVA 1IO4C 2X0WA 4G83A 1CO1A 3WTTA 2ATAA 4AGOA 3VD2A 3KZ8A 4MZIA 2BIQA 3EXJA 2IOIA 5G4OA 3KMDA 3WTUA
chains in the Genus database with same CATH superfamily
5I1JL 1C1EL 2CO6B 4KKZA 1IB5A 4C56D 3C5JA 5AVTB 3R06A 4F33A 2Y5QA 5F0LB 5D6CB 1Z1WA 4JJOA 3RWIA 1OGTA 2VDLH 3QZPA 4KK5C 2DQGL 5HGDA 3S37H 2XT1B 3OBAA 4FQ2L 1OAUL 3VGGA 4BUGA 2XV6B 3CHQA 1BFOA 1H8SA 4X8XA 2J25A 1I9IL 1ZS8B 2X4OA 4G6JH 2QADD 4NFDA 4BSVB 4UQDA 4ZFQA 4NKIH 4BZYA 3R1GL 1OGAE 1NDTA 1FDLH 4H1LB 1H5BB 2O93L 3KGTA 4OGXH 2ZNWA 4FNTA 4NBYB 4OQ1A 3V9EA 2WB7A 5JLZB 1RZIA 3GIVA 4AGNA 3PGDA 2J2ZA 3UG4A 2WLJA 2XBDA 4HWBL 2BHYA 3MUJA 4YHLH 5F1SA 1KJ2L 1ORQB 4WI4A 4UQ3B 4MA3B 2A83B 3BCDA 3RY5A 3KJ4C 3C5JB 1TU2A 3CMOH 1H15B 2O72A 1EZSA 3UH8A 1HWHB 2X4QB 3NCYP 4UMSA 2C9UA 5DMKA 5T1MA 3G5XA 3QUYD 5IG7A 3FB8A 1WS8A 3IXTA 4YHZL 4DEPC 3G5VA 3GDBA 4KKQA 3UAJA 3W2DH 2XJLA 3EDKA 2JJTA 1A0QH 3CDCA 3LVEA 4H0HB 2J8UE 5MHSD 1R5IA 4QOKD 3QWOA 4UILH 1INQB 3AXHA 3APDA 1G5AA 1ZANL 2JKIS 1N5AA 3VX0A 2H1LM 2Q5BA 3RVUD 5L8LB 2MCAA 4C4UA 1RSYA 5CUSH 1XGRA 5E00A 2G0LA 3QQDA 4HAGA 4ODXB 2D7MA 4Y4HD 3C2SA 1O7DC 3UTPE 3GBML 4LSTL 5DZ9A 5I5RA 3X12B 1CBVH 4HX1A 1F18A 4QYOA 1U8MB 5E9DA 5EC2A 1RIVL 2ICWB 1EEQA 5HYIA 5C09A 2ROYA 4XAWH 4PGEB 1J8SA 4FEMA 2FHCA 4M6MH 3T8XA 3KPSB 4NZJA 5GGRA 2E7DA 2DW5A 3ZYOA 4F24A 1Z9SA 1EXHA 1BLNA 4DN4H 5IBUB 1AQKH 1MUJB 3BGMA 3A6OA 4H8PA 1KWKA 4FHJA 4P23A 1QP1A 4IOSD 1OTSD 1GOFA 1BQLL 4FJYA 4EVNA 2NNFA 1RJZB 2EDLA 4FAAB 3BESR 3LQAL 4MXVE 4X6CB 3STLB 3CSYA 1AFVH 1S7UB 5L7XL 2HJKB 4XN8A 1KJVB 5E95B 4AL8L 4K3EL 4E9TA 4QJ5B 5BZZA 5C8JB 1UHVA 2LFGA 1L9PA 3O8XA 3ZDXB 3EGDA 1MG3C 1V3MA 5KYYA 1JGEA 1IGMH 3CPUA 5GZND 5C0GA 4N26A 5B3JF 2X5PA 1RHFA 2CDEA 3GXDA 5IQNA 2EUWA 3T2NH 3IJHA 4IBWA 3X14B 4H8VA 1L9SA 1YEEH 2A1WL 4GAGL 7PAZA 2DYSB 3A6CH 4UWQB 3DJ9A 3PREA 3CZLA 4ZOAA 4FKKA 4M3JA 3PXJA 4JRYE 4YLBA 1E5BA 1OEZW 1QFHA 4QHPA 1G4MA 1XVSA 5D1XB 3G3LA 3NH7L 4DH2A 5JDSA 1RZKL 1UH4A 3WKMH 4PJAB 5ELIA 1UM6L 1ZWIA 3DVNA 4I4WA 4LPYA 4F58L 4FTVE 3KS0H 1A7QL 4DOHB 2EC8A 2EIEA 3OB8A 4LL4A 2ZXEB 1R5VA 2XXCB 4KZ0A 3KEHA 3ROOB 4FXKB 3VJ6A 5D7IA 5IB2B 4MYPA 3QVAA 1GS8A 4G8EB 2MOVA 4I77H 4LLVB 1Q90A 2KQMA 1YEJL 3ETBJ 4H0IA 5ESAB 4A2FA 3ZN6A 5K9JL 4Z3EA 4G3YH 4Y2DB 2FATH 1XH3B 2AK4E 5HHXL 1MCSA 1WT5A 1FE8H 4WQOA 3UAJC 3WYRA 1JN6A 4NB7A 2GHZA 2XV2A 4NLAA 3VI3A 3G6DH 2F08A 3LD8B 4ABWA 3NZHL 1TTCA 2WNKA 3EYFA 1ZGLP 3RKPA 2B15A 5B4MC 1OM3H 1HSAA 1I8IA 5AB1A 4R4FL 5A1AA 2CE6A 15C8H 3HPLA 1L3NA 2NY2B 4QRRA 1IJNA 4TVPE 1TCRB 6FABL 1Z9MA 3RNKA 2OYLA 3N0AA 3NIDB 4QHNB 2XYCA 2CRMA 1MHHB 1WISA 2ZUUA 2UXFA 1ZDSA 3KL0A 1DANU 4PRIE 5C70A 1PY9A 1NSNL 4WU5A 3LN5B 3AS1A 4YFLF 1L7TH 5ANMA 2EE3A 3L13A 4ELDA 1BM3L 5ESAA 4HJ1A 5AG8A 1J1PL 1PKQB 2CDFB 5IG7B 4H20H 3SGEH 3U7AA 1SZNA 1ZXKA 5HVHB 3NRQA 5T3ZE 3WXVH 3D8MA 5SWZD 2DL9A 3E2HC 2DJMA 2APBA 4WFHE 2XG4A 4XNMB 5DJ8B 1WWAX 1YMME 4MA7H 2DYPA 1GSKA 2FZ3A 3C5XA 5HHME 3HG2A 4CSSA 5HGAA 3ROLA 5JHDB 2H6OA 2MKWA 2VSMB 4XO4A 5I0VA 4TULH 2NW2A 4IJ3B 1WZKA 3VG0H 1VACB 4I9WD 2ARWA 3K46A 3S4SA 4P2QA 1S9KC 4FFVC 4JLRB 2XCMC 2HT3C 1S2EA 2DQJL 4BYHA 2CLVA 1MHEA 4FLSA 3RVXD 2N3JA 5HDBF 3LKQB 5EWIH 4B9CA 1XR8A 4KJYB 2WNGA 2H4EA 2VW4A 3EG9B 4DGVH 2PPCA 4XXCC 4HUVA 3IK2A 1JV5B 1UXWA 4G6JL 4MJ2A 1R3LA 1GIGL 2B59A 2E9JA 4IDJL 4AG4L 4X7TB 5I18L 2ERJC 4UZSA 4MA1C 2F8IA 5C0CB 4N8VB 2BFVL 3ULUH 1OOAA 1MWAB 4Y2OB 3QJSB 4M5ZL 1S7UA 5L88L 4MRCA 3AGVA 1ACYL 1MZZA 1NCTA 1K6QL 3IDGB 3IJYA 1OSYA 3LIUA 4HWEL 5K9QG 1HE8A 1KYOK 2X4SA 1T0MA 3S3CB 3T3MF 4O58L 5DRNB 2HN7B 4NO0A 3B9EA 3EYVB 5CSGA 5TE4L 3NDZE 1XBDA 2IAMA 1BAFL 1GZHA 2H3NA 3RY6C 3KL5A 5EOCH 3TJEL 2JJVA 4CN6A 3TF4A 4P2RA 2L8AA 5DURD 5I8KL 4GRWF 4Q14A 1EZVY 4YSOA 5LGYA 4BE5A 4GMSL 2H1XA 5BQDA 1EMTL 1I7ZA 1IC0A 4XXWC 5GRVK 2NYKA 3PF2A 3HBPA 1HZLA 1MCLA 5CBAB 2RH0A 1GC1C 3TWCL 1WFIA 3S8WA 1BHGA 2YK1H 4OH2A 5JOPD 2CCWA 2YMXH 1J0HA 3VFRB 2WQVA 5C07B 4WHYG 2HH0L 1ADQL 3D2UB 3ECBB 3DO3A 1TSRA 3FCTB 2PLTA 3O2VL 3EXLA 2UUDH 5ERWA 2BNUA 5HHQB 3SE8H 3BHBA 4X7SL 5GISL 1BW8A 4HOZA 2OAAA 2E5EA 3BZ5A 4CBPA 3ARVA 4X7TA 2DKSA 2FVNA 4LHUG 1JZ2A 3DC0A 3ULUE 4HUWB 4R4BB 5C0FA 5EUOA 2DQUH 4BH8B 2QDWA 1CXHA 4W1TA 5C6TL 4K15A 3UPRB 1UQSA 2QKIA 4OFKA 3X11B 4YHML 3FB5A 3VQLA 3DKHA 5IVXF 3GXNA 1JN6B 1BCIA 4DEUA 3DRQB 2XG5A 3UTZB 4XBGA 1BWMA 3SYQA 3VXQB 3DGCR 3PAYA 2RIKA 1WCQA 3NYKA 3T71A 1BOGA 2WZ6A 2D9QB 3CZFA 5GS0L 5GSVB 2AQ1A 2B4CL 2BLFA 4FQPA 3V6FB 2ZYRA 3VXRB 5C3LD 1Q94A 3OKMA 3OM3B 4CDGC 1ZGLB 3P11L 4QXUL 5L2JB 3FFDB 2QDVA 5CHNB 1U8JB 1YEFL 2G3XA 2H6PB 4O00A 3QHZL 1Y1DA 4HEMA 9PCYA 4GAFB 2WYIA 3VSTA 5E56A 4HJTA 2JKNA 4U0RC 4JHWH 1BOGB 3QT2A 4H2CA 1A6WH 3SYAA 3K71A 1ZIAA 1PD6A 3ECWA 4OCYL 3RWHB 4CMHB 3EJZC 1G7MB 3DARA 5CU5A 3A67H 3RWDA 5K5YA 4RFOL 4MBOA 3W0WD 4UOW0 1HXKA 3VM7A 5CKAA 3F04A 2Q7YB 1ROWA 3DTUB 3Q9PA 5DJ6A 2EICA 1CDIA 2VC2L 5EUOB 2VDML 2L0DA 3PJNA 3D0LB 5J6HB 3RVUC 5D2NB 1RPQA 2PO6A 1AXSA 1KLGA 2MCPL 2ZP0T 5K1JA 3GIZL 1UUNA 3ULUD 1A1OB 3BKYL 3PDDA 4PD4K 5DHDA 3CCHA 4QRAA 3S35H 2ZTBA 3IDYC 4BFGA 4QTHB 4GI8A 1SXZA 4AK2A 1WK0A 2XX0A 4X6DA 3JWDH 1A9EA 3QRGL 1FZKB 3WOVA 1M1SA 2LU7A 2RR3A 4YHOH 5FYKL 2E86A 3LYRA 5LNGA 4G9FE 3HG1E 3US1A 2HZHA 2H32B 2GABA 1FG2B 4XCNB 1H9VA 4OF7A 1JERA 4HS6B 3Q06A 3F6IA 1ZT4B 4N2KA 2VXQH 2E9WA 4ZPVB 4DFHA 3EDFA 3NP4A 1I53A 2CGYA 3A23A 4U1IB 4N2HA 4XBMA 2EP6A 3PIQA 3SDAC 4JFFB 5HYFA 1OGSA 5IFJA 2R2HB 3GMLA 3LZRA 4P2OA 4IGBD 1EX0A 3N55A 3EOAB 4BD4A 1U8IA 4A6YH 2IH9A 1I85A 1E4XH 3ARPA 1T1ZB 3Q8CA 4X6BB 1MRDH 2DDQL 2WWOA 5TFSL 3TVMD 4XR8C 4KV5F 1MW3A 2SEBA 3P4MA 5M95B 3S88L 4OZGF 4EDWL 1UD5A 1JCVA 4KK8C 4P46D 5DJZB 5FYKU 2VCOA 5C0CA 3HN8A 2X88A 3PABA 3G9VA 1KCVH 4XPGL 5E51A 3ZE1E 3GS7A 4WWOA 2IDTA 3T5WA 1TZHB 5J9PA 4M7LT 5A7EA 3S96A 4LASH 4JPIA 4UT7L 1BVLA 2ZPKL 5DUMH 1QTPA 2HRPH 1KG0A 4LQFL 3DX7B 2F18A 3EBHA 1TO4A 4KZDH 4HQQL 3MUGA 5DK0B 2LTQB 4EN3C 1AD0B 4JZOA 5HPMA 3SCMB 3V6OA 1I9RH 1S7XB 2HA1A 3L3OA 5CINL 5FA3B 4DK3A 1RK0B 2ZX7A 3UPAA 2Z92B 1HKLH 4XVOA 3UL4A 5E8NB 2OTWB 3MBWB 1VGKB 2XN1A 3T6VA 3MLRH 1MFBL 3VXOB 5KYWB 3U7WL 2QSVA 2VDPL 4F2MA 4N2IA 5F9WB 3HE6A 5CJQH 3RWCA 1OCRB 2J20A 3LY6A 4J4PA 5D6CA 3DX6B 3P3SA 5BZDB 4OM0H 3MV9E 5DJYA 1AO7A 3O2DH 3QQDB 2ZUQB 3GJFA 4GKSB 4YAQA 1KGJA 4KGLA 1P4BH 1Z3GH 2VJ8A 4F93B 3QUZB 3SODB 4YHIB 1P4IL 1CD0A 1ZA3A 3GSXA 1T66D 4JGNA 3D0AA 2FK9A 2VDNB 3T0DA 4W4OA 4BFIB 1M56B 1M1XA 1D5BA 1CXFA 3PAZA 2NLJB 2QHRH 4LVOC 2NR6C 1NCGA 3QJUB 5KYXA 4PRID 3V4LA 4OLZH 4TQEH 3QFDA 2WVVA 4Y1AE 2ZONA 3L6FB 3KWTA 4XTRD 2YMXL 3S7GA 1HNGA 4KXZH 4PN6A 1A6UH 4MA3A 1D5MA 4X42A 3RTQC 1NAMB 4YE4H 3JV6A 1ADQH 2CCVA 2AJ3B 5DJAA 1MLBA 4P2RB 2F8VA 4AVIA 4F7TB 2XDHA 3CXDL 4DPCX 3WNJA 1G7JB 2H0PA 4FQCH 5L4MA 1I9JH 1DL7H 4HMCA 1DJZA 1FVDB 4KXDA 3VXSA 2Z7YA 4LFHG 4PB9L 2PF6A 2YKLL 1VADB 1CFNA 2XPYA 1EA9C 3WNOA 4ZSOE 1QHPA 4OCLC 5KANI 5DO2C 3T2OA 3K6DA 1T0NB 1OLLA 3HNSL 5AZUA 4M02A 4XOAA 4TTGA 4DF9A 4MQSB 1TITA 4MXWH 1PPIA 1Q9OA 3LS4L 4N1EA 4HHGA 2WANA 3CPLA 2PN5A 1O7SA 2L3BA 4K73A 4HJ0D 4F57L 5GJTH 2K7QA 4LBEA 4JS7A 4JO2H 2CPCA 4D8OA 3BVNB 1DQML 5E99L 5AVSB 3KM2A 4P07A 1FFNB 1XT5A 5DJ2A 2V37A 2EDNA 3MJ7A 5KS9A 1NBQA 4ORGB 3K0YA 1FN4A 3BP4B 4YWGL 4D9LH 4JDTL 2VNCA 2FX8H 2NUPB 3SE9H 5I1DB 4OI8A 3HFML 1JNLH 2BSCA 5J3HC 1HHHA 4WRLA 5A6MA 1FZJA 1ZS2A 5D1QC 5FHAL 5HDWA 2H1PH 1MHPL 1OAZL 1CFSB 1KEML 4BFKA 1LHZA 1URLA 2D3VA 2VLKB 2V5YA 2WUCH 3QWQB 5DUPH 3NTCH 5E2VL 2JVUA 1GC1L 4FYRA 4OLYL 3P0VH 5T5FL 4PWGA 3D87B 1ZMYA 5E2TL 3TEZA 4F7MA 1IZJA 3VFNA 4J4PC 2J5WA 1D5RA 2YD1A 4Y4HC 2WQAA 5TE6H 4LSQL 4AITA 4OZGE 2WO3B 2VDMH 3BPOC 4PJ7B 1CVSC 2AJYL 1JZ7A 1YN7B 5HI4C 1QOKA 1QFWH 2APTA 3KS0J 2HT3D 4IRJD 2ZUXA 2X3AA 1ND0A 3CZEA 4JDVB 4W4OC 2BRRL 2EIJB 2YGNA 4ZUSB 3GSRB 1JZIA 2W60A 3D85B 4ELME 3ZUNC 5C0RH 1Z9NA 2XLLA 1ZT7B 2XKNB 3UJJH 1QSFB 2BM3A 4TSBH 1MREH 4P2QE 4X9YA 4XPAH 4DP7X 4QRTB 3KPQB 1OCOB 4M7JH 3ARFC 3X17A 4PCTA 1HI6A 3O6FA 2WYZA 1N59A 2X6UA 1IBZA 3L1OL 2VABA 5F1NB 3TEXA 4E5XG 1T22A 3HRZC 4EDXB 5TQ2H 4PJFB 2VMCA 1MCQA 1R3KB 3IB4A 2CKBB 4PHZA 4P9HH 2N59A 1UD2A 3O9WD 1XQ4A 4Y2DA 5E23A 1NC4B 2A38A 3W39A 5ADOL 3O6KH 5CWSA 3LS5H 3L3GA 3UBHA 1CT8B 1INEL 2GBAA 4HBQA 4XH2B 2DH3A 3F00A 4M43H 2TRYA 2DDQH 5FF6B 2CLZB 1AGBB 4I3RL 1MCOL 4M03A 4N3UA 4P04A 4EDWH 4EBQL 4XXCA 4WZ9A 3GIVB 1WA0X 3P3TA 2VZUA 2C9SA 5E4EC 1YNTB 3HE7D 4JVUA 3MLTB 3VACA 2Z1KA 2EDWA 4FI6A 1MLCA 1Q0YL 3UG3A 1U3JA 5JXAH 4M4RB 1JF1A 1P5UC 3DV4A 3DX1A 4P9MH 2Z8VC 5ICXA 3UGXA 1A25A 3GGWA 1IFHH 4NX0A 3O3EA 5E2WL 3NIDE 3HMXL 4BE6A 1JFQH 2WN3A 3QCUH 4FN0A 2Y7QA 1OF0A 1U2CA 1ZA6B 3N42F 2O30A 2IANB 3OJDA 2MNJB 3MCLH 3OR7A 2FO4B 2ENPA 4HQQH 4R5XA 3UG5A 3O3AA 4DUXA 1ETB1 4IU2A 1Z5LB 2BY2A 4PAZA 4PJ7F 3J07A 2ATPB 4FLHA 2IH3A 3ESPA 1RUQL 4NOFA 2FDBP 2AJXH 1HZHH 5TJWK 3VXUD 1DQTA 2PP8A 5D2LF 3SGEI 1EANA 1E6OH 3WS3B 4YHYB 4AYBA 1EDQA 2FJHB 5C0NC 4MVBC 4OZFG 3OC5A 3E9UA 2PTTA 2Y6TE 5T1LD 3ZDYF 3FO9A 1E5AA 3VXNB 5C3IA 1BJMA 1MHEB 4LCWA 3AY4A 1JXFA 1AXIB 4LL9A 2VM4A 2EDTA 3C60A 4OU3A 4DVRL 4K0OA 1A6TB 5EEXA 1EFXA 1DJXA 1Y6KR 3WUWG 3TS8A 1HL8A 4C4KO 1Q1PA 4E41E 4U1KB 3PDOB 3QUYA 2A9MH 1NUGA 2GC7C 5HGAB 5IQ9B 3U0WL 1U3HA 1VIWA 2JSFA 4YSDA 4UUJB 2JF1A 5E6UB 1IC1A 1XB3A 2AJSH 4HH9A 1MG2C 1T66C 2J8UF 1GRWA 2XY2A 4JFZL 1N0XH 4DP9X 5DVLA 3WIFA 5J11C 2K8QA 1KTKE 3NESA 3KWWA 3DX9A 5MEOB 4XN1A 1JPFB 3FO9B 4ODTH 1A4KB 4IDLA 1WAEA 3NJLA 4B50A 5H37G 5DJDB 1SVCP 5CBEB 3ZE0E 3S37L 5ACZA 4MJJA 2VN7A 3AU0A 3D3VB 3WFHB 4V2CB 1J0KA 1MY7A 1DBKL 2FE0A 4AQEA 1PBYA 3OHXB 2VN3A 1YEKH 3LNGA 1TEFA 1RJYB 4HS3A 1A3ZA 3FOMB 4W68A 1QPPA 3C5ZD 1MELA 3MOAL 3QK0A 2FIRT 2XJKA 1AQDA 3REWA 4CC4C 2YHGA 3TN0A 2Y7LA 5D1ZD 2AF2A 4IBLT 3UTQA 1KELH 5IW6A 1HN1A 2XU9A 4MAUL 1YNLL 2DN7A 3I3DA 2XFXA 1DVFA 3T0XA 2X4RB 1DQDH 1VHPA 2EE6A 3GGWB 4NKMA 4EEEA 4YHLL 3V8OA 5DRWB 1Q9WA 2AQTA 4MXQD 3WNPA 4CMMA 4DETA 3OAYH 4IRSD 1E7UA 4JO3L 5EORL 1GZQA 2Z0UA 4Z7VE 4BZ1A 1FWXA 4G8FA 4PU2A 5G4OA 1DEEB 4BSVA 1BZ9A 4MJ6B 4OCNC 2X89D 1OP4A 3F01A 1CDBA 2EUXA 5KSVA 4JY5L 5FWRA 4O5LL 3FT2B 4EI6B 1HXYA 5HHPA 3F83A 3QR1A 5JPMA 1HEZB 5FECA 2FEEL 3RDTB 5HGBB 3B83A 3T9WA 1YN6A 3DVGB 3OX8B 3BD5A 2JI3A 1XB6A 2V2XA 4K5OA 1Q94B 3OKMB 3WLBA 5J13C 1H3WM 4E5XA 2HX8A 3SDCB 1WZAA 2ZCLL 4Y2DD 3NA4A 4XCFL 1U8NB 3KPRE 5CUSL 1TJHL 2XZCL 4CU6A 3VVVA 5DUPL 3QCTH 4LHUA 3ZRFC 3TYFA 1GY2A 2BY3A 1GZHC 3UYOD 2NY7L 3PFQA 1AIZA 1WSST 1ZVYA 2HLFD 4ZXBA 1S7WA 4PRDA 3KVDD 1LL1A 2V8MA 3MLZL 4PCYA 2R0WL 2X53A 1JG9A 3MGOA 4A7GA 1R46A 3FFOA 3REWB 5EUKB 3JTBA 4MMXA 3AB0B 1MNUL 3O41A 1RK1B 1NAML 4XVSH 4Z6AT 3PIQB 1KXQA 4I89A 3LN4A 5J8OA 4XPFH 4YQXL 1JCKA 3K91A 3L3HB 4XVJH 1DZ0A 1WVZA 2VUKA 1ZD6A 4ZUSA 2HFFA 4JFOB 3WSQL 1PZ5B 2P43B 3EUUA 3PXHA 4BUHA 4TSBL 1NFDF 2O5NA 4CC1A 2GSGA 3D39D 2H2SD 1CICB 3Q05A 3ZMRA 3UJIH 1IGTA 2VE6A 1R6VA 2DY2A 2WXOA 3K4DA 2CBMA 2PWFA 1MUJA 3BGMB 1F3DJ 1BXVA 2F8OA 3GBMH 4LSTH 4S11A 5F3BA 3LEXB 5HJGA 5E4AA 3GUFA 2FD6H 4B9ZA 3GC3A 1IKFL 1M53A 4AGMA 1RUPL 4I4WB 4KROD 3CWGA 1HHIA 1E90A 5C2BH 2QL1A 4MQTB 4H88H 4ZTEA 5K1VA 1R24B 4IK7A 3L6FA 1PVHA 1TTGA 3PY9A 4NO0B 2AVFA 1R47A 1AR2A 2DQHH 3ZK0A 3JV4B 4JRYD 4LF3B 2Q86B 3ZX1A 1BVKA 3HB3B 5AYUL 2XWBB 3P9MA 4GW1A 1TYRA 2ARJB 4HEPG 5DHVB 3V0FA 1JYXA 1FFNA 3QR2A 4Y4FC 3WEOA 4MMYA 3HC4H 3QIWC 4UM8A 1ZY9A 1VSCA 4FOMA 1FV1A 4F15C 4XAKD 3SPVA 1CTMA 3LQMA 3H3KA 4WTZA 1V05A 3LHPL 2RTTA 1Q0YH 1CN4A 3LHAA 1I1AC 2I5YL 4P9ML 5ICZB 1ZE3H 3DX6A 2Q3ZA 3FFDA 1WBZB 1A5FL 4KJPD 3TJHD 2ZG1A 4NC1E 4Y8DC 4LPUA 5C86A 2DQGH 1KLFB 4M4PA 5KSVB 1ML0A 2NXYD 3MTRA 4HXBH 5F89B 3QZWA 3UPRA 2ZF9A 4F3FA 3LRMA 4U6HB 4U7KA 3TPUA 5JHDE 1W6LA 5TF1L 3G9AB 4F8OA 4AL8C 4P2QB 1D6EB 4PGBB 4KV5E 4JR9L 4XB3A 5BZWA 4I18B 7PCYA 5F0JB 1E0OB 3DRQA 5B8CC 2OJEA 2UZIL 1P4LB 3U0TA 4LARL 3KPRD 4IRSA 4OI9A 1OAYH 1PZ2A 5K9OA 2GJ6D 4JJ5B 1ITBB 1DVFD 4XNZC 3QEUB 4UIKL 1B3JA 1AD9A 2BINA 3LMJL 4C59B 1KGUA 4TNVK 1P7QB 1G6VK 2FWUA 3E3QE 1KCSL 4GUPA 3UTPD 4XN9A 4ZUVB 3TTSA 2CUHA 1HHKB 4ANWA 1FBIH 2CWRA 1EWHA 3PE9A 5DC4B 3ORJA 4PTUB 4OVVA 4N5UA 5CCKL 2GFBA 3RX8A 4BFIA 4ZX6A 1HIML 1JHKL 2G3MA 4GSDH 3VFSB 1XGUB 2VM9A 1DBAL 1W6WA 5T1KA 1UYWL 2BS8A 4AV5A 4WUUA 2XXFA 2MJWA 4AGPA 1OQXA 4IKIA 4NT6A 4RMUA 1SXCA 4XZUA 5CM1A 4N4YB 4J28A 4OF8A 1N4XH 4RZCA 3SCMC 4JM2C 3ZJAA 3U4KA 2A3TA 3QZBA 1REIA 3II2A 3INOA 4RSVA 3EO0A 4MQ7B 2X6MA 4PRAA 4XO5A 4Z7WE 2Y3AA 1N64L 3OL2A 3QORA 3H54A 3TBTA 5EU6B 1ZAGA 3DX8B 3EGXA 4NBZB 3WG7B 3CDGA 4X9FA 4P5TD 4XNUH 4DQOH 4E9XA 2F19H 3D4CA 5ABZA 3HBGA 3CFUA 3HG1B 1WA1X 3WY4A 4XN5A 3GRWA 4MJIE 1P7KA 4IRJB 1WWBX 5GRXG 4O51B 4Z0BL 3MRDA 4KOBA 1XEDA 1W8NA 3BDXA 1TVHA 1KTJA 2ZX5A 4Y9CA 3WHXA 4FJ6A 3QQXA 4UM8B 3T2NL 2FO4A 3CVDA 5BOZG 3U4EB 2AABH 4HIHB 4HFUL 4R4ND 5SWSE 3RU8L 2I85A 4OGZA 4O5LH 2J5LC 1OAQH 5CP3H 3ZL4L 1NBVH 4KXZI 5CU9A 4Z7VB 5B21A 3UYRH 3QH3A 4AKPA 2AGJH 3ATAA 3DX2A 3PWPE 5EEUA 5DQ9B 2A9AA 1N19A 4Q2ZB 4GLRI 4QXWA 2X44D 4PJBE 4YXLH 4B5EA 3WNKA 3JQOB 2AEWA 3WFBL 1JGLH 2COQA 3QUXB 4QRPE 1TQTA 4IRJA 5IB1A 4G82A 2WXHA 5HDQH 5LGJB 2BW5A 1DDTA 4WFGD 2Z0BA 3ABKB 1HQ4B 4TS6A 3FQTA 1A7RL 3KPOA 1JI1A 3MRHA 4PVBA 3EOBA 1NCBL 1SUHA 4JG0L 4MA8H 4Y5VA 4OSUH 4JFQA 5H94B 2PYFA 3QEQE 1XCQA 4L1TA 4LU5L 3I3EA 5KAQG 4AEHL 4JM2B 1NC4A 3VXQA 1BD2B 3IWVA 3SJVD 4TVPL 2J1XA 3ZYJA 2EKSB 1PQZA 2DLFL 4AYID 4QTHA 1BSIA 2IOMA 4LEXH 5ECJE 4PEEA 2FGWL 3S36L 1BVNT 2AEQL 3KGSA 1JPTL 3U0PA 3TWCH 1XSIA 1KENL 1D5MB 2YK1L 1I8IB 5B38A 3UO1H 4WWKD 3HC2A 1X4ZA 3ILEA 3IJ7A 1U95B 3V4PL 3WEAA 3HC0A 2YPVL 3IU3A 4WGKA 5D71H 3MX0A 1P1ZA 3QWOB 5LNEA 5IROD 3VGAB 1T3FB 2NX5B 3FN9A 3B2PA 3ZDXF 2VR7A 5EU5A 5GS0D 4KNQA 1VFMA 3L16A 1K3ZA 1D9KC 1PNDA 1S3RA 1ZCRA 4PLJC 3V8CA 2H5UA 5E8PB 5EIIA 3KJ6L 3OTTA 4YAQB 4IGBA 3SYOA 1OP3H 3NABL 2IMNA 2VDLB 1J86A 3ATBA 5DF0A 2X0WA 2FLBT 1CDGA 4FG2A 1DFXA 1QFWI 3VB9A 1WIOA 3SBRA 1Z32X 4ZO8A 1O9ZA 3MLWH 1QR1A 4IEFB 5FW6A 2FJFA 4H1LH 4XGZB 1RZPA 4C4KT 4P4KD 3MOBL 1MVUB 1PLCA 2WXQA 1SHXA 5FO9B 2H41A 4D2NA 1NMAH 3G6JE 2FBJH 4N8CH 2XTJC 3RJDA 4UTBA 1BFTA 1DVFB 3MBXL 5AB0A 1K85A 1DQQA 3QZOA 1EHLH 5D4QA 1KLFA 2BNRD 2EEDA 4ACTA 1KJ3L 1T2JA 1F5WA 3RWIB 1IEAA 4M9PA 4ZUTA 3QA3B 1VGEL 5IWLA 1M71B 3IGFA 3QUKB 2GITA 4P5TA 1J5OH 4F20A 4PJEA 4G42A 4BK8A 1BAGA 5I1IL 3QXVA 2N7SA 3MRRA 4NZDA 1XGYH 1X5FA 2AZUA 2N56A 2EYTA 2C26A 1EFXD 2F8XC 3WN5B 3S3PA 3STZA 3GD1C 3IDJA 3CVHL 3QR0A 3K6NA 2JMRA 3ILPB 3WIFB 3T6QC 4IMLB 5DLLA 5TE4H 3CH1B 1J0ZA 2Z35A 4UM9D 4ONHB 1TZIB 1TJGH 2DEXX 2E46A 2WCPA 4NBXB 3WKNA 4LDEB 3WAJA 1YEHL 5FO7A 4RGOL 5D2LB 3H9ZA 3V7AE 4K23H 4UTAL 2F58L 1RJLA 4I2XA 3T0EE 2UZPA 2IPTH 3CFNA 3EAKA 3QDGD 5J12C 3UGEA 4YDIH 3H9HB 2OP4L 1NJ9A 2E7LC 4NQCE 1XDTT 4WDIA 4ELMB 3UZQB 1WFMA 2FEDD 4LDCA 4W9EC 4L8CA 4YFLI 4KZCA 2BSDA 5AFAA 1HCFX 2QMKA 4LCWB 2WZPD 3D2TA 2NY4D 1CGYA 3I6LE 5DC9B 4DTGL 4ZAKB 3MRBA 4Q9CA 1F6AA 1WFNA 1AMYA 3RWEA 4M61A 4A68A 2B14A 3EJZD 2JXMA 3OG6B 1OTSC 4DGUA 5C0JA 1VFUA 3DXAB 4ADIA 1MFAL 4G9DB 5DEJA 2F61A 4X5XB 1R5WB 1TEGA 2ATPA 2XN0A 1AXSB 3RTLA 2BW4A 1FL3A 4FFYH 1JHTB 1D6VH 4KZEL 2WMPB 4PJ8A 2DQUL 4QD2E 1EXUA 2UY7A 2CO3A 2ZXAA 1FC2D 5IREA 5IQ7L 1QVOB 3U4AA 3O3EB 4HHAB 1IBGL 4KMQA 2J71A 4JFED 4MFHA 4Y89A 1WH0A 4I2XE 3ULSB 4LHUB 3RVTC 1UCBH 4MSWB 2CJUH 5BS0E 5DD0H 5DS8B 1BEYL 1WWWX 3DO4A 4Q9QH 2WLZA 2OMTB 4GG8B 2DYPD 1JHLH 1FORH 4WGVB 1UWFA 1QR1B 3HAEH 4R7DA 2BNQE 2BP0A 4N5EC 3BO8B 5JORB 3EYUH 1CQKA 1CYGA 5JIIA 3SDDA 1I1YB 4HDIA 5CP7A 5DTFA 5B1AB 1UOLA 4I0PD 1UD3A 3US9A 5I73B 4H8UA 3VTAA 4OD3H 3BQUD 3OR6A 5CZXD 3QC6X 4PS4L 4WEBH 1NH6A 4XPBH 4AUJA 2ALWA 2A5UA 5ADPH 4PJAA 4JRYA 3GMMB 2GC4C 1CFSA 4A38A 1B0GB 2ZOWA 1E2VA 3LXAA 3FHQA 1X44A 1WA2X 2HRHA 1QQDA 4Z3TA 3NA9H 4GUCA 4FADA 4Z18A 1S7RA 2DJUA 1FLTX 2NY3B 3BP4A 5FOJA 5IJKC 2FX7H 2DQFA 1TJXA 5CSZA 4Y9GA 4G6FD 4WCYH 2ICES 1S78C 4FMKA 5EBMA 1HS6A 4I0PB 4HGKC 1OK0A 2WMPA 2RCSL 1MCHA 2GT9B 2CH8A 1SRDA 1RJYA 3BSZL 3ME0B 2R2HA 4JN1H 4BM7A 1A1NB 4ZW7A 3PUCA 4M8UA 5JW4R 3DMMC 5D7JC 1NC2B 1NFDA 4Y5XC 5CN2A 5IW1A 4EZKA 3TJHC 1JNNL 3LIZL 2ZKYA 1YPZE 2HPOA 3S3DB 4FHBD 3A47A 1J10A 3JTSA 2IQ9L 4QRBA 3TVMC 3N40F 3QDJE 1LO3H 5KUMA 2ZJSH 4N6QA 4DIXA 5IV2A 2Z93B 3TIDA 3KWWB 2R1WB 5B7EA 4LSUL 5IVXB 4RX4A 4R26H 1OWWA 5DLMH 1PL3A 2D2CC 2DIJA 4LRIC 4MZ3A 1G6RL 5I1KH 1A7PH 3G04B 3CX5J 2VZ1A 4GKZB 3ZZ1A 4OZIB 4B60A 1YC7A 5KVEE 4XI5C 1CL7L 1E8XA 1GGUA 1U91B 3MV8A 2ED7A 1MSPA 3K7UA 4M6OH 1A1NA 1NLDH 3GS4A 5C0IB 3SDAD 3T77B 4WFFE 2IPUK 3GMOB 2FWOB 1YPZF 4CNIB 1U30A 4PB9H 1NLBH 2Z35B 4PFEA 4OLUH 5ICUA 1MHPH 1OAZH 5A43C 3FUMA 5AVUB 3NABH 3NJNA 4QHUA 4N86A 5DJ2B 4FABL 3VFMA 3U4EA 1A9BA 2DRUA 3QJHB 1UXLA 4AH2B 2YZ8A 3QS3A 1A3RH 2ZAHA 3TO4C 5KYWA 2CIKB 1BZ7A 2VR9A 1DQMH 4L5FH 2MPVA 4U2ZA 2KL6A 2XVGA 3S4SG 3HIZA 3DTXA 3DETC 2YD9A 1LEGB 4FG6C 3RQ3A 4YHZH 3TH3T 3US0A 1YCSA 2AEOA 2P4AB 2EXWD 1ZA6A 1G7LB 4E41B 5KYUB 2CO4A 3UBXA 4FI8A 4RAUB 2YARA 5L0QC 3AS0A 1LEIB 5IMMA 2V3EA 4W4NA 3N43F 2L4OA 3HOGA 4GW5B 4PJGB 2GTZB 2XXMB 5MENE 4PJEF 1MEXL 3W0WE 4KKLC 2Z7ZA 4PRPB 3D9AL 4FGMA 4ZG1A 4M5YL 3JWDC 3U2SA 1N12A 1QLEH 3FT3A 4OLYH 5T5FH 2NUTA 2HT2D 3MLRL 4FFZL 2AEIT 3UBXB 4LEBA 5KSBB 2VDPH 3UTQB 2CALA 2IH1B 2QZQA 2OXHB 1ZE3C 1O6VA 1A9VA 1HILB 2F53A 4XP6L 2E27H 4KUZH 5D7LE 3EADA 1AGCB 5DK3A 4QNPF 5FW8A 5D5MA 1U92A 3O4OB 2KZWA 4O2EA 4AMKL 2NY6B 2Y22A 4Y4KB 2Z31A 1CE6A 1HVXA 1DP0A 3GJFK 1CFBA 4G1MA 4GQ9L 3A6CL 3LQZA 1FC1A 3UO8B 35C8H 3MN8A 3P9MB 1J05A 4FS0A 1HL5A 4B96A 3VCLA 4JY4B 2FHFA 1LO4L 3JV0A 4AYFA 3U30C 1R3KA 5HHNB 4DP4X 4ODVH 4ALAH 3L3KA 3VFRA 5DZPA 3SBWC 5A2JH 3MRKB 2CA3A 5KS9F 3EOAA 1MFDL 5EU7E 4P49A 1JGUH 5E6RB 3V6OE 4N87A 5IFJB 3RWCB 3M6DA 3EYFB 3Q13A 8PAZA 4LAQL 2F7OA 4R6UA 5IQ9A 3FRPG 3CLFL 1I82A 1S9VB 4JFSA 4WNQB 3RX9A 3GXFA 1UVQA 2FSDA 1UGNA 1M05A 4GEIA 4JG5A 5EDXA 2KDGA 3UTTA 4BELD 3BEWA 1D6EA 1U8PA 2BVEA 3ZDXE 1C5BH 2KT6A 5H94A 4TNWF 1MNNA 2G4GA 4X2UA 4I0CC 1JZHA 3NEXA 5I8CB 3L3DA 1EO8L 1TMQA 5E4IA 5DDHB 3APMA 4I3RH 3OC8A 3LS4H 2X3BA 4MD4A 4ZMVA 5MP6L 4KOCA 4KH2A 3S96B 3QXAA 3GKZA 1BQKA 4J3UA 3MPCA 2NYYD 1WTGT 1NGQH 2BFGA 2DM7A 3FB7A 1QLRB 1IAIH 2YQ3A 4P5MB 1YEIL 4K3JL 3ZHFA 4Y4KD 3ILDA 4XN7A 4AGQA 3AXLA 5DJ6B 4BWTA 3QUZD 3RPIA 3PJSA 5DI8A 3QHFL 5GZOC 4PJHA 5TDPB 3BDYL 1KN4L 4KJQD 4KQ4L 2Q8AH 4QHKJ 3LEVL 2WTPA 2ZUYA 3MCLL 1SOSA 4M4RA 2QPUA 4H20L 1YSOA 4IS6A 4JDZB 4PJ5A 5KAQF 4KDTC 1JPGB 2ESVD 2VDRL 2BVQA 5E7BA 4BSWA 2FWOA 2PPEA 3HG0A 2NSXA 4DPBX 3WXVL 5ILTL 3SYPA 4U3CA 3CFEA 3ZE2E 3GTTA 4JFWA 3QXAB 1QPKA 2DMKA 3OKDB 4LSVH 2ADFH 3RGVA 2JK5A 5KBMA 2P26A 1JTOA 3PHQB 4M6NH 3EO9L 1BP3B 4XPTH 1X5LA 1AP2B 3S3BB 3GSQA 1E4HA 4IIQA 1YUKB 1MVFA 1ZJBA 2CDFA 3LNEA 2J8OA 3CQQA 2JH2A 4RISH 5E6ID 3O6LL 4HC1A 3VW3H 1I7RB 1YRKA 3V4UH 4AIZB 5B39G 3CX2A 2APVA 3NIDF 2H6UA 4NKOB 4TOYH 3FUFA 5FCSH 3FQNA 2HFFB 2ADIB 4TKWA 1NGYA 3MC0A 2FUQA 1ZK5A 1RZJC 1IM9A 1TQBB 4PY8I 5E0QA 2IDCA 2Y2YA 4R97C 4NSKB 4Y4FD 5LBSH 4N2OA 5F7FA 3P3RA 3P30H 1OGAB 1EXGA 1DZBA 3CNKA 4OIBA 2Y7SA 2QFRA 4N20A 3MJ8A 4O2FA 4IGBC 2VISB 3SDAB 4X0NA 4GLRH 2A9NH 2GJ6A 2P5EB 2YC1A 1AS6A 4Y1AD 3OD3A 5L88H 1P6AB 1IGFL 4PIBA 3BKJH 2JLPA 1XH3A 1J1XL 1Q0XH 4UINH 4NN6C 1K2DB 2Y6SD 1QW8A 1K72A 4C47A 5BS0D 4PV1C 1X4XA 2IWFA 5EU4A 3D52A 3LS5L 3JZ7A 1E28A 4Z7NB 3GTVA 4HKZB 4ICWA 4BDVB 3NCWA 5ALBH 4HA1A 1BZDA 4PJHF 5D5MB 2PXYB 2DM3A 3MRPA 4IDJH 4LVNC 5BVJA 3L2MA 5AOLA 3TBYA 4PLNC 4BHUA 4GRWE 3AS2A 1ZV2A 1U3HB 2Z31C 4DP5X 1ZGLA 1NCCH 2IVFC 3T65B 3ZRCC 2G30A 2BXZA 2OL3H 2JB5H 2VT0A 4EBQH 1CYXA 1I8UA 5DMJB 4XVUD 4JO3H 1KBKA 4O58H 5AL8A 1KBVA 1C5DB 4NZFA 3VXPA 1ZEAH 3INUL 3PL6B 4JRXD 3UTZA 3DHMA 3SGJA 3EJSA 3IFPB 1HOEA 1GAFH 1YMMA 1Z66A 5EOCL 2D3LA 1BFOB 1FE8L 4HHAA 2MQGA 4PB0H 4RMWA 4NZRL 3IDIA 3ZYIA 1GTFA 5KYUA 1DQLL 3RPIB 4E41A 1DE4B 2B8OT 5KBDA 1OVZA 3QP3A 3MCKA 3LQAC 3WJJC 1WEJL 2VSCA 3H85A 3HB3D 4XCYB 5E2UL 4AVJA 5KOVC 3ISWA 1MFMA 2CO6A 1DJGA 4Q4EA 2YD2A 4LCWE 3GSUB 1AHWB 2EILB 1W9XA 4IKLA 1KPVA 1R17A 1M71A 4M7ZB 8FABA 1CPUA 2VDNH 3REVB 5C9KA 4D0DB 2H0EA 3QCTL 4YGVB 2Y9RT 4PREA 2HH0H 4IOIB 3RTQA 2W88A 4KK9C 3STLA 2QQNL 3F3HA 4GS7B 5E70A 5HGHA 1JGIA 4X7SH 3OAYK 1FFOA 2J6EL 5DVNA 4R8WH 1T2QL 3UDWA 2E27L 4KUZL 2V7NB 4QXGH 2EC9T 4PSRA 1LP9A 4GSRA 2RQEA 2FX9H 4IBYA 2N7BA 3MV9B 4GXVL 5EZOL 1F97A 1IM3B 3NSYA 5A7BA 2ZSVB 5EG6C 3GLDA 4DVBB 5IFAL 4FCHA 1RZ8B 1IC7L 2XVBA 4CJ0A 4ZYKB 1MAML 3G04A 4N0CD 4HJGA 2DWXA 2WXJA 4WKXA 1TJIL 3GM8A 1WICA 2K6YA 3B3BA 4IBZA 2LQRA 4N1HB 5E1QA 3IMTA 2LOEA 3IDJB 1UTDA 4MZ2A 4CA4A 2XZZA 1L9NA 2ALAA 2YSTA 5BVPL 1HK6A 2K6ZA 4HPOH 1XD1A 4MMXC 4X5RA 2B20A 5ALCH 5E08L 5F72S 1H3PL 4NDMA 4QXUH 3FB8B 1AZVA 2CUMA 3O81A 3RWFA 1PGRB 3TN0D 1DBKH 3HZKB 1TCRA 1MH5B 1J1PH 4NQDE 2DWDB 4HGMA 4IHOA 4CSTA 1AO7B 2XQ0A 1E2WA 4UQIM 1TFHA 3HUJB 2YD6A 4JRXA 1TLKA 2OZ4A 4RQQB 3BAXA 3M45A 4TQHA 2PCFA 2PR4L 1IM9B 1G9NC 2EEFA 2XHNA 1EHAA 1E9PA 4H8HA 4K2UH 4TV3A 1B0IA 1XEUA 5DEGB 2VXQA 5AYUH 3SDCD 4BK4A 2D4DA 3BX7C 1OAYL 4MHHI 4P2OC 5DWUH 1AQMA 5EBWB 1N7MH 3DVIA 1KPUA 4MXQC 4MZIA 3VG0L 5HVWA 1KNOB 1S4IA 2OJZH 5C6PB 4FP8L 1YEIH 1ZXQA 2YD7A 4WI2A 5IMMB 1UT9A 2WQXA 2Y7NA 3HEIB 3OXSB 3MROA 2G60L 3TJEH 4HSQA 4PJ6A 2YRLA 5ANME 4R9HA 4OT1L 3FT4B 2CHZA 1JGVL 5SV3A 4ZMPA 1J0YA 1EQWA 3AREC 2J1ZA 3P9LA 3SZ6A 2DTSA 3ZKXB 2FEEI 2XQBL 1F8TL 1ZT1A 4Z9KB 2BSSA 3QAQA 2WOBA 4HUMB 1JPGA 2VZTA 1MRDL 3DSNB 3F8UB 4NWTL 3MBED 2W9DL 4Y5XA 3SGDH 1SYSA 2I07A 3RA7L 1LO0H 1V7MH 3ETSA 3I2CL 4GP4B 3QH3B 12E8H 2BSTB 1OGAD 5LLIC 4GI6A 4L9DA 1L9QA 3MYJA 3U1SH 1SBSH 4A2GA 3QDMA 2DTML 3NAAH 4NQCD 3CN3A 2ZAGA 3IJHB 5DJ0A 5C08B 2BX5A 4ATTA 2A6DA 3QI9B 1MHCB 4F9PC 1DVSA 3N41F 2JKRM 1W2KT 1KGIA 4OZHF 1SY6H 3Q44A 2H3KA 4UT7H 2Z9TA 4WY7H 4J3XA 3S3SA 3IDXH 3Q8FA 1PLGL 5ERWB 2R1YA 5IJDC 5DJDA 5GZNA 1ND0B 3QI9D 2HVJB 4LOUC 1GCFA 3IGAA 3A4EA 3KLSA 4BSJA 4PMFA 2OKMA 3SDYL 4PTTA 1NMBL 4LFHD 3EO0B 3FL7A 5C0ND 3BYTA 1CK0H 4ODHL 4DSYA 3LZQA 1BA9A 2CBPA 3K6FA 2D2OA 1FZOA 1UJ3A 1MPAH 3FQYA 1DN2A 3NT0A 4PH8A 3UEZA 4FG4A 2WVSA 2Z8WC 1XIWA 3H55A 4NENA 2DLTA 2Z7WA 2DAVA 1BJ1H 3A0OA 4G7YL 5IBTH 3HHSA 2C3GA 4WUUB 1DQVA 5HDBB 5I1CL 3AACA 4OKVB 4BCYA 1URIA 1G7HA 2IWEA 2VLRE 1KBGL 4EN3D 2IBGA 2YRZA 4HBCH 1ZLEA 2UXVA 4UOW1 1ZTXL 5JMOC 4URKA 1C12B 3KW8A 5F97E 4MYWB 5KVFE 3VDCA 3KH4A 3ALPA 5HYJB 2VWEE 4AT6B 1MWAA 4Y2OA 1NCNA 5C08D 1QAWA 1RUMH 3CC5A 3A4DA 3DJRA 1L9OA 4GQRA 5DD1L 4AJWA 2FT7A 1XGQB 4OM0L 2ZZUT 1U8CA 3GB7B 3DUUA 2VMDA 2E7MA 4YO0B 5EO1B 5TF0A 3RP1A 1II4E 2ODHA 3DGGB 4KAQH 2CHNA 4GKNA 3ARFB 4Y7MA 1ZOXA 3O0RH 5C09E 1BREA 4KRPC 1YYML 2YD5A 4XO3A 2GBTA 2PPFA 4N2DA 3T1FB 3R1GH 1JPTH 3NIGB 1RK0A 4EUPG 2OW6A 1AO7E 3BWSA 4MNGB 5AVYB 5HJBA 4CUCA 5I8OH 4C83B 1WD9A 3NPZB 4NZ8A 2IFFL 1QFPA 4G6MH 2GTZA 1ZK9A 3QUGA 3SOTA 1G9HA 2FJGA 1A6UL 2IAND 3DRTB 3DV6A 3MNZA 4U1GB 5C6WH 2OW7A 3MV7A 3P2DA 5HDQL 4L1LA 1KJ2A 3PQYA 2XPGA 3GLAA 4JFEB 2RA1A 2B4CC 4U1MA 5EMYA 4NO5A 1Q0EA 2OK0L 2W9LA 1YYLL 5E03A 1V10A 4RMSA 4ODSH 3DIVA 3RWJB 3UTOA 4ZJ9A 1SLXA 3S9DB 2NLJA 3U48A 5GIRA 1ZGLM 3HNSH 5LWYL 3C2AL 4FFWD 5CKGA 2G2RB 1OGPA 2R29H 5EDSA 2FGWH 1G9ML 1IC7H 2BWQA 3FRUA 3B43A 4YZFF 2VR8A 4NHUB 5HXMA 2F5AH 1KENH 3VD1A 5FYJU 3I02B 5C0CE 2UZXA 4TYUA 2WUCL 1MCFA 4L4TB 2W0FB 5BZDA 1UYWH 1LK2B 4FRWA 4C56E 4TVPD 3L48A 5C2UB 3T0WA 5D7EA 1U9KA 3IGKA 2ITCB 4A55A 5TD4A 4D8PA 4TVSa 2YEZA 4GRMB 3M86A 2CMRL 3HS0C 4GXUN 5L9DH 1O5PA 4XAWL 4WW1A 2J2ZB 4B27A 5CSBA 4BKLA 4O02B 5E8NA 1IBDA 2GK2A 2WQWA 4EI5A 2MFNA 4U6YA 2VKWA 4ZOCA 3PHOA 3O6MH 4JPKL 2Y1ZA 4U0QB 1B0RB 5EOQL 5I28A 5SWSD 3FSWA 4NN5B 1MFCH 2IV9A 3BQUC 3DYMA 4PHXA 4XNUL 4ZX4A 6PAZA 3FTZA 4FQXA 5DFVC 1NAKL 4WFFD 3RFZA 5CLYA 5IT2H 3O11A 2C9QA 2EH8H 3BLBA 5D7KD 2DQEL 2VL5B 3ILQD 3V6ZB 3BWUC 4NIYE 1TYEB 4K8RD 5TE6L 2Z91B 5I17A 1W0YT 3O2DL 1PX8A 1XX9C 4FFVD 4GAAA 3GSNB 4OFIA 4BZ1H 5CIPH 3CFKA 5HHOA 1TTUA 3NCBB 5LN8A 2EC9U 2XWRA 1QFWM 2O5ZL 3ARRA 2HB0A 3N06B 2G60H 3U46A 1T21B 3SKMB 2QQQA 5L2KA 3ENEA 2FO1A 4RRPM 1NIAA 1IT9H 4DUVA 5HY9A 2ISDA 2HVKA 3CC1A 3O6KL 4R96A 3Q6GL 3QJTB 3LSOA 5I24A 4OW6A 3K81A 2YAFA 3L4VA 2OYKA 3H2WA 4XWGH 5CINH 4E2OA 1T0OA 3BWAA 2X0VA 1TT6A 3R4DA 1UM6H 4NRZA 4JHAL 4ODUB 2E4TA 4E0RA 4O51A 3F7PC 4FZEL 1JL8A 5L2JA 4ORZC 3R7RA 4XI5D 4KI5E 4YL4A 2VLLA 4YHKL 2GCYB 2XC8A 4KX9A 4G1EA 4B9YA 4L1DA 2P80D 3HZMB 2DLGA 3B5GA 1C1EH 3ZPDA 1NGZB 4P5SA 1CTOA 2C34A 2I60L 2NOYA 1P4IH 1E8WA 4FXGA 5K39A 2EDDA 2EDKA 1K2DA 4U4BA 4DW2H 4G7QB 2GJRA 3LRHA 1WZ1H 2LGNA 2VQ1B 1FAIH 4OAWA 1DEDA 1BQSA 3MO1A 1INDL 3C5SA 4WTQA 1VCBC 1ACCA 2YEZB 3NZHH 3RRQA 2FLMA 3C60C 3BVXA 2HMID 2B3IA 5ISZE 1D5IH 5ITBH 4N2AA 3L17A 4M48L 4PJXF 1WFOA 3GINA 3H7BB 5EF3A 2B39A 1UB6B 5I19H 1LEIA 4OV5B 5F7BA 1FNSH 2XRAL 1CICC 1W80A 3BXNB 3NEOA 4KI5C 1KJ2H 4JY6A 1LO2L 2VN4A 3CHSA 4L1BA 3FCTA 4HPYL 4RFNB 4PP1D 4WV1B 5GGTA 5L8KB 3QQ9C 1JPFA 1JMZA 1CXLA 2X4PB 1B6DA 4G7YH 2Z3FA 4Z7UF 2EADA 5DMKB 3OKEB 5MEQA 1MVYA 3MZGB 4GG6A 3VFNB 1AGCA 4ZFZA 1WAAF 1ASQA 5E94B 1ZLWK 1XHHA 3NTCL 4G8AC 5E2VH 3OLDA 4J3OF 4JJ5A 4NRXA 1LD9A 5FECB 4G8IB 3L54A 4LCIL 1RIHL 1QKZH 2C7UB 2NUTB 4PJ9A 2OBGA 4J6RH 2WXFA 3IXAA 3FH5A 3CMOL 5CEZH 1A6TA 2AV7B 3WXWL 4B3VA 4XP1L 2B0SH 2H32H 3MNVA 4F15B 1YC8A 2X4OB 3TIEB 5I30H 1MWAH 3QZWB 2HXAA 2YBRA 4I88A 4WNJA 5GRJH 3WLWD 1E4WL 3B7UX 3QG7H 1E9PB 4AE1A 4DHLA 2LLLA 1IMHC 1YEWA 4GKNB 1N8ZB 3ZDYB 1BYPA 2YFNA 5C07D 4J3BA 1H8NA 1Q9LA 2OMUA 1JHTA 2AXFA 2GKIA 3BUTA 1EAPB 1TVHB 3HFMH 3BZEA 3LRSB 3CFJB 3SPCA 2DWDA 1YY9D 4FNSA 1Q72H 4GIAA 4P5TB 2OMYB 2R2EB 4PRHB 5J6GB 2JCCE 1UFGA 5AUMB 4MD4B 3ATEA 3KW7A 4KKCD 4Z78A 5DJZA 3GEWB 3KEDA 5E8EA 1E6JH 1DQDL 5DS1A 1KIUB 3LKQA 3VB8A 1E7VA 5IMLB 4ZAKA 3B6SB 3IFPA 4GY4A 2WWKT 2W0KA 4PRHD 3WE6B 3WAKA 1DQIA 4N2NA 3S48A 4NQED 2VDQH 2P42B 1X5IA 1Q9KA 4L29B 1F0LA 3WENA 4Z5RA 1JXJA 2FEJA 1ZHLA 3GMLB 1IILE 4L0PB 4ISVB 5JIQA 3EJYC 5KSAA 1OT4A 3WTWA 3L3IB 5KVGH 1IGCH 1KELL 4FA8A 4XWOC 3OZLA 1T20B 5LWYH 3OXRB 5EHFA 5C0CD 4OZIA 3CVIH 1G9MH 2VO8A 2FJUB 3LEYL 2I27N 4PBVC 5ETUA 5F7WC 3X13B 4FABH 2XA8L 3LPGA 4FE9A 5GRUH 1FJ1B 1AGDA 2XWDA 3EYOB 1U8KA 3P3UA 4L5FE 5F6HJ 3LH9A 1F3RB 1LMKA 3EYVA 4FYSA 1TJHH 2DH2A 4AKQA 3QXUA 3VFOB 4JFDD 1E67A 3D48R 3STBA 5FO8A 3QIBB 2ITDB 2CUAA 5IHLB 2A0LC 1IFHL 2CMRH 4LLYB 1FNLA 5KANG 4WWKA 2ZXWB 3G5VB 5D9SA 4Q6KA 1ZA3B 2HFGH 2BNRB 2LFEA 3DECA 3ZL1A 3C08L 3IN0A 1Y7VA 2J72A 1KB5B 2QR0A 2XA3A 1ONQB 1AD9B 4X6EB 2A6DB 1A2YB 1S6NA 3MLVL 3QI9A 4HISA 3FCSA 2QKIC 4OD2A 3OJMB 4WK0B 4BWWA 1A4CA 3R8QA 4M5YH 5DU7A 4YQXH 3PQYB 5CMAB 4QCIB 1AR1C 3EG9A 3JTTB 4FXGC 5GGRY 1TVBA 4MHHG 4EF3A 2Z1PA 3WMQA 3K1KC 2YBRB 1PF3A 3E8VA 3EYQD 5C1MB 5BW7A 4J5VA 4HETA 4MJ5B 4LDLB 1FIGL 1SYSB 4LRNL 4ZFGL 1YDPB 5HPMB 1NCDL 2EKJA 2YJQA 3JWOH 3KR3L 1RK7A 4GW5A 4PJGA 2BRQA 3SGJC 4BFEA 4OB5L 4MMZC 3T1WA 4W9DC 2WW8A 5KTEL 2V2TB 1KULA 4IM8A 3F85A 2ESVB 1HX0A 4LKCB 1KYFA 3S5LA 4MMZB 4F33B 1W0WA 5EC1B 1I31A 3NN8A 3VDAA 2G9HB 3QYMA 1GL4B 3CHOA 2GJ6E 1IE5A 5I6XC 4DKAA 4RWYL 4GOSA 3RG1C 1G9MC 2R69H 3SDXF 3MACH 3C6LD 1JGUL 3KLAA 1IQWH 1XGZA 2CJ3A 1CDUA 3MLUL 5KN5B 1A02N 4U0RB 4B0MB 1C12A 3FPXA 3QISA 3FW6A 1FO0L 3SE4A 1IFGA 3IKKA 5CN3A 4YHNA 3G5WA 5FDWA 3L4ZA 3BH8A 1BFVL 2NNXA 3BAIA 1UGKA 3MV01 3B9KA 1GGBH 4PJ8B 1VESA 1EZVX 2VC2H 3NJVA 3TYGH 4UB0H 1R24A 4DVRH 4QRPD 4M7LL 2OR7A 3KPLA 3CAFA 3WN5C 3QO0A 3VYPA 1U6AL 4NENB 1X5KA 5H4ZA 1B9KA 4JMXA 3RWGB 5DO8A 3QEHB 1JNNH 1SMAA 2PPAA 2FQEA 1CFQA 2V7HA 4S2SA 1U41A 1KV7A 3QIBA 3TCLA 2IQ9H 4E42A 1U58B 3FRPB 2UUDK 3PWPD 1NKGA 3V0JA 3I6KA 4HD9A 1LEKA 4G59C 1AR1B 2B1HL 1WLHA 1VCAA 2NZ1A 1KMGA 2JFCA 3VO0A 4QXTB 1O7VA 2FECI 1FVDA 1JDDA 4YOKA 1YYCA 5FFGA 5HJ3A 2P7TA 4G8GE 1AGDB 5B38G 1MCCA 2WKOA 3NCJH 1DVUA 3MV7E 2UVEA 4FMVA 3UC2A 2PW1B 4HT1H 3D0VB 3BFWA 3QE5A 3E7JA 1FVCB 3SGDI 4PJHE 4N3TA 4ZZFA 1BX2A 2P48B 4X9BA 2DQCL 3HRPA 1JZ3A 2VDKB 5DUJA 2NCMA 3TFKD 5KEZA 2UZXB 2WN2A 2IAMB 3RILA 3OLIA 1C5BL 1NCUA 2K6WA 3IAGC 1YPZA 4H8WC 1OT1A 4OLUL 3V4VL 3OAZK 4E9WA 2W5PA 2CBTA 1I8KB 3MRLB 3ZMEA 4HG4K 5E1GA 4M62L 3PWUB 5GGTL 3GXUB 4LARH 1NZRA 1MCPL 3OAZH 4HFWA 1PDKA 1QKZL 2XVLA 1EEYA 2FJHA 4PREB 3T0BA 2D0GA 4JPWH 1QMUA 3AY4C 4L4TD 5DQJA 4G6FB 4N6RB 4QRUA 4HUUB 1NFIB 1FZMA 4S1RH 1VAHA 2TRHA 2X4NB 5F70A 3EGDB 3RUGB 2KS0A 3QORD 3LH2L 4E9LA 3F7YA 1IEAB 2EZ0D 2IAMD 2IANA 4XPFL 5B1JC 2YSSA 2CKBH 2ZXDA 3KPMA 4B9KC 1NUFA 1W72A 3QZLA 4P3CH 2VO5A 4QT5A 1ID2A 3BEVB 5GSVA 1ERNA 3HR6A 4AM0B 4PWIA 5B7MA 4PI2A 3A4AA 2JIXB 4QWWC 2ZCLH 3WTYA 4FTVA 2OMTA 3T08A 4GH7B 1JF1B 3DV4B 3PHOB 5ICXB 3B7YA 3IS1X 3S4SB 3F5WA 5LG1A 1G87A 5EA0H 2O5XL 1OTTC 4EJ1C 4F2EA 2WSPA 3BT0A 3DMMA 2R29A 4HJJH 5D7JA 5IROA 4DGYL 5I15L 1CQYA 4MAYD 4YDKH 5A40E 3FTGA 4ZX3A 1W72L 3N3EA 2VZVA 1IKFH 4WW2A 2J44A 4NQDD 2FSEB 1KCRH 3EJUA 4LB8A 1YNKL 4I48A 3EFDL 3HJ0A 4L3CA 4ZFZB 3G5ZA 3VWJB 2VRAA 1AKPA 5AZ2H 2VDQL 2E6QA 1E9QA 4IRJC 4JKLA 5JW3H 3VW3L 2FIKB 5DEZA 2R56L 3NGBB 3FYEB 1INQA 3MAWA 5HYJA 3GO1L 3IJEA 2A6IA 2E6PA 4M93C 1SJVA 4YHMH 5J7CC 5CD3B 2OV0A 3EJTA 1EHXA 1VFBA 4UZGA 4Y5VC 3MKKA 1QI5A 2JB5L 1EV2E 2Q76B 5JXEC 5JYLA 3AAZB 3R4RA 5I1LA 4PJIB 5J1TC 4XC1H 4A37A 1E5UI 2YRPA 4GKSA 4WAFA 1EJ6A 4W6YB 2J4WH 2BVUA 3ALWA 3ARWA 4X8JA 5DD6A 1YVLA 1KBBA 5C0IA 4HXAL 2XACC 2B4CH 2VRQA 4HLZG 3VFUB 5CEZD 4HS8H 5HYQA 1KDJA 1KIQB 4IIQC 2H47C 4B5ZA 3L3JA 5JHLA 3ZTEA 1OAQL 1ZIBA 3SKJH 2WVUA 5C0EA 1AJ7H 4I7ZC 2HSIA 1QSZA 4DP6X 4H26B 3BQVA 3F5WB 3QEGL 1IM3D 3FNKA 5D4IA 1WBXB 1I7RA 4QJ4B 4XNQB 2HCZX 5IVXA 3ZTCC 1QSVA 1KTLA 3MCYA 4QO1A 4DCQB 3BKYH 4E9SA 3ZE1B 3APFA 1QRNA 3C6SA 2K0RA 4X98B 5AW7B 1JGLL 4APQC 3D4ZA 3BJ91 1NCCL 4MNQA 2A6KB 3FQUB 5DUBB 4I3SL 2AQ3A 4LIQE 3N43B 5T1LB 4JCLA 5D7KE 1LWJA 1FSKB 3UO1L 4NI3A 3PABB 1BGXL 1CLYL 1ZEAL 1A8JH 3INUH 3RL2A 4I9XA 1D7BA 3S97C 3W81A 2E59A 3ISRA 4MS6A 4RMTA 2NY0B 4J8QA 4KI1A 2PO6D 3IM1A 1U36A 3LNDA 1KPRB 1XCWA 3EO1B 4PJHB 5D5MF 1SN2A 4C58B 4YFEA 2PUQT 4K9EL 3ARTA 2HKFH 1HINH 3L9YA 4G80A 4N8VG 3QNYA 5A16B 4GMTL 2QHLA 3QDME 4V1DD 4JRYB 1CLZL 3ZZLA 5ILTH 1KLUB 4KXCA 2QQKH 3MJ6A 4MLIA 1FYTA 4K5PA 3D39A 5CJBA 1ZT4A 2W91A 3N9GL 3CSYB 4YBQD 3BE1H 2NY0D 3VD0A 4OD1L 3SBWA 4XPGH 5I8CA 1I9EA 4NQVA 3ZTNH 4L4VE 3VSQA 4LT7A 5T3ZL 4FJZA 1C9SA 1CGTA 4UDTB 2NZIA 4A6YL 3QZNA 3X3FH 1OHZA 1YQVH 7FABL 4MDRA 2FX9L 4I13B 1Z9SB 1SJMA 1NGPH 4AYSA 3BOVA 2NXZD 3WY2A 5EEYA 3GLZA 3MRCA 1J8RA 1JWSB 1U8OA 2F19L 4RA3A 3IDMA 4WW1B 3S5YA 5HDBE 1JZ4A 1I3RA 4F7CA 2FB4L 3UJJL 2BCKB 3U25A 4K94L 1OAJA 1OCCB 1DQJB 4WFEE 1JHKH 1D2PA 2VXTL 5DD5H 1LK2A 1KB5L 4Z7OE 5LXGH 4BKSC 5DC0A 2D7TL 4ONFH 3BPNB 3TXAA 2NY4B 3VYNA 3WELA 4ELKA 4KKCC 2OYPA 2CR6A 1JOIA 3KPNA 1JWSA 1U8OB 3Q2LA 3NCYS 2BSBA 3RZCD 4JY4A 4RGMC 2ZPKH 2FH6A 1A7NH 3OWRA 4NQSA 5CJQL 4AYFB 2ENYA 2Y0SA 4XCEB 2ATKA 3GBNL 4LO9A 2OCJA 3D1MC 3QUMB 3IXTB 3PV6B 2BHUA 4TXVB 2JELL 3COOA 1P7QA 3FU0A 4YK4C 3Q5YA 5MI0B 4E5XB 3V4VH 4HIXH 3CN2A 1UCTA 2J8UB 3BYYA 1UB5A 4RRPA 4UV7L 5HHPB 3QDAA 1QYGH 3RY4A 4EQ3A 1V27A 2NMSA 1MCPH 1PFOA 4Y5YA 4B3EA 1ZWIB 3DVNB 1WFTA 5C08E 1QSED 3VGBA 4AX3A 1OAKL 3DMMB 4U1HB 2BIQA 5D7JB 1H3UA 3CZGA 3W11D 4ERSL 2LV4A 4PJ5B 1LMIA 3PPSA 3VTMA 1XH1A 3LPPA 4K3HA 4YL9A 4HAKA 3VWKD 3WY1A 3TESA 4TUJB 4Q9RH 4BH7A 2X6BA 1YEHH 2R7EA 2W1NA 2FR4A 1NBYB 1X5GA 1C8QA 3M7FB 5J5EA 3TPKA 3FONA 1S3KH 3KPMB 4PJBA 1ECYA 1PJWA 5JOPE 1F90L 2X4TA 3LB6C 2DBJA 3I74A 4JFDB 1SJHB 4L3EB 3BJLA 4Y9FA 3UC0L 1A14H 1CMOA 1GJWA 2NY1B 4E41D 3PHAA 4HUUA 4PW9A 1IKNC 1Q9LB 3ESOA 4XN2A 1E6OL 3F05A 1X7TA 4JFVA 1L0XA 1BBJA 4WK2B 5LBGA 3RA7H 3V4PB 1RL1A 5ACZB 1MI5B 2P5ED 2VN5A 3N1GC 1ZLVK 4QDGA 3AQXA 1FLRL 4OCWH 5I23A 4AC4A 2J57A 5FAAA 4OZFA 4DP0X 3L1FA 1UWXH 3TIEA 4N90D 5B3NA 1K5NB 1NOLA 1DANT 3LCYA 5CIPA 43C9B 1IEHA 5I6LA 1BYNA 4YS4A 3RTQD 1NCAL 4PJDA 1ZLSL 3VXRD 4A2HA 2WYHA 1UVQB 4AEHH 1OZUA 3FUJA 1XH0A 3MXVL 4PRBB 4HBCL 3GMNB 1YZZA 5FYKD 3D85D 2E76C 1CG9A 2W59A 3X12A 5CGYD 2V9RA 3NG5A 3A5VA 4OFYA 1DFBL 2JCCF 4PJDB 4N9GB 4OGXL 3HI6L 5LGKA 4M6AA 3TBCA 1D7FA 2EE9A 1CICA 1U4FA 2CRZA 3HC3H 4OZHB 1FZKA 5C7ZA 3VFPB 9CGTA 4TQIA 4K7PY 1QWUA 2PTUA 1SGKA 4X8CA 3VU2A 2XBTA 4WO4A 2VJXA 2FYYA 2YAOA 4Y2DC 3MBEC 1JK8A 1KPVB 5E5MA 1NC2A 1NFDB 3DHPA 2OX5B 3QEGH 3VI3F 1ZSDB 6CGTA 4BZ2H 4P3DB 1MAKA 5JPNA 2JJSC 4PYHA 5FHAH 3E8UH 1SOXA 1FHGA 3AT8A 3S34H 3CUPB 1QBBA 2X28A 1NICA 1NFAA 4S1DC 2PR4H 1GC1H 1DQQB 3W5NA 2PO6C 3F64A 3UBGA 1AKJA 4A7VA 4P2YA 4BFNA 3BAYA 4HCGA 3X1GA 3IPEA 4S0HA 3WI9A 3VE0B 1P69B 3QJFB 4OAWB 4JZJB 3D4YA 2CHXA 5JOFA 1KIPA 1ITCA 1HAUA 1WP6A 2BVPB 3CVHB 3LKSA 4X5LA 1XZ0B 4Y4KC 5ENWA 5ESVB 3SEPA 5EO0A 1HH6B 1VACA 4LSUH 3ARGD 3BRDA 1IEBA 1LLAA 1BGXH 1CLYH 1HHJA 3L7FA 3FAXA 5H2BA 4AM0A 2ZKXA 5GGSY 1FVEA 2IAAC 4JY5H 5E5UB 1JDCA 3GMPB 3UTSA 1E5CA 4ABUA 3WL9A 3T65A 4L2YA 5GPRA 1PJ9A 4Z0XB 2MQ3A 5EO9A 3QBTB 1TQVA 2ESVA 3RHWK 4HKJB 5F88A 5GGVY 1F11A 4YO0A 1CBJA 3ZQ9A 1NFIA 2GIMA 3BWAB 4JM2D 5EF0A 4M7JL 3N2JA 5A2LH 4G8FB 3N85L 3HI5L 4IS6B 4N8PA 4HIIB 3TA3A 1CLOH 3FCUB 1PZAA 3RUGE 4G6KH 5KVEL 3BUPA 2V9UA 5E9DD 3WEMA 5ISZB 3UMTA 2AKRA 1YEGL 3QO1B 5ACMA 1M9SA 1UQSB 1GHFL 1I7UA 2I7OA 4PJCA 4ZS7L 3MFFA 1YYLH 1PX4A 4R0LC 3GXIA 4BXVA 1BX2B 2DQTH 2ZT9C 1CGSL 5KVFL 2W07B 3CBKB 5E2WH 3C5SB 1Q9OB 5EU7C 5MEPB 2WXLA 5IQ7H 2JXMB 3B4NA 5I1HL 1T5WA 5F3BB 2ODIA 2R9HD 3QIWD 4LNRA 4X9HA 4YDJB 4WENB 3WGVB 4DUWA 3CDGB 3AG1B 3H9SA 3ZSSA 1N10A 5D70L 1QUNB 2PYFB 1NGZA 1QUPA 1WBYA 2LABA 4G8EA 3CN0A 4LLVA 4P23B 2HLAA 4MQ7A 4PRAB 1NMBH 3RGHA 3UADA 1QATA 4U6YB 5HP5A 4AQ1A 3MXWL 4A7GF 1KZYA 1CZ8H 4NYLA 5HYJD 4DTGH 2EO1A 2VR6A 4NHCH 3H9HA 4WHTB 3GRWL 4WEMB 3F7LA 3NSJA 4LP8A 3OKDA 1XF3B 2ICWA 4OGAD 1G7PB 4RMVA 5IW1B 3V0AC 5I6XB 3DSFL 4ODUA 3HS9A 4H8QA 1JK9B 3P69A 4WEBL 4FQQB 5IWLC 2B7DT 2YD3A 1EGJA 4MD5A 3S6CA 2ILLA 4QRQB 3RKDC 3RIKA 1LE9B 2Z7UA 1SNRA 4FX5A 1KTDB 2YMOA 1FA4A 3IJEB 5T1KD 1DBBL 3ZKQD 3CBJB 1CVRA 1M1XB 2DKMA 4XHQA 5BUPA 4JCWA 4EN3A 3AREA 4V11A 5JQHC 5I66A 1ROCA 4LLUA 2IADB 3LHPH 4G71B 3V0DA 3VD5A 2B1OA 2RCSH 1U92B 1FORL 3NSXA 1CU4L 3H9YA 2YAEA 3C9NA 1AY1L 4AMKH 5F6IC 2A83A 4FLOA 3TBWB 4U1SB 3UAJD 4ZRGA 2GJJA 3EF7A 4MS8D 1HXYB 3KYAA 1HXMB 1G6RA 3RPKA 2OJEB 4PS4H 1TEYA 1YYMH 1FI8C 4DNLA 3MLYH 1QEXA 3OGOE 3NSCA 2N0KA 5DA0B 1SMOA 1YEDB 1WFJA 1S5HA 4R83A 4YSQA 2V5TA 4GUOA 2ZOKA 5GZOA 2F54A 3SQOL 4IBTA 4GI9A 5ABAA 2PMZA 3FN0L 4X5QA 4XP9L 2AXHA 3RAJL 1H3XA 1T83C 3BP5B 4W93A 4UNUA 2IG2H 5HBBA 1K6QH 1OANA 3B9KC 1TZAA 3RVVC 1GXEA 1AKJD 4KVPA 2GTWA 3U6RB 5IEKA 4LCUA 4M3HA 3V0VA 1ZHBA 1NDMB 1MFVA 3L5XH 3AJ7A 3H3PH 1F58H 3E6HA 3P0GB 3VRJA 1AHMA 4LLQB 1R75A 4FQJH 3HW7A 2IJ0C 5IB5B 4AJ0A 2EXYC 2OS7A 1B4JH 2BIHA 2EEBA 4YX2L 3LIZH 3WFCL 4RNRB 5SV4A 4WTWA 1PZUB 3NCMA 3GRGA 1HQRA 4QF1A 1QA9A 4U31A 1WC7A 3FB6A 3FSVA 3M8OL 3QQ3A 1BMWA 3K2IA 1SDYA 1U4EA 2XTLA 3T4AB 1C08B 4KROC 2XN9A 1A6AB 3MNWB 1IGJB 2NY3D 4PY8J 4JFEA 4C8XA 4BUQA 2QELA 1MWAL 3ALXA 5DZLA 4IBUA 2OL3A 3W9EA 1MJJA 2BSRB 4U1KA 1AC0A 4HS6A 1BVNP 2OTWA 3MBWA 1KN4H 4UV4H 3UCRA 2ZCKL 2QKSA 1BPLB 3IAQA 4N90E 4GQZA 1TTFA 3P40A 4FXGB 5IJKA 1AZBA 2GUOB 1TQUA 4R90L 4UDTA 4UQ2B 4DPAX 4L3EE 4PJ7A 5F96H 2V9QA 3HNTH 4MCZB 1UWEL 3W82A 1U58A 3IETA 3TT1L 5I8KH 1MFCL 2XWTB 4LNRB 2CK0H 3QXTA 1UD4A 2YSSB 2WVTA 4HPHA 4MNQE 3WEXB 5MEPA 2WINB 4XOEA 5KOMC 4MDJB 3CQFA 5D72H 5F7NC 3QIWA 2ID5A 3WHE1 2O61B 3ZZQA 2V8LA 1R3LB 3SPVB 1F4AA 3PV7A 3B9KB 4XP1H 5DO2D 3VG9C 1N5YL 5I30L 3SPIA 2AITA 3BKJL 3IFLL 1KN2H 1CGXA 3DBXA 5ID1A 2PCPA 1KCLA 3SD2A 1E50A 1XO8A 4PJ9C 2FECL 3MLSL 2BXYA 4H88L 1F4XH 2OZ4H 4ZW8A 2MPAL 1MEXH 4JN2B 2BOBB 4N0UB 4AKOA 1KYAA 5SX4I 1CCZA 1IC4H 2EXSA 3TT3H 2DLIA 2FNBA 3TVMB 1SDDA 3ROLB 2R0LH 1IAMA 5CHNA 4HP5A 5LQBL 1H8OA 2D03H 3M17B 3WIIH 1K4CA 2EVHA 1ZTMA 1IGFH 2G3ZA 3KXFB 2F7RA 5ES4B 2KPNA 3FT2A 4EI6A 1T0NA 4PI0A 5DDHA 3RIFK 4AQ1B 4Y16B 5JPMC 4X99A 2ZG2A 4NQTA 1OXYA 1NBZB 4NO2B 4YPJA 1KNOA 3SD5A 5ALBL 4L8SB 5DURB 2XG5B 1CGVA 4S2SB 4NKMB 3L8QA 1GJUA 5IUSA 1OPOA 5A6IA 4LVEA 2X1XR 4YPGB 3GBDA 2DWYA 3JWDL 3RYMA 5KBNC 4B7IA 3LX9A 4X6DF 4KXAA 5D2NA 5IHWA 3D25A 2Y5TA 5IESL 2G5UA 4IHOB 3GI8H 4OZGB 4PJ7E 4UDUA 3CFQA 1XGUA 3OVUB 3QFDB 3H6AA 4X7DC 4TM9A 1SEBA 1JK8B 1PX3A 1A7OL 4X6CF 3MLPA 3DX4A 1LQBC 1FNSL 2XRAH 1I8LC 3CX5K 5D71L 4FLQA 3FQXB 1S7VB 1OIOA 3CLFH 3BFOA 3RNQA 3HAEA 3VD9A 4LCCA 4FZ8H 1OF2B 2HFGL 2ZWLT 3BD3A 4Y9EA 2VGLM 2M2DA 1U8NA 1UD8A 4GRWB 5DMYA 2VDRB 2ZXGA 4OJFH 4Z23A 3M46A 3WD5H 5HI3D 3BZDA 3T0VA 1NDMA 3ET9F 3VFTB 4APQA 3GSQB 5EZLB 3MACL 1U8JA 5IGXL 2CA4A 3OXRA 2XPGB 3J8F7 3PP4L 2C1PB 2YA0A 3QDMD 4NQCA 3WTTA 4ETYA 3SPGA 2NQCA 1GW6A 1JNHB 1RZFL 4JQIH 4EIUA 3P9WB 4OGQC 3DRTA 3MNZB 2BNQB 4KWUA 4U1LB 1RZ7L 3ZKSD 3MJWA 4OF3A 2YQGA 2BVQB 1ODAA 1E30A 3ARDC 1DBAH 4G80B 1KCKA 3I9GL 5F0PB 4P06A 4BHUI 4BEIA 1N6UA 1QNZL 1SVZA 1UM5L 2DQDL 4EPSA 5JZ7D 2CGZA 5LCVH 2HVKB 3FSZA 1AAJA 1T0MB 1NKOA 4NQDB 3D7PA 4WLCA 2B2XH 5JR1L 1AKJB 4P59L 5JUEH 2F7IA 2Y06H 2OSXA 2ZIDA 3B2VH 5FC9A 3NP3A 3BDYH 5LBVA 4J3VA 3SO5A 3SPHA 3S35X 1E65A 1FGVH 1N8OE 2V5SA 3GSOA 4AEFA 5BW7C 5KJRL 1QASA 5LBSL 4FLRA 4NXSA 4J3OD 3QQ4B 1JVOA 4ZT1A 2X4NA 3HMWH 3QDGE 4L9LC 3CFJA 1JZFA 5HGGS 5IBUG 5C0BA 1SJHA 1HKLL 3SQOH 2ADGA 2WWMD 1KT2B 5DRXB 3WEXA 2GAZA 4N8UA 2QEJA 1IFRA 2UWEF 2XWTA 2NNAB 4DN3L 5HVHC 4HT1L 4X98A 3IPFA 3QFJE 3CMGA 2R7EB 3VFPA 4WI8A 5H4YA 3SKOB 3QDJD 4KFZC 2ZOUA 4QRQA 3RL1A 3AZUA 1JTTA 4XX5A 1XF1A 5IHUH 4WKZA 4MD5B 5CR8A 3NRPA 2AQ2A 5LVEA 4RGOH 1V3KA 1FH2A 5CEZE 4FNRA 4XP5L 2HRGA 4QJ3B 3U7YH 4PLKD 5IW3A 2ZSVA 3LZOA 2J73A 3DNKA 2CR3A 1BF5A 4KZDL 3JV6B 2YLHA 3RVTD 4KO7A 2D0HA 5GS1B 3WS6A 1IVLA 4TLSA 2VIRA 1FUNA 5KSUB 1EFXB 2A2QT 3QQ3B 4WK4B 5B1BB 4IMLA 2QQLH 4GO8A 3WFBH 1FFOB 2X41A 2J6EA 3FU6A 4KVNH 3HS8A 1NINA 3ZHLA 2A9NL 4XMLL 3L95B 4F9PA 4ZMQA 2Q2LA 4XO8A 4PTUA 5IB3B 4E36A 2FCBA 2VDPB 1HHKA 1P9MC 1RZQA 4D0CB 2R2BB 3C6LC 4Y4KA 1XD0A 2Q8BL 4Q7DA 2M8XA 5HHMD 4ZXBC 3ULUF 1OD9A 4W81A 1R4XA 1M6OB 5SWZE 1RZJL 3WJLA 3O3AB 1KB9J 3L9BA 3POHA 5EA0L 5FYJD 1V55B 4PSPA 5FHBL 4Q0XH 2R8SH 3IDIB 3RBSA 3FOLA 4FQLL 5LJYH 5GGVL 2Y69B 2ADIA 5BRQA 4M00A 3DLQR 1G1OA 1KFGA 3TTYA 2O5YL 3BAEL 2XTJD 5JHDD 4JLRA 3WN6A 3BUBA 4KO5A 4TSCL 1NCBH 4AJYV 4WI9A 2WOYA 3SCMA 3HR5A 4QGYA 2JIXA 1YNTA 4U1LA 3UOAB 3G08B 4K4KA 4X4XB 4N25A 4PJCE 2GW5A 3TBBA 4GXVH 4JPIB 4NZRH 1H6EA 4FULA 3RZWA 1BZEA 2LVEA 1S9XA 3WU1A 3QDHA 3T3MB 4NKIL 2PWGA 1VFAA 4HCIA 1CD1B 5E2UH 5JTWA 1LWHA 1BZ9B 3JWNH 1TJIH 2GIXA 3CK0L 4GG8A 4NNPL 5L6YH 5GSRB 1IC4L 1Z5HA 3LSOB 3QRBA 4OV6F 4X4KA 3BFQG 1VPOL 4MJ5A 5I1AB 1Z6JT 1O5DT 5I5IA 3TEWA 3IU3B 2WAHA 4HS8L 4ORGA 3FN3A 2YC1B 1X5AA 2EDJA 2BHFA 4MX7A 1U8LA 4NUJB 3ZO9A 4ZMZA 5BMFH 4UMGA 3MA7B 4Y1TA 1ULVA 2QADC 2ZUWA 3D09A 3PNWB 3WIHA 2VW6A 2R4RL 2Y1AA 3IF1B 2DWTA 2BCMA 2EXTA 3A6BH 2EDOA 3LD8C 3KPQA 4WFGE 4JFFA 3N44B 4QRSA 2FBJL 4MKTA 4N8CL 4DO5A 4GFXA 1GYVA 2WSKA 3PJLA 1GR7A 4UILL 3ZDYE 3DPDA 3ES6A 4JO8A 3VI4E 3LZFH 2ZJSL 3QGVA 1A4JB 3U9UA 1NCHA 3GXMA 3AGWA 4EVNB 3ZE2B 3V9FA 2IFFH 3BLPX 5EOTB 2JTDA 2DEWX 3FHEA 1EGJL 3H9SB 1CLCA 1NA8A 4FXTA 4FP8H 3ABZA 3GMRA 4GRLC 2X2YA 7TAAA 4WDIB 2Z34A 2WB1A 3L7EB 5D1XD 4YXKH 2HX9A 4N2CA 1T20A 1TCMA 1MJ7H 2AJ3A 2LR4A 4ZFFB 1EHLL 2O6DA 3VXSD 1P9MA 5KS9E 1D5ZA 5JXEA 2OK0H 3BIKB 4DQAA 4N0UA 3QPQC 1C08A 1TZIA 1OW0A 1BQLH 1UASA 2HG5A 3R8BB 3FT9A 5CGYC 5I0YA 3OQ3B 3EDJA 3THMH 4RGND 4OGYL 2RBLA 2FT6A 4XC3L 5IKCB 5JO5A 5KS9B 5BRZE 4U3SA 1FRGH 2QMJA 3L5IA 5F6IB 2CM5A 2YD0A 4TUOB 4AW7A 2GI7A 4AE0A 4Z78B 2ADGB 3KZ8A 4J3SA 3EF4A 1J5CA 1CLVA 1UT2A 5T3ZH 4S1RL 2B77A 2HX7A 3G5ZB 4XB7A 2VL5A 3V6ZA 5FV2A 3N40P 3O45B 2A6KA 3FQUA 1NGPL 1SN5A 3CFMA 3EJQA 4PJBB 2X1QA 1FL5A 3FMGH 4ZD3L 5DTFB 1PLGH 4X4XA 1RXLA 3V6FA 3ZBMA 5E9AA 2BP0B 3BAJA 1AO7D 1OLZA 3V52L 1JTPA 1JV2A 3OKNB 1G9NL 4QWWD 2GUOA 4LCYA 1J87A 4XNXH 4ZTOL 5J1AB 1MVUA 3TA3C 1RUQH 5IVOA 1NOFA 4ZFOL 3UZEA 1L0YA 5HVFB 3S5ZA 5JNYB 4JZJA 1ORSA 5F3FA 5JOEA 5D8JH 2GQHA 1NIEA 2E75C 4NCDA 2WKGA 1LO0L 1V7ML 2RD0A 3HG4A 5I0WA 5EN3A 3WMSA 1KG0B 2CLRB 4CU8A <