2X0WA

Structure of the p53 core domain mutant y220c bound to 5,6-dimethoxy- 2-methylbenzothiazole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Toward the Rational Design of P53-Stabilizing Drugs: Probing the Surface of the Oncogenic Y220C Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x0wA00
4IBZA 3WTXA 1KZYA 2XWCA 3D09A 3Q05A 2ADYA 4L0YA 2GEQA 4IBYA 4G82A 1UOLA 1EAQA 2BIQA 3WTTA 2J20A 4AGOA 2FEJA 4LOFA 4IBQA 2J1YA 4MZRA 2J6WA 5AOKA 2X0UA 5AOLA 3IGKA 1HJBC 3VD0A 4LOEA 3WTSA 4IBWA 5AB9A 2P52A 2AC0A 5KBDA 1H9DA 3WTVA 5A7BA 5AOJA 4AGMA 3Q06A 1HJCA 1GZHC 4IJTA 1LJMA 5G4MA 3IGLA 4XR8C 1CMOA 3US0A 2IOMA 5ABAA 3WTUA 3EXJA 3D05A 2AHIA 3VD2A 3KMDA 2X0WA 1T4WA 2ATAA 5BUAA 2YBGA 3TS8A 5G4NA 3VD1A 4A63A 1HU8A 2VUKA 3WTWA 4AGQA 1TUPA 2BIMA 3D07A 1E50A 3ZMEA 5LGYA 1EANA 2J21A 5AOIA 2MEJB 2J1WA 4L18A 2XWRA 4IBTA 4L0ZA 2BINA 5LAPA 4LO9A 1IO4C 3WTYA 3QYNA 4GUOA 2H1LM 4AGNA 4G83A 2IOIA 5ECGA 2IOOA 3D0AA 3WU1A 1TSRA 4QO1B 4HJEA 5G4OA 2PCXA 2X0VA 3KZ8A 4AGPA 1CO1A 2RMNA 1EAOA 2J1ZA 3QYMA 4AGLA 4KVPA 2J1XA 2OCJA 3D08A 4IBVA 3US1A 2BIOA 5AOMA 3D06A 1YCSA 2WGXA 4IBSA 4MZIA 4IBUA 3Q01A 1GZHA 4GUQA 2BIPA 3EXLA
chains in the Genus database with same CATH superfamily
4YXKH 5AVQB 2NNAA 4TSCH 2YO3A 2AKRA 1QRKA 2I9LB 2BSCA 1QP1A 3T1FB 4DGWC 2O61A 1IB5A 1FFTB 3TZVD 5I16B 1OGAB 1Q72L 4LL4A 3BVNA 3QEGL 1OK0A 3RZWA 3NRFA 3S5YA 2RTTA 4YSDA 4XXWC 3E0GA 5KJ4A 1JD7A 4G6JH 1YMMA 1BZ8A 4TSBL 5I0ZA 5I5IA 1HIML 2VDOB 1PZCA 1IAIL 4ODBD 5FGBA 3DK2A 2JLLA 3DXAA 1U0QA 4K94L 1GTNA 1MJUH 5C08B 3PWPB 4JZJB 3VXOB 3ULUC 3BLBA 3QAZC 1IC4L 1IM9B 5D70H 2XZZA 4XMWA 4F1ZA 5I8KH 3MRHB 4D9QE 3SPCA 5IG7B 2OMWA 1CT8A 1CYWA 1PSKH 2DKSA 3NCBB 1DBAL 3MOAL 4DW2H 4RBPH 3TO4A 4EIZC 1CGTA 1T7XA 2FB4H 2FL5B 3B83A 3OR6B 3Q1SH 4OFKA 4NZ8A 1Q0YH 1ACCA 3IJHB 4HKZB 3RHWK 1AE6L 3FUFA 5IQ7H 5IROD 3O2VL 3SE3A 4LFHG 2PF6A 4CVZB 3HS8A 1AMYA 4NWTH 5MHSD 5J13B 4O58L 5A2CA 3FUHA 2JWYA 3I02A 4Y4KB 3ZKND 3MTRA 5IP4A 4PBWD 3SDAB 1JUFA 3S3BB 1JF1A 4HEPG 5F7HA 1XF2A 1BJMA 3LRKA 3PHSA 3MRNA 5E6YA 2DB8A 3CK0H 4MS8D 3SQBB 3QAQA 1WAAE 3BVXA 5AYQA 4N0FA 7PCYA 5DGRA 4HQQL 5I8KL 4NWUL 4PLJD 5HJGA 3Q8BA 1F13A 2AJXL 3IJYB 1JBJA 1TJGH 4J3OD 1AGFA 4ONHB 4HIIB 3IAGC 1Z5HA 1AGEA 1P5UB 5I1EL 3WIIH 1ZVHA 2FB4L 3BQUD 1W9XA 5BJTB 4XP9H 4YBLB 4OJDH 3M1BB 4JO4L 4JKPH 2WP3T 2E9GA 2QR0A 4FYSA 4NWTL 1TZIB 3BFOA 1A1NA 4D3CH 5C0JA 4LEEA 3K2KA 5TGBA 1KBGH 4FKEA 4IRZA 4MNQA 2AXGB 1J05B 4RGMB 5IMOB 5IWLA 2RQ8A 1ZHLA 4G1EB 1ETZA 4Z9KB 5FXCH 2G5UA 4L1DA 4PCYA 2FGWL 3RPIB 4WV1B 43C9A 1USQA 1G94A 2FCBA 2BNQB 5AW4B 2A9CA 1KCRH 5F8QC 2ZXQA 4Z77A 1JPGA 3MCG1 4JHZA 3SDDA 4LBEB 1A9VA 4W9GC 2YGQA 3MLTA 4FZEH 4TKWA 4Y2NA 3NJKA 3PWLA 5IVOA 4RAUA 4OCMC 4KZDH 4J12A 4JM2F 3T6VA 1P53A 3BFWA 1A5FH 3BE1H 2G5BA 4HUMB 3O6FA 3FNKA 4YX2L 1SVBA 3DWTA 4MJHA 1MHHA 1NSNH 4NAMA 1JXDA 1KJ2L 4P4KA 4RESB 4RNRB 2P43B 2JI3A 4M7LL 1R24B 1AZVA 3GSVB 5D1XC 3HFMH 3L1GA 3WNPA 4APXB 4LCCC 4I4WA 5ESQA 5BV7H 3L7EB 1DO5A 4E0RB 2BY0A 3T77B 4ZX4A 3GSOB 3RURA 4Z0XB 1A2YA 5EWIH 2O6DA 3FB5A 4IMLB 4FQXC 3VFUA 1V10A 4BUHA 1UVQB 3WJMB 3LRHA 4X7SH 3PWVA 5AB9A 3M17A 5ICYB 1TJHH 2A6IB 2VE6B 4C59B 3SYCA 1O0VA 1F4AA 1NBYA 1T1XA 3PQYB 3WJLA 4ETQB 2VLLA 1ZA6A 4XVJH 2Z8VC 5KSBB 2KC0A 2NLJA 3NSXA 3W9DA 4HCRL 4UINH 1KF9B 3T65A 1A5FL 3ENEA 5D7IA 4UDTA 3U6RA 1HZHL 4F9LC 3BAXA 1PG7X 4A04A 2V9QA 4M5TA 1TO4A 2N56A 4NKIL 2EDBA 4KI5E 3UO1L 3QFDB 2HCZX 2DLHA 4AUUA 2VO8A 1G7JA 5IROA 4JO1L 5EHFA 2EEFA 4K5NA 1R4XA 5JW3L 4M43H 2H2PC 3R7QA 1MFBL 4DSYA 2HRHA 5C07B 1LEKB 2ZD0A 4A63A 1XGYL 1F2QA 1AHKA 3FKUS 4N0UE 4PH8A 4Q2ZA 4UOQA 1V3KA 3LNDA 2AKRB 2Z65C 3KPRE 4PB0L 4PYGA 4FNUA 3SJVB 4OZFB 3G5ZB 3N5AA 3QFJD 1SEBB 5EZPA 3ZKQD 3N44F 3L81A 2C7FA 3WLWD 3GB7A 3SQRA 4Z7OF 1XGPB 3PXJA 4FYQA 4K5MA 3IDMA 4PD4K 3VTTA 3S37L 4YZFE 4RETB 2WD0A 4XP4L 1M71A 1YMMB 1X5HA 4HIHB 3WNKA 4P48A 4XP6L 4HK3N 3B2MA 3BQUA 4UNIA 3DXAB 2XTSA 3J8F7 5AKTA 4YSUA 4M61B 3UEQA 2AFNA 5AAMC 4JPVH 3VRJB 3TC9A 2BRRL 3B6SA 4E9YA 1AKJB 4BFJA 5IVXB 1KPUA 1MCPL 1DUYB 3O3BB 2V2XB 1XL6A 4WKZB 2BVYA 4AIZA 3B8SA 1AMXA 1Q0XH 1Z9PA 2TSAA 1RAMA 1UWXK 3ATBA 3IJ7A 3GMPB 1OB1B 5H37G 4JZOA 2V7HA 5D7EA 1MCOH 2XWXA 3BH9A 1A9EA 4JFHD 3RUGA 5AVRB 4J1UB 3TYFA 2GTWA 5PAZA 1E2VA 2KL6A 3S2AA 5LXGL 2KPWA 3A0OA 1NMAH 3UGEA 5BS0D 4FEMA 3ZTNL 5AKVA 3V4VL 1F11A 4D0CA 1WBYA 2C9SA 3TOPA 4G6KL 2VDLH 2ALWA 1RZPA 3QDJA 4R90L 1D5IL 3JTSA 3MJWA 4JPVL 2J1KA 2W95A 3V5HA 1JGUH 2WXKA 1PZUB 1AGFB 4F7KA 3RX8A 2QBWA 2ZCLH 3QXDB 1G6RL 3DX8B 3MLRH 1FE8L 4FI6A 5ALCH 3VG9C 3ZHLA 4L37A 4NPYB 4NX0A 4OZGB 1GSMA 1TETL 2ADIB 4R4ND 4JY4B 5D71L 4JO2H 5AWNH 3TNNB 2LE9A 3V52H 3P02A 1R5IA 2QR0B 3MREB 1XCXA 3IVKA 4Q6YA 3WKMH 4PJIB 4U6XB 4WENB 1MZZA 4OCNC 5TGBB 1X5XA 4MNQB 1ACYL 4D0DB 1ETZB 1NMAL 1SLWA 3BUPA 3L8QA 5EBWA 1BEXA 4YK4C 1LEGA 4Z77B 1GIGL 5C0CE 4BV1A 5I8EB 4GY4A 5FO7B 3BX7C 1OQXA 2Y5TA 1AOHA 1CD8A 3REWB 1GPOL 3GSQB 3HG3A 3MJ8B 4A6YB 4HJJH 5GS1A 2TAAA 5KVEH 3BMVA 5JHAA 2EEXA 3NIFB 4JPKH 4FQ2H 4Z78A 4RDQG 5F7AA 2EDYA 4TYUA 5ESQB 4X6CF 2CKBB 2NY6D 4JO2L 5AWNL 3GSXA 3V0HA 3SDCD 3QFJA 3C2AH 1DVQA 4NGHH 5DD3H 3TZVB 2E6PA 3D39D 2C9VA 4OT1H 2JKLA 2ID5A 2YARA 3NH7L 4LEOA 2EIMB 1WJ3A 5ERWA 5F7BA 3IXTA 1UOVA 1GW6A 1TSRA 3B3BA 3VM7A 3LEYL 4NQDA 5DEZA 4PPTA 4N85A 1KTDA 3L54A 1NBYB 3VWJD 2XFGB 3LYRA 1RK0A 3HC2A 1XIWB 2NY4C 3T4AC 3ZHNA 1JS4A 4DO4A 5LHDA 5MEOA 1UD3A 1KTLA 2P5WA 4JQIL 4N4YB 2QVTA 4JUSA 3FUIA 3N40F 5D7IB 1WWBX 2EDNA 3C5ZD 3X13A 3HE7D 5JDSB 5KSUA 1CGYA 2B1AH 1JVKA 4FQ2L 3GZOA 4KNQA 4Q4IA 2R27A 1XH0A 1JNNH 1T1YA 2PYED 2J6EL 1T04A 1N64L 4HBCL 5BMFL 4MAYD 5HVHC 2DWDA 5DD3L 2F8VA 3ME0B 2X2UA 2HZHA 4IRJC 3H9SD 4NCC1 1TTUA 3F6JA 2H0EA 5KUKA 1CYXA 1CLZH 1N8OE 1L7IL 2OBGA 4M7JL 4TQHA 4UQ2B 4BHUA 3KS0H 4UT7L 3U4AA 5ID0A 1A1OB 1A0QH 1IIIA 5LBSL 3UBHA 5BS0A 3P69A 3EFFA 5FUZH 3ARED 3BKYL 1C5BH 2YRLA 2OTPA 3A6BL 2GSGA 1UGKA 4DKAA 4LCIH 4QRPD 1YO4A 3VXSE 3IDNA 1M71B 1W0YT 3BEVA 3PIQA 2NUPB 3H9HA 4XAKD 1S3KH 1D5ZA 4YL4A 5JUEL 3LSOB 4X4YB 2BC4B 4KI1A 4XZUB 3DVNB 2Z91B 3HLKA 1OAQH 1GYAA 1G7QA 5EUOE 2QGDA 5I5RA 2Y36H 2RJMA 2ZZUT 3CGTA 2HJFA 3B6SB 5AAWC 1TJIH 5I1IH 2Y7OA 2PWGA 3BP5B 1CLZL 2A9AA 4OV5A 4KO5A 1I7UA 1NCAL 3N1MC 5FYLE 5D8JH 2AEPH 4MX7A 1AQHA 1HXKA 4YLCA 3IM1A 1GKOA 3HPJB 1FL6B 3P3TA 4Q8BA 4Y9FA 4YC2C 3FT4A 1C5BL 3LNFA 4HC1A 3FCTB 4WFFE 1QYGH 4LCIL 3CVHB 3C08H 2X40A 3Q2WA 4MNGA 4U6TA 3QPQD 4IOSA 3KGTA 5CP7B 5DF0A 3VFNA 3OTTA 3PPEA 2F9BT 4XMPH 3ZE0F 2UY6B 4ODXA 5FYJH 1MFNA 1WK0A 1XF3A 3LN9A 1TG8A 2X4TA 2IH3A 3MODH 4P9HH 4X50A 3WO4C 2CXKA 3WKPA 2JKJA 1O7DE 2JKTM 1OAQL 3MRBA 6FABH 2WO2B 3U4BH 4FQPA 1BZDA 5LBVA 1P5VA 1QNIA 4HIEA 4ZPTA 3WO3B 4OD3L 3LH9A 5I1IL 3HG4A 5L0QB 3NQKA 3KDMA 3EF7A 2O5YL 2RACA 1QFWM 2GAZA 5D8JL 2AEPL 3DC0A 4MQ7B 4IDLA 2BSTA 3JXAA 5K33A 3QQ3A 1NANH 3MRGB 1QYGL 1LP9B 1NGQL 1NGZA 3K6FA 3S35L 1BBJB 1T22B 3PYCA 5LDSA 4BZYA 3BQVA 1W6LA 3F84A 1OP5H 2FQFA 1NAML 5BRQA 3NIGB 5SWQB 5FYJL 3C5ZA 2I60H 3HE7A 2WUBL 2ARWA 2HRLA 2PO6C 1UYWH 2BW4A 1PJWA 3GFUA 5JO5A 3QUYC 5F96L 1OAXH 2PYEA 2NCMA 1IM3A 3U4BL 3LZPA 1JVLA 4G8EB 4QRAA 5LB1A 3ZVVA 3RKDD 3TEUA 1HEZB 3MHZA 3LKSA 2XPZA 5I1GH 4GQZA 1OHZA 2GYSA 3BDXA 3U7YL 1DFBH 3ARBD 2J8UF 4QKTA 3BKJH 3C60B 3S8WA 3MLXH 4KK6D 1HKLH 2FD6H 4P99A 2NXZD 5D7HA 3EGXB 1DR9A 2P1YA 4DEWA 2CQVA 3GSXB 4TL4A 1XAUA 2IF7A 1K8IA 1SHXA 5KOVC 1ZTMA 2GW5A 2O6EA 5DLML 4IU3B 2VH5L 5C0RL 2YRPA 2DQFA 2EDMA 3NZSA 3AREA 3IDJA 4GQQA 1D9KB 4HKXB 4GG6E 4LEOB 1G9NH 4QRPA 3GSNL 4URKA 3L3IB 4FQ1L 1UYWL 1JMXA 4EI5C 1A22B 4Q89A 4ZXBC 5JMOC 3ULSA 1KTDB 3WUWG 4A68A 1OAXL 3UABA 1JXJA 3S34L 1RK0B 2F0CA 5FB8A 4HKJB 1BGXH 1D7FA 2X89D 1UA7A 2WXLA 4S2SB 4OJEH 3GMMB 4XNZC 5CR1A 1JGVL 3F7VA 2GJPA 2E46A 1PDKB 1U2HA 1DFBL 1AAJA 1HKLL 4HJ0C 4DGVL 3DGDA 4L4VE 1H15B 2YWYA 4W9LC 1T04B 3UCQA 1PKOA 2OYKA 4NUPA 1U8QA 3ALPA 5J56B 5ICZB 4A2MA 1CDIA 5TDOB 2X10A 4NFCA 2WJ7A 4WSGA 4ACTA 4YSAA 4N1CA 3CH1A 3RX5A 2DWYA 3MLZH 2WCGA 1VZIA 2R2EB 4BFIA 2DIBA 3M7OA 2L04A 3SYQA 4DHLA 5KS9A 4OLXH 4ELDA 4YHLL 2YA1A 1MWAL 4IMKA 5FA3B 1KZQA 3IN0A 5D1QB 3AMKA 1BGXL 1NCTA 4HBQA 2H1LM 3TEXA 4AMWA 2GSGB 3T71A 1LEIA 1TQWA 3JT0A 4Y5XC 5B8CC 3T8XA 3NA9H 4ORGB 4FHKA 1JZ6A 1P1ZA 3H7BB 3E7JA 4POUB 1FNGB 3PIQB 1J8HE 1DN0B 1WFUA 4RFOH 4P5MB 1E90A 2OLDA 4I3SH 5HHVH 3PHOA 4TPRL 1JDCA 4UQDA 1KIRB 2BWIA 4MYPA 4R83A 4AQOA 4DOHE 4YDKH 1G7QB 2QKSA 4YXHL 1X5IA 1Z9LA 5I19L 3PGCA 4AZUA 1SY6H 2WYTA 1XF5A 1J5OL 5F7YC 4HHAA 2YA0A 3ZY7A 3ZYOA 4LHJB 4J8RB 2XICA 1V3LA 3QEQB 4OLXL 3VFSA 1YN7A 2J43A 3LV3B 2PR9A 4RFEB 2Y06L 2Y69B 2JCCA 1M9WA 3STZB 2JJWA 1UWXH 3UL4A 3HC0A 1H3XA 5E6ID 2XPGB 3MUY1 4FEIA 3CZFB 4MXWH 1F5WA 2VDRB 3UMNA 4KNUA 5E51A 1XF3B 1TMCB 1U8LA 2X4TB 4WWKD 4WGVB 3EYUL 4P59L 4XO9A 2KKQA 2WVUA 2K4WA 4M03A 1OWRM 3P9LB 2NY6B 1CGWA 3L5WA 3SDCB 3QORA 4ZI8A 2XQBL 3FTZA 4HOWA 1SXNA 4FX5A 2DH2A 3BCDA 1E9PA 1Z6JT 1SM3H 3D39B 4C56A 3PRZA 4BKTC 4EUPG 1N5AB 1N0XH 2K7PA 2FJGB 4FGMA 1BG1A 4PWHA 3TPUB 4AW4A 2BZCA 5EZOH 2YQBA 2BSTB 5JLZB 1QBBA 1I8IB 5D2NE 3FTSA 5D5MA 3VWJB 3RVWC 2YAEA 2X89A 4K3DH 5F7FA 4MHHG 5DFWH 1FNLA 3UYRL 5C9JB 3MGTA 3NCCB 4B60A 4GJTB 1QEWA 12E8H 3V6ZA 4KROD 4UT6H 4I9XA 4BZ2H 2Z3FA 2FSEB 3GM0A 3DYPA 5JO5B 3V8OA 1CFTB 3TPKA 4CA4A 3TVMA 1W8EA 1IU1A 4PJ9D 4KI5F 1NJ9B 2IFGA 4MAYB 3MLWL 5AG8A 4J27A 3EH3B 3EH5B 3HB3D 3H9SB 4S0SD 4TQIA 2DRUA 5FV1L 5DJ8A 1GXEA 1IILE 4PIRF 2YRBA 1M9SA 3ZGIA 1TIUA 1DZBA 3KWVA 2DZEA 4KI5C 3BZ5A 1TPXB 2CK2A 3GXFA 2YPVL 4GBXC 2DWEB 4HJGB 3QQ9C 3ARUA 3UJJH 2ATKA 3AREB 5E9DA 2OSXA 2OMXB 1NFDB 3NFSH 4JANA 5IMMA 2D03H 3BVVA 4X98A 1CXLA 3DOSB 4JFPA 1HC1A 4OF5A 4YZFF 5DFTA 1USZA 4BZ2L 3AQYA 1QFPA 3NCJH 3BYTA 1OLLA 1RP9A 5A6MA 1WITA 3EDDA 2P24A 4LSPL 1IGMH 3FZUD 3K3QA 3WAKA 4GW5A 5GGSY 4BM7A 2N4IA 3QDMA 4AE1A 1DQKA 1MLBB 1TNNA 4Y88A 2ZUTA 1JCVA 1ZJAA 4PWFA 4G6AC 15C8L 3V0GA 4HWBL 5CBEB 4DN3H 1ZK5A 2EYSB 2X3CA 3U9PH 1BVNT 2HTKC 3VFPB 1AXIB 1XBRA 4U1LA 4JFSA 1EHKB 3QCUL 3RIFF 3MCYA 5E6IA 4X6BB 5DZLA 3GM8A 4IHOA 2WLIA 5IUCA 2DLTA 3P73B 3O8XA 1GOGA 1KCVL 1IE5A 2YN5A 4OD2A 2WWOA 3CZSA 4XHJC 4Z7WE 4FXKB 4WFGD 3LKNB 4FFVD 4WWKA 4P3WA 2VDQH 4PI0A 2BP8A 2XN0A 2YOCA 4JCMA 1IL1B 5AD0B 1A14H 5J8OA 4S1DC 1B6DA 1UT2A 4MZ3A 2M26A 1T66D 4L8CB 3E8VA 1AZUA 1SQ2N 3SGDH 2O4EA 4WU5A 3VB9A 1ZXQA 3P0VH 1MF2H 4PRIE 5KN5A 5A7BA 3OKMB 3DDGA 4F1SA 2A6JB 2HJKB 3HRZC 1CR9L 3S5LG 5E99L 3ZZ1A 1SRDA 2ZWYA 2CGRH 4NRZA 3QQDB 3ASWA 3VXPB 3CLWA 4OIAA 4N6RB 5FF6A 3WY3A 1PAMA 1AKPA 3RL1A 4HHAB 4X8JA 2OR7A 4Y16D 2V5SA 3K6IA 4HWEH 1H8LA 3VX0A 4IK7A 4YN3A 4QCIA 2EDEA 4JM2D 3RE0A 4MJ2A 4A2GA 2HTLC 1TYJA 3QUXC 5ESVA 3AT8A 2XTJC 1UACH 3NZHH 4PJ9A 4OU3A 4TUKL 5T1KD 4BE5A 2CO3A 1JRHH 5CU9A 2O1AA 1FFNA 2NYZA 5HHMD 1MF2L 4TV3A 4Y2DA 1I31A 1OT1A 4CN1A 1U21A 3X1FA 4AYDC 3Q48A 4P0DA 4QRQA 5KVFL 3ARBB 1UUSA 2DQJH 3D69B 3V0WL 4XO8A 1NLBH 2BVQB 3W0WE 4JCWA 3V8CA 3REVA 4ZQTA 3T0EA 3L5WB 4TLTA 1SHMA 1PJ9A 3BKCH 3IF1B 1MZYA 4OGYH 4BWTA 5LGKA 2ZONA 5DO2D 1ZA3B 3I84A 4W9JC 3EIFA 3MACH 4GAGL 4NKDA 1YEFH 2G0LA 3LKRB 4HWEL 3CN2A 3MNVB 3UBXI 2MJWA 3ILPB 2NZ9C 4OFYA 1UQSA 4JPSA 1T5XA 1XV8A 4OUOA 3B7SA 4QRTB 1GC1H 3QQ4A 3SCMB 2VAAB 4HUCA 1MCJA 3FQ1A 2J7LA 2NR6D 4P23A 4F20A 1CGVA 3GKWL 3NZHL 4K8RD 4KJWC 2GUOA 3HR5B 1JRHL 1JF5A 1ZD6A 2GT9B 3MGOB 3KPLA 3D3VE 3QCTH 4FG6D 3PWJB 1Q9OA 1V05A 4XAWL 3QNYA 4UANA 1ZSDA 4FFTA 5LGJB 1KTJA 3DSFL 1NDGA 5EFIB 3KXFE 1E9QB 3DHUA 5MEND 1OWWA 4PBDA 1NDTA 5E5UB 3BKCL 3LD8B 4GOSA 5MI0B 1E65A 2WLZA 2H47C 2MPAH 1OM9A 4JRLA 2VMEA 5DQJA 2J55A 3BLPX 1YEFL 1L0YA 5F6HJ 4AK2A 3L4XA 3DTXB 2J12B 4HUVA 3P30L 2FR4B 4QJ5B 2VM4A 3WUZA 5I1DA 2OJEB 5EF2A 4BZ1H 4D8PA 3UJTH 3WGUB 1MHCA 3VMOA 1LD9A 1T21B 4UQAA 4JY5L 2GTZB 3DOIA 1RUMH 1N7ML 4B97A 1UZ8A 3A6OA 1M7DB 3CN1A 4WI2A 3V4PH 5K69A 1H5BB 1D6EB 2ROYA 3KR3H 3QCTL 4NP9A 3A47A 4X98B 1MCEA 3DSNB 4JFPB 2HG0A 1FIGL 2HT3D 4PRNA 4M1DH 1Y1UA 3LNIA 3UTSA 1P84K 1Q9WB 1TQSA 4IOFD 1FLRL 2PTTA 3UBXA 4BH7B 4W9ZA 2W0PA 2EILB 4K7FA 5CSZB 3G6JB 3IGFA 1MJ8H 2WTRA 1Y07A 3GS7A 2DM7A 1H9VA 3IDYC 5EUOF 3UCRA 4JFZH 5D9SB 4Y16A 1RSYA 2OTWB 1WFNA 1B6UA 1D5XA 5CMAB 5GGRA 3UJTL 2YXMA 1INDL 3CU7A 2ICCA 1BIHA 1BX2A 1NCHA 4WFHE 4EOWH 2GSIB 1J9RA 2K3HA 3SE8H 1RJYA 2EXYD 3CHOA 3MBED 3ZZLA 1X5ZA 2ZTBA 3RGVC 4ZW6A 1UHVA 3PL6C 2VT0A 4Y4FA 4D9RE 1VZHA 4W70A 5ECJE 3LRSB 5I26A 3HBZA 4PSPA 4NN6C 2CUMA 3LVEA 4V11A 3IGAA 3CHQA 5CCJA 2YA2A 4XXCA 4AVIA 5ACLA 1FZMA 5CLYA 1J9TA 1TQUA 4MDIB 3RDTD 5C3LD 35C8L 2HJLA 3DBSA 3AROA 1FWXA 4RRPA 3VXQB 5I6XB 1M1XB 1I8KA 4PJEA 1IGCH 4OIIL 5IJDC 3M46A 1G7HB 3ZX1A 4DERA 3RL1B 4DGIH 1AS7A 1Q9LB 1PNCA 5T1DL 1N59A 1XD0A 4YZWA 5DR5H 4RA3A 4PJBB 1MW2A 3QRGL 2VISA 2F58H 3BOVA 4D0BB 5DEFA 4E68A 1KEGH 5BZWA 1MFMA 3RVTD 3OR7B 4QAWA 1F97A 2Q87A 5IR1B 2X1XR 4PJ9B 5KYYB 3KPNB 5L4JA 1FFNB 4YEEA 4TUJA 1C5DA 5JIDA 4Z6AT 3HB3B 3I6LE 4URTB 2VTFA 3OHXA 3T6WA 1C7SA 3EO1A 4ZS7H 1EHLH 1IGCL 2V2TA 4A6YL 2DMBA 2AEWA 3IKCA 2ZF8A 4E5XA 3C5SB 2AEIT 4O51B 2NQCA 4XNQA 1EERB 5GRYA 5HHOD 5DUML 2EIJB 1UD8A 3CFJA 1C8PA 2CKBL 1LXMA 5DR5L 5L6YH 2VUOA 4GG6F 1NLDH 3HUJA 1G1KA 2FNBA 5GRJH 4ZFOB 4EIUA 4TVPD 5AKRA 4F33A 3EO9H 5EEZA 2WB7A 5IEHA 2AVGA 5CO1A 1XHHA 5BXFA 3VXUD 3ETTA 1OARH 5F1OB 3Q8CA 1LDPH 3BPCA 2GUOB 5BQDA 3IMRA 2DEXX 4X5LA 4FXLA 2MCPH 4KTDH 4LAQH 2FSDA 4O2CA 4LCUB 4JBSA 2HUEA 2E3VA 4JR9L 1SJMA 2A74C 3VVVA 1SY6A 4LQFL 4BFRA 4A39A 2MSPA 3CBJB 3DUSB 1OF2B 4M7KH 3VCLA 5HGGS 4AEHL 1QKZL 4AYFA 4WNJA 5CCGE 3QEUB 1J8RA 5D7LD 4J2QA 3NACH 2VKXA 4HU8A 2PMZA 4YHPB 3N1QC 4H8WL 3VM5A 5FYKE 1OTUC 1BEYL 2WXNA 5LG6A 3PNWB 3TWYA 2V5TA 4QRRA 4CL7A 1JN6B 5L6YL 1P7QD 1IRAY 1NLDL 5GRJL 3U2SB 1FORL 1X9RA 1YN6B 4Z7VA 2AQRA 3EGSB 2QHRH 4NO0D 4N86A 4R9HA 3MRJB 2CPCA 4PV9A 2KZKA 2CALA 3BVWA 4B0MM 1ZS8A 3S97C 3L1OH 4MD5A 1T83C 5EN2A 3TJHC 1NGXA 1I8AA 2GBTA 3LN4B 3TTSA 5FW8A 3RDTA 3RQ3A 4YNYB 5D55A 4M7KL 5T1LA 4KTEL 1SLVA 4G43A 2H1XA 2QSTA 3I2CH 3QZMA 3ZDYB 4K7FB 1GYCA 2CA3A 4EAEA 5HDLA 4AXWB 2XA8H 2VLKE 4G8GD 1WHOA 4WI6A 2HT4D 1GSKA 3GXPA 3O2DH 1BW8A 1S9WB 2ZUQC 4WHYH 4A1RA 3RVXD 1X4YA 3BWAA 3U36B 3FUDA 2A9BA 1K5NB 4AYSA 4JM2B 4X7TA 1BLNB 1K8DA 1TQTA 5J1SC 1AR1C 2ADYA 5FYKU 4UT6A 5F89B 3FOLA 3BN9C 2HP4A 2JB5L 3G5WA 4QHLA 3V0DA 3I6GA 5A6IA 1UM4H 5T1KB 2H1PH 5AOKA 4ABUA 1SJHA 5HHMB 1A21A 2HH0L 4X6CA 1EJOL 1FPTH 1G43A 5B39A 3FUKA 1M7IB 3RKPA 4X6FA 5E2WL 1WICA 1ZT7A 4JN1H 3CVHL 3I2CL 5EOCH 2KI6A 3BUDA 3L3OA 2ZQKA 3GRGA 4IRSD 4RGNC 3GSRA 4YFDB 2XA8L 5C97A 5D2LE 5K9KB 1BWWA 4PP1D 1D2OA 3SGDI 4PS8A 5HHNA 5HHOA 1QSFB 2A9NL 1JNLH 2ZIDA 1SJXA 3K7UA 4NQVB 3BRGC 4O2FA 5C6WH 1BQLH 4XNBA 3T8VA 1IEHA 4I0PD 1CG9A 4WI9A 3ZT7A 5D72L 4RVBA 1FGNH 5F7KC 1L6ZA 3QULB 5F1IB 1KXQA 1X9LA 2CK0H 3SE4C 4B95C 2H1PL 1PEWA 4IIZA 3UBGA 6CGTA 3GPSA 3EJRA 3FN9A 1FPTL 3BPOB 4C4BA 1MW0A 4RMUA 1W6WA 3I85A 3LS5H 3DPBB 4AGQA 3O9WC 2JJTC 1CFNA 5DEFB 3NDYE 4KFZC 4GMTH 4ZW8A 1YQ2A 3TGXA 1PLGH 5MENB 3HN3A 3Q8AA 3PUUA 4IIQC 5D7LA 1YJDL 3SY0A 5AW6B 3UACA 2GB2A 2Y6SD 2YK1H 2R9HC 1KPVB 4YDVA 1JRHI 1PS3A 3N44B 4K55A 4P06A 3FFDB 3WSQH 1KNOA 5CCKL 3JZYA 2IOIA 4Z7OB 5ISZE 3ULVE 3DIFA 3HLAA 5I75B 3T2LA 2Q6WB 2E86A 3V9EA 5LN8A 1A3LH 2VABA 2HPOA 4L9LC 4NO0A 2CO1A 4MBRA 3F64A 3X11A 2CK0L 2AQTA 3MNWA 2FEDD 3OD3A 2NUTB 5E4AA 4QWWC 2E74C 1QA9B 4LHUD 4Q7DA 4NQXA 1T1WB 2CCWA 1BJ8A 1GRWA 1Q94A 4ONGH 2IALA 3VSQA 3CH8A 1JDAA 2IBZY 5IEHB 1XFPA 2XJKA 5FC9A 1KLGA 1XGTB 3KYNA 1Y0LA 4QT5B 4XOCA 1QBMH 5JPMA 4D9QD 4FXGA 4FHBD 3BPCB 3IU4H 4GRLC 1AXTH 3KWUA 1A3RH 4MZ2A 3RTQC 2ICWB 3PWNB 4F8TA 2QL1A 3MRCB 4O2CB 4IM8A 4G8GA 2X2JA 4DP1X 2XVGA 1EQWA 1IBBA 1SYVB 4GSXA 3QC6X 3T2OA 1IEBA 4JM4H 2J5LC 4L8SA 1LDSA 4Q6IB 3DUUB 4F9PC 3EYQC 3KM1A 1XMEB 2D3NA 2AANA 3RIKA 2F54A 4Z7UA 3X3FL 4LCYB 3VG9B 2B7DT 4ONGL 3MBEB 4IKJA 3CX5K 5F7LB 1HHKA 2D0GA 1B2WH 2Z35B 3WN5B 4GT7A 5I66B 1X5JA 4Z7WF 1DEEA 1TTGA 3SKMB 3S96A 1UUNA 1IAOB 4OF6A 1XZ0A 3IU4L 1JV2A 3IDIB 4RFNC 3HE6A 4LPUA 1OK8A 3NJFA 4IRSA 1ZS8B 1U8OA 4LCVA 2Q5BA 2FLMA 4X8GA 4E42A 3D0LA 4OW6A 1JWMA 1YNTF 2BXZA 2FQGA 3PNRB 4P3DA 2EDFA 4YK4B 4N8VB 5HHQB 2OX5B 1JPFA 4JM4L 1JWSA 4EJ1C 3FXIC 1HX0A 4FQHB 4FADA 4I0PA 1IC0A 2DWXA 5EA0L 3C6LD 4JPIB 2Z31A 1BMWA 3A6CL 1YYLL 1FZOA 1EIBA 4JFXB 4GW1B 2H6PA 1HHJB 1B2WL 1PCXA 1E5UI 2R0WH 2K9UA 4ZMNA 1K8DB 1SXAA 3MA9H 4XCCL 1MCNA 2QTVA 3UPRA 3QO0B 4RISH 3KNBA 2I9TB 2J8UA 3H4FA 2X88A 4L8DB 4H8UA 3OB0K 1P6FA 2BZ7A 3QVAA 4G9DA 4X6CB 1ZIBA 4XVSH 7PAZA 4ALAL 4G83A 1OAZH 2A4EA 8FABB 4OJCA 1IQWL 2CM5A 1HXYA 3AITA 4PHZA 3T4AB 2NY4B 4Y0GA 1WVZA 4P2QE 3WXVL 4H88H 4OCRH 2A0LD 1HQRB 2PPFA 2VDRL 1KY7A 2WMPA 3VAEA 3K46A 4BZ1A 3VGAB 4GRWE 4S1RH 4IKKA 5I74C 3PGDB 1BZEA 5F6IC 5F9JA 1GGBL 3V4PA 4U1NA 2ZNXA 2A83A 5HVHB 4LKXB 3MA9L 1SYSA 1LQBC 1GOFA 1UTDA 4IRJB 1SVCP 3QWOA 3Q01A 2AK1L 3VXUB 4BWUA 2AXWA 2O6PA 3FQ2A 1AG0A 4GEIA 1IGYA 2HMIC 1J5CA 4MB3A 4KI5D 5DRXB 3WEOA 5F21B 4G9FB 3NA4A 1DQJB 1OANA 2EVJA 3CLFH 2G3NA 4H88L 4HIXL 1NGWA 4BH8A 1XAKA 3GIVA 4BE6A 3HG1B 1MRFH 1HCZA 5D7LB 1E40A 1LILA 1DVTA 1U8KA 3NOIA 2VL5B 1LO0H 3HVNA 3ABKB 3KPRD 2WQAA 4NP4L 1JYNA 4X9FA 1R3JA 1P7QB 3LTVA 3DIFB 2YD9A 5E5RB 4EN3D 4FJ6A 4RLDA 4QXVA 1S5IH 1WAAA 2ZSWB 3PV6A 4JRXE 2VABB 2ESVE 4JNXA 4NO0B 2FJFA 2VRAA 3ROOA 4A7GF 3DROA 5CEZE 4WLCA 5JOPD 2XBTA 4AYBA 3LZFH 5GSVB 2FRGP 4NQXB 2ZOWA 3HZVB 1JSYA 1LTXA 4EVNA 3CDYA 2DKMA 1OAKL 1X4ZA 5BNXD 1CZ8H 3N06B 2ZAIA 3TA4D 3KJ4B 3P2DA 5C2BL 4YC2B 1LNUA 3KYNB 5E1GA 3NAAL 1Y0LB 2VLRE 2VSDA 3FQXB 3OQRA 5SX4H 2HG5A 3P9MB 4FXGB 2BFGA 4DETA 2DOCA 3T4YA 1KT2A 3AGVA 1LK3H 2HKHL 4JGUA 3TS8A 4FS0A 4G8GB 3MJ6A 4G2AA 4ZAKC 3NJXA 5EB9A 5TE6H 3OZ9H 5HI3D 3S36H 2MCMA 3PAUA 1NQBA 3PABB 4P46C 5HYSG 1U42A 5DFAA 4Q0XL 5HBBA 2FWUA 3ZE0B 3VTMA 2ZUUA 3B7YA 1JIBA 5DJ0B 3LNGA 2EVFA 4EI6A 1MW1A 5CP3H 4G42A 3Q8FA 1D5MA 3BIKA 3ZPDA 4C55A 1E27A 3WU1A 2EE3A 2P5EA 1CDBA 3KVDD 3NJHA 4Z7IA 1IAKB 2CLRB 2X0VA 2XN9E 3B9EA 1TZHA 4UDUA 4E9QA 1JWUB 1UCBH 1JV2B 3D18A 4HX1A 4WEEA 2Y7QB 3TBSA 1KCWA 3GHEH 4QRUA 4NNXA 1J1XH 3K71B 4K3EL 2EKSB 5HYIA 3QYMA 1G1YA 1KELL 3KYAA 3U30B 5DSCB 1KB3A 3ESUF 2WQRA 1JPFB 1A4KB 1HSBB 3AY4C 2Z0UA 3EYVA 5DK2B 2XZAL 2F8OA 3NCFB 3O6KL 4NZTH 4DP6X 4R97C 4GFXA 3VJ6A 4MVBD 2CO6B 3LOWA 3L2LA 3ISRA 4Z1PA 3MYJB 4O00A 5F2FA 3UAAA 1BZQK 4MB1A 3UO8B 3FT3B 1ACZA 1J0IA 5C0CD 2C26A 4JFWA 4PMEA 3BUQA 2X4PA 3RWGB 2OAAA 1GYVA 1A7BA 2L4OA 2J1YA 2EQDA 5E5MB 3BVUA 3DX9A 4P3CH 2OZ4L 3KNBB 2J8UB 4AL8H 4C8XA 3JBG7 2DQTH 1G0XA 3VD0A 4NKMB 3RFZB 4Y2LA 4E9LA 1X5MA 1UM5H 4N0UA 2PCFB 2QVKA 4X8XA 4EI5B 4EF3A 3KPRA 5INCB 2PN5A 1CE6B 1MJ7L 1OAUH 1JI2A 1X9UA 4UCFA 4FD0A 3K5SA 1P1VA 1QFUH 2ED7A 5DA4A 3AADB 3ES6B 4DEPC 6PCYA 3P11H 5SWSA 4EN3A 2BO0A 4NZTL 3B1UA 3K6SB 3B2XA 1QBLL 1CDGA 4XNZB 3P4MB 2E7MA 1S7RA 3X3GH 3OMAB 4MMZC 3L95A 3MRQA 1I9EA 1EDYA 2WLHA 4AUJA 2YQ3A 4LHUB 5E1AB 4ANWA 3LEXA 2FLRT 2YPLE 1BJ1H 1GGIH 4Z0BH 3CVCA 3LPFA 4IBLT 1V3MA 1WZKA 2OJ1A 5KYWB 2IG2L 5ANMA 3H6AA 3RB5A 4ANUA 5BZZA 1AHWA 3L45A 5K9QG 1ZANL 2X2HA 1ZGLM 4ZO6A 4CW1B 4KDWA 4ODUB 5JW4N 1CD1A 3KPQA 2NQDA 3GINA 1OAUL 3TF7C 1IAIM 3CFEA 5MERA 2F7OA 4MMXA 2NDFA 4NHCH 4UUJB 3VDCA 5D1ZC 2JJUA 4MAZA 3O2DA 5B7EA 4Z7QE 1PZ5A 1DANU 4M1GH 5E8OB 2H2SD 2YS4A 4Y5XB 1L5GA 1U33A 3F12A 2B59A 4UTAL 2OJZL 1R33A 3OJDA 4ZUVA 3KGUA 4KQ4L 1MREH 5L2JA 1UCTA 3FQUA 2LU7A 4DCQB 4GKNA 3C5XA 3PG2A 4C58B 1GY2A 2AEQL 2PCXA 3IMVA 3LKPB 4K9EC 1AZNA 1K2DB 4GH7B 2YUXA 1F4WH 1FG2A 3BUYB 3NSJA 5ITBL 5TF1H 4POZC 1FZKB 9CGTA 3KL0A 3UG4A 4KKBC 5KG9B 4GSQA 1UB6A 2C5DC 3IBOA 3JVGC 5D6DC 1EAJA 1WCBB 1SBSH 4EVNB 1HYRC 2GJZA 2AW2A 3D08A 3BLKA 1CD0A 3CNKA 4GAYA 3RWCA 1VF5C 1MUJB 3H6JA 1AFVH 1ZXKA 4L1BA 4NHCL 2X09A 3N55A 4YO0B 3G5VA 5KYXB 5TE7H 3C09B 1PZ2A 4DTGH 3T4YB 3C6LB 2R83A 4WHTA 1AS6A 3MPCA 1RZGA 2JXMA 3CFDA 3L3KA 1MREL 2R0KH 3NTCH 5DJCA 2LHAA 4M8QA 1IKFH 3WOVA 4GS7B 4I77H 2JELL 1CGXA 1WFTA 4PGCA 5DDHA 4Z7NB 5C0CA 1TKWA 4WFFD 1OB0A 1R3KB 4DP8X 3UZQA 1VGKB 1ZV9A 4K3JH 2CMRL 4NZJA 2XLLA 2ZWKA 1CJYA 4LSQL 1I9IL 3CLEH 4B9CA 3BIKB 2DY2A 4TRPH 1U3HC 3S37X 1FL5A 1ZTXL 4WVRA 1TZHB 3C9NA 3LQMA 3CFBA 4PJ7E 1BM7A 5TE7L 3UGUA 5HI5D 4GXUM 4BYHA 4NRXA 3IGLA 3QRBA 4XMKL 3WS3B 1T3FB 3EH2A 3DMMA 3ARDD 5DXWA 2ZKHH 3I75B 3NTCL 3EYSH 4L4TB 5D2LF 1A7NH 3MBXH 1CLYH 2ZOTA 3ZO9A 4EXKA 4F2MB 1ASOA 5H37H 5BRZA 1JZ2A 3MROB 4J3XA 5EZLA 3V95A 3WNJA 1F4XL 2QSQA 4I87A 4U1JA 3WEBA 3X1NA 5FO9A 5E6RB 4EIGB 1A65A 2X2YA 2DDQL 2DQUL 3DX7A 1WC7B 4OCWH 1S7UA 4QR7A 4ODTL 2NTSP 1EANA 1YA5A 2XIDA 4XXDA 2ZICA 4GBXB 4NKOA 2BSRA 3KYMB 3VH8A 1WTGT 1ZT1A 2R4SH 1MPAH 3FFCE 3BWUC 4ZG1A 4KY2A 4H0GA 2ZKHL 3OB0H 3QO1B 2OMYB 3KPRB 2QFPA 5DYOB 1TDQA 5GZND 3ARGC 3O3AB 4N0CC 1S9XA 4B53A 1H3WM 5GSRB 5LO7A 5KANI 1BVLB 3MFFA 4LSUH 5J89A 4PIBA 5L7XL 1DQDL 3ULVF 3ZQXA 2YEZB 4FLSA 5B1CA 3UTZA 1EGJH 4KKQA 1U41A 3CZJA 4J28A 4EZLA 1XGUB 2R51A 3ULUL 1Q1JH 3ARPA 4U1MA 3F04A 4JY6A 1TNMA 1CGSH 2C7UA 2ZJSH 1N5YH 4JDVA 1N2RB 1KIQA 4OD1H 4AX3A 1R0AL 3CZUB 5DJZB 1MY5A 1F86A 2HKFL 2VR7A 4Q9BA 2BIPA 5EUOA 2F19L 2Q3AA 3INUH 4F7MA 4KHTH 2ZOKB 4ZFOL 1CD1B 3KPQB 4AENA 1NKRA 1RUKL 2DTSA 3IXAB 4GW4B 5CINL 4L4VD 2YQ2A 1J11A 3ET9F 1R3LA 4YXLH 4LF3B 2WCSA 3GEFA 1OD7A 1J5IA 1CB4A 4K3GA 2E9JA 2X1PA 3FSAA 3F12B 1MH5A 1PEZA 2B59B 2WB1A 2ZXEB 4P2OD 2AS5M 1RU9H 4XO3A 1P7BA 5L2JB 4B9GA 3EJTA 1A1MA 1OGTB 3HRZB 3FQUB 3R18A 3MJ9H 3TXAA 2CBPA 4K71C 4WI0A 2E0PA 1P6AB 1T7VA 4V2BA 5DJ6A 3Q1EA 4OF3A 3KCPA 4HEME 4XPTH 2J25A 3KPMA 3ESNA 5CEYB 4DEUA 4F58H 2KLRA 1UD4A 1F8TL 1B0GA 5AVTB 1A6WH 1G7MA 3LPWA 2EXTA 1J8HD 4UAOC 1ZMYA 5CJ8A 4BWWA 4DH2A 4Z3GA 4UF7C 3ARDA 4RMSA 4YHNB 5C3IA 2P7TB 5H2BB 3BJLA 2AXFB 1ZHNA 3CJJA 3QUXB 1S2EA 3EJCA 1B4TA 2W38A 5IMLB 1FQ9C 3OC5A 5C0BA 1DDHA 3F85A 1THCA 4Q4EA 5I8CB 3HKZA 5DUBA 5SX4I 1U8MB 4LFHD 2ZPKH 4NPJA 3NEEA 1RU9L 3G5YA 4S1QL 2G4EA 1KCUL 2FYYB 5DWPA 3U4EA 3VI4E 3FAWA 5DI8A 5ENWA 5DT1H 4JFEE 3MJ9L 1EA9C 2EH8L 3FONB 3HJEA 1FNSH 2GJ6E 1A4JB 3HPLB 3TTYA 2ZSVB 2D73A 1WS7A 1H3PH 5IHUH 2JK5A 4ZOCA 4UZSA 3WFDH 5E4IA 3UZQB 3GEWB 1A6WL 4NQEE 1DBBH 3MKGA 4ELKA 4WW2C 3SPHA 2R29H 2X9WA 2B0SL 2IH8A 5IBTH 4FFZL 4AQ1A 5TPWL 3SD2A 1DCEA 2FVNA 1ZHKB 1MFAL 4ZQKB 4N8UA 3NABL 1BDYA 3J7HA 1LO3L 4YDNA 2Z6FA 2O30A 2FEEL 3UMTA 4H8HA 1MCWW 3QIUA 1OZUA 2OYPA 3QJTB 4AIOA 2EDDA 2Q86B 3TBVA 3WAJA 1RZIA 2BP0A 5IW6A 2BIOA 1ZEAH 3DX6A 1GAFL 1KIUA 1E6JL 1HILA 4GRWF 3U46A 1XGQA 1DQLL 3KPPA 3J27A 3O4OC 3OF6A 4JFYA 3QDGE 4TLUA 1H3PL 5IHUL 2C3VA 2LR4A 3P0YL 2VDKH 2OL3B 4B6ZA 4MWFB 2GSMB 2CDEA 4N2OA 4U4BA 3ZT5A 1KJ3H 4QLRA 3EYOA 2DWTA 1ONQA 1YNKH 4XXDB 1BQHA 5ESAA 2XT1B 3MRMA 2BSRB 1HDMA 5JIHA 4QWWD 4IJ3B 4PS4L 4LIQH 5I1HL 3HZMA 1H8OA 3OKLA 1M05A 2CJUL 3FQTA 4PJ8C 2DJUA 4P2OA 3UAFA 5IHWA 4MTMA 1ZEAL 5IY5B 5K93A 3V10A 1WHPA 4LRNL 4HF5H 4JG0H 2I07A 3CMOL 5CP3A 1CICD 1EAPB 2Z8RA 3HC4H 3RA7H 5LQBH 3U7WH 3AFLA 1FNEA 1A7RL 3IDYB 4UT9H 1FO0B 1CLCA 4LDCA 3T08A 3UTZB 3VXSB 1XH3A 4PV1C 3ZO0A 2A73A 2JTDA 2R1XA 3CXDL 1PZAA 1KJ3L 4X4XB 3QJZA 3H42L 2HX8A 4MJIB 4JDVB 3SPGA 2DW5A 3CDZB 5D96C 1KB9J 2HLAB 5EUOB 3CWGA 1N70A 4E9WA 1FL3A 4EIBA 1BFOA 1OKEA 2ZKMX 3D07A 3G3LA 2W60B 1MNNA 3FU7A 3MGAA 5FPIA 1U9KA 4GO8A 3ZKMC 1M1SA 5ETUB 3TF4A 2FX7H 3KLAB 2WNKA 3NJJA 4I9WE 4PGBB 3RVVD 5CZVH 3NCYP 4DN4L 3IPBA 5IBUG 1NBVH 4KJPD 2XC8A 1G87A 1RUPH 4BINA 4NN6B 4HEPA 5EOQH 5C0IA 5LVEA 3WEXA 3QZNA 2W65A 3O11A 3B3IA 4H1LG 5E94A 5TH2A 4DK5A 5TQ0H 2ITCA 1DJSA 1KGIA 3ZE1E 4MD0A 4N22A 5LAXA 5GGVL 4Q97A 1CXEA 3QI9D 5DD1H 5BOJA 5D4IA 2IWEA 3ABZA 3NK4A 2EICA 3VFWB 3DO7B 1WT5A 3LB6D 5DJ6B 1EPFA 4QHNB 5A2BA 1P7KA 4KXZI 4HWZB 3KPMB 2YUVA 3IBEA 4H44C 1TEFA 1CIDA 5GHWL 1B0GB 3CN4A 4FMVA 2ZX6A 4PRID 1VEMA 2HWZL 2H3XC 3ARDB 2E6JA 3AJ7A 1U58A 4GG8B 4N87A 1KTRL 1QLFA 2NSXA 1DBMH 1NBVL 3FQWA 4JHWH 4OGXL 5G5DA 5JNYB 2YAFA 1X5LA 4ZMWA 5EOQL 1V7NL 3O3UN 1DDHB 5FOBA 4ZMYA 2QGBA 1X7QB 5D2NA 2OQJA 4HLZG 4NXKA 2WNWA 2NY5H 3F7RA 1GMEA 2UZIH 3BZEB 1WZ1H 4XC1L 2ITDA 1WA1X 3G9VA 2GIMA 1EDHA 2G60H 1EAQA 2MIZA 2XN1A 4HDIA 2WXJA 2BMKA 5KVDE 4AT6A 3ZT6A 4PMFA 5EBMA 1PG7H 4MJ5B 3BHBA 5KVGH 1UM6L 2FHFA 1S78C 4N2HA 5EH1A 1T20A 2X4QA 4KJYB 5K1JA 4AV4A 4X4MA 3ARFC 5HSFA 1W80A 1F3JB 2VITB 3W0WD 1XB3A 3BP6A 4JHWL 3ROLA 3U48A 5KBMA 3L6FB 4O02H 1GL4B 2WAHA 2AJ3A 1MEXH 3TBTB 2F5BL 3U2IA 2H0JA 4IKIA 2NDGA 2GEEA 1DZ0A 1HQ4B 1WZ1L 2Z9TA 2XWJA 3BT2H 3CSYA 3GK8H 4QTIH 5EU7E 4GG6B 2ZX9A 1RZIB 4DVBA 2BP0B 3BGMA 3BAWA 2I5YH 2A74B 3ARRA 3GBMH 3DX6B 1C1EH 3CC1A 2WP3O 1IC5L 1NUDA 2EDTA 2FE0A 2NX5B 4TN9A 4JO3H 1X7SA 3IFNL 1HHHA 1EZUA 3HZYA 2EH7H 5LGHL 1MAMH 1R3IH 3LDBC 1C7TA 5EG6C 3TT3L 4MD4A 3GXUB 3D3VD 3DA0A 3D4YA 4PJGB 3HNVL 3UH8A 1NDMB 4M93B 3GXIA 1P4BL 2V37A 5A2FA 2TRYA 1M2VB 4NRYB 3D33A 4OIFA 2BWQA 2ZWZA 1QOKA 1ONQB 3KXFD 2IH9A 2WN2A 4H8PA 4L4VB 1B3JA 4AG4L 4L8BA 3WEMA 3LQZB 3QUZD 1NEPA 2WQVA 3QH3B 2C9AA 3HZMB 4P2AA 3I3BA 1DJGA 3B2VL 2P3YA 3BT2L 4Z7QF 2QQLH 2DQCH 3GBML 2I5YL 5G4OA 4DO6A 3MU3A 2QEJA 4ZZFA 2A5UA 1KN2L 1TQCB 5C9KA 3DYOA 2I07B 3B8YA 4JO3L 2NMSA 4HH9B 3MZTA 3LRMA 4HOMA 4I1PA 1R3IL 1F45A 2DQIH 5B1JA 2GVYA 4XN5A 5IESH 1L4IA 2X41A 4KV5E 3K8LA 4DZ8B 4EXPX 4U1KB 4ZTOH 1EHXA 1JZ5A 1GJWA 4P5KB 1OW0A 4X7FC 3GXTA 5D7KD 1OGSA 1W2KT 3U0WL 1MCCA 4DF9A 1J8HB 1NFKA 3IMUA 5EIQA 3U25A 1CQYA 1MCSA 3CV5A 1JZEA 4PY7A 2UYLB 3DUHA 3NN8A 1AR1B 4DOHB 3EYFB 5K39A 4Q58C 1HHIA 5HGHA 5I9QB 3PS6A 1VADA 4YE4H 4NC1C 1BFOB 4UOJA 5I17B 4A67A 5GGVY 1LE5A 4NO5B 3FU7B 4XXWA 4OZIA 5H37A 4BFOA 4M5ZL 4Y1AB 3U9UB 4ERSL 5CBAB 4YGVA 5DURD 4XOEA 1CN4A 2YUWA 4R96B 4WFHD 5GJSL 1SOXA 1AI1L 2W65B 3OM3B 4FP8H 4DGYL 3B3IB 3DGGB 5FA4B 4N2LA 5KUMA 5JYMA 2LV4A 3S8FB 3V5DA 1Z66A 4F92B 3DKHA 3Q06A 4IKNA 1GYWA 4G8IA 2OMUA 2Q8AH 2YC1A 4JVUA 1LK2A 1AD9B 1UH3A 4D9RD 3W0WA 5ABZA 1AO7D 2DQDL 2OXGB 4KK8C 4LNRB 5IQMA 5K9JH 5KSVA 5ANHA 1ND0A 2H8PA 3BPNB 2M83A 4PJ7F 4XWOC 4DK3A 5KZCD 3FB8B 4OM0L 5JIPA 1RJCA 3O9WB 1DQTA 1QATA 4JS7A 2WXOA 2YAOA 5IJKC 1EGJA 1LLAA 2G2RB 5G5DB 1R5VA 5HGDA 4LLMA 4G1MB 4JE4B 5FOBB 3D50A 2UZXB 4FP8L 5D2NB 5HHXH 4PJ6A 3T8MA 3L4WA 1F3DH 1F1AA 1KN4L 4JGMA 1UWEH 4H2CA 3W3BA 2W9EH 2XG4A 1PQZA 4QY8B 3D3VA 4TLSA 1FBIH 4V2CB 2XFXB 3BEWB 4LLVA 1RSFA 4OR1A 3O45B 2FWOA 2CGYA 2WYHA 4R8WL 4L9LB 3E3QE 2ERJC 3NESA 4DT2A 4PJAE 1G9EA 4OM1H 2FH8A 4YLQT 1FAKT 5DWUH 3HJ0A 5IV2B 4KX7A 2D9CA 3M45A 3I6LD 4HSAC 3KBHE 4YR6A 3B37A 5DHVB 1QFWH 1RIVH 4AIXA 1SJVA 1KXTA 2GFBB 1LYQA 5EIIG 4BGDA 4F7CA 3W5NA 1MHPH 2APWA 4A7GA 3SBWC 4GRLB 3T1WA 3SGJC 1WG3A 4P57B 1CICB 2OMTA 4NM8H 5E4EB 2ZUYA 2X05A 1HOEA 4HS6B 4ATWA 1S9YA 1VFAA 2WANA 4NNYA 3BGMB 3KE0A 2FBRA 4OIBA 4WWID 2B2XH 1E2ZA 2J5LB 4BSJA 4QXGH 3V9CA 4XZ4A 3L9BA 1D7DA 3N0AA 5D1XA 4K9JA 1HHHB 2E6QA 3DHMA 3ZR6A 4IGBD 1IJNA 3WDJA 3F65A 2AJUL 1EHAA 3GJEA 2ENQA 1HXMB 3RUGE 4OM1L 2VXSL 2VQ1B 5AB1A 2VQTA 3QB7C 2CHNA 1Q90A 5TDPB 4FFYL 4K2UH 3NFPB 3BWZA 1HNGA 4WO4C 3MDJA 2AV7B 2MNUA 2EYTA 3R19A 2V7NA 5I18H 4A2HA 5I73B 1IKNC 3QDJE 1JGEA 1U8IB 2WQWA 3J07A 3N40P 5DJDA 2PWDA 1BFVH 5FYKD 3WY1A 4KK9C 2P8PA 3H3PL 3FJTA 3MUGA 3H9YA 4OFPA 3RFRA 2WBWB 4Z7WB 3QI9B 4QXGL 2K45A 5DVKA 5CEZH 2VC2H 4WF7A 4R4BB 4JUTA 4OF0A 1QQDA 2R39A 2R29A 1E6OH 2P5PA 3R0NA 4L5FE 1AO7A 2HFGH 4AJYV 1YNTB 2ICWI 3EH1A 5FCSH 1KYUA 2H7WA 4PRIB 4Y5VC 2QGEA 1R46A 2X9YA 3M86A 2Q7AA 2XPYA 3D30A 1B4LA 1NCCL 2IQ9H 1JK8B 4MASA 1AQDB 1YNLH 2W8CA 3Q2CA 2WZ6A 1BQUA 7FABH 3R0MA 8PAZA 4OCSH 4LT7A 1ZLEA 3U1PA 4EE2A 5K39B 1ORSA 3QJVB 4KKNA 2WVVB 5DMIL 3IGUA 3NBNA 1BFVL 4WGKA 4GFTB 4MBOA 1FFOB 5JMRA 4BRVA 1B4JH 3V7MA 1HSAA 4NJAL 1JD9A 3K72B 3S88L 4BQBA 3VI4F 3HNSH 1SDDB 2VC2L 3QFJE 5J12C 5IK3A 3FO9A 1C08B 2R4RL 1NC4D 2PTVA 4TNVK 5GRXG 3NJMA 1ZV5A 3GMLB 5AAMA 5E00A 1MVFA 3MX0B 4WFEE 1OT2A 4N1EA 3B5TA 3FUEA 1BZOA 1FH5L 3TJEH 4QPEA 3MCKB 1RULL 2YC1B 2IQ9L 4FJZA 4NQDE 3IDGB 5FKPB 3MBWB 4APQC 1MWOA 3MLVH 3MLPA 5CILH 2GCYB 3HI5H 5T1MB 3OKOB 1LO2L 2P5WE 2BNRE 4KXBA 4PG9A 5HXMA 3EW3B 2R2CA 1DBKL 1PX8A 4WU7B 3FO2A 4LB8A 2OSLB 1JV5A 2VM3A 2C1PA 3VE0B 5IHZB 2IGFH 4KMTL 1V7ML 2D7TH 2XWEA 3EOTL 1E8ZA 4BDVB 4UT9A 1PLCA 1JGIA 4F8QA 2V6HA 1J5DA 2VW7A 1TT6A 4N2BA 3V0VA 2Q1EA 4L3EA 2K70A 2P42B 2JIXD 4JZJC 3Q44A 1H19A 3EOAA 4LQ1A 2VMCA 5IT2H 3UC0L 4KOBA 5T5FL 1BAGA 3HNTL 3ULAB 3DLQR 5BO0D 1J8SA 4ODSH 4PS7A 3TP4A 5IKCA 2V9TA 2JQMA 2I27N 3MLVL 3OZKA 3KXFB 4UV4H 5LCVA 4N9GA 4R2GD 4AVJA 5J13C 4OI9A 3TNMB 2N7AA 3QZWG 2ZKYA 3QUZB 5DMKB 2ZX5A 4YQXH 1GOHA 2IGFL 3LEVH 3T6ZA 5F0PB 1GZQB 1PF3A 2MQGA 3II3A 5CZXD 1AJ7L 1RFDL 2WIIB 5ISZD 3CHRA 3ULVD 1E7UA 1ESOA 1KPRB 4F7CB 4FQCH 3IAPA 1J10A 1SPDA 1T2QH 4HG4J 3MR9A 4NI3A 4X7CC 4G8FB 1TU2B 1U8CA 2OMTB 4PR5B 4WWPA 2R8SL 4X9HA 3L7FB 4XNDA 1YLBB 5L88H 1I8MA 4NNYB 3WUWA 4RQQA 4CC1A 4RZCA 4XP1L 1O9WA 2X6BA 4ODSL 5DHEA 5GS3A 3IETB 5EZIH 1CFBA 3P3SA 3KYOA 4LKCA 4KVCH 1S6NA 1GR7A 1Y6MR 2JI1A 1XCQA 2GY7B 1BPLB 2F08A 3KW7A 2Q10A 4ODVH 4RSYA 5GISL 4MNGE 1BFTA 1ADQL 4YQXL 3ARTA 3ZTCC 1CXIA 2J5WA 1ZJBA 3QHZL 3LEVL 4HAGA 2FJSA 4RGMC 4P4RB 4YIQB 2CLZA 1AYRA 1OL0A 3A67H 1MFDH 2UVEA 1UH4A 2H32B 3AG2B 4WV1C 5I1AA 4X4ZA 3GUTB 2V7NB 5ECGA 5KBKA 1T2QL 3TEWA 4K15A 4CNIA 1ED3B 5A16B 1I7TB 2PP8A 1YECL 1KGWA 2XWBA 5J6HB 1MJJA 1NC4A 4LARH 2HX7A 1S7VB 4LGSB 5LNEA 1M3JA 5MEQA 2P8PB 2NW2B 4I5BA 3VI3A 1P2CA 1RJLB 3KD4A 2X70A 4FQJH 4WJ5B 1P6WA 4E5XG 4CVWA 1TZOA 4U7MA 2QKIB 1JPEA 3IFOB 3MUHL 3SKOA 3ZE1F 4XBEL 5CGTA 3O4LA 5EZIL 5C0GB 1HCVA 1QQDB 1S5HA 4R97B 2YMOA 2AQSA 4HULB 3R06A 5MP6H 3VNYA 5CSGA 1ZT4A 4GINA 3WE6A 4O02A 4AQ8C 3HHSA 2O5XL 4N2AA 4QF1A 4HLEA 3A67L 4XBGB 1IGFH 5ABDE 4A2DA 3OMNB 3HRPA 1SJEA 4ZUTA 3WFHB 3Q05A 3QRFM 5SV3A 1NEZG 4JLRA 2DYPD 5KJ7E 4Y9EA 4FL4B 4NOFA 3WIHH 4YUEL 4ZOBA 4AGOA 2JIXA 4Z3JA 2LT9A 2EZ0C 4GQ9L 3HN8A 5FX3A 4M8UA 2F5AL 1N18A 2W81C 4RGOL 3JYCA 4LSVL 5IBLC 1HSAB 4N5ED 5BVJA 3FRUB 2EE9A 2CR3A 4U1IA 2I24N 4DEPB 5I2IB 2OSYA 4JFOA 3TFKD 4FNPA 4XPGH 2P52A 1ZWIB 4F7PA 1N8ZB 4HPHA 4UQ9A 4MMZB 1B4RA 5E00B 1OZTG 4YDJB 2CDFA 2FBJL 4H8VA 3V5KB 4A7UA 1IT9H 5AAWA 1EO8L 2V9UA 2EYRB 4N0RA 4OSUL 1T4KA 4PWKA 5DVMA 2KQMA 4P2QD 1BXXA 2GI0A 4KKLC 5E08L 2PETA 5AYUL 1QNZH 4FABH 2FX8H 4QYOA 4E41A 2Y7NA 1I8LC 3KMDA 4Y19D 5BO1H 3ZYJA 5I1LA 2A6DA 1Y6NR 3A22A 2Y22A 3WIAA 1DE4B 1U92A 1HN1A 2FQEA 4XN9A 5D1ZB 4CSZA 4PSRA 2H3NA 1OT4A 5FGBC 3V0VB 4A7TA 2WUCH 4UTBA 2VGLM 4EO5A 3ZUCA 2AQPA 2V8MA 4IGBB 5DK0A 1BVZA 3OWRA 5JPNB 5F70A 5FGSA 5CF3A 4JB9H 4DPRA 4F5CE 1JTTA 2XRAL 5GGUA 4YPJA 5JXED 3G5XB 3VW3L 3TO4C 5HPMB 4XCNB 4NO3B 2WYZA 4JVWA 5F71A 4NZRL 1OPOA 1X5YA 2A1WH 5C0FA 4P2RA 3NJNA 4QHMB 2OL3L 3H2QA 1NCDL 4W1TA 4XPHL 1T7ZA 2VQ4A 2W0FB 4AGPA 2BOCA 5BO1L 5FECB 2WGNB 1F1DA 1QW9A 5DUPL 4DJMA 3ARVA 4X7EC 1IGJA 2SODB 1U91A 5IIEA 2PO6A 1EMTL 1QFWI 2KDGA 3M6DA 4FYRA 4JRXD 1UXSA 2ESVD 3ALXA 4LSTH 4F3FB 5A2KH 3QUYA 2WBXA 1E4KA 3WD5H 4IW4C 1INQA 1YCSA 4F8OA 3BH8A 5CEZD 2YBRA 4PTTB 2XUWA 3FBQA 4RZCB 2CO2A 4KV5F 4MA8L 1RPQA 3FF7A 3U7AA 3O0RH 1NGPH 4CAGA 4U0RC 3IU3A 3P4NB 1EXHA 4XI5D 2XQYG 2VLRD 3TV8A 1T80A 2JJVA 1TXKA 3UAJD 3UPAA 1FO0L 3NPSB 2P28B 1BQRA 2JFCA 2ZUVA 4AM0A 4X6DE 3E80A 4IKLA 4PG2A 2VLKB 1RJZB 1ZVSB 2AJZA 2OR9L 4YAQA 2NQ3A 4KXAA 1PLBA 5JHLH 5HJDA 3V79C 4W9EC 2IDUA 2XWZA 3HC3H 4U1SB 3N04A 2BJMH 4CNIB 1YEGH 3SDDC 5DMJB 3WD5L 1UZGA 4C56E 1KACB 4QGTA 4ZS6D 5FYLL 3FT2A 3VWKD 1AANA 4WUUD 2OYLA 3WHE1 2MHAB 1JMZA 3O0RL 3QISA 2WXFA 4NKQB 2QSCL 5HYQB 2EC9U 2XN9D 2F53B 3FB6A 2XU9A 2ZXGA 4P2QA 2IH1A 3ZTJG 4CVXA 2VO5A 3EUUA 3K81A 3TZVC 2EDQA 3M1OA 2QJDA 3S5LA 3IDXL 5D2LB 1F6LL 3HHSB 3OHMB 3ESOA 4RIRA 4Y19A 1MAKA 1SFDA 4I18B 3RI5K 1AGBB 1UZ6E 3L17A 4TVSa 2VQUA 4AVKA 4ZUTB 5CWSB 3QG6B 3WJLC 4F91B 1Z5LB 5JHDD 4R3SA 2TRHA 4LEXH 5DS8B 1YYMH 2CRZA 2EIZA 1AYOA 4HXBH 1GA2A 1FC1A 4DPAX 1UWFA 1HINH 2VN3A 2Z64C 3AQZA 4H8WC 1IBYA 4JDEB 2X4RB 4JFOB 4FQIH 3AS3A 3GTNA 4KAQH 4WNQA 5IROC 4U6YA 5E9DE 1RCYA 1AZRA 2IDFA 4O2EA 3K74B 5T33H 3ZKNC 3OXSB 2BVPA 4ZYKA 5I71C 4J2XA 4PJAF 4PVLA 4KUZH 3JWNG 4Y9GA 2ICEB 5E9NA 1T4KB 2IANE 1CD9B 2PR4H 1N3NA 4R0LB 4CADB 5ISZB 3DV6A 1VGEH 4MNHA 4TQEH 3INOA 2LLGA 2Y1VA 4MS8C 5LN4A 2CBQA 3NT0A 2NOYA 4EUPB 2ESVA 4I0CC 4QYOB 1S4IA 2H26B 1IBGH 3QDME 4GAJL 3OAWA 4ZO7A 4B9ZA 2CBMA 3OV6A 1PKQB 4PLJC 1INEH 4ZFZA 4UBDD 3KEDA 3EG9A 2YPLD 1HINL 2ZXBA 1ORQA 3F5WB 4J3OC 2AI0L 5B7FA 4J3SA 5I15L 3TA3D 4ZMXA 1ITCA 1JE6A 3L3JB 3QHFL 3BQUC 4OGAD 2H3NB 4TULL 3DX2A 3VSVA 4L29B 2AJYL 4GKZA 4M48H 4MLSA 1JPTL 5F7DA 4O9HL 2VXUL 5T33L 3FF8A 3M88A 2J56A 4OZFG 4HZLB 4TOYL 1S7WA 2QPFA 1OLZA 2LFEA 3RUGF 1OP9A 5IM7B 5KW9L 3FQNA 3DO4A 5KVEE 3GD1C 3LY6A 1M56B 2ZF9A 3FO0H 1S7QA 1FFPB 1PTZA 4NUGH 4PJCA 4IJTA 1EXGA 5E95B 4DPBX 3UIYA 2CO7B 2Y23A 4ATTA 4UAOB 4X5QA 1K4CB 4OUUA 3VQLA 1CU4H 3T2NH 4WUUA 4X0NA 3BZ4B 3KJ6L 2C3XA 3BH4A 3WFBL 1SVZA 4HIJB 4PJHA 3TV3H 1OCOB 3DJTA 2XN9A 3RIAK 5JHMA 4M48L 5ID1A 3T0XA 4XH2B 4PRDA 1INQB 1BD2A 4N0YL 4MFHA 5EEVA 1LVEA 2N59A 5DRZA 2IFFL 1IBDA 2D31B 5L0QC 5IW1A 3EDFA 1M42A 3GIZH 3MV01 4U05A 1E4XH 1GJUA 1SXZA 2B77A 2XXFA 3MRRA 3C6SA 1UXWA 4X6EB 5CKAA 3T0DA 4NUGL 2DYPB 1GMIA 1KJMA 4AM0B 5F1NB 3AW5A 3P40A 5JHDA 3IN2A 3FRPG 4L3FA 1CU4L 1UA6L 3O3DB 3OAUL 3T2NL 4Z3IA 1FRGH 2YMXH 1J1PL 3L9EA 1MCFA 4FG4A 3UEZA 3T0EE 3NIDE 3TV3L 1WBXA 2WXMA 4DZBA 4L3CA 3MV9E 2BVUA 3BSZL 2G2NA 4FOMA 1QUPA 4N3UA 1G9HA 2Z7UA 5CHNA 1KTBA 1NOAA 2NTFB 4FMFA 2ZWLT 2BM3A 4OJFH 5EU6E 5HYEA 1ZLSL 4XPFL 4NQCA 3U6XA 4S0TD 4XPBH 2BZDA 2J2ZB 2UXFA 4H20H 2Z0BA 3L4YA 3O4OB 2CIKB 5E6SB 3QJFA 1I3RA 2P8MB 1HOCA 5CIPB 1WQVT 3S5LB 4Z3FA 2HA1A 4PREB 4GRWB 3AQXA 1MIEL 2QV2A 2UY7A 4PI2A 1FRGL 1AS8A 5CD3B 4FG0A 3PXHA 4GQRA 4MAUL 5C09B 3VXTA 1XR9B 4JJ5B 5AZ2L 3LQAH 4R3SB 2VZSA 5C0EA 2BDNH 4YDIH 5I6KA 1YEIH 2F7QA 2PCPA 3WLBA 3AGWA 4ESKA 2IO5A 2VR6A 4D2NA 1LWRA 3PWUB 4PP2A 5BZXA 1X5KA 4NSKA 1FDLL 4PGEB 3VUAA 5FYJE 1TTRA 3OX8B 3AG3B 4NNPH 1XCTA 2HSIA 3FFCD 5H35A 3K91A 1KC5H 2FJHA 4OZ4B 3CHPA 4ZYKB 4YSCA 3FUJA 1XR8A 3BO8A 4HETA 4MQTB 4EQ2A 5CJ5A 4HXAL 4X99A 3UTSE 1B0RA 4ODHH 2YXVA 3KCWA 4NERA 4OFDA 3RNKB 4U2ZA 2XX0A 3PCYA 4JFQA 1CS6A 4JRXB 2ESVB 3VFRB 3PHAA 1T5WA 4JJOA 1ASQA 2EDWA 4ZPVB 1AGDA 2Z4TA 1X5AA 4BUQA 1JCKA 2Q76A 5EBLA 3GZPA 1HCFX 1MRCL 3K1KC 4F57H 1AQKL 1HAWA 3VTAA 3H85A 2IADA 1AR2A 2IV9A 1G7LB 4OCYL 4HSCX 2CO4A 4GXFA 2BVEA 5E2TL 4L18A 5AZEH 4R4NC 4I3RH 2VLRB 5DZPA 4GKZB 3ZRSA 2KPNA 4M4RB 1DQQB 2GY5A 3OSKA 3NFNA 2KH2B 4OZHE 2PUQT 5E8DH 2OP4H 1L9TA 2DLFH 3GJFK 4XNYL 5CGBA 2F68X 1FSKC 2QPSA 3WIHA 4GIOA 1WUZA 3BGFB 3FQNB 1MQ8A 1AZZC 2VW4A 3QA3A 1A6ZA 2X1QA 4ALAC 1ZVNA 3SQOL 4FHJA 1A6VH 1W0VA 4J3OG 4LLQA 4L1TA 2FX9L 4MA1B 4PV8B 4WY7L 4JG9A 4DKEL 1AC6A 2W88A 1X9QA 2YD1A 5DTFB 1KYFA 1Z5YD 3BXNA 3VWKB 1ET7A 2DN7A 2F7RA 4YHIA 3R4RA 4YSEA 2YGOA 4PJEE 5DMGD 5HTSA 4KHXL 3UTTA 5D4JA 2XN9B 4FNTA 2NY6C 5ID1B 5DJAA 1K85A 3SDCC 4HKBB 3FUMA 4JEGB 1DANT 1Z9OA 2Y07H 1UKSA 4Q9RH 1L9NA 3RYMA 3B9KD 2QVIA 3KWWA 4QRSB 3VD3A 1UT1A 1G9ML 3UTQB 1FVDB 3ZTEA 1RLBA 1AH1A 2OK0L 5IHHA 1UXWB 3GGWB 5T8IA 4MZRA 1Q38A 3VWJC 1PNDA 4F37F 4RMTA 3HS0A 3SDYH 3E6FA 5BZDB 4HV8B 5AQ0A 5J0BA 3CN0A 2CJ3A 2ZKXA 3DRQB 4JREC 1OOAA 4JFED 3G08B 5DJXB 3C5ZC 4ZUWB 1Z3GH 3HE7C 3MV8E 5AW2B 3WHE0 1VIWA 2GJ6D 2YLKA 4LOVA 4C47A 4L3CB 2Z7WA 5G4MA 4UQ3B 1HHGB 4MAYC 5FHBH 4NQED 4U6VL 3FFCA 3EJSA 4JGNA 1NPNA 2WXIA 2V3FA 2XVLA 3RWIB 1W72H 4FQQB 3HUJE 2BLFA 1YY8A 3B43A 1WTLA 1TYEB 3GQFA 5J6SA 3OKNA 4RH4A 3RY6A 3IRZA 3UFIA 1BZ9B 1TPXC 3GSWB 4C4KT 1QACA 3QJFB 5L2KE 1KWGA 4PWEA 3AREC 2DTMH 4LSRH 5EO1B 2F8IA 1NICA 1MVUB 1TZAA 2BIMA 1OPGH 1UATA 3D85D 4NN7C 3C8KB 2YPLB 3DJSA 5EMYA 3IAQA 3RGVA 2BP3A 2PW1A 1D2PA 4JPWH 3PL6A 4P2YA 5AKSA 3TA3B 1CQKA 4PRHB 5F8RC 1V5JA 3QDGD 4B9IA 3QFGA 3ZL4H 1I1AA 4GUOA 4XCYA 1KG0A 4IHBA 3BUIA 2HFEA 3MJ7A 2Y7LA 4QRRE 3ZN6A 1FYTA 5ELIA 1NGYB 3K0WA 1IBZA 3MLUL 5DK3A 1JNHA 3BC9A 5FUOL 4MCYB 4Z7VE 4GMSH 1CF8L 2ADJA 3ESPA 5F9WB 5JHLA 1C5CH 3UGXA 4Z7QB 3VG0L 4LLYA 3HI6H 4XMLL 3ZDZE 2UX6A 1T0NA 2FJHB 5EU3A 5J1AA 3QJHA 1FFQA 2R69H 3WV0A 4AJWA 4UQCA 3QPQC 1F2XK 1B0RB 2V5YA 3H7LA 4U1HA 5AW0B 4OLYL 4M9OA 1IFHH 1RI8A 4JFQB 4MMYB 5IB5A 4LU5H 2OXHA 2PWEA 2APSA 1EH9A 4ZFFA 1SXSA 2VXTH 1L9RA 4GEJA 5EBLB 5GRUL 5BV7C 5GZOA 2X4NA 2XZQH 4BUGA 2QZQA 3L9RB 4UQEA 5GS0D 3DETD 4X5XA 1PD0A 3BRFA 3BD3A 4NQTA 3WHXA 5JQ6L 3GLDA 2J73A 3UYPB 3TEYA 4B7IA 5CEXB 3D6GA 4XC3H 1MSPA 3HI6L 4MDRA 4PGDA 3GXDA 3RY5A 3K2UH 5IB1A 1QUNA 1YPZA 1U8NB 3FTGB 3W57A 4TTDD 1JZIA 3WMPA 4X6DF 3SPVA 3GRWH 5EPMB 1ES0B 3UTOA 1VACA 4I9WD 4JQXA 1OE3A 2ZOLB 5E8PA 7CGTA 4JFEA 5AOJA 2LU3A 1IFHL 2GJ6A 1MCHA 1RZKC 2EKJA 3OGCA 4WDIB 1KGUA 3COOA 5DEGA 5I5MA 2GK2A 2XV3A 2ATPB 3F58L 3PWPE 1CMOA 4HJ1A 4GPVA 3BDYH 1J48A 5HYJA 1FFRA 3APMA 1NFIA 1A25A 3RKDC 5SWZA 4X0KA 2XA3A 2YKLL 3EOBA 5E0FA 3ARBC 1RMFH 4KK6C 2UVFA 1A9BA 2JE8A 2GITA 1NM4A 3IFLL 2NXZC 4OV6F 1KXHA 3VXNA 3EFOA 4LASH 4PJ7B 2AXJA 3GT6A 3CZNA 4NJ9H 4XCFL 5DUJA 4GUCA 3U83A 1GJIA 4PWIA 3GMNA 1F90H 1CGUA 3QXUA 2ADGA 4JN2A 1OCWL 5F7WC 3V0AC 3D85A 3U6XS 2EVHA 3SKNA 2DQEL 2VDMH 1UZ6F 5DJ2A 3QUMH 1FVCA 3QDGA 1OSPL 3HS0B 4X42A 2W07B 5FWRA 3BDYL 5E8NA 4OFVA 3VGBA 4ZUUB 1I3GH 2ZT9C 3HMWL 3DVIA 3RZCD 1MIML 2IQAA 3KZ8A 2Q8BH 4ZJ9A 1J0YA 4OI8A 5IFAH 1RHFA 5T3ZH 4JG1L 5JORB 1FZJA 2BX5A 3LD8C 5MI0C 3FFCB 4QTFA 2XQ0A 4EDWH 1XB8A 5E24E 1E28A 1ZHBB 5TDNB 4XNXH 4D94A 5DVNA 1IVLA 4PWGA 2LFGA 5KANG 3NMEA 3S3SA 3LS4H 1S7TB 2ADFL 2BNQE 1MNUL 5GRVL 1JXKA 2Z4QB 2Z1KA 1E3XA 2O6CA 4G6MH 3LIZH 5E2UL 1HL9A 2EIKB 3BCFA 2AABH 3FSZA 1R5WB 4WK0B 4K9EH 4QTHA 3ZJAA 1RIHL 3WE1A 1EEYB 1WO2A 1YDPA 2Q8BL 4PY8J 5I6LA 2AMGA 1J1OH 1D6VH 1JGDA 5T3ZL 1RUQL 3DVGA 2F54E 4Z7UE 4LLUA 3HAEH 1NC2D 3EGDA 1VHPA 5C7XH 5EO0A 1I1YA 2HFEB 4YSOA 3RAJH 2MTAA 2BNUA 4XNXL 5T3XH 2DAVA 5ITFA 4JHBA 4AGMA 4GKOA 1A7OL 5ACZB 3WNIA 1IE4A 1U93A 3VDAA 2K6ZA 2OMVB 3FU3A 4Z76B 2QTEA 4KITB 4YGAB 2OYMA 2OTUA 4ZNEA 1FI8C 5E6IC 3X1EA 3SE4A 1BVKA 2M1KA 2WY3B 3O41B 3O8XC 4K9EL 1IC7L 2G5RA 1FF5A 4HS3B 1U8HA 4FC3E 1F1GA 2GK0B 1PZDA 2HT2D 2MQ3A 3VFTA 1Y7VA 4P04A 5IQ9B 1T4WA 4WWKC 2JJTA 1HI6B 1Q72H 2BCKA 1RUAL 3QEGH 1NPUA 4NS0A 5FYKL 4EZKA 3FQRB 2R1YA 1PU0A 1VDGA 2ENSA 5HGAB 5FO8A 4IIQA 2ZUWA 5D6CA 3RAJL 1L9OA 3ZIMA 5T3XL 2G0KA 2JF1A 3RJOA 3TBWB 2HXAA 4QXTA 4CSTA 5AG9A 2ZAGA 3B9KB 2XX1A 1IAIH 5J12B 5IB2A 4ELMB 2BOBA 2FIKA 1CFQB 3FOMA 2X7LA 2AITA 4K94H 4GI6A 2CLVB 1IC4H 2X53A 1RV6X 5A7EA 1BQHG 2QPUA 3P4OA 3O6FD 1JGLL 5IB1B 1XH2A 5ICXB 4P4KD 3O6MH 1FG9C 2EO9A 1DBAH 3MOAH 1XXDC 3VI4B 3N3EA 1A4CA 2V8LA 1P4LA 2UUDH 1PG7W 3SPVB 3V9FA 1VACB 5HYSA 5IFHL 3GJFH 3DRTA 4APQB 3QUKB 1AE6H 4KROC 4KRLB 3O2VH 3RZCA 4TL5A 2GJ6B 4P9ML 3TO2B 4W9HC 1CL7H 4O58H 4NEHB 5IGXL 5HHPB 3NIDF 1ZCRA 1ID5I 1EFXD 4NBZB 4PJ9C 1OO2A 1EJ8A 3RTQA 4NQEB 4ENZA 4Y2DC 1XSIA 2W9DH 3V6FA 3TN0D 3CVIL 3EOBB 3HB3C 2IWFA 2RFXA 3X1GA 1HAUA 4WWNA 2FIRT 3GBEA 3IYLW 3F7YA 1T0MA 1K72A 1Y1DA 2XG5B 4HQQH 4NWUH 2WZAA 4YPGB 4KH9A 1GHFL 2Q7YB 2H3KA 4W4OA 2AJXH 2YD0A 1HH9B 1A6AA 3M7FB 3ARSA 1RZ8B 3O6ML 2PWHA 1VFBA 3LKQA 4WCYL 5I1EH 4LLWA 2ADGB 1RZQA 3ZHDA 5K9QI 5IB3A 3Q13A 4WUKL 3PJSA 2WXGA 3JVFC 2QGCA 2EE0A 1RK1B 2KT6A 2XNAA 1VKXA 2AAVA 2WLNA 4MB4A 1U8JB 3EBHA 5SX5K 4JO4H 3WKQA 2VZUA 1CL7L 3MA7B 3UOAB 2BVOA 5A6LA 4G59C 1HS6A 3FZUC 2JKXA 2F15A 4H1LH 5DVOA 1SN5A 2R23B 3T5WA 4DKDC 3FU0A 1FH2A 1EO7A 1NC2A 2R2HA 3Q3GA 2W9DL 3L3DB 3FW6A 4F8NA 2FGWH 2WXPA 2WINA 3BDBA 3B2DC 4WI3A 1U8PB 4GKSA 1EBAA 2R1WA 3RHWF 1LJMA 2OPCA 4OZGE 3MRKA 1RHHB 5JR1L 3CFKB 4MJ4A 3WL9A 3W39A 4K23H 3Q5TA 4TF4A 1VLXA 1Q9KB 5IJVA 4YX2H 2RCSH 2YPKA 1U3YA 3QXVA 1KJ2H 4AMKL 4MXQD 4M7LH 2RALA 4PRPA 1XEUA 5IQOA 4KDTA 3TBYB 2WWKT 3MNDA 3BSHA 4FFVC 1LWHA 2W94A 1MCWM 1KBPA 1BV8A 2B3RA 4P9HC 1AP2A 2YXFA 4HLZH 5LGYA 1T66C 4X9IA 3SGEH 2XWTB 3MCLL 3ULVL 4N2KA 2YLHA 4DK6A 4QUOA 4X5WA 3WFZA 4U2YA 4FTVE 2LABA 1BSIA 4LLUB 5IZ7A 4UM8A 4FNLH 1N4XH 1SEQL 4GXVL 2Z92B 4XN4A 4K23L 4HCRH 5HVGB 4XGZB 1JHTA 1DUZB 3CC5A 2V4LA 1HZHH 1RZ7L 2RCSL 3D9AL 3N42F 3Q2NA 4LPTA 4OZHF 3KAAA 4ENED 2PW2A 1YUHB 4NKIH 2P5EE 2B4CL 4Y16C 1WWWX 4WI4A 3UO1H 4I48A 3PDDA 2VWEE 2ZG1A 2WO4A 1OSYA 4JO1H 3QDJD 3NUKA 1UXLA 3L08A 4JM2C 4LZKA 5JW3H 1MFBH 1S7XA 3MMEA 4IEFA 4TNWK 5FAAA 3GSUA 3ZE1B 1WIUA 4P5TD 1EFXA 1XGYH 2HFFB 5FKAB 5B4MD 1L0PA 1BREA 1MDTA 4PB0H 3H0TB 1GZHA 2I32A 2OS7A 3QXAB 3TN0A 3CE1A 4G80A 5GGTH 3CDGA 2IWGA 2ZE0A 4WTXA 1CDJA 1W72A 1E5CA 3BAYA 4FNLL 1N4XL 1DLHA 4PJEF 2IXQA 2R1YB 5M7QA 5HDRA 4GLRI 3S37H 3T04D 4XP4H 4XXCC 3EO0A 3AXHA 3SSGA 4Y2OA 2VZVA 5DO2C 1YEHL 3NZ8A 1KBKA 3OKEA 4XP6H 3S3CB 4XNMB 3UP6A 2L7UA 3NSDA 3FOMB 4U7KA 1G9NC 5CLXA 2XJLA 3E8UL 3OKDB 3P4OB 2NR6C 3ATDA 2BRRH 4K8RC 2NNAB 1OTTD 1MCPH 5HYSB 2D8KA 3UERA 3VYOA 5JA8B 4FG6C 3BPOC 3W1ZA 2VIRA 2B5IB 2O61B 5AVWB 5GGTL 5FW7A 5SWSE 4HK0A 4R7DA 2BWDA 2FATL 3BVNB 1QR1A 3RBSA 3DECA 4WFED 2FJUB 3MRLA 2NY2D 1IGIL 4PJAA 4R7VA 1AQ8A 3ZRCC 5I1KL 5JOPE 2XOTA 5LXGH 1GS8A 3O3EA 4RWHA 4NQDD 1SZNA 2A9ML 4ZAKA 5FFLA 2GC7C 4QO1A 2RFXB 3K8KA 3ZTNH 3LZRA 4R7NA 2QQQA 2R69A 3V4VH 3HUJF 3MUZ1 4H0IA 5I75C 2P5WD 5ANME 2BNRD 3G9AB 4G6KH 2APBA 4J3WA 4P46A 1BBDH