2X0VA

Structure of the p53 core domain mutant y220c bound to 4-(trifluoromethyl)benzene-1,2-diamine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
193
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Cell cycle
source organism Homo sapiens
publication title Toward the Rational Design of P53-Stabilizing Drugs: Probing the Surface of the Oncogenic Y220C Mutant.
pubmed doi rcsb
total genus 49
structure length 193
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x0vA00
3D0AA 1KZYA 2X0UA 3Q05A 2X0WA 5AOMA 4AGQA 4IJTA 1IO4C 1E50A 3Q01A 3D05A 2J1XA 3D07A 1CMOA 2VUKA 1GZHA 5G4NA 5AB9A 2IOOA 4GUOA 3VD2A 1UOLA 5ECGA 1EANA 4IBTA 1TUPA 2MEJB 4G83A 1GZHC 2P52A 4IBYA 4LOEA 5G4OA 5LAPA 2BIOA 4AGMA 2IOIA 4HJEA 2PCXA 3Q06A 2AC0A 5BUAA 3EXJA 3WTUA 2J1ZA 5AOIA 5LGYA 2OCJA 2RMNA 3WTYA 1T4WA 2ATAA 3D09A 4LO9A 2GEQA 1EAQA 4GUQA 4A63A 3IGKA 2X0VA 3WTVA 2WGXA 2J6WA 2XWCA 3IGLA 2ADYA 2J1YA 4AGOA 4MZRA 1TSRA 3EXLA 3WTWA 3QYNA 4IBWA 2XWRA 3WTSA 4MZIA 2BINA 2BIQA 4LOFA 3US0A 2BIMA 3KMDA 5KBDA 4IBSA 2H1LM 3VD0A 4IBVA 4IBUA 1LJMA 1CO1A 1EAOA 3QYMA 4IBQA 1HJCA 4AGLA 1HJBC 4AGNA 3KZ8A 2AHIA 3D06A 3WTXA 1HU8A 2J1WA 5G4MA 4QO1B 3D08A 5A7BA 3US1A 3ZMEA 4IBZA 4XR8C 3WU1A 5ABAA 4AGPA 2FEJA 4L18A 5AOLA 1YCSA 5AOKA 2YBGA 5AOJA 1H9DA 4L0YA 3TS8A 2J20A 4KVPA 2IOMA 2BIPA 3VD1A 4G82A 4L0ZA 2J21A 3WTTA
chains in the Genus database with same CATH superfamily
1PVHA 3ESPA 4JFZH 5I66A 4ONGH 1VESA 1XTMA 5CBEB 2BRRL 2R1YA 4AENB 4AUJA 1NMBL 1TU2B 3FMGH 3BEWA 4HU2A 1RUAL 5D1XC 5E6IC 5E08H 1A7QH 4Z7NF 1FPTH 3BPLB 5CINH 3GRBA 3VSUA 1CGWA 4ZUWB 1T0NA 4C56B 3EJZD 4NM4L 3C2SA 4PJ7F 1UJ3A 2NYZA 3CVIL 4U1JA 3NMEA 1GZPB 2A9MH 4IRSC 5JHAA 2FYVA 4GXFA 5DJCB 4BKLA 1NINA 4FERA 1LE9B 2VITA 2RD0A 2YD8A 1UA7A 3A22A 4DWHA 1M6OA 2QQLL 1MAKA 3CFKA 2K6ZA 2R0LL 2P5EB 1U92B 1N6QL 5B22A 3APCA 4K94L 5D96B 3STZB 4Q2ZA 5EUOF 1EERB 2GCYB 2NZIA 5AB1A 1TT6A 5IBUB 2NT0A 4RMVA 1FL5B 3GSQB 2VMDA 4ZUVA 5C6WH 5JXAL 2YJQA 1OANA 2C3HA 4R4BA 5KSUB 1IARB 5AVYB 2YPLD 2QTEA 4RBPH 5IHZA 8FABA 1FYHB 4LMQI 1J0IA 1T2XA 4WEUD 3ZDXF 2FIKA 2GBAA 2QGDA 4UIKH 3RDJA 3SBWA 3SDDD 4XCYB 2BINA 2GITA 1ZS8A 1IKNC 2BIQA 3A21A 1AS8A 3KLAB 4Z7QE 5C2BH 5J8OA 2L04A 4X6FA 4NOBA 4EOWH 2GJZA 3BHBB 3ZN6A 1FZJA 2MMXA 3PDOB 3C60C 4KHTL 3S2CA 3C09C 4Z3TA 4LVOC 1TYRA 4GI8A 3C5JA 2P4AB 4I7ZC 3ARTA 5D7LA 1CN4A 1G4MA 1TQBC 3MQIA 2AXHA 1S3KH 2ZOLA 4M6NL 5GS0D 5E8EB 2ZAGA 2NOYA 3RNQA 3CSGA 1UT2A 1E5AA 4JLRA 4N0FA 4CSPA 1YEKH 4FG6D 5K39A 4UT6L 2BWQA 3JYCA 1B9ZA 1YJDC 3ESMA 2QMKA 3ARQA 3EHBB 3HMXH 5K9KA 2IQ9H 1S7VA 2G75A 3F7YB 1IGCH 2H6OA 1GVIA 4G9FB 4LP8A 4KRNA 5CEZH 1ZE3C 5I6OA 3RVWD 5HHOE 2KT6A 5F9WB 4HX1B 3E9TA 3QHZL 3SQOH 2FZ3A 3WEXB 1WGVA 5D9SB 4XPAH 3FQYA 2ZUWA 2O5YH 1JGUL 1F41A 4Y1TA 3BZFA 1THAA 1A0QH 3GKZA 3MODL 1FVCA 3U9PH 2CUHA 4Q4IA 3OAYK 4KVPA 3UJTH 1AANA 4BYHA 5AW0B 3VXMB 3RFRA 2APBA 2VDMB 4KI5C 4DUWA 4OZHB 2LVEA 3GSNA 1F97A 1NBVH 3WFBH 1PIGA 2X0UA 4XP9L 4ZXBC 4JO2H 4MA8H 4N24A 4U0RC 3TIEB 3O45A 5AYQA 4WF7A 2CKNA 1GJUA 4CADB 5J6GB 4XVUC 3TBYB 4GUOA 1Q38A 4PJDA 5KVFL 3EYQC 4NGHH 4KJYA 4AENA 2XTLA 2MQ3A 4ABQA 1V27A 3Q3GB 1NGQL 4WK4B 5DI8B 4DKTA 2OR7A 5FFLA 4TSCH 4GRMB 5TJWK 5HHVH 2CXKA 1HDMA 3QDMA 3JWNG 4G1MA 1HEJC 1X7SA 3K6DA 2AC0A 1G84A 2J6EH 4ZNCD 4YXLH 4E9TA 2FX9H 1SJEB 5DVLA 1KIUA 4YDKL 3A4EA 3UIZA 1FL3B 3NK4A 1PY4A 5T3ZE 3ZL4L 4P2OB 3FOMB 3QORD 3V0DA 2DPKA 3TNMA 1GCYA 4PJ7B 5G5DA 3V0HA 1MFVA 5I1GH 1KJ3L 3IMWA 3U0TA 1HHKB 4W4NA 4NQCA 1L7TL 3NJHA 3EYSH 3P0YH 2V5MA 3GSQA 6PAZA 1RIVL 4NWUL 4ZMQA 3CXDL 4NC1E 3HI5H 3FW6A 4AV4A 1Q1PA 5IHZB 2A74B 1UUNA 2YGQA 3L8QA 3MA7A 4AE1A 5T3XL 3TXAA 2OMTA 4NKIL 3T4YA 5BV7H 4TQIA 1I3RB 3ARVA 3FFCB 3BE1L 3MBEA 4APQB 4LCYA 2L7EA 5I1IL 1CPUA 1ZS8B 3KLAA 3TJEH 3UTTD 4MB3A 5C70A 5KYXA 4HIEB 2GJZB 3BHBA 2QGBA 4Z23A 1Z5YD 4P2RE 2X6BA 4KXAA 2CPUA 2WAHA 3EDDA 4DQOL 2IBBA 3AITA 4G71B 5K93A 5KEZA 1A6WL 3CZLA 3E0GA 3QWNA 3L3IB 4KY2A 4NWTL 3K6SB 2DWXA 1S7XA 1Q1JH 4OFPA 4NRXA 4JFFA 3WO3B 2R39A 3NT0A 5E8OA 4ANWA 4PAZA 1E9QB 4XXWC 4F2EA 4HUUA 4WNQA 1XO8A 1QBAA 1SXNA 4Q97A 4NUMA 5TDOA 3EH3B 3SDAC 3HI6H 1EXGA 3C6LC 4IQHA 3RWFA 2A9NH 5K9OB 4YGVB 1F1AA 5LHDA 3KPLB 4HUCA 4EZJA 1AQDA 3QWRA 5DRNB 2DJUA 4LRIC 2EACA 4WI4A 3RX5A 4LEXH 2BFGA 2N59A 3PL6B 5D7SL 4M4PA 3SPHA 3TURA 4MJID 2LFGA 3EYOA 3GEWB 4HS3A 5BV7C 2VLJB 3ARBB 4F92B 3B7UX 1HHIA 1BZOA 4QTIL 5TK2A 4AGQA 2MPVA 3B5GA 3LEYH 4AQ1B 2MQCA 4ZZKA 3L4XA 2CO7A 3P9LB 5EU6E 1XF2B 1T20B 2EIDA 2P24B 3PWUA 3BDYL 1N68A 4A55A 3TO4B 4QRQB 2DWEB 1MPAH 3LMJL 3QO1B 4NI3A 4RISL 3OJDB 5A2IH 2H0FA 3K2KA 4R8WL 3RJQB 2WP3O 1OGSA 3T0EA 2V9UA 2MNUA 4AEHH 2AJYH 3NPSB 5I8CB 1AZVA 4LZKA 1TF4A 3D85B 5HJGA 3RY4A 2J4WL 1B3IA 3CFEB 3QQ4B 4C4UA 1WGOA 2C9PA 2OJZH 1A1NB 3QUZD 5IQMA 4FEIA 2DL9A 4NT6B 4DKFL 3HC2A 2XQBH 1ZWIA 5LXVA 4EMZA 2Z8VC 1P7BA 2O6CA 4NBZB 1C12A 7PAZA 2G5RA 2NNFA 2HKHL 3QUXD 5CGYD 1OP5H 3GBLA 5DFAA 1D6EB 5DD3L 1A9EA 4XRCA 3T0AA 3V4LA 4UT9H 3BGFB 1X5GA 3OKYA 1G7JA 1N0LB 5T8IA 3G6JE 2WZPA 2P5PA 3KAAA 2KZBA 3KL3A 3QJRB 5IFJB 1OP4A 4NFBA 3X17A 2AQQA 3U0WH 3IYLW 4JFUA 4CSTA 1L0PA 2XFXB 4X5LA 5DZPA 2JVUA 5AYUH 4GBXA 1D5IL 2VGLM 4W6YB 1NIEA 3IVKB 2NUTA 3K71B 2I9LA 5FFOA 1CC3A 3KXFD 4XN5A 3G7TA 4RAUA 2VDOH 4JM2C 1VFBB 4A2FA 3LKPB 3SDYH 5HJ3A 4Q9QL 2XN9A 5DJ2A 3H0TB 4L4TE 4R7DB 2FX8L 3L5XL 2DRUA 3AT9A 1ITBB 4LAQL 1QFWI 4NNXB 5GGSA 2ESVD 3L3IA 3H2PA 2ZTBA 1M3IA 3IBOA 2EC8A 4K5PA 1ZHKB 3WI9A 1UURA 3CE1A 5T3ZD 4UT6A 2ED9A 4QHUB 2YC1B 2BDNH 1MJUH 3PIQA 4NQCE 4ZD3L 4NQEE 3P4MB 5AZEL 5DVPA 1QLFB 3CZUB 5J0BA 3IGAB 5LGKA 4ONHB 1ZPUA 1E50A 5AG8A 1AJ7L 1MOEA 3TBVB 3GJFH 5FYKL 3GRWL 5KSVA 2XYCA 3O8XA 2GT9A 3HC3H 3DYOA 3EJUA 3KHOA 4OD3H 4OU3A 2PPDA 1HHIB 5EOCH 2LGNA 1LMKA 5JYLA 1YMHB 4IRJD 3PABA 2CO7B 4OCRL 5AW1B 2AK4A 3QORC 4XP5L 5EZLA 3TPKA 1CYXA 1QASA 4NBYB 1HK6A 4F9PC 3FH5A 7PCYA 2ENQA 3UEQA 4J8RA 4YH6A 1G94A 4PTTA 2IDSA 1MCFA 3BP5A 4XVJH 5DT1L 2JB6A 2X4SB 1KLUB 2FEEL 3W9EA 2BSRB 3T0EB 3LNHA 1Z9SA 4NQUA 4ZW8A 1JS4A 5IK3A 3WLWC 5L8KB 1KMGA 2JJSA 2W1NA 1I31A 2F7OA 3IWUA 3L5IA 1HZHH 4LNRB 4MJ4A 4KI1A 5KSBE 4P2QD 3K0WA 5K1NA 2WXFA 1JGVL 1JF1A 3FF7A 3KLLA 1E6JH 4Z7QB 2ZG2A 5E2WL 3ZDZE 1QP1A 1DO6A 1CICB 3ENEA 3QEQE 5KSAA 4Y5VA 5DEFA 5HHVL 5I0VA 4LEOB 4LPUA 2F58H 3VA2C 4CBZA 1EO8L 3BQUD 3P30H 4LCCB 4MZ2A 2R2BB 3WHXB 5JMOC 4L8SC 1B2YA 5L8JB 3MRPA 2OR8A 1YMMA 2OMYA 1SYSA 3FT0A 1RZ8B 4PJFB 4NDMB 3U4EB 1EXHA 3MYJB 4ERSH 4OTXL 2PYEE 2OMXB 5EF3A 2EIJB 4HZAA 3S37X 2FJGA 4WWPA 1AD9A 4HG4J 2Q1EA 5EOTA 2UZXB 4X5PA 2Y24A 3ZUCA 5DO8A 1OPGH 4TNVF 3CCHB 4DKAA 1MFBL 2Q8AL 3QGVA 3GT6A 1DVFA 4OY9A 2PXYB 1RZ7L 1A9BA 3INUH 5D4QA 5EC1B 2YPLE 1AY1H 3NJKA 2KC0A 4GBXB 4XBPA 1SQMA 3S37L 1B4TA 3IU3A 2GAZA 4AC4A 3EJTA 3MRBA 5LCVH 3FRPG 3INUL 3DVGB 2DQDH 4YXKH 5MEPA 3M17B 3LB6C 1P5UC 1GYAA 2VW7A 4GAGL 2JJTC 4XR8C 3ZDXB 1HINL 4ZFFA 4PJ5E 3UX9B 3V9FA 2VH5L 1RHHA 2F8VA 3QRFM 2Y7OA 5I17A 3DGGB 3WLBB 2LTQC 4RX4A 3CLEH 5HYSB 3S37H 1B0RB 1IGCL 1THCA 4CU7A 1YDPB 4OV5A 4HS6A 3FU0A 1W72A 2WCPA 2QVKA 4JO4H 1E4WH 5AW5B 1E90A 2MKLC 4QTHA 3BVNA 2DWSA 2BIHA 4BINA 4PYHA 1QQDA 3S3SA 3V4VB 2K70A 3D07A 3WMSA 4DK6A 2HTKD 3G6JB 3FTZA 3ESUF 3IGAA 3PAUA 4C57C 2C9RA 2BCKB 3NFSH 3VTTA 4HU8A 4Y2OB 1UJTA 5HHMD 5FFGA 5I1EH 1S9KC 2AI0L 4WGKA 3ZTNH 4LSUH 5KYWA 1C1EH 2VUYA 2YJLA 4ZTPH 2Y72A 3RB5A 4QTFA 5T3XD 1YEGH 1Q9WB 5D1ZB 3TT3H 2DI7A 1KCBA 2IWFA 1FFQA 5IB5B 1BP3B 5IW3A 5FO8B 1ADQA 2NNAA 4QRUB 1EBAA 3L1GA 3EBAA 5CSZB 1L4IA 2HFEB 2E7MA 1U91A 1R3JA 5FUOL 1EAQA 3VNYA 1EA9C 1S7QA 3CGTA 1E7UA 3HBQA 3TA3B 4CN6A 5JXAH 3QNXA 1QUPA 4GT0A 3HC3L 3TONA 2M83A 2CQVA 5AAMA 3CSBA 3N1GC 5AD0B 4RISH 3MFGB 4JN1H 5EBGA 2QQKH 1R5VA 2Z4QA 3N0PB 1ML0A 4F15C 4LCUB 4PY7A 4Q6IA 3WL9A 5DQ9A 3US0A 5JIKA 1D5XA 2Z0UA 4LCWE 5E99L 1J5CA 3LXBA 1FVDB 1N2RB 1UM6L 3GINA 4P23C 3GSRB 3W39B 2ZCHH 4E9RA 3TU6A 1F1DA 1J0KA 1CUOA 3NUKA 1I1RA 4MZ3A 1SYSB 2JKXA 2OJ1A 3NGBC 2HMID 1AKJA 3CSYB 2XACC 3PJNA 2FECL 4KXBA 5EOTB 4OT1L 2DTML 2Y1VA 1DQLH 3CHSA 4IRJB 5HJDA 4BDVA 2G5UA 1U8KA 2Z8WC 3RTQB 2JQAA 4PRDB 4K3GA 3F84A 4N6QA 3RWCB 2R0KH 1ZK5A 1ASQA 2ZD0A 3CNKA 5EWIL 1N5AA 2KDGA 3MRLB 1HSBB 2A1WL 3O4LD 3IJSB 4MD5A 3GEFA 5DUBA 5E03A 5JW4R 4Q9QH 2X9ZA 4P5KA 3VXUA 1RHHB 5HYJE 1J1XH 4KPHH 4WNJA 3I2CH 3Q13A 5DURD 2DAVA 3EFFB 3Q5TA 1O0VA 3RWIB 1UD6A 1KGXA 2ZCLL 5HYSA 1F3DH 3ZT6A 2HTLC 2WBJA 3EUUA 2GPZA 3GZPA 4U1LB 4HS6B 4W9KC 3D3VB 2J1XA 4JM4H 4K3EL 2FUQA 2FHCA 2CO1A 3CQPA 4F7CA 1UWFA 4Z77A 4JVUA 5A40E 2C7FA 1ROWA 2HX7A 3IJ8A 1YPZA 4NO2B 3KDPB 1Z3GL 3H42H 4N0RA 3Q2CA 4BWUA 3MV9A 4LF3B 1M2VB 1WIPA 1PYWB 1MWAA 1OAYH 1SYVB 2YBRB 3GSXB 5DJAA 3SDDC 2PO6D 1W2KT 4H20H 2BIOA 1VSCA 4WEMB 4NQVB 4OLZL 5CIPH 3GIZL 2OBGA 3TH3T 4PREB 4XOAA 2YPLA 3VXQB 2G0KA 1W0VB 5SX5K 5BVJA 5AW7B 2ZUUA 4JFXB 1JZ7A 2CUAA 4B9KC 1E2ZA 3FQTB 5D1ZA 2Y9RT 3BUYA 4TL4A 4EQ3A 4PJ9A 5L0QC 2J6EL 1AGFB 4LFHD 1D9KA 3IGKA 1NQBA 1T1ZA 2WZ0A 1BECA 1N70A 2A9AA 3WMPA 2BVQB 5BS0B 3D9AL 4P06A 1PZ2A 1JPFA 3ZHDA 4H2CA 4JM2F 4HIIA 1CDHA 3FUEA 1G9NL 1M9SA 1MCDA 4HG4K 4RRPA 3TEXA 2APXA 1UEYA 4NENB 4PJEF 2C3VB 1UWXH 3GMNB 1L9PA 5ENWA 3SE9L 4HCRA 5F3FA 5JXED 3UYPA 5KVDH 5FWRA 1BJ8A 1WFTA 3SGKA 5L4JA 3MNVA 5KSBA 4JHWL 1NLBL 2OMZB 3CFCL 3DV4A 3GGWA 4Y16C 3LB6D 3GMLA 2OZ4H 1RZ7H 1T22A 3PWPD 5DC9B 3G5VB 5C08B 3VU1A 2Q2LA 4PVBA 3QC6X 3MLTA 1B0GA 4JKWA 4XPAL 1AHWB 3E6HB 3LRHA 1IE4A 2K3TA 1A6WH 4ZS6C 1ECYA 2PTVA 2Z7YA 3DSNA 3H3PL 4X7DC 43CAB 2OP4L 3D7PA 3ZIMA 4EUPB 4ZFZA 4XI5C 5ADPL 4K71B 3ZKNC 4CRPA 5GS0L 3A67L 3MJ9H 2CJTA 4HWNA 4RLDA 1E4XI 4PJDF 3VQ1C 3C5XA 4KHXL 3RZCA 1YEHL 4FA6A 1MCEA 2X28A 2XWEA 4F33A 2V9TA 3E9UA 3SO3C 1AHKA 1RZJC 3RWCA 1NBQA 5E2WH 2X4TB 4ZMLA 3B9VA 2HA1A 2OULB 4F9LA 4QXTB 1AVAA 3P69A 4NUJB 4NQQA 3QUZB 5F7UA 3LIZH 1E27B 4MD5B 4QMEA 1CTOA 4Y2DC 2FJFA 1EEZB 3FB8A 4HH9A 4NWUH 3VTMA 4P5KB 3VXUB 2NUPB 5DD0L 3G04A 2AV7A 43C9B 2BOLA 2VDKB 1V55B 1Z5LB 1CURA 5T3XH 1NKRA 1RP8A 4AYMC 4Z7VE 2F0CA 1KIRB 3KL5A 4MDIA 3ASNB 2YGVA 1RZIB 3VRLE 1HXMA 2XBTA 4PJGE 3EO9L 4CDHA 4HPOH 2CCLA 4NO5A 3H7LA 2FX8H 3L5XH 3DBXA 4YXLL 4OKVB 3GRGA 4NO2A 3WNKA 4HJEA 4FQHB 3PQYD 1J8RA 2XN9E 5GRVK 3NCBB 4IGBA 3ZTJG 3CH1B 4QGTA 3TH4T 3PP4H 2UUDH 3JWOH 5F1SA 1WVZA 2PYEA 3E3QC 1RZFL 2XZQH 3SY0A 4CVWA 4K94H 2FWUA 2PMZA 4U4BA 4YAQA 4PJ8B 1XBDA 2VLJD 2EDQA 1JHKH 3DURA 3NCXA 1BOGB 4X6DA 1QHPA 3GDBA 2MH4A 5LGJB 1PBYA 3O2DA 2CUMA 4ZK8A 1R3KB 3QFDB 4A6YH 5BS0E 3L3GB 1JTOA 4X6CB 4WTQA 1SHXA 1AAJA 2V5SA 2I07B 4MB4A 4LLUB 3W11C 1EFXD 2XI9A 2VC2B 2BIIA 3UXFA 4HIIB 3DX3A 3WG7B 3KYNB 4D8PA 4ZMVA 1LWHA 3RA7H 1CT8A 2E8ZA 2P48B 3GMNA 5DJZB 3MV8B 2VR3A 5BJTB 5DMIL 3FT4A 3MUUA 3C12A 2HTKC 2DLFH 4I87A 2AXJA 5EBWB 5E6ZA 2GCYA 3G08A 4P3CL 4J1UB 3CWGA 4MA3B 5KOMC 1MDTA 1P7QA 1SHWA 3S3BB 4DO5A 5I6NA 3MODH 4PWKA 4WKXA 3U9PL 1AIZA 4Z8FH 3ORJA 1GMEA 4E41E 1S78D 4MDRA 3Q8FA 4PY8I 3B5HA 5FW7A 3ISYA 3HNSH 3MLTB 4L4TD 3CBRA 4AGPA 5GZOD 2WKOF 5SWQA 4NZTH 5AOLA 4HWBH 4UTBA 5FGBA 3QNYB 4X6FB 2Z65C 4NN5B 5DD3H 4ZFZB 4WFED 1K4DB 1CXHA 1HC1A 2E46A 1PG7L 4JJ5B 3A4FA 1EHXA 5HYIA 2XTJB 4MJJA 3C5JB 2DQJH 3ZIYA 5HHNB 3SJVB 1XSOA 3D0AA 2HUHA 4AQAA 4KFZC 3V0EA 1ND0A 1CDJA 2ZXQA 4NPYA 5T1KA 1S5IH 3DUUA 3DJTA 2EVIA 2DQIH 1JN6A 1TNMA 2HKFL 2V5RA 4ELKB 3AJ7A 4WHDA 1ACZA 1ZVSB 3HE7C 3DUSA 2ZCKL 2VDRL 4AK1A 4Z3EA 1VPOH 1IGJA 2ICWI 3V6FA 3D48R 4X5QA 2P44B 3KEDA 4MDIB 4RFOL 5H2BA 3SD5A 1UWGH 4UU9A 5F0JB 3EKCA 1JIBA 3IXTA 1ZD6A 2XWXA 3N85L 4XMXA 2ZSWB 3TV3H 5ISZE 2VO5A 3LHAA 4D0CB 1IEAB 3QUXB 4IHOA 4Z7OF 4KI5F 2E7DA 5IJBC 1OK8A 3K81A 2FH6A 1ZVYA 4ATTA 1ZLVH 3IFNH 4F58L 3ARPA 3QJVB 3B3IB 4KK5C 4LOVA 4G6JH 2PYFA 3GFUA 3FCSB 1A7QL 2W5PA 3J27A 4HEMA 5FK9A 5B7MA 1NMBH 4P9HL 1JG9A 1XD1A 2NQDA 3IMRA 3P40A 5FHAL 3SIKA 4JGNA 2EH8L 2XWRA 4HH8A 2EC9U 3SGKC 2CGZA 1KB3A 5FKAA 1RJZB 2HSIA 5KVGE 3QFDA 2V8LA 4UCFA 5DI8A 4HFWA 4UBDC 5F1OB 1RCYA 4JCLA 3RX8A 3F5WA 3BWAB 3CHQA 2NR6C 2PP9A 3SB3A 1C08B 4WCYH 4G8FB 4D8PB 4XMPL 3ABLB 4MMZC 3BKCH 2ZPKL 3I50H 4OJYA 1GL4B 3QISA 2X6VA 2F9BT 3AC0A 2R2CA 4QHPA 3JV6A 4QRBA 2YN5A 4HCFA 5LDUA 3SYPA 3HMXA 4TLUA 2DM2A 1RIUL 2CK0H 2YKLH 3L3DA 3A6BL 3N42B 3SCMA 4OBSA 2C9AA 1MCOL 3HG4A 5ABAA 3HG3A 4L3CB 3KG5A 2IALB 3HLKA 4MJ5A 4ABWA 4R96A 5ELIA 2JNZA 2JFCA 4MLIA 4ZX3A 3O2VH 4GQ9H 1LL1A 3L7EA 1SJMA 1FGNL 2HFFA 3N55A 2DQEH 3NSFA 1J8KA 3UABA 1CZ8H 4Z0BH 1IAIM 5KJ4A 1L7TH 5FV1L 2R56L 1PZ5B 2UZIH 1FL6A 3T8XA 4XN1A 1CFMA 1N8ZB 1USZA 4WI2A 2Y36L 4PV1C 2NSMA 3QFJE 3T6VA 3NN8B 5E56A 4FDWA 4DKEL 1G0DA 1N4XL 4O51B 5F9OL 4C47A 4AQZA 1V10A 3SYOA 2VXQL 4FQJH 5C7XL 4BFIA 4C56E 4NQDA 3P73B 4F7KA 2ZUQC 1KN4H 5DLLA 5T1KB 1BX2A 2EDNA 2XT1B 4TKWA 3PAVA 3IKKA 1MCBA 4PGBB 3T8MA 1BD2D 5HHXL 5JXEC 4OGZA 1IQWH 2NY3C 4MMZB 3N9GH 5TDPA 5FAAA 4GS7C 3BKML 4ZUWA 4C56A 3EH4B 2OXHA 5HYJD 3CDGA 2YD2A 3F12B 2A2QT 4ZPVA 4JG0L 4AXWA 5EORH 2OMWA 2ZCZA 2EE3A 3CFDA 1OP9A 1AKPA 1CL7I 3SDXA 1DFBL 1LNUA 1UQSA 5CU5A 4UQDA 3ARBA 1BXVA 2YUWA 5F6IC 5I8KL 1EFXA 1QR4A 4XNMB 3T1WA 2DMCA 3PWNA 4NKDA 1NCWH 2ESVE 4N9GB 4DF9A 3C5ZB 5E2TL 4JHAL 2KI6A 4Q2ZB 3D4CA 3ZRSA 4JEGB 1HL5A 5JPNC 5D7LD 1IM9D 1OCOB 1QRKA 3CVHB 1NCBH 3N9GL 5JW3H 2BVEA 1XZWA 5FK9B 3OQRA 3OM3B 1TTBA 5LBSL 3L6FA 5JO5A 3ULVF 2BS8A 2X1XR 5E8DH 4QRPD 1J0YA 2BZ7A 4YDVA 1FFNA 2E3VA 3JUYA 4XCYA 3PCYA 1NCDH 2I25N 5SWSE 5I1AB 1Z0NA 4PIBA 5MEOB 4B95C 4DKEH 1HXYB 5ES4B 5TE4H 4N1CA 1KJVA 3CLFL 4E41A 3GMOB 4XNQB 3MLPA 3LZPA 2KL6A 3MJ6A 4Z7WF 4MNGE 5E6RB 2H26B 3B2XA 3WOVA 2F6AA 3CPUA 5J89A 1IIKA 2LABA 1NC2A 4EI5A 1GR7A 1L0YA 4JQXC 4KHTH 1HYSC 3FTXA 4OLVL 1PZCA 4LSVL 5CGMA 1RD6A 1C5DB 1DQVA 1T1WA 3U4KA 4XRCB 4MA1C 3W9DA 4OLWL 4D9LL 1V3LA 1U8QA 4KJWC 5C2BL 2YBGA 2H1PH 4MJ6B 5DRXA 2BP5M 5GSVA 3IDJB 2PETA 4K7PX 2YMXL 4G9FA 4UDTB 1LTXA 1FNGB 3RDTC 3KM2A 3MPCA 4ZI8A 4MJ5B 3UG3A 2YFNA 4OZIE 2WINA 2J2ZA 1HH6A 2YRPA 2VR4A 4OFYA 2CJSA 2CDFB 4QRTA 3BKCL 3I50L 4FNQA 1UA6H 3BZFB 3QK0A 1NAML 3ZHKA 4A6YB 3TA3C 3GQFA 1SJHA 1BZ9A 2YAOA 4YC2C 3F64A 4I9WE 1WWAX 3OVUB 3T8XB 5JR1H 4MAYC 4LPWA 4OQTA 2CDEB 3DHUA 2KPWA 1XFPA 4TTDD 3X11A 1TZOA 4F2ME 3RRQA 2XTSA 2VZVA 5GGSB 4GAYA 2NY2D 1XB6A 3NSYA 4AEIL 1ZT7B 3ZMNA 4Y9CA 4UT9L 4A1RA 3RFZC 1G7IB 1BX2B 2N01B 2C9SA 3O4LB 2V6HA 1WSST 4GUPB 4WU7A 5HVWA 4UM9A 2YC1A 4LDCA 3EXJA 4GS7B 3Q9PA 4PJIA 4J39A 3PIQB 2BVPB 4KOBA 4ZBJA 1QSEA 3F62A 1SHMA 4GRMA 5KVEH 3NIFE 4ZUUA 1FDLL 3BP4B 5D93C 3PXHA 4MWFA 5IHBA 1DJSA 3U2SB 4G1MB 2A38A 1MQKL 1OY3B 4JG1H 4YHML 1BG1A 2X4PA 1XH0A 3LV3A 1OO2A 2ZX5A 1YMME 4JREB 4HC1L 1SMAA 3THMH 1KXHA 3FO0L 3FOMA 3UDWA 1P4LA 1GYCA 3IXAA 4ODUA 3RTQC 1KENH 3FUNA 1LO5B 4P3WA 1CDGA 1D5MA 2D7MA 1HHKA 5EV7A 1OWWA 1GRWA 1B4LA 5DZJA 2XY1A 1NMAL 1MHCB 1NAMH 4F7PB 3H9SA 1BZDA 1NFIB 7FABH 4LHJB 1YUKB 3R0MA 5E2VH 1ZHNB 3TEUA 3T8VA 4YSOA 3GF8A 1TPXB 3VRIA 2AHIA 3L1FA 4MFHA 2COQA 2HT2D 3MA7B 3Q8EA 3PV7A 3SGEH 3O81A 1GGUA 4HKXB 4QHKI 1QFUL 4ZS7L 5GGVY 3WY3A 1KPRB 1KLFB 3HE7D 4O58L 2FLBT 4WKZB 2K4AA 2A3TA 2CIIA 4AL8C 3K80A 1MWOA 5TD4A 4KFMA 3TN0C 1HXYA 4PV8A 2VWEE 4FS0A 1AE6L 1GW6A 1TCMA 4LLMA 3AWFA 1A5FH 4FFWD 4JGJA 3OAUH 4FQPA 1IM9B 4OF7A 3CVHL 1FZMA 3J2PA 4QKXB 3WENA 3AABA 1EVTC 5C08E 2JK5A 2EZ0D 1MCWW 1U8NA 2XWZA 1OT1A 4E42B 2E9GA 3FN3A 3UTSB 1E9QA 2E7LA 1M71B 4LLDA 5ETUA 4ODTL 1B4JL 3E80A 2Y1ZA 1QFUH 1AR1B 1C5DA 1T1WB 2EDHA 3MCLL 3SO3B 4HHAB 1HCVA 1AD9B 4MLSA 5HPOA 1CS6A 4QGYA 3WFHB 1FN4A 1FNGA 4R5XA 4EBQH 1KXVA 5CJQH 3CBJB 4B6ZA 3BAWA 5GJSH 2MOQA 1X5KA 4A2EA 1A9BB 3JWDL 1DSFL 1J8HE 1DCLA 1S5HA 4PRPA 2VLJA 1RK1B 4I0PA 2WY3B 5AYTA 4M8QB 2E0PA 4NCDA 5CZXD 1OGPA 4LIQE 4GRWE 3VFSB 1DZ0A 2E7HA 1WFMA 4H8WH 5JQ6H 2ZSVB 3VD7A 4KXZH 1QSFA 3TN0D 3OG6B 1JRHI 3MREB 1M05A 1YNTF 5INCB 3Q06A 3OJMB 2KZKA 4GW4A 3WY4A 4NZUH 4JFSA 4AW7A 3Q2WA 3PXLA 4FNSA 4HCIA 4IKNA 3BFWA 1YDPA 1XSIA 4Y2DB 4NC1C 3VXTA 3ZDZB 1G7IA 1PEWA 5BRZA 3ETBF 1YC8A 3B9KD 4MMXC 4OFVA 3BVNB 1ETJA 3D51A 2ZWLT 3H9ZA 3RIFF 1PKQA 3AWGA 4JRWA 4N20A 4K7PY 3RI5K 4GI9A 5LXGL 4A6YL 4IMLA 3AT8A 3VFVB 3G6JA 4WJ5A 1ID5I 2IIJA 3RX7A 4YDIH 1SVCP 3HG1D 3HAEB 3IPBA 5DWUL 3FT3A 5FA3A 3MV8E 4OIIL 2NNXA 2GVYA 4YSQA 4P5MA 5F3BA 2BY3A 4DQAA 4G5ZL 1G9MC 1N4XH 3DX0A 4L05A 1DVFD 3QDGE 3W56A 4R7NA 4PP1C 1KXTB 1I85C 5GS3A 4KKCC 4FOMA 2UZIL 3QJTB 3SO5A 1A9EB 3QIUD 3SKOB 4M4RB 2O1AA 4PGCA 1CFNA 3D2UB 4X6CE 5LQBH 3GS7A 1GGIH 4ENED 1DQDH 4AKPA 5BW7C 5F9WC 4BXSV 1CU4H 2FE0A 2CALA 2XWTA 3UACA 1JZGA 2VB5A 1XIWA 1MF2L 4ALAH 5HJBA 1MCQA 4G5AA 2NZ9C 3UPCA 4RFNB 32C2A 5EUKB 1D7CA 1JWSB 4LLQB 3DTXB 2WZ6A 2GTZA 1YRKA 2Z1KA 2CM5A 3B2PA 1WTLA 2DLIA 3IRZA 2O72A 2UY6A 4LSVH 5EULV 4BZ1L 5JIHA 1CIUA 2EXTA 3BUQA 2YAHA 4I4WB 3SYAA 4TTGA 4PV8B 4P23B 4Q6IB 3NACH 1FCCA 3BLBA 3JYBA 2B1AH 4G8EB 5DK0A 2R27A 1QW8A 1D9KC 2F1AA 4J6IA 4ZOAA 5E0FA 3T65A 3VX1A 4EIGB 2X4OB 2YK1L 4KI5D 4PUBH 3GSRA 2QFRA 1OTUD 4MMYB 4ESKA 1ORQA 4WY7L 1UD4A 1YECL 3CBKB 4XP1L 5BO0D 4N8CL 5I16B 3DJZA 2NR6D 3BESR 3WFEL 5B3NA 2DICA 2Y3AA 1SNRA 2X6UA 1HQRA 1HCYA 1HHJB 1KBGL 4ETQB 1KPUB 2WXNA 1A4JB 4MCNA 4XP4H 4YHIA 3U79A 1IKFH 1LEKA 1JFQL 1U8KB 2F5BH 1CCZA 3TBVA 3U9UB 1Z9MA 4LOEA 1HZKA 1KCRH 2BC4A 4JW3A 3FUDA 3K4ZA 2VIRB 1JPGB 3SDAA 3TIDA 4Z7NB 4M8QA 4AV0A 4OZIB 4XCNA 3D25A 4JFWA 5SWZD 3VI3B 3NDYE 2J25A 4U6YA 1M6UA 3UYOD 2V2TB 4GJTB 1PLCA 3WN5A 3ZQXA 3HG2A 5K5YA 3HC0B 4L5FL 2N3JA 2EE0A 4GW4B 1ZLVK 1CXFA 2GKIA 1C16B 2QBWA 3IS0X 1AGEA 2W0LA 3KJ4B 1JGDA 1RULH 3KS0H 3DO4A 4U1LA 9CGTA 2BH0A 4H13C 5FO2A 1YJDH 3MX0A 1IL1A 2OW6A 5ICYB 5IK3B 1T0PB 3TF7C 1LXMA 4TRPL 5EZOL 3WE6A 4OZFG 4ORZC 2EIKB 1GPOL 3G9AB 2XC8A 1U4EA 3AM8C 4TQEL 2VXSH 5I66B 1GYWA 2GC7C 4RMUA 5CBEA 5F44A 5KBDA 4IMLB 2Z31C 1IKOP 1YEFH 2UUDK 2A0LC 2VDOB 2AF2A 4R0LB 1AGBA 4LBEB 2CHZA 2WO4A 3H56A 3U4AA 1ONQB 2R69H 4M56A 5DURB 3QG6B 4HQQH 4LEOA 4F8NA 5LWYH 4LLWA 5F3BB 4JRXB 5CJ5A 1TZGH 1DDTA 1TJIL 1XTLA 1GHFL 2EECA 2NMSA 1I85A 2OTUB 4JN2B 1M6OB 1H6EA 4OZFB 1BM3H 3ZYZA 4FKKA 4P49A 4PGCB 2FJGB 4GP4B 5A7BA 2BVQA 5KUKA 3OKLB 4O02A 5ACLA 3FQUA 2WLHA 2JCCA 4E5XB 2XFGB 1MCOH 3KLHC 1J9QA 2W0PA 3RZWA 4JDZA 4Z78B 3CZFA 1O6VA 2PXYA 4GXVL 4HK3J 5IG7B 32C2B 4NENA 1FNSL 1TTAA 3KCPA 2C3VA 4POUB 3IU3B 4RFEA 5AAMC 2CKBB 4Y16B 4PRNB 5ENWB 1KCWA 1COBA 2D7TL 2DIBA 3QFJB 4JPWH 3VWKC 1JGEB 2ZPKH 1K6QL 1NCAL 1KGUA 4I4WA 2IAMD 2UVEA 3BN9D 3NIDE 4Y19D 1WWWX 1GYVA 3KPRD 1OCWH 1O9WA 5HVHC 4KRMB 3ZDYB 1MH5A 1IGIH 2ICCA 3CLWA 3ML9A 2F74B 4UTAH 2LLLA 5ACMA 1N3NA 5KVMC 1TSHA 1ZTXH 4Y4HB 4C59B 3BRGC 2ARWA 2ZCHL 3DI2B 3MRNA 5D7LB 3VDAA 4X98A 2WLKA 4QTHB 3VG9C 1NCJA 4PBVC 4OT1H 1UM6H 5AVZB 3RPIB 3PUUA 4IOSA 4MKMA 3Q5YA 4G83A 2UXVA 1I8UA 4Y2NA 1KTCA 4YN3A 1CD1A 1WIUA 1TNNA 4KTYA 1O6SB 1QBLL 2JSFA 2PTTB 5D5MA 3VXRE 4B41A 2C5DC 3F83A 5E99H 5JIIA 1VFAB 2PPAA 1K9TA 1KBKA 3WE1A 3UPRA 1G5GA 2YEZB 3ARRA 4UOJA 1BQHG 2XX1A 4EN3A 4OLUH 2Y6SD 3LAFA 2F61A 4XAWH 1OKEA 1I7TA 4JKKA 2J5LC 2J6EA 3H9HB 1FZOA 3NIFF 2FATL 4O4YH 1SOKA 3LZQA 4MYWB 4JFDA 2ADGB 5HYFA 43C9A 1LQSR 2HFEA 3EJSA 3AQZA 3VXMA 1R3JB 2GSGA 5A2AA 4M93B 5IVXB 3WEOA 1KIRA 5DGQA 3LNFA 3WYRA 2BS9A 4HETA 4AI7A 5F9JB 3WD5L 4PM1A 3UPAA 2CPCA 4A66A 2HKFH 1EXUB 4N8VB 1GAFH 4XPTL 3VFUB 3VXSD 2F53E 4OKVA 5H94B 2JIXA 2WBWB 1N7ML 1OB1A 1E9PB 1PF3A 2BOBB 1CWVA 3ZTNL 5I76A 4L0PB 5CKAA 3OHXA 1I9IL 1ODUA 4KVNH 2WXPA 1IGMH 3HC4H 4MCYA 4AUUA 3DURB 3QDMB 3FB7B 1LO3L 4G43A 1QR1A 3A23A 1E9OA 1NM4A 1Z66A 1HQ4A 3H4HA 5EOQH 4G6FB 1SJEA 4J3XA 1QPXA 1UM4L 4P59L 4Y5VC 5T1DH 3ZE0E 4EKJA 4GAFB 3DROA 3ZGIA 1GTNA 3OLDA 5IEKB 3ATEA 1GW0A 3MGTB 4ZW7A 2YXVA 4GMTH 5IBLD 5J3HD 1WV7T 4I48B 5D1XE 1HKLL 2JCCB 4GKNA 1N0XL 3L3KA 1NEUA 5B38G 2EXWD 3JVGC 4PS4H 3REVB 2BHUA 4HFUL 2K6WA 2K7QA 3IJSA 4AVKA 4X6DE 5DMKB 3MRDB 4TV3A 3BUIA 2WZ5A 1QTSA 4GAJL 4NJ9L 1X5XA 4JQIA 3DRTA 1X6LA 2VLKD 1RQ5A 4UILH 2VSCA 1TVBA 1IC4H 4MNGA 3D3VA 4YDLC 3ILQC 4FTDA 3RVVC 2H3KA 5FO7A 1FYTD 1DUZB 4JZOA 1S7XB 1TETL 1OHQA 4H0LC 2FRGP 3MXVL 3I6KA 3CX5J 3T6QC 2B9AA 2GHZA 2ZP0T 4ZAKB 4KKLC 1IEHA 4DOHE 1BXXA 4XT1C 2W07A 4K8RL 4XH2A 1KCKA 5E1AA 3KDMA 1DP0A 1HZHL 2FO8A 3GBDA 3AXHA 4UQIM 3D39A 3IPEA 5CEYA 1YEEL 3KPLA 4N1HB 5C0JA 5MERB 1ND0B 4Q9BA 5GHWL 4KZEL 4ZYKA 1KDIA 1ZLSH 3WJMA 2IDCA 1UXWB 4TUUA 5ANHA 1NFKA 1JV2B 4XVJL 3ARBC 2VAAB 1JZ6A 3OGCB 3PAYA 5FHAH 1KF9B 2D4DA 3SPGA 4LBAA 2HWZH 5I2IA 4JFDB 3E8VA 3FB6B 3GJFK 1OV8A 5DLML 1JPFB 3P11L 3ULVD 3QQNA 1E6OH 5KUMA 5HYQB 4L4TA 3G3LA 1I8LA 2OL3H 2YR3A 3GB7B 1H3UA 2FD6H 3ESVF 1S9VA 3TO4A 2OSLA 4I85A 1J9RA 4S1SH 4OZ4A 4Y4KC 2XG5A 2C9XA 3NIGE 4Y2LA 5BUPA 4XP5H 4FFYL 1KCLA 1OTSC 2XBDA 4KAQL 2NZ1A 3OZ9H 3BAKA 1SEQH 2YGPA 4F80A 2ZXCA 1CJYA 4V2CB 1HIMH 4DNLA 5F71A 1OCZB 2VDRB 4EI0A 4K7FA 3P3UA 2G60L 2K1MA 2KQMA 4I18A 4MCYB 3Q9QA 1P2CA 4EN2A 4FXKA 4OFYD 1BQHB 2H8PA 2EP6A 4FULA 1LHZA 3MRCA 3T5WA 3RBSA 1IGFL 1HILA 1DJWA 2IH1A 3MLXL 43CAA 1C12B 2W0KA 3GSVB 4HAGA 5BV7B 5I5IA 4HJGB 5FOJA 4ZMXA 5FOBB 1AQ8A 4OI7A 4R4ND 1R47A 4BKTC 2TSBA 2SEBB 1A64A 2YGOA 3ZRCC 5AKVA 5E2UL 3BOVA 5F96L 1QRNA 1ZLWK 3Q05A 1N0LA 3RDTD 3UBGA 2B5IC 4KTEL 5IFHH 2QGCA 1KGYE 1GGYA 4E2OA 3WHE1 2B59A 4BQ9A 3QUZA 2XTJE 2ZOWA 1MI5B 3ZK0A 4L1SA 1OTTC 2FJFB 1EEZA 4HH9B 1BYOA 4AVJA 3HNTL 4U3CA 3PFQA 4H1LA 2E5EA 2P52A 3LXUX 3LEXB 2XPZA 4L4VB 2O61A 3LKPA 4KQ0A 1TLKA 1HI6A 1I8LC 4LHQB 1GC1C 4O9HL 2X6CA 3NTCH 2V5YA 4XBEL 3GXMA 4RMTA 2EVGA 1X5MA 2RCSH 2EYSA 3UTSD 3V6OA 2XQBL 1CQYA 2X4NB 4POYA 2NLJA 2Q76B 4U1IB 4DKFH 3BRDA 4MVBC 4V2BA 4XC1L 2QFPA 1PZ5A 2BNQB 2OPCA 3RA7L 1D7BA 3N41F 4XH2B 4U6VL 5K33A 4FG0A 1DDHB 3IGLA 2XKNA 1D6VH 5FGCE 4FABL 3QAZB 2AI0H 3D39B 2E27H 5JHDD 4X7EC 4UOQA 2KQNA 3UG4A 1NBZB 1TEGA 5L8LB 3LKSB 1E8ZA 4GSRA 1CI5A 3GWJA 5E5MB 3DC0A 5AUMA 5EEUA 2AEIT 2FHBA 5KWYC 1UXWA 1XH3B 1JV2A 1AXTL 4PGBA 4F1SA 1OPOA 4IBVA 3VXPB 5EEYA 3L4ZA 4MMZA 5TK4A 3WEBA 5I6PA 1MVUB 2MPAH 4XN2A 3NTCL 5HDQL 5I2IB 1UCTA 5IVNA 3CDGB 2PWFA 3PABB 2W9EH 1G6RB 3PP4L 4G2AA 4AXWB 4OM1H 5GZNA 1NBYB 5I19H 5IR1A 5IESL 1NAMB 2H9GB 1EO7A 1M7IA 2IANA 3JV4B 4WHCA 1YNTA 4TPRH 4WFFD 2W91A 4LL1A 1UADC 3FU8A 4XO8A 3VI4F 1ZSHA 1Z6JT 4K55A 2XXFA 1H8OA 3EO9H 1WBYB 4GOSA 3FSAA 2R8SH 3IDXL 5HDLA 1N67A 1UACL 1DUYA 4IIQC 4R84A 3V5HB 4XCCH 2EE2A 3BUBA 3ECBA 1MXDA 2QZQA 4CNIB 2QVIA 1UTDA 5EA0L 4FXKB 1ZTXE 4M1DL 1FFNB 3D0VB 2DQFB 4HJJL 5D7KE 2H2SC 2VLKA 3QIBB 5I1AA 2CR0A 4R26H 2AS5M 2B4CH 3ZMRA 3THML 1FAKT 1OTTD 3GBEA 2R4RL 4NX0A 5I74C 5D93B 1T03H 4GEIA 3WIHH 3ULUH 2E86A 3P30L 2R23B 5D1ZD 5HHNA 5T1LA 1TVHB 5CLXA 3SJVA 5DDHA 3HS0A 3MDJA 1FLRL 2UZXA 5KVEL 2W38A 4LESA 2YXWA 5D96C 5FHBH 4JFED 4KDVA 3DX4A 3JBG7 1DVFB 3OC8A 4A37A 5KBMA 4H26A 1BW8A 5CEZE 1MI5A 3TA3D 2XPYA 2J88L 4XBPB 1ZVSA 3Q6GH 2B1HH 3O6LH 5DJ8A 2JTYA 5LJYH 4Y4FD 5HI4C 5BV7L 1S8DB 4XX1G 3NOIA 1U8OA 2CXGA 5SV4A 4GAAA 2FECI 2X4QA 4FNLH 2VQTA 1HI6B 1IGJB 1YMMD 5H8DA 3WGUB 2A83A 4FNRA 2WN3A 2OTPA 4N85A 1OSYA 2CDFA 2RH0A 3KLQA 1PY0A 3CDYA 3QJFA 3ZDYF 4JHVA 2NLJB 2Q76A 1PX8A 4U1IA 3TF4A 1F2QA 3M88A 4B0MB 4UNUA 4XMWA 2F54B 3GSWB 2NY5L 4QOKD 1UOKA 4IBWA 4NQSA 4EN3C 3UO1L 5DQJB 4MB5A 1HHHB 4XWGL 5C71A 2CK2A 5GS1C 5I30H 1ZKAA 4M61A 5EBLB 5LNGA 4GAYB 2AJVH 3ULSA 3X3FL 3IN2A 4N68A 2AJXL 4B9ZA 2DWYA 3TOPA 3AACA 1G7HA 3S5LA 1JAEA 5E5MA 3FFDB 3E1F1 4BA0A 5CHNA 1XH3A 5GS2D 2N0KA 2X2UA 3GSOB 1HYRC 3TBSA 5HSFA 1Z5HA 4ABUA 5DHVA 1W8OA 5DR5L 2DM4A 2A0LD 3BDXA 4AMXA 3IFLH 2K9FB 3U2SA 1GZPA 1O5PA 1IC0A 1LP9E 1RZJH 1X7QB 2QADC 2X4PB 1C08A 3AUVA 3GBMH 4DTGL 1LE9A 2VITB 2DLTA 3ZE1B 3TWCL 3TZVD 4PRBB 1HINH 2JJWA 4N0UB 4JPVL 4OJDH 1U91B 1QFHA 3O8XD 3UTSE 1U92A 3ILQD 3MV7A 1WAAF 3RL2B 4JDTH 2XXCB 1GJIA 2UZYB 2CD0A 2OFQA 3QJHA 5JPMC 3C08L 4L3CA 3WIHA 1NIDA 2F7IA 3V0WL 4R4BB 3R18A 5A2LH 2LFEA 3ARGB 2CH8A 3QC5X 4CU6A 2BNQD 2WANA 2P80D 4ODSL 5FC9A 4K3JH 4ZNEE 1INDL 2J71A 2GUOA 2VDPH 3L7EB 3NCMA 1RKRA 2KKQA 5E9DA 4CN1A 4DN3H 5FLVA 2AEQH 5D8JL 5BMFH 1NCOA 5IGXH 4JQVA 4DGWC 2B9BA 1ZVHA 2WZAA 2C4XA 5AALA 3D85D 2FX7H 2EIZB 5C0CB 2VERA 4NZRH 5AZ2H 5HPMB 4M6NH 1O5DT 3VRJB 3DJRA 5JIMA 2EEAA 1FNAA 2FEEI 4HK0A 2WQWA 5JUEH 1IQWL 3BWUC 2ZYSA 1W0WB 1IGYB 3LSOA 5TFSL 3RFZA 5TTRA 4JLRB 3DOSA 2YA2A 4LLDB 2V7NA 5ETUB 3GM8A 5DJ0B 5J3HC 4H26B 3U46A 4BQ8A 3WS3B 4PWGA 3ZE0F 4U05A 4EOWL 4HZLA 4KK8D 4IOFC 4JKMA 5I28A 1F2XK 1N5AB 1SBSH 3IJEB 5GZNC 2FHFA 3GI9H 3VH8G 4UIKL 1U8OB 3ES6A 5HY9A 2IWGA 2WD0A 1UGKA 1MFNA 4G9DB 1QKZH 2VLKE 2KYIA 4XNYH 12E8H 4GG6E 3SDXB 4BQBA 1KYUA 1PD6A 2BSTB 3T0BA 3O41B 3QEGH 4JQIL 4KZ0A 5C8JA 5JW4M 2XV2A 1I7ZA 3DX1A 3PWNB 2ZAIA 3PHAA 1L0QA 4KNTA 4NKDB 3JWNH 1FGNH 3VFSA 1RP9A 3CD4A 1ETA1 3GRWH 2A77H 4IU3A 4X42A 1AO7B 4X99B 1QLEB 3RPBA 3AROA 5C0RH 4PN6A 4F7MA 5DQJA 5CINL 1CLYL 4UTBH 2Y07H 1NOFA 1NC4A 2DQGH 3AS1A 2WM0A 1JNLL 4M61B 2OYPA 4OGXL 4WHTB 3FMGL 2EICA 2ESVB 2GIXA 4LLVB 4NP4H 2WIMA 4JFZL 3TBYA 4XVSL 3IDIB 2FBJH 4NOFA 2WVSA 3HG1E 4NQVA 4Q6KA 3SDCB 4BZYA 1I1AD 1PKQB 1PLAA 4F2FA 5I0XA 1PSKL 2D3VA 1A7OL 1CK0L 4YZFE 3BO8A 5IB4B 4IBZA 4AQ8A 1U8CB 4PJ9B 3CX2A 4I5BB 1MLBB 3BDBA 1OCWL 5DEJA 5C6TL 3IK2A 3OKKB 2VXQA 3NJMA 4XCFH 4C8XA 5JMRA 2DJ4A 2P49B 2AJUL 4PJXF 3D69B 2XWJB 2VDOL 5HDOA 4U6HA 3DHMA 3MV7B 4S2SB 5G5DB 3G5ZA 5T1JA 4OIAA 1VADB 2A9CA 1TOXA 4MJ6A 3L1EA 3ZE1F 1YEIH 1HCFX 4NKIH 5BQDA 2PR4H 4BV1A 1NANI 1A3RL 1GXEA 4QCIB 3ERXA 2A74A 3ECVA 4QRSA 4KV5E 1MXGA 1CDCA 1EANA 4POZD 4TLKA 3F58L 3RVVD 4MQTB 2XV6B 3VXOB 3Q6FA 3ULVE 5BRZD 4ZFOA 4HSAC 4U7SA 5D71H 1LYQA 1AY1L 2W80C 3L3HA 4LL9A 4P23A 1P4IH 1BEYL 2M26A 4L9DA 5TH2A 5JQIB 4MAZA 2DTSA 2R2EA 3GC3A 4EI6B 4M7ZC 3ZL4H 2WJ7A 2PW2B 5JXEA 1IZJA 5EF2A 4LKCB 3OLIA 5F88A 2A6IA 4S1RH 5HGBA 1Q9KB 2WO3B 1XGQA 1BF5A 2DM7A 4QO1A 1LP9F 4FRWA 4GFXA 5E8OB 2ADJA 5EZOH 1XF3B 2ICES 1BVLA 3E2HB 5DJ0A 4PEEA 3VFNB 2VDQB 2XWCA 4LDLB 4X0KB 1JF6A 5HHQB 1WZ1H 1U9KA 3TZVB 1ZANH 3QCVL 3MLWL 2CUIA 4PVNA 5D4IA 1T6BX 3QG7H 1A6AB 1CD8A 3E1ZA 3V55A 1GMIA 5AZ2L 2YQBA 1NL0H 2FEDC 3FQWA 4XX5A 5ID0A 1EV2E 4AQEA 1PG7H 2FH8A 4HS3B 2PPEA 3TIDB 3LEYL 5TF1L 3UEZA 5C8JB 4Q9RL 2EADA 3WFBL 2ED8A 1ES0A 1HH9B 1QVOB 1BJMA 5DFWH 1YNLL 1FFRA 4TPRL 2EDRA 2FAUA 2XPGB 4UT7L 1T20A 1V3MA 5F89A 5JHLL 1CLVA 4X6BB 3V0WH 3NQIA 4FQHA 1PU0A 1QI3A 2VRAA 1JGDB 1BQSA 3O3EA 1KXVC 4FQIH 4OH2A 1ZLEA 3HI6L 1JTPA 1KB9J 2PYEB 5ESQB 3T1FA 3IDIA 4RGMB 4WSGA 3WKML 5AB0A 1JK9A 5TPWL 1KPRA 1MFEL 4MQSB 5IBUG 3BWZA 1PLGL 1A3QA 5I8CA 4KV5F 5C9JA 2EEDA 3VDBA 4FQXD 2NX5B 2H47C 4H0IA 3VNZA 4OGYL 3N1FC 1VCAA 3CFEA 4LLMB 4PS7A 1S7TA 1WBXA 3D34A 2X9YA 5FUCE 3X12A 3C87A 1AGBB 2BSDA 3O0RL 1YUHA 1JZHA 4KQ4H 5I73B 4ONFH 4Z3GA 3FUJA 1ITCA 5KS9E 3L2LA 3IMBA 5FIEA 1P5UA 3IRPX 1G9ML 1PY9A 3DTUB 4KKQA 4OZGA 5D1QC 3UTSA 1M71A 2XVGA 3GHEH 1NICA 1A14H 4JN2A 3KXFE 1QSFD 4OZFH 3TN0A 3R7RA 4OUUB 1AG0A 3O6KL 5LCVA 1P53A 2BP8B 3S8WA 4W9GC 2RGSA 1KEGL 1Y6NR 4O9HH 5HVGB 3S5LG 3FQUB 3VXSE 2FT8A 1JWMA 5IM7A 4O2CA 2C4FU 3QO0B 4PJ9D 4U6XA 5F7WC 1P7QB 1VDGA 4M7KL 3OPZL 4XTRD 3KCPB 2E6QA 1RK1A 4G7VH 2I9LB 1AQKL 3HB3D 4LGPB 3SKJH 1IBDA 1OD9A 3MLYH 4WAFA 1FSKB 3WAKA 4ZO8A 3L3HB 1MKFA 3MLYL 1PZUB 2BVOB 1S7RB 2HN7A 1K72A 3SZ6A 3MREA 5FDYA 4QDGA 3OF6A 1B88A 4BRJA 1WBZA 2P5WE 5D7IA 3V0GA 3LQZA 2IFFL 3H85A 1Q9KA 2I5YH 3B43A 5FM5O 3OB0K 2JJTA 1KIPB 3PJSB 1K8IB 2VKWA 1QWNA 2LU3A 3VFNA 3VXRD 1ASOA 4GG6F 4ODWB 2DLEA 2A4CA 1OE3A 2CNZA 2JELH 3L3JB 4NPYB 4Y16D 3K46A 3V7MA 3C5ZD 3VB8A 4BD4A 5C0FB 4GKLA 5F93C 1JN6B 3P4MA 1FLRH 3BP6A 2VXTH 4HIJA 1I1FB 1BQ5A 4H4NA 3NDZE 4OFIA 1BJ1J 2ZJSL 2FK9A 3HAEA 3I84A 5FA3B 4D3CH 4PS3A 1MCSA 4R2GB 2G9HA 5HGAB 3EG9A 5H35A 2OP4H 1H0DA 1ORSB 4BCYA 5D4JA 4AW4A 4L3ED 3QAQA 4MAYA 4FG4A 4AEHL 4UU9B 3GUTA 4FFZL 3V0AC 2F5AH 3H9HA 3D2UA 3SJVE 5BQ7A 3H9SE 3L9EA 1RK7A 2K8MA 1S9YA 3QJUB 1S2EA 2BM3A 3BAIA 3TLRA 3BDYH 4URKA 4E0RA 3BP5B 4K5OA 1Z3RA 2WXLA 2IQ9L 2VNCA 4YHZH 4JRFA 3V4UL 2JH2A 3RDTA 4I3SH 1YC7A 4N0UE 1C8QA 1ETZB 2A6JB 1WEJL 1Z9SB 3ARFA 3BUTA 3E8UH 5I15L 1A7NH 4QJ4B 3VAEA 2WCGA 1EH9A 4DEPC 2Y7NA 1RZPA 1CYWA 2JIXB 3FT9A 1CLOL 4LNRA 4Z95L 5E1IA 1HEZB 5BXFA 1OB1B 5F3HB 3UH8A 4XWOD 5HI5C 4UM8B 1E28B 4H8VA 4PWFA 3U7AA 4EI5C 4NNYB 4TVPH 3D05A 2OYLA 2VDNL 1BVKB 3U1PA 4Z76B 3RIAK 3ZJAA 1QNZH 4Y5VB 1JDCA 3CFUA 3SDXE 2QHLA 2UWEB 3FO1A 5CD3B 2D31B 2CKBH 4QWWC 3MXVH 3TV8A 5I16A 4G8FA 1DE4A 4IBYA 3QNZA 1J9TA 4JDVA 5D72L 4GBXC 1YG9A 3HUJE 1IC4L 2QKSA 3FUIA 2XRAL 1P4BL 1ED3B 2JB5H 4XZ4A 1JZ3A 1KPUA 5L2KA 4YWGL 3B4NA 5BUAA 2WXQA 1IM3D 3WTUA 1A21A 2LLNA 4ELDA 3W37A 5BOPA 4M5SA 3SCMB 3L3KB 3O4OC 4K0OA 5HDWA 3OR6B 4H5SB 4ADGA 3NRPA 1X7TA 3VYPA 25C8H 3BT2L 3KPMB 4M8VA 3FSOA 3HAEH 3REVA 5C6PB 4OZIA 5CLZA 4LQ1A 1TXKA 5D71L 5EU7E 2GUYA 4UNIA 3RWJB 1QABA 2FGWH 5DJ6B 3SHSA 5EO0B 3IGFA 3T0ED 2BVOA 2DY2A 1KTBA 1EWHA 4IBLT 3IU4H 5I17B 3Q6GL 3RGVB 3MRHB 4ZPTB 3NCFB 3VI4A 2VSMB 1U30A 2CRIA 2GHWB 1UZ8B 1AGEB 5CJ8A 2Q9OA 3EAKA 1UASA 3CVCA 5DRWB 4Z0XA 2FB4H 4ICXA 1P7QD 3RGVC 4D0BA 3CSPA 4WWKD 1BVOA 1I8KA 3HJEA 3NA9H 4IRZL 1UXLA 3GZKA 2BSCA 1JF5A 5CXPA 1KCVL 2X4RA 2XXGA 3TT1H 1AO7E 3WIHL 4EO5A 5BPPA 3ULUL 4BGLA 2PXYC 2Y2TA 3DWTA 2W07B 4ODHH 3KLDA 4RMSA 4I0CC 3C6SB 1OCRB 3ZHFA 1AP2A 3BZ4B 4ENZA 3IMUA 5I74B 3MFFA 4JB9H 5DQDL 3QG6A 1HWHB 1T6VN 1E3XA 3ZE2E 5EIVA 4RGNC 4RQQB 1IGFH 1T0OA 4Z7WB 1NFDE 1BMZA 1W8NA 5I1CL 1GOHA 3DETC 4PW9A 4J27A 2V2WA 3TFKD 3MGOA 4J3SA 5IJDC 3K0YA 1Y7VA 3JZ7A 3FL7A 3U4BH 3RWHA 2CSPA 4L4TB 3CZFB 4YLCA 4KKAD 4OLWH 3S0PA 3TEYA 5C0GA 1EO5A 5EO9A 1QKZL 2QQQA 3L5HA 1E4XH 5I19L 1FVEA 1R5VB 2QADB 4TLSA 4ES9A 3WNJA 3OQ3B 5FDWB 3NCCB 4OZHE 4W93A 5G4NA 4RVBA 2BHFA 2ZG1A 1KLGB 1G4RA 4NNYA 4YX2L 4OIBA 1MH5B 5CILL 3WIIH 4LSSH 4PR5A 3DRQB 3UP6A 4F93B 2F74A 3AG2B 5D1ZC 3WKNA 3S97C 1X4XA 3FFOA 1M56B 2I85A 4RNRA 4KNSA 2D31A 2H8PB 2NY6D 4WFGE 4X98B 3NIDB 3WDHA 4AEEA 2Y5TB 1HILB 2CBMA 3CSYA 4S10A 1XXFC 2DMKA 1WFNA 5LBSH 2JLLA 3WUWA 1ED3A 1OW0A 1XIWC 2P43B 5TFSH 1HHGB 1HOCA 3UAAA 3HUJF 5D2LA 4IRJA 5T1MA 5L2KD 3OR6A 4H5SA 3GJFA 3GNMH 2JKJA 3NESA 4D94A 2ADYA 4UDTA 2VL4A 3TJHD 3B7TA 3KPMA 2OM5A 1A6VH 2B59B 4LHUB 1MCHA 4LSTL 5I8KH 2JKSA 3B56A 3MJ9A 5J1AB 3D50A 5DUBB 5KZCB 4XMUA 1FORL 3ROOB 5J1SC 2AEQL 1J1OL 1FRGL 2DV6A 4H1LB 4FTVB 3UZVA 4A6YA 2W65B 4JO3H 2O61B 1QI5A 2EVHA 4MKTA 4K3JL 1BQLH 4P99A 5JTWA 1IVTA 2PCFA 5GGSY 1CXIA 2EDWA 4YIQB 3W38A 4AG4L 2YEVB 2X4NA 2R7EA 3TL5A 3DNKA 1LD9A 2FYYB 2RA1A 1XCWA 4ZMPA 3O4LA 4PLKD 3FHAA 4Q9CA 3MV9B 4GINA 5ACZA 4K15A 1ET8A 3US1A 1MWAB 1SYVA 2YBRA 3BQUC 3LS4H 4KO5A 3ZL2A 3ZW3A 4YQXL 2BVPA 3CIQA 3QXDA 4FQLH 4ZUUB 4K9EL 4LVNC 2WLIA 4M3HA 2W9DL 3EOAB 1T0NB 3PRZA 4PWJA 4A04A 3RQ3A 5BRPA 4UAHA 2NTSP 4CVZB 3G5YA 4OVUA 2G2RA 3IJ9A 2TSAA 1PZDA 1HSAA 4RQQA 5F6HJ 4HUWA 5LB1A 4BSVA 3RL1B 2D3NA 3SKNB 2AK4D 2Z6FA 3C8HA 3ET9F 4MXVE 3VFGH 3ALPA 1VACB 4XE5B 2JKWA 4XAKD 1R5WB 4HWBA 4KK6C 2VE6A 1MAJA 5FF6A 5BS0A 1GCFA 3WUZA 2EE9A 4KKNA 3DX8B 4RSYA 5L9DL 4IJTA 5L7XL 3GHPA 3UAJD 4KVCH 1KPVA 3H9SB 3H7BB 4UQ3A 2D7QA 3FSZA 4FE9A 2Y7MA 3OMZA 4G80A 4DGVL 3W0WE 5C0GB 3ULUC 3CN3A 2CO6B 2Y3NA 4N0CC 3QWOB 3VSVA 1JFHA 1UZ6F 8FABB 1RSYA 1VGEL 4L48A 3QHFH 3S35H 5DLMH 4YBHA 5DMKA 1J8SA 5AVSB 1HX0A 2FUTA 3KWXA 5DT1H 3L3OB 5J57B 4DJMA 2NSQA 4K7PH 1J0HA 2OMUA 3VG0H 5ECJE 1TZIB 2EEFA 4PR5B 2ZX9A 3PP3K 1FZJB 3F04A 3NJGA 3FT2B 3BIAX 1KGCD 1RUKL 3FAWA 1G0XA 3NFNB 1IM9A 1J7VR 1E5UI 3F2LA 2CU9A 3WBDA 2BVYA 4N4YB 4OBRA 4WW2F 3QIBA 1JSYA 3VFTA 4K23L 1MJJB 4KC3B 3DSNB 5LN4A 1N10A 3AG1B 2HLAA 2WGXA 4FKHA 4RZCA 3V7AG 5GIRB 2PR9A 4QT5A 2WXHA 4FF9A 5CILH 3WIIL 1ZGLP 4N2CA 4U1SB 3RZCB 1NUNB 2J3SA 2ZX8A 3PNRB 1F58L 5ALCH 3NACL 3IPFA 1ZLUH 3MNZB 4HJTA 5IMMA 1NGPL 4U7KA 3HN8A 1FN4B 3T0VA 2APFA 4KMLB 4HX1A 3WJMB 4TQPA 5GRUL 3V52H 1KV7A 2ZG3A 4PJAF 1F4AA 4PRPB 4ILDA 5DZ9A 1PX4A 1CTNA 4N0YL 5TQ0L 4EPSA 2VDQH 1MF2H 4R7XA 2WOBA 2DKSA 1KTLA 2YAEA 5CGYC 1OIOA 1YEDB 1Z5LA 4PJXA 2J1WA 1P1VA 4OSUL 1GGIL 4HHGA 3SPJA 5T5NG 1YEJH 3ZR5A 1QYGH 3N1QC 5EOCJ 4PJEB 2XZAH 2Y2WA 4TVPD 2EC9T 1NH6A 4L8DB 3NAAH 2ZWZA 3SBWC 4NRZB 5MI0B 5J6GA 5FM4A 3ABGA 3ZVVA 1F4WH 5BRZB 4KJYB 3ZHLA 3F7VB 3UTPD 2YLKA 1Z1WA 3BLKA 2HH0L 1U8MA 4AYID 3F3HA 1G6RH 2LE9A 4YDIL 3H2QA 3NA4A 5T1DL 5D7IE 3NJNA 3EOAA 4QYAA 4XBGA 4RWYL 5KVGH 1G7HB 5F8QC 3FBKA 4GMSH 1QAWA 3NZ8A 2AXFB 5FECA 3S7GA 4Z3IA 4NO3A 2VO8A 3JZYA 4LOUD 3RL1A 3SKNA 5CEXA 4A7UA 5DHVB 5CF3A 4FABH 1FC1A 3GSVA 2IPKB 2AITA 4OFQA 5DRZA 1DJZA 1AXTH 1NGYB 2JJVA 4QHNA 4HYTB 1L7IH 4LKXA 1CFNB 1Q0XL 3HLAA 1EJOH 3TCXA 2JJSC 1QG3A 4H8WL 1OE1A 4XOBA 4FD0A 5EZJB 1VZHA 2AXWA 4EUPG 4Z7VA 1M2OA 3RL2A 4GW1A 3GMMA 1Y6KR 4NZJA 4PBWD 1T5XB 2VDKL 1BOYA 1MY7A 25C8L 5LBGA 1DN2A 1G7PB 4OGQC 1ILSA 3QEQB 1JV5B 4R8WH 5E8NA 3QJHB 3B83A 2PF6A 3MNMA 1CICD 2JJUA 5HHOD 2OMUB 5T33L 2Y6SC 3OXRA 1ERNA 4FC3E 1KTKE 1MVFA 4P48A 1FA4A 4KITB 1G6VK 2VN7A 4LARH 1PPIA 4M1CC 4W81A 3VE0B 1K5WA 4JPKL 2Y0SA 3EDEA 2BSBA 4PB0L 1WA0X 3O11A 3O8XC 3QDJB 4RWYH 5E9DB 4DP5X 3I9AA 3MLUL 3C5SA 5M94B 2OSYA 5ICZB 4NXSA 6FABH 4AIZA 2ODIA 3LPGA 5GIRA 1K4DA 3LTVA 4YDZA 2ID5A 1JHTA 4BFBD 4QT5B 2NY7H 4JNXA 3ISWA 5C0CA 2XKNB 1R75A 3JWOL 5IFHL 1AMYA 4OCYL 3RWFB 4L9LB 3AXLA 3KR3H 4Y5XB 1DEEB 1EAOA 1Y6MR 3LKSA 3SDDA 2R1WB 1A3LH 3PL6A 3SPCA 1A4JA 3C8DA 3SKMA 1GOFA 1T66C 5FYLH 5LGHL 3QVAA 1WFOA 4J7RA 4YHLH 2JKLA 1FE8H 3M1OA 3FTGA 3RVXC 3RG1C 3QS3A 4KKCD 1BCIA 4EJ1C 3BRFA 2V2TA 2AZUA 2EXYC 2VR7A 4WK0B 1XGUA 4MNHA 3BPLC 1E4KA 1L3WA 1I4FB 2F5AL 2YA0A 2BSTA 4N90D 4LSRL 4JKNA 5J11C 2KZ1B 1RZKC 2PKDA 3FQXA 1G7LA 5DS8B 1LO0L 1RSFA 3DX9B 3FCTB 5CLWA 1CGSH 1IEAA 4IHOB 5DEGA 1KY7A 2YGNA 1U42A 2QR0A 3VD1A 3MUGB 3GI8H 4M7JL 1JZ8A 2HWZL 2B5IB 3GSUB 2OL3B 3U6RA 5GZOA 1FCGA 2CLRA 1T2JA 4OCSL 3WNOA 4Y89A 3X14A 2UV3A 1ASPA 1WS8A 2WQXA 5GRXG 1TEYA 1A1NA 1A3LL 2PXYD 2V3EA 2JELL 2AQ2A 4ZFGL 4CILA 3MCKA 3MLSH 5CEXB 2E9BA 8PAZA 4BFKA 2Z64C 4KY1L 3BO8B 1DJGA 1KJ2A 3PWJB 5JDSA 3RHWF 1RLWA 5I82A 4O2FA 2B20A 4OZFA 5EPMA 1I8IA 2CHDA 2VR8A 1MZYA 4JFFE 3L9BA 4ZJ9A 4CGTA 1JGLH 4LKXB 1DEDA 1JXDA 1LEIA 1TVHA 3VM7A 2COVD 3BIBX 3KR3L 2Q86B 1G5AA 5LG6A 1E30A 4AG4H 4X6EA 3D2TA 2XWJA 2OCJA 2XY2A 1F3RB 1JZIA 1YYMH 4WW1A 5JNYB 5H4YA 3KJ6H 1RULL 4LK4A 4Z7VB 1JXKA 4JDZB 4Z78A 3SKJL 1I3GH 4FJ6A 4LO9A 3CVDA 4JVWA 1IBBA 4NGHL 4BUHA 1VADA 4DK5A 4IOSD 1EK3A 2ETWA 1I3GL 5KANG 2H6PA 2QKIB 1B2WH 3GMPB 4U1MA 1U2HA 1JGEA 4FG6C 4XMLL 1PLBA 5HJ3B 4NQXA 5L0QB 3Q5OA 5BO1L 4MQXD 4R7DA 3EGXA 4HIHA 3ML8A 4PS4L 1JGLL 1C5CH 2WVVB 3G6DH 4QUOA 4X0NA 4NN6C 4HT1L 3QDJA 1E5CA 4XP6L 1G1KA 3B34A 3GLZA 4GQQA 1A2YA 4DEPB 3HZMA 1FO0A 4HFUH 4ZOCA 3VH8B 5JHLH 5GJSL 4EI6A 3INOA 2XX0A 1BDYA 5CEZL 4XPGH 4JL2A 1R3IL 1EJOL 3CDZB 3CZGA 1J1PL 2QDVA 3AY4A 4GMSL 4QO1B 1O6SA 1L7IL 2ITCB 2PTTA 3P0VL 5D5MB 5KVEE 2R83A 2VRQA 4LP5A 3U6XA 1XF3A 2ZONA 3GSOA 3ZE1E 1GZQA 4F7TB 3BLPX 4P8QA 1AH1A 4EEEA 5I9QB 2YEZA 4GSXA 4L4VD 4X8CA 1I9RH 3BW9A 5EOQL 2ILLA 2RFXA 4PY8J 2BMKA 1LO2H 2WTPA 2Z3FA 1PQZB 2NR6A 1LK2A 3M46A 4GRLA 4JZJA 5ID0B 1HWGB 4K5NA 5CEZD 5EN3A 1XF4B 2XZAL 2Y69B 3QZOA 4NP9A 3VU2A 5D2LE 4YC2B 2ZWNA 3TASA 3ARDD 2J72A 2YO3A 1DLHB 2BWDA 3EOYG 4RFNC 4IGBD 3H9YA 4YHKH 2FIRT 3AQYA 3L5WA 5DJDA 2CJ3A 4X6BA 2V37A 4JG0H 5HP5A 3WD5H 5D2NE 2OA9A 1TDQA 3ARGA 5DVNA 1X5LA 2WNXA 3X14B 3NJIA 3P9WB 3BYTA 2X40A 5LO7A 2QV2A 4UWQB 3QRBA 3MOQA 3ARWA 3QIWB 5ESQA 4YPGA 2GUOB 5HHOA 2VDPB 1IBZA 1CD0A 2QVTA 1WO2A 2B4CC 3FB7A 1NKGA 4YX2H 1NWOA 2L7UA 2AK4E 2QQLH 4G6KH 1IZKA 2OCFD 3GMOA 3GXTA 5C7XH 1UB5A 1I8IB 3WTYA 1CXKA 2OMXA 1L6XA 4GLRI 4OW6A 4TMPA 3CVIH 5C0IA 5HPMA 1CLZH 3RGVD 4NUPA 1WAPA 1A22B 2OZNA 3OHXC 1VB9A 4R2GC 1HKFA 3MCYA 5IEKA 1RUKH 5BCAA 3WNNA 4WW1B 5JNYA 3KPPA 1XGTA 4ZO7A 2J1YA 2Q0ZX 2VN5A 4TUOA 1JBJA 1KSRA 4N6RB 5EC1A 4CUCA 1BLIA 3WS3A 5B7EA 4HZLB 4LFHG 4LPXA 1EMTL 4GEJA 4P9ML 3V6BR 2XQYK 3MV7E 2J55A 1CE1H 5IP4A 4NHUB 1RZQA 2YEQA 5FYLD 2FR4A 1JNJA 5JYMA 5I8EB 1Q0XH 2WINB 3VWKD 1DTUA 4B50A 3BUDA 2HG0A 4BCXA 1CF1A 5FGBC 4UBDD 4NIYE 5DJYA 4UOZA 4DGYL 3U48A 2QPUA 3NEEA 2VDNB 3EOBA 1T6WA 3SOBL 1CLCA 5D1QD 1VGEH 1ZSDA 2HB0A 1P4BH 3L1OL 3VH8A 3VJ6A 3T6XA 5D72H 2DIJA 2AKRA 3L9RA 4Z3HA 5E1QA 3WO4C 1ZT7A 3DX7B 4L4JA 2XWDA 4R4FH 5CN3A 3CFBA 1FWXA 4HLZH 1MIMH 3M7OA 2YQGA 1EQWA 5J6SA 2HH0H 1U3ZA 1MFUA 2WUBL 1H3PH 3VI4E 4WU7B 1SY6A 1J0JA 2DQCL 3PJSA 3SDCA 1A6UL 4YDNA 4P5RA 3S3DB 1F4WL 4G8AC 4J12A 3NJFA 1WA2X 1UA3A 5KYWB 5E94B 2FQDA 5IB4A 1Q4NX 3OXSA 5TDNA 1PIFA 4XVUD 4HIJB 2AQPA 4L0ZA 1F3JB 1U41A 4PJAB 4Z95H 1S9WA 1GPOH 2HRLA 2X4UB 5DD5H 4G6JL 1EUTA 5IFAL 4O58H 4AL8L 2C3XA 4GRLD 3LIZA 4NN6B 5CSZA 1OALA 1JYXA 4BE6A 4UMSA 4U1NA 5T5NF 4F9LC 2JV6A 4I9XA 4HKJA 5GGTA 3QEGL 3HCVB 4JG5A 4N5UA 3QIBD 1Q0EA 2OSLB 1KT2A 4KH9A 12E8L 4BK8A 1WFUA 2R0WH 4LXFA 2GY7B 3VVVA 4F7PA 1QSED 2VSKB 1OPGL 4WIQA 1NOLA 1ZHNA 2LHAA 1KFAH 1YAZA 3VFPB 5G4OA 4PY7B 4XGZA 1OT2A 1T04B 3HR5B 4HEPG 1OF2B 1RY7B 1TENA 2DQHH 2CDGA 4UV7H 5D7LE 3GNML 5AOIA 5ESAA 3KLSA 2NY3D 4ODXA 1QNZL 4PRHE 2GBTA 2K4WA 3WCYA 2DQIL 2J73A 4ZFOB 1P2CB 2BCMA 2Z93B 3PV6A 2DIEA 1WD9A 5F3HA 3O2DH 5E6YA 1E28A 4DPAX 4I3RH 1AKJB 5C0BB 4RSVA 2P9RA 2HPTA 2BSSA 1OQXA 4HCRL 2WPGA 4JBSA 1NIAA 5F7YC 4Z3FA 2JK5B 2MCAA 3W1ZA 3FO1B 2P3YA 3FB5A 1P6AB 4IKIA 5CD3A 1XSJA 1RVFH 1KCSH 5ICXA 5DD1H 4N1EA 4ATWA 2QJDA 4OCXH 1EVUA 1RUML 2ARJQ 3QUGA 4JMNA 4N6RA 4HIQA 2MCMA 4JFOB 3QUHA 2HJKA 4MAYD 5EHFA 1V7NL 4WWOA 3QI9B 3II1A 3LS5L 5F7EL 1HJBC 3RWGB 1E5BA 3PDGA 5LVEA 4IDLA 3FQWB 2DD8H 2H7WA 3WKQA 1XCTB 5FLUA 4F5CE 4W4OC 2K3HA 3OPZH 5DU7A 3T2PA 4CU8A 5AAPA 3HS9A 1QVOA 3K74B 1T1XB 4ZTOL 2BFVL 3WSQL 1KTRL 1A4KA 3P2TA 2P80A 4JPVH 3BVDB 3RWJA 3TWCH 3V4PH 2BERA 5F89B 2CMRL 4R3SA 4DP9X 5CZVH 1RZJL 1YPZB 1TKWB 2FL5A 5INCA 4ETYA 1YCSA 1KN2H 3MRHA 4ZPTA 1IU1A 4N3TA 1AGDA 2VDLB 1W0YT 3VI4B 5HVHB 3IDMA 1CI3M 3BISA 3GJEA 4JFYA 1MG3C 4GLRH 1D3CA 4H8UA 4KJQD 3RPKA 3VXTB 4S0TD 4ZAKD 1UH2A 1J12A 3VYOA 5C3IA 1JK9B 2PTUA 4KX9A 2BSED 5T3ZH 2X4RB 1CE6B 3PWLB 1DL7H 4UZSA 1T3FA 2X0WA 1NCCL 5AOMA 1YY8B 3OXSB 5TDNB 3ULVC 3FQTA 3LKQA 4YHNB 5LXGH 5B1KA 1S7TB 5A6IA 2B0SH 4YVUA 3C6SA 4KK6D 2JCCE 3BZ4A 1FV1A 2IOOA 1FO0L 5IF0B 3ARBD 2ZAHA 2Z31D 4KRPB 4MD4A 1S7UB 4FQIL 3QDAA 4M7KH 5DJCA 4RMBA 4EDXA 2EDYA 1MJ7L 3V5KB 1O7DE 1X3DA 1NCBL 4ODVL 4PCSA 1A6VL 5DA4A 3FSWA 1WZKA 3SQBB 1IE5A 5B1JC 2APWA 3A24A 3PQYE 4YUEH 2PO6B 4TNWF 1L6ZA 1CXEA 3DTXA 3AMKA 1YYCA 4XCEA 4ZDHA 3G5VA 5MENA 3NJXA 2HJFA 1S9XB 3OKOB 3AW5A 4TVPE 3U30C 3PV6B 4BSWB 5CM1A 2X89A 5HD8D 4I18C 3MRQB 5DGRA 5DWPA 1VZGA 2WBJC 5HVFB 4XE0A 5FW8A 1FIGL 1J5DA 1F4XH 1M7UA 1ODAA 2BLFA 3GZQA 5I9QC 3GRWA 1PLGH 5F1IB 3JWDH 2F53D 3DRQA 3NPSC 4Q6YA 4WUKH 4CMHC 5MENE 4WSJA 1L5GB 1DFXA 2YOAA 3K6IA 4P5TA 5D7KD 3KLHD 3TBTB 1MHEA 5I1HL 3CN2A 4YE0A 4ODWA 1TQSA 3QEQD 4LE8A 3A3YB 2X4TA 4JANB 2WZPD 4MA7L 1F90L 5GSRA 4JKPH 5BUGA 2K6YA 3QW9A 4FFWC 4DO6A 3L5JA 3MBED 3FQNB 4AV5A 1HOCB 3MO1A 1U36A 2JTDA 2NUPA 2G9HB 5HGAA 3AADB 2IADA 3U9UA 4TXVB 4LOUC 1S8DA 1OARL 2QTVA 4ZXBA 4NRYA 4QXGH 2NY6C 2A83B 2AMGA 2B8OT 3TPUA 4NZTL 4XCNB 1T1XA 1WYJA 3ZKMC 2EUZA 5J1AA 4HOZA 3GUTB 1MVYA 1WZAA 3MYZA 3HVNA 4FEMA 2J20A 3A6BH 5EZIH 1UEMA 2AQ3A 2F54A 3PGDA 3UBXG 4FFZH 1FFTB 2HLFD 3SZKC 4PJGF 4E0RB 4Y4HC 1DBAH 1X4YA 1A02N 3CUPA 2LV4A 2XU9A 5CNHA 2AJUH 4LNVA 2HCZX 4J4PD 1MCNA 3WE6B 1TYJA 4WCYL 3DMMA 3GPEA 1F45A 3SE3C 4PHZA 5BXFB 1OM3H 3GIZH 3NA9L 4ZZFA 4UM8A 3TBSB 2V0AA 3MRKA 3D3VE 4Y1AB 1ONQA 3FK3A 1D2PA 1J87A 1INQB 5DCCA 5L4IA 2DQUL 2I07A 2HYMA 4D3CL 5E23A 2Y1YA 5A2BA 4A67A 4AMKH 3MJ8A 3TH2T 3SOTA 1BLNA 2G5BA 2WWOA 4XC1H 4GO9A 3B9DA 3NH7H 4W9HC 5I5JA 2RMNA 3HRZA 5SWZE 1BAFH 4YL4A 2TAAA 4HKBA 2OK0L 3IFNL 4F58H 1QBBA 1WP6A 4FI7A 2MJWA 4FQCL 2XZQL 4I1RA 3JWOC 1RIVH 4N2EA 4NQCB 4KTGA 3SQBA 1JNHB 3P0YL 4J3OH 1SUHA 2ZWSA 1MHPL 1U8IB 1PX3A 3FNKA 4W9EC 5E8PA 1AR1C 3JT2A 2CKBA 1GA2A 2JB5L 2Z31B 3Q1EA 3ZQWA 3Q0HA 1GGTA 4FQXB 4N2IA 2NZ9D 5JR1L 4U3SA 1JD7A 4BSWA 3MCG1 4DGVH 2OMTB 3FU3A 2TRHA 4I2XA 2D9CA 5G55A 4EUPH 3AS3A 3V2AR 2ZCKH 4HXAL 3MNDA 4LCYB 3V10A 2YPKA 1P84J 3L3OA 3ARYA 2V8MA 3D4ZA 5T3ZL 2WYZA 4PJ5A 5CZKA 1U2YA 5F1IA 2QVFB 1UZ8A 3DJSA 4ZOBA 3AXIA 4JY4B 3TVMD 4JFVA 5CCKL 2ZKHL 4LL4A 2MOGA 1F8TH 3MRNB 4N0CD 1XCQA 2ORBL 1MRFL 1OTSD 1J5OH 1LDPH 2Q7NA 4HK0B 3UL4A 2HLAB 4RZCB 1BVZA 1MCPH 2WKGA 3UTQA 3MRMA 1NDTA 1P5VB 3FOLA 2V7NB 3NSCA 2GFBA 3KXFA 1MRCL 1S6NA 2PCPA 3FQNA 2DDQH 4GW5B 1AP2B 2BFVH 4OI9A 2W60A 1NCGA 4GBXD 1DVZA 1GIGL 2A6DB 2OV0A 5ADPH 5I1JH 3HE6C 3UGEA 3WKMH 3CU1A 3K5SA 2D0GA 3UAJA 4ZXBB 3K72A 1RL1A 3IFOA 2XZCH 5H2BB 4X4ME 1UWYA 1A0QL 1NPJA 5TGBB 1IRAY 3QR2A 1J11A 4O5LL 5T3XE 2FD6L 3CFJB 3P77A 5C0AB 1OAXH 1I7ZB 1OE2A 3US9A 3B3BA 3OMNB 3PGDB 4G6AD 4Y1SA 4YSTA 4CKQA 3WS6A 4D0CA 2Y5QA 4AQ1A 5L88L 4PI0A 1IIIA 3HFFA 2XTJD 1XF2A 1AYRA 1FRGH 5H4ZA 1PFCA 2AQSA 3CUPB 5TF1H 4E36A 3IJYA 1OGAE 1E3ZA 3KPRA 1T7XA 1V54B 4BK5A 4G11A 4UT6H 4LIQL 3NIFB 5EIIB 4QY8A 2KS0A 3KBHE 5D6DA 3W2DH 4UT7H 2MHAB 2AXGB 5H94A 4IU2A 4S1QH 2ZWYA 5FYJE 3EJCA 1S3KL 2QPEB 2UY7A 5FKAB 3N6YA 5I1EL 3F7VA 2PCXA 3CG8A 2VZ1A 3ZT7A 3QXTA 1BQRA 4KRPC 4Q74A 1U8MB 4NFCA 4BQ6A 4QRRA 5I76B 3D9AH 4YFEA 4N3UA 4HPYH 4F9PA 3F01A 3HHSB 5IEHA 3F5WB 3BXNA 3HPLB 5AKRA 3TCLB 1FNHA 4ZX5A 1NSNH 1X4ZA 3OAZH 3U36B 3VWKA 1QWHA 1DJYA 3MJ8B 1JHKL 4BCZA 1JZFA 4U2YA 4A7QA 5K9QI 3EHBD 3B8SA 4PJ7E 2OJEB 4AM0Q 1LK3H 3NCYP 1E4WL 1BD2A 3D69A 2ZF8A 3V4PB 4HKBB 1QLEH 2M2DA 3ABMB 5CCJA 4BK4A