2X0WA

Structure of the p53 core domain mutant y220c bound to 5,6-dimethoxy- 2-methylbenzothiazole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
195
structure length
195
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Toward the Rational Design of P53-Stabilizing Drugs: Probing the Surface of the Oncogenic Y220C Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 50
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2x0wA00
3D05A 3KMDA 2BIQA 3Q01A 2BINA 4G83A 4AGMA 1GZHC 4IBZA 1IO4C 2XWCA 3WTSA 4MZIA 3TS8A 4IJTA 4AGNA 1CMOA 1T4WA 3IGLA 2J1YA 3D06A 4A63A 1TUPA 1YCSA 2GEQA 2J1WA 4GUQA 2AHIA 4IBWA 3KZ8A 4G82A 5AOJA 4XR8C 4AGOA 5LAPA 4LOFA 2RMNA 4AGQA 5A7BA 3WTWA 2ADYA 4IBSA 3US0A 4LO9A 3Q05A 4HJEA 3VD0A 4L0YA 2IOIA 1H9DA 5ECGA 2BIPA 3WTXA 2IOMA 2VUKA 1CO1A 5KBDA 3WU1A 4QO1B 1HJBC 3US1A 3EXJA 4IBTA 1HU8A 4L18A 3VD1A 1EAQA 1UOLA 2J1XA 4GUOA 4MZRA 5AOKA 4L0ZA 2J1ZA 5BUAA 1EAOA 1LJMA 2J21A 4KVPA 4AGLA 1HJCA 3WTUA 2ATAA 3WTVA 3VD2A 2FEJA 2X0UA 3QYMA 2AC0A 5AOLA 3D0AA 2WGXA 1KZYA 1EANA 3D07A 2YBGA 5AOIA 3QYNA 2MEJB 2BIOA 2X0VA 4AGPA 3EXLA 5G4OA 5AB9A 2XWRA 2H1LM 1GZHA 2OCJA 3WTYA 2BIMA 5G4NA 3D08A 1E50A 2J6WA 4IBVA 5AOMA 2IOOA 1TSRA 2J20A 3ZMEA 2PCXA 2P52A 2X0WA 4IBYA 5LGYA 3IGKA 3Q06A 5G4MA 4IBUA 3D09A 4IBQA 5ABAA 4LOEA 3WTTA
chains in the Genus database with same CATH superfamily
2H8PA 4PV1C 5FHBL 5FYKD 3HBQA 4X50A 3CQQA 3QI9D 4HZ1A 2F7OA 1FIGH 3I3DA 3GGWB 1ZV5A 3ZHKA 3ELQA 4KZEH 4LNRB 1LVEA 3KS0H 2K9FB 5C0FA 1BM7A 1N18A 1P7QD 3RX7A 2CO4A 1LNUA 4HJTA 5F7AA 1AGDB 3CH8A 5DURB 4MB1A 5ITFB 3K4AA 3WBDA 3ZSTA 5FDWA 3WCYA 5D5MF 3T3PE 4FMFA 1WS8A 4LIQE 5DFWH 3NBNA 3IPEA 5IB1A 4O9HL 5E9DA 4QY8A 1MAMH 3ZTJH 2YAHA 4KK5D 5FF6A 1XGPB 5IQLA 4PJGE 4PQXA 5TH2A 2Q8BH 3G6DH 1O75A 4U05A 4LSVH 3L3HA 5LCVH 3RBSA 4JJ5A 4HKZA 5EN2A 2ZUXA 3STLB 2BIPA 3SDAA 1SLVA 4OLUH 1M6OB 4OZHF 2R2BA 4X6DE 4JPWL 2NDFA 2WP3T 4PJIA 2CWRA 2W60A 4TRPH 3FTZA 2J25A 3QO1B 1NLDH 3BSZA 1KIPA 2N59A 1SXBA 4U7SA 1HHHA 3RVTC 3HN8A 3AM8A 3DROA 3GMQA 3QIUC 5DJ8B 3Q8EA 3EH2A 2BVEA 3GSQB 1F6AB 3UADA 3ZR5A 5HGDA 5C07E 2ERJC 1D7FA 4OBSA 3RUGB 5BOZG 2KERA 5CP7A 1PIFA 4QI3A 2XWJB 2OJEB 1O7VA 1JMZA 4L8SA 3V6FA 2NY5C 5DLMH 3RY5A 3H9HB 3X1BA 2GSGB 4RMQA 1K8DB 5EO1B 3U46B 3GXMA 3ARFD 4B5ZA 3NUKA 1C7TA 2XN1A 2NSMA 1KV3A 1P1VA 4BQCA 4Q9QH 1LEKB 3VGHA 1W0VA 1MKFA 4F7PA 2MNJB 5KVDH 1BWMA 1A22B 4U2YA 4MNQD 3QUYC 5JXEC 1WA2X 2HA1A 5T1MA 4ZSOA 1WS7A 1YJDL 1OCWH 1AD0B 2WXGA 4HOXA 2CAKA 3WNMA 3GZPA 5AZEL 2FSDA 3SJVB 4LNRA 4U33A 5JHBA 1H3UA 5EEZA 1AGDA 4PRDB 3JWOL 4XOCA 1FDLL 3DGCR 5ITFA 4G8GD 4HOMA 1LYQA 2E7HA 2W9EH 5JDJA 1I9IL 3GLAA 5D1QB 4ERSL 1KC5L 2IV9A 2P24B 1Q38A 3TBSB 2EC8A 4S1RL 2LU7A 3P30L 4KRPC 4Q0XH 2HUHA 1TJHH 1U3HB 1XGPA 1GR7A 2GY5A 1BD2B 3ARGC 4BCYA 4FZ8H 4K3HA 3MJ8B 1Y07A 4YLBA 1ZAGA 1SXNA 3L08A 3NEOA 3S96B 2VXTL 3SE8H 1M6OA 1OF2B 2E76C 3L9EA 1EV2E 5I16B 5JLZB 3QO1A 4XNMB 4X6FB 3V0VB 2I85A 3SEPA 4PCKA 3TV3L 5LG6A 2HTKD 3C5SB 3VG0L 4K8RC 3UTZB 2HUEA 2ZYHA 5DJ8A 3GSQA 4LOFA 3SKUD 1F6AA 4X9HA 4CNIB 2D7TH 1A3QA 5T5NG 2R2EB 2NY3D 4LHUB 1YEJL 2GY7B 3LKNA 3MBWB 4HCIA 5CP3A 4EZJA 1T1WB 4Z7WE 2OJEA 2FSEB 3T8VA 3ARDA 4N5ED 3HMXH 4LU5L 3H9HA 5D8JH 3KR3L 2GSGA 3CN1A 2IAMB 2XOTA 1K8DA 2FJHB 4HT1L 3U46A 2XWXA 1K6QH 4K2UH 1TJMA 4DPAX 3ARED 1M7IB 1CK0H 2HX7A 1WD9A 4P0DA 3W2DL 1LEKA 4W6WB 3X14B 5E5UB 3AGVA 1HOCB 3EBAA 1H3VA 4IEFB 3WN5C 3A6BH 4U3XA 4LLVB 4L4TD 2VDOH 4NUMA 4MBOA 5BUAA 2N0KA 1A1MB 3L4VA 5EEVA 1R47A 1KXQA 2B15A 3WFEH 3ZDYB 4HPHA 1TZGL 3O4OB 4P04A 1AD0A 2BFVH 3M1CA 4PJ6A 1WUZA 2B3IA 4P4KD 3II3A 3ULVD 3SJVA 4KV5F 1T7XA 3SGJA 1EXUB 1DJSA 4PRDA 2VDMH 4FP8L 4X6BB 4QHKI 3FOLB 3HLKA 3EGSB 1ZOXA 3QUHA 1XO8A 2YKKA 5JNYB 2IQ9L 5BS0B 5D1QA 2A2QT 5KVGE 4FADA 2P24A 1EMTH 4AH2B 1TQBC 1C12B 2YPKA 4O5LH 4P3WA 3TBSA 3APDA 4HWBH 5DQJB 3BWSA 4ILDA 1U3HA 4ANUA 1BD2A 2MMXA 3L8QA 5IJKC 1IC1A 2IPTL 2VWEE 4JRWA 3MJ8A 4J4PA 4XB8A 4Q14A 2WC7A 3WY4A 4CJ0A 2Y72A 1OF2A 3E2HC 4NKDB 4A2DA 5C70A 4ONOA 5I16A 4IOSA 2WNWA 3QGVA 2VN4A 5JLZA 4XNMA 4X6FA 1QFWM 3V0VA 1K85A 3MDJA 5K39B 4YH6A 3W11D 3C5SA 4GI9A 4MQTB 2WXHA 3V55A 2CUAA 3BPOB 4IU2B 4KI5D 1SDDB 4RMBA 5H37A 4HOWA 1KTCA 4CNIA 2V9UA 3ARPA 2R2EA 4G6KL 2CBQA 4LHUA 4LSRL 3MBWA 4N8CL 3WY1A 1T1WA 4AV4A 5IB4A 4AQOA 2FSEA 2IAAC 1HZHL 1ANUA 4WI5A 2EACA 2YUZA 3DGDA 1SY6H 4ORGA 2V6HA 2IAMA 2FJHA 4ZMYA 4X42A 2NUTB 3GMMB 3GXIA 1T1ZB 1JHTB 2YWZA 5CLZA 1M7IA 2B9AA 4KBPA 3X14A 4XBGB 3I75B 4YDLC 3T4AA 4GO9A 3S3PA 4BH8B 3NAAH 4IEFA 4LLVA 3BFWA 4AUJA 4GQZA 4NXKA 3I6SA 5I1IL 1A1MA 2VZVA 4M1GH 2OR7A 4CC1A 2JCCE 1DFBL 4KJYB 4QO1B 2A9ML 2QKIB 3PL6C 4N2AA 4MASA 2QQQA 2VIRB 4R2GB 5F70A 7CGTA 4UBDD 1QKZH 3L3JB 5E0FA 1EXUA 1CDUA 2BNRB 1WFIA 2RQ8A 3C8DA 3KJ4C 1OP5K 4JM2D 4X6BA 4WO4C 2XIDA 3B9KB 3FOLA 5GRJH 3ES6B 3EGSA 4FS0A 5JNYA 2AXJA 4H25B 1FGNL 3HR6A 5BS0A 3NTCH 2NY3C 4L8CB 1NCHA 4KHTL 4AH2A 4AMWA 1AMXA 1J7VR 3DX9B 4LIQH 5DQJA 4AM0A 3N91A 4P23B 2EE9A 3IRPX 35C8H 3BKJL 1B6DA 2F8OA 2XICA 3VB9A 1ID2A 3PG2A 2WZ5A 3MRCB 4IQHA 3WFDH 1HK6A 1A7RH 1CFVL 2LU4A 4W6YB 1JNLL 1BFVL 4NKDA 1KLUB 3D85D 2KQNA 2M26A 5IW3A 5F1OB 1NCTA 3SCMB 2Z34A 5CEXB 1ZWIB 3H2QA 5ERWB 5K39A 2Y6TE 3VWJD 3LH8A 4M43H 1JK9B 4IU2A 1SDDA 3E0GA 4H13C 1MDAA 2BHZA 4ADJA 5FLVA 1P6WA 2EDWA 4G6ML 4JFDB 4NBYB 3PGDB 4NYLB 1CURA 4N2EA 1PNCA 2H2SC 3ENEA 2NLJB 5LGYA 1FFPB 1UEMA 1YZZA 2OKMA 4WO0A 3GMMA 2KZBA 3L3OB 1D7DA 1T1ZA 2NUTA 2AQ1A 1JHTA 2WXIA 3GRWL 1QSEB 4W9HC 2V33A 3PQYE 4MHHG 5B38G 1W80A 3OLGA 1AXSA 4XBGA 3I75A 3I3EA 1ILSA 1IAII 4BH8A 1ZGLM 4X5QA 1ZGLP 4HLJA 1G9HA 1GZHC 1F11B 3VI3F 2NDGA 3WJJA 5CEZD 3WYRA 2IFFH 5DO8A 4PJXB 4DPCX 4AZUA 5ESVB 4BM7A 4KJYA 4Z0BH 3TT1L 1KIRA 4GRLD 2HRGA 3I6KB 3BGFB 2QKIA 3CVHH 3M86A 4IGBD 4M7LH 4BQ9A 3KLAB 2VIRA 3FN9A 2XT1B 1NIFA 3L3JA 1EZVX 2BNRA 3C6LC 1BBDL 3ZMRA 2QMJA 4UTAH 1GKEA 3JXAA 1LE5A 3CX5K 3MXWH 4N86A 4B9PA 3B9KA 4A39A 3DMMD 3ES6A 2QDWA 4B41A 4XMVA 1YQVL 2Y7NA 1IRAY 1JPTL 1WT5C 1DBKL 3GS7A 4H25A 4PBVC 2E74C 1XAUA 4NJAL 2Z35B 1GY2A 2FD6L 3RI5K 1MH5B 2ZUQC 4PLKD 4F8PA 1CGXA 2UXVA 3DX9A 1YMMD 5HI4D 1MLCB 1U33A 2BSRB 3FQRB 4P23A 4JFFD 4RGND 4UIKL 1DDHB 1OCZB 1FVDB 3JT2A 1KJ3L 4LRNL 3OVUB 3MRCA 2PCYA 5I71C 4OZIE 1WAPA 1K8IA 2ODHA 1UM5L 2MCPH 5IVXB 1KLUA 3KWXA 2VYRE 5BUGA 1L9QA 4MS6A 3SCMA 2Y1ZA 5CEXA 4Z95H 1ZWIA 5FYJL 1JPST 3UG4A 1Q0XH 5ERWA 4BUGA 4LEXL 3EJPA 1Q9KB 2YD4A 1JK9A 3GSVB 2J6EL 5I1CL 1OEZW 2CR0A 2X0UA 3O81A 4IMLB 6FABH 3BLKA 4UBDC 4N2CA 4JFDA 3PGDA 1I1AD 4NYLA 1WFJA 5I30L 2WB1A 2ZE0A 2X42A 3UMTA 4KK6C 2NLJA 2DLEA 4JRYB 5F7BA 2CM5A 1DJXA 1FFPA 4FQHB 3SE9H 4A66A 3L3OA 5HJBA 5ANHA 2IALB 1DEDA 4NZUH 4R7LA 1QSEA 3V4PB 4EZMA 3TEUA 1AHKA 3VX0A 2ZXCA 3FQUB 4JO4H 2AJYL 5CIPB 5CWSB 5JIKA 5E51A 2WZ0A 4OGYH 1ECYA 3C5ZD 1C1EH 1F6FB 1K3IA 4KJPD 4Y8AA 5FYKL 3UBXG 3KCWA 1LP9E 1F11A 2QMKA 1GGCL 3EG9B 4PJXA 1ACYL 4MQ7B 2Q7NA 5ESVA 3RDJA 4OI8A 2OR8A 4NUQA 1AS7A 5AVYB 2AI0H 3VJ6B 3OJ2C 4XH2B 5AVQB 1AZNA 3A6CH 2PTVA 3KLAA 5GJSH 3UP6A 4H0IA 3VFMB 2Y23A 2NY0C 3PWVB 5DRZA 3P2DA 3P1VA 1GW0A 2ZCKH 1QFPA 5GGUB 5HI3C 2P7TA 3NEXA 3RVXD 2A99A 3ZE1B 3KM1A 1FAIH 1I9EA 3AADB 3DETC 1N6QH 3HJEA 3I85A 2O5ZL 5E4EC 1X5YA 4HEMA 1IAIH 5CZVH 4HC1H 3S2AA 4NQQA 1MH5A 2A38A 4M4RB 2P80D 1FH5L 4HKXB 3QUXC 4JN1H 1NLBH 3IDNB 5HVHC 1MLCA 2BSRA 3FQRA 1AHMA 1F4WL 5EZOH 4I9WD 4JPIB 4ODVH 2OSLB 5C0AE 5F6IB 1F41A 2K6WA 3F12B 1OGTB 1HN1A 1K3ZA 4IKNA 2VDQL 5AW1B 4OD2A 5IVXA 1YRKA 4ZRGA 4HD5A 1TETL 2B2XH 4ONFL 3WJMB 2P45B 2K3HA 3CFCH 4TXVB 2Z31D 1Q9KA 2DQJH 2ZKXA 5EZLA 3SQBB 3V10A 3V9EA 1J18A 1RZJH 3GSVA 1EDHA 3RHWF 1BXAA 8PAZA 1QRNB 3S36X 2ZQKA 5ID0B 5KBNC 4ONGL 4N90D 5C0CD 4IMLA 4ACPA 1UH2A 1ZJAA 1IM9D 5T5FH 3EBHA 4LE8A 5D93B 1I8MB 1PZ2A 3K1KC 1HNYA 2CBTA 4JRYA 4QLRA 5DHDA 2A74B 1V7NL 4FQHA 1K5WA 4AQ1C 2IALA 4GRWH 3FFDB 5TK4A 2MSPA 3CHSA 3V0HA 3V4PA 3FQUA 5CIPA 5CWSA 4G7QB 5HI4C 2EINB 3FUKA 3L16A 1C5CL 2GCYB 2Y2YA 1ES0B 4Y4KB 3VDCA 5JYMA 2ZCZA 2P42B 1CLZL 4TQIA 2IH3A 3NN8B 4RGNC 1AO7B 3EG9A 3Q5YA 4R96B 4ZMQA 2R8SH 4CDHA 3BWUC 2NCEA 4MQ7A 2DBJA 3UYRH 1CDIA 2AJUL 3B4NA 3QO0B 3PIQB 5GZNC 3VJ6A 4XH2A 5DK0B 2FCBA 3PWVA 5J13C 1KIQB 1MY7A 5MERB 5GGUA 1ET7A 2IV8A 4HJSA 1SBBA 3BAXA 1I8KB 2BY1A 2WNGA 3MNMA 4JGUA 1LO4L 2X3BA 1PX3A 1TJIL 2M8XA 5GS0D 1EUTA 4TF4A 1RIVH 4Y19B 2NY2B 4M4RA 1G84A 1NWPA 1S5IH 3UABA 3BRFA 4HKXA 1QX1A 4NUJB 3FT3B 1IBHA 5CCHE 3IDNA 4TQHA 4YHYB 4OCLC 3S35L 4KMTH 3TH4T 2TSAA 3KGTA 5FUCE 1SOXA 3ZR6A 4JPIA 5FAAA 3MI6A 2CDGB 2OSLA 3VCLB 3F12A 3QJSB 1OGTA 4IRZL 3ZDZB 3ZKNC 2CJ3A 4QRTB 4MAYB 2NY4C 4YZFE 3N0AA 3C60D 4XN9A 4V1DE 1ETB1 3WJMA 1X5AA 5E6ID 1MJ7L 1L9PA 4RWYL 3SQBA 2WXOA 4PRHB 4IDJH 5DRNB 4QF1B 5ID0A 3QJVB 2ICES 3U6RB 2YKLH 2NNCA 2YD0A 1NUDA 1FHGA 2CK2A 4K3EL 4NWUL 1PLGH 2VXVH 5EU6B 3DHUA 5LBSA 4FFYH 2XA8H 1OP3K 4WHTB 3RVXC 3MZGB 4TUOB 1KSRA 3IAQA 1QI3A 2A74A 2AEOA 5CJQL 3WGVB 1IGTB 2ORBL 4YK4C 1TCRB 2IJ0C 3QCVH 4Y4FD 2DKMA 3FFDA 5D1ZB 5C07D 4XMPH 2IQAB 3UBXB 3US9A 2UY7B 3ZL4H 5E99L 2GCYA 1ES0A 1VIWA 4NCDA 1A4AA 4N6RB 5DHVB 1DQJB 3NN8A 3BRDA 1UOLA 1AO7A 4R96A 4ZOBA 3QZNA 4YWGL 3UH8A 4PPTA 3ULVL 4AW7A 1AG0A 2VDPL 3T0EC 4FNUA 4DUVA 3QO0A 3PIQA 4Y5VC 5DDHB 2J8UB 4NWTH 5DK0A 3F6IA 3WMPA 3F64A 3P3SA 5MERA 3N1GC 3VO0A 2YHGA 3LPOA 4OKVB 1GCFA 1OAYH 2Z31C 3NSXA 2I5YL 4JRFA 4MD5B 4YHML 1DQKA 2FUTA 3TWCL 5B7MA 1I1RA 1IAMA 3IGUA 2OR9H 1INEL 5DS8A 1HXYB 4Y19A 5F72S 3UC0H 2FECI 4TKWA 4L1TA 3IU3B 3MCLL 4ZXBB 4AT6B 4JE0A 1CFSB 1GCYA 4NUJA 3FT3A 1T2QL 4EN3C 3TEXA 2Y1YA 5CMAB 4OM0H 1QTPA 3MLUH 3QPKA 3VXME 1BZ9B 2CDGA 4FNLL 4KH2A 3WEBA 3GMNA 1A6PA 3GZQA 5B8CB 2ESVD 3SD5A 2X3AA 4X7SL 4PJDE 3FAXA 1RUKH 5D5ME 2ZUYA 1KGUA 5SWSE 4M8RA 5D7JC 4PJFB 5DEGA 1FPTL 4BFOA 5LVEA 1M7DB 2SEBB 5D7HA 3HCVB 4F9LC 1ZK9A 1E6JL 5DFAA 4LLUB 3ZL1A 1OAQL 3M17B 5M94B 2QDVA 2AQNA 1G43A 2RGSA 4PRHA 4UIMB 5DRNA 4PP1D 2DBLL 2KDYA 2D3LA 4QF1A 3U6RA 3V0JA 1G94A 3SBWC 1E5CA 3UEZA 1UH3A 3VYNA 4JB9H 1E90A 2E6QA 3GRGA 4BFKA 5CD5D 4OZHE 3ATBA 1JZJA 1IIKA 4WHTA 2OZ4H 4ZYKB 4TUOA 3QUKB 3WTSA 2UZIL 1IGTA 1C5BH 1TCRA 1OT4A 5D1ZA 1KYUA 2IQAA 3TPUA 3UBXA 2E46A 2AK1L 4YHZH 3IU4H 25C8L 4IIZA 2XZAH 3DX8A 3CHPA 4A63A 5DHVA 3IFNL 4N6RA 1DQJA 4MXWH 1PLCA 3VGDA 3ZHLA 1I8IB 5DJ0B 5LQBH 2HSIA 1N5YH 1A5FH 4JPVH 1A1NB 3B34A 5KSVA 2QT6A 2LQRA 3DJSA 5DDHA 1BM3H 2J8UA 4YC2C 3FJTA 4JL2A 1FIGL 2JK5B 3D4CA 4X80L 2R7EB 3R8QA 3PAVA 1G87A 4OKVA 3KVPA 4MD5A 3DDFA 4QTIH 1QFOA 4HXBL 1N0LA 4DP8X 5J6GB 4KXZI 1MAJA 5DEJA 3IU3A 4ZXBA 2V9TA 3RWHB 4AT6A 1CFSA 4DOHE 4W9JC 5C6TL 3KWUA 1O6VA 5CMAA 4GBXB 2Q8BL 1BZ9A 2L0DA 5E95B 4E0RB 1DBBH 1UWGL 1XGYH 3G6DL 3OAYH 2EP6A 4IYKA 4LSVL 5AW9B 5DUPH 5LCVL 5B8CA 2EVGA 2C3VB 3OLDA 4PW4A 2FT6A 3QJHB 2YPLE 4OLUL 4CKVX 4WUKH 4PJFA 3VMOA 4TRPL 1M7DA 4YXLL 1WLHA 2FBJH 3N85L 2HRPL 3HCVA 1NLDL 2OXGB 3MUHL 4LLUA 4K9EH 4X99B 3M17A 1IKNA 1RZKC 4FFWC 3TA3D 3JTTB 2X1WL 4UIMA 4N4YB 2EEBA 4BBWA 3SYCA 1R4XA 1TZAA 1J5DA 1ZLDA 3X17A 3RVWD 2FO1A 3HUJB 1A47A 3BFQG 5CCGE 5JIDA 3MTRA 2WBJC 1X5IA 4I0PB 2FQEA 3QUKA 2EDMA 4IBVA 5M95B 3JVGA 5CEZL 5BOPA 5HHOE 1UC6A 4D0CB 3Q43A 1P5UC 4Q9QL 4JNXA 5D1XB 1KCLA 4HLZG 5E24E 2BWQA 5DUBB 4N2IA 4N1EA 4WEMB 3IDYC 5KVDL 2AFNA 4Y2DC 1MJ8L 3IGFA 4NJ9L 4QGTA 1I8IA 4XMXA 5DJ0A 1CGTA 1YNTB 3NZ8B 1A1NA 4UZUA 2HZHA 3QRGH 3KLQA 4IIQC 1CDYA 3C5XA 5DCCA 2JK5A 4FYTA 3ZYZA 1SXZA 2R7EA 2WIIB 3VGFA 1NFKA 1RV6X 3BESR 3ESUF 4PJ8B 4Y4HB 4PJIF 3FSAA 1R3KB 1XTLA 4J3SA 5HY9B 1LTXA 4RZKA 4WHYG 1O6SB 4JPKL 1OP9A 2FGWL 2I9TA 1ETA1 2W9EL 1EBPA 4NO0B 4JQIA 3U9UB 5J6GA 2E8YA 3RWHA 3G6JE 5F7LB 3W9DB 4LCCC 4R84A 1FYTB 1XF1A 1Z3GL 4ZS7H 4Q0XL 1D5ZB 1HOEA 4KV5E 1TJHL 2N1TE 3Q2CA 4XVUD 4J3XA 5FHAH 2G4GA 4GBXA 4QRPE 4E0RA 3WV0A 1A7NH 2CZNA 4HALA 2V5RA 2Z6FA 3BHBB 2C3VA 5B21A 3QJHA 5GJTH 3FH7A 1JZDC 1L9SA 4OCMC 1ET8A 4G6AD 1MWAB 5IG7B 2OXGA 2WMPB 4OGAD 3VVVA 3AS3A 4X99A 4WCYH 5BRZB 1U8LB 2PP9A 4KXZH 4F7KA 3JTTA 5KS9E 5IHUH 1Y6MR 4BINA 1DBJH 3QUML 5ICXB 2YK1H 1NCDH 4PRPE 1AC0A 3FCGA 2I32A 4Y5YC 4KY2A 3AROA 2WQWA 3HMXL 4I0PA 1UXSB 4LB8A 4OCRL 4GYBA 2R0WH 2EIDA 1VJSA 3ASNB 3HZYB 4HJ0C 1F02I 1GYAA 1ADQA 1D7CA 1K6QL 4LHQB 4V2BA 4IRJB 1CK0L 3F7VB 5D1XA 2YBGA 1TQTA 4LASH 3K0YA 5DUBA 5C0BB 4ZAKB 5I5RA 3QR2A 4PYHA 43CAB 3S88L 1D5MB 3A6BL 2VLME 5F7DB 5IB2B 2NTSP 3O3BB 2VDOL 3COOA 3PUCA 4M6NL 1YNTA 3NZ8A 1RUQL 2AEIT 4KC3B 2JI1A 3RGVB 3LPGA 4S2SB 1NAKL 4ZOCA 4TSAH 4BUQA 3PQYD 3SGKA 4HS6B 1NEZG 2X6MA 4MA3B 4NQSB 5EWIH 4F8NA 1FC2D 4PJ8A 4Y4HA 3NJIA 3TGXA 4U0RB 2K45A 3L9RB 1T04B 3U7AA 1RH8A 2FLBT 1NAMA 2VDML 2V8LA 4YR6B 5EOQH 4IOIB 5HY9A 2WXRA 5LHDA 1O6SA 1ECZA 4DP7X 4H88H 5JDSB 4NO0A 3U7YH 3U9UA 5A2KH 1ZTMA 3NCYS 2OTWB 3VTTA 4EIGB 1OWRM 2IWFA 4M4PA 1EMTL 1KJMB 3GM8A 1QLEH 3HPJB 3EYOB 4OIAA 3W9DA 1FYTA 4O5LL 3W3BA 4HWBL 2XPGB 4EXKA 4RH4A 1D5ZA 2QV2A 3LRKA 3V6OA 5KVFH 2XN9B 1HAUA 3GYRA 2K7QA 2EEAA 3BDYH 3TS8A 1FUNA 1MRDL 3GIVB 4OQ1A 1QSZA 1NCBH 1N68A 3SKOB 3BHBA 4BSJA 2QTEA 4NC2B 1S7VB 3LD8C 5AYTA 4TQEL 2WQVA 2YLHA 1AQDB 4RDBA 3RLSA 1B0IA 2UWEE 1ACCA 3S3CB 4QGYA 1MWAA 1F00I 1G6RH 2WMPA 2XX0A 3I2CL 1PY0A 4R5TA 3RIFF 3KJ6H 5BRZA 1U8LA 4QXGH 3SZKC 5AZ2H 3T0AA 3DV6B 3T8XB 2LOEA 5ICXA 3HMWH 2H7WA 3ARQA 3ECVA 3RAJL 4D9LH 2GB2A 3OPZL 3HLAB 1DBAH 5ETUA 3RJQB 4KKLC 1E7VA 1UXSA 3HB3C 5FO8B 3IB4A 4M6AA 3QG7H 3HZYA 2AP2A 3K74B 4V33A 1IVLA 1Z1WA 3GUTA 4JHAH 2FO4B 4IRJA 2WO2B 3F7VA 1BQUA 4AIEA 4BXVA 2C9VA 5EO0B 5C0BA 5EHFA 4ZAKA 2AJXH 43CAA 2OFQA 3NAAL 1D5MA 1RU9H 2A0LD 5IB2A 3O3BA 4QOKD 1CB4A 1NCIA 1HWGB 1NMBL 3RGVA 3U7WH 4ZX4A 5IROA 4S2SA 2R2CA 1IC4L 2IXQB 3TYFB 1A3ZA 3Q1SL 1BCIA 1NDGA 3ZTEA 4HS6A 5HDQH 4MA3A 4NQSA 5GS0L 4L5FE 4A38A 5I1EH 1QKZL 3OL2A 1J87A 4G6AC 2VKWA 4ZUSB 2Z7ZA 1T04A 4AENB 3NFSH 2CNYA 5CR8A 4YR6A 4IOIA 3VI3E 5A2CA 1G7JB 3SDXB 5GRJL 5JDSA 1TXKA 1P7QB 1JYWA 2NZ9D 3MCG1 3KBPA 2OTWA 5F0JB 1ZMYA 3AABA 3HPJA 1KJMA 3K71B 3EYOA 2CGZA 4LIQL 1OD9A 2PO6D 2APXA 2Y07H 1I85A 2NCMA 5FC9A 1IBFA 2Y7QB 2X05A 1KTRL 2XN9A 3ASWA 35C8L 1TSRA 1EH9A 4NS0A 5IVOA 1BVZA 2PCXA 4RGMC 3MOQA 4YDVB 5C3TA 1WICA 2AV1B 1BAFH 4KVCH 3WFDL 4UDTB 1S7VA 5C09B 3WIFB 3O6LL 1AQDA 1AE6L 2DQIH 2QELA 4XPTH 1SHXA 2RB8A 5HGAB 2WLNA 3OQRA 5D4HA 4HHGA 5EEUA 3FUMA 4QRRD 1QBMH 4UV7H 1DEEB 1BJMA 1PLAA 4M43L 3GLDA 4BFNA 4RSYA 3DV6A 2O5YL 3QHZH 3T8XA 2OK0H 3UL4A 5E7FA 2EEXA 5T1KD 3CTTA 3X1EA 1S7SB 3TIEB 3HLAA 3LIZH 1FFQA 3U0WH 5FO8A 4K3DH 3X1FA 1CFQB 2FNBA 2PWHA 4YFLF 2C1PA 4ODBD 3ULUE 1WG3A 1K5NB 2EXWD 15C8L 2FO4A 1YYMH 4K3GA 3J07A 4XNZC 3IDGA 2R59A 3BKML 5EO0A 3BSGA 2V3DA 4FQLL 4L29A 4HJEA 2XBDA 1H9DA 4F9PA 3G3LA 1JDCA 4NUGH 3QJTB 5H94B 4LAJH 4LLMB 2FX9L 2IXQA 3TYFA 4IHOB 3SE3C 3CVHL 4OLVH 2QR0B 3QSKB 3FBKA 2K6ZA 5D72L 3HG1B 2GBUA 2GSMB 4ZUSA 1CLVA 3OHXB 4AENA 2CPUA 5D9SB 1JXFA 2H1PL 4NCC1 2FL5B 3V4UH 3NACH 3BYYA 1G7JA 3SDXA 1ED3B 4UQ2B 1P7QA 3B9DA 5CZXD 4O58L 2H0PA 3PV6B 4FFVD 3K71A 4UU9B 4Q2ZB 4JZNA 4EJ1C 1JS4A 1X9QA 4CSZA 2Y7QA 4FLOA 2Z0BA 3MC0A 1OKEA 1IGCH 1DSFH 3RDTC 4BA0A 1ACZA 4MDIB 1UKQA 3F65A 4YDVA 4OZFG 4PJ9C 2LAGB 4UDTA 1FZOB 2DI8A 5C09A 2ATKB 4KX9A 4QHPA 2MCPL 3WIFA 2C3WA 4DFHA 3RIAK 4YPGB 2QFPA 1J5OL 5HGAA 3LJ3A 2F8VA 4D8PB 1P0SE 4FXKB 1Q0XL 1DL7H 2ZF9A 4GSXA 4YGAB 1DEEA 1GW6A 1UM6H 3GS0A 1NCAH 3EJSA 1EBAA 4PYGA 2MOVA 4S1SL 5B3SB 5JHAA 1IX2A 1S7SA 4V1DD 3TIEA 3DYMA 3QWOB 3EDFA 4XI5C 1FFTB 4XN8A 1CFQA 4YHIB 2N7BA 3CZSA 4M1CC 5JPNB 4PHXA 3BKYL 1K5NA 4HUXB 3IJEA 4G7YH 4NZUL 3WXVH 3BPCB 4DKFL 1YEFL 3DJZA 3MVSA 3UJJH 2F1AA 2PO6C 1C1EL 1DTUA 3LH2H 1JE6A 3KYMB 3AREB 2WLIB 2VMEA 4RMSA 5DYOB 1E4XI 4HKBA 5H94A 4I1PA 4JZJB 4LLMA 4RMWA 1MPAL 2JKRM 3B8YA 4GUQA 2AI0L 4MJ4A 2QR0A 4MJID 4JM4H 5AUMA 2XNAB 2BY2A 3LQAL 5GJSL 3VFOA 3MV7D 1KN2L 1V05A 3HG1A 3LHAA 3ZDYE 4ZTOL 2N01B 4P4KB 2VERN 3OHXA 1INQB 1N4XH 5F1KC 2FL5A 2DKSA 5C6WH 4KGJA 3V5HB 1ED3A 2VDPB 4H1LB 1N6QL 2GW5A 4UQ2A 2FWLB 3UJIH 5T5NF 5GRZA 1IAIL 5CZVL 4K9EC 3DVFA 4UU9A 1T03H 3IJ8A 2ID5A 3OLIA 1YECH 4LZKA 2FWSA 1BQHB 5EZOL 3DUSB 3AAZB 3KXFE 4MDIA 4A37A 2MOQA 5EZJB 4TSCL 5EULV 3WI9A 3ZOAA 4R6UA 4K7FB 4F5CA 4K94C 1FZOA 2ATKA 4MB4A 3O0RH 2AXWA 2JJSA 4LKXB 4G9FE 3RILA 3DX7B 3UIYA 4YPGA 2F8XC 3HI1B 3VXSE 4D8PA 4FXKA 3CFCL 1KACB 3EHBC 3MRFB 5F3FA 1RZJL 2HWZH 4PJXF 3MLXH 4ZTEA 4B96A 4IRZA 2BSEA 2J8HA 3KYNB 5CINL 4Z7OB 4Q7DA 1FE8H 1YEIH 5SWSD 1OAXH 3HHRB 4XMUA 4YSSA 3T2LA 5DJDB 1EEUA 2F58L 5A2JH 3KYOB 2Z7YA 3QWOA 4D8OA 4WEBH 4HWZB 4A7GA 3QDAA 2KYIA 1VZIA 4ONHB 2H1XA 4JDVB 1U0QA 4YHIA 1ZVHA 1BG9A 4K9JA 4WI0B 1OXYA 2BP0B 4XP1L 4HUXA 4XCEB 1NFDE 1E9PB 1L0PA 3BPCA 3TBBA 3RYMA 3L45A 1S7TB 2ZTBA 3BDXA 3KYMA 3QS2A 5E1HB 2WLIA 5FGBA 5GGRY 5CGMA 2FNWA 1GYUA 5DYOA 4NO3B 3K2MC 2DLGA 3IRZA 4JZJA 1B0GB 3NPZB 3LY6A 3SQOH 3UYRL 1JDDA 3JWNG 1XFPA 5ABAA 5KANG 3I02B 4HUVB 4OT1H 3VXUA 2XNAA 4CU8A 2AW2A 1A6WH 3EFFA 3SZ6A 1UCTA 4C4KT 4N0UB 5FUCC 4FTVD 1O9ZA 5DZAA 1Q90A 4NQTA 5L9DL 4L5FH 1INQA 4D9RD 2BSBA 2CMRH 2YLKA 1XGTA 3BIBX 3F7PC 3GM0A 4I13B 3GMOB 2DWYA 4RZCB 5EB9A 3V5HA 4H1LA 1RIVL 2D3NA 4LCWE 4B50A 3LS5H 2EYRA 4R3SB 4ZMWA 3NJGA 3EYQC 1E4XH 5LDUA 1P69B 1F2QA 1BQHA 3MKKA 5AOJA 1T83C 3DUSA 3AAZA 4XB7A 4C47A 3RX8A 2MFNA 1RPQA 5EZJA 3CFEB 4J12A 1URZA 2FQGA 4GUPB 2ZJSH 1PG7W 4N26A 3INUH 1X6NA 3FOMB 4WFFE 5D96B 3DX7A 5CGYD 1ZEAH 4WW2C 1FO0H 1FYHB 5FK9B 4ETQB 4LMQE 3HI1A 4YDIH 1N64H 1XCTB 1PY9A 5ALBH 3ZKMD 4N0CC 2TAAA 3SQRA 4X6CB 4A7QA 5IEKA 3MRFA 3PNWB 3BLBA 1BSIA 1LO3H 4FYSA 3KYNA 4PJBB 1MY5A 3VWJB 5DJDA 3FQWB 4X83A 4TNVF 3UZEA 1PLGL 3D6GA 3KYOA 1T7YA 4HWZA 5C0DA 2E9BA 1VADB 1NGZA 4ONHA 5B7FA 4JDVA 1URIA 2CR3A 5JW4Q 4WI0A 4XN2A 4GAYA 2X87A 2BP0A 2ATAA 4M93C 4XCEA 1S78D 1E9PA 2BRQA 3G9VA 3F7QA 3ULUH 1Y6NR 1D5RA 5JHDE 2H47C 1EAPA 4HIEB 3C8HA 5L2KE 2PCFB 5ESQB 3UTOA 5IP4A 4NO3A 5HHMB 2ZONA 1H9VA 5AW4B 2I69A 3AWFA 3A22A 1N7MH 2CE6A 2DQTH 3F8UB 4KQ3L 3D2UD 5E8PB 1JIBA 4HUVA 5DF0A 4FA8A 4NWTL 4NN6C 1OK8A 1MI5E 4YBQC 2GTZB 2Y7LA 4NQCB 4N0UA 3S8WA 4IGBB 1QHQA 4RWHA 3WNJA 3DI3B 5ALCH 2ZNXA 2VW4A 4N9OB 3K6IA 4KDVA 3IDJB 1P6FA 3GMOA 5JOPD 2AJSH 4WUUE 4RZCA 4XMWA 4JFZH 2IBGA 1CF8H 5I6XC 2OR9L 2VDNL 3QZMA 4M6ML 1CYWA 3IKKA 2I07B 4R3SA 4WENB 3DMMB 5AWNH 3FNKA 3EDDA 4PJ7B 5ABDE 2K8MA 3DKHA 4OZFA 1AGFB 4TMPA 3THMH 3F62A 3MLUL 1IGJB 5F7FA 2R0ZH 4O51B 5CSZB 2C3XA 1RJCA 3RVUD 1NM9A 3CFEA 1DVZA 3N3EA 1HCFX 4GUPA 4N5UA 1RUKL 4UV4H 3B83A 3CHOA 2R1WA 3FOMA 2BW5A 2ICWJ 5LNDA 4OFVA 2CXKA 1NGWB 2R51A 5FK9A 1EEZB 2PPDA 4ETQA 4I87A 3CVBA 2CALA 4X6CA 5BZWB 3CMOL 3NFNB 2MTAA 3FB7B 5I66A 3PNWA 5K9QG 3NSDA 3B43A 5F9AC 3HS0A 3IF1A 2DLHA 3AC0A 2UZPA 2PWEA 5F7HA 3VWJA 4JB9L 4KOBA 1ZT1B 3FQWA 3LZLA 5J5EA 1NZRA 3GXPA 3RWIB 1VADA 3DYPA 1AOHA 1F4YL 3SDDC 2IMNA 1T0MB 2PXYD 2Y7SA 3UG3A 1UUSA 1HJBC 1I1AB 1AIFB 4UM8B 4GMSH 4WF7A 4UT6A 2OW7A 4QXUL 4PRPD 4N28A 3EF7A 3QUMB 1HSBB 1FFRA 3UCRA 1QEXA 3IU4L 2WO3B 2XZAL 5JHLH 5C0JA 1EZVY 4ESKA 3LRSA 2PCFA 1T1XB 2OJZH 2AQ2A 3IS1X 4MXWL 2XACC 4N1HB 5AB0A 5LQBL 5INCB 1A5FL 2C8NA 2FT8A 4MWFB 3KBFA 3C5ZB 5DHYB 3U4KA 4IOFD 1V3JA 5E8PA 1BM3L 3VVWA 3ZDZF 2OYLA 3LN9A 1OE2A 4K15A 4WZ9A 2GTZA 4NQCA 3KEHA 3TIDB 4FI8A 2Q8AL 4IGBA 4LVNC 1Z9PA 1RJZB 5E4OA 1QR4A 2FATL 2PKDA 2X4RB 3E1F1 3HG0A 2EZ0D 5E9DE 3OGCB 4YHNB 4LMQI 1MCWW 2I07A 3DMMA 4OCSH 1UJTA 3TZVB 1F1GA 4HCGA 4PJ7A 2AAVA 3JBG7 3P3TA 1QHPA 2FHCA 4I88A 1AGFA 4PP2B 1GTNA 4PJIE 1MN4A 5GGQH 5LNEA 1IGJA 5C08D 1JAEA 4O51A 5CSZA 3UGXA 5BUPA 2MPVA 1L0YA 1MCOL 2ENJA 1NCJA 5FKAB 2ICWI 5C9JB 5IQOA 2DTSA 4WUKL 2WB7A 5IHZB 1DQDH 2VL5A 4H8WL 2FBJL 1NGWA 1EEZA 1CYGA 2HAZA 3BWZA 4K9EL 3FUJA 5BZWA 3NFNA 3FB7A 4NHCL 4NT6B 3RP1A 3L1FA 3ZQ9A 4Z3JA 1PSKL 1AG6A 2FECL 5LGJA 3FDWA 2DEYX 5BMFL 4Z3TA 5DLLA 4OD1H 1AHWC 5AEAA 2BIQA 3ZKXC 1KBVA 4E9LA 1OSEA 1ZT1A 2DQUH 2J8UF 6TAAA 5KVEE 3RWIA 2BP8B 2ZUUA 3WIHH 3ZQXA 2ZNWA 3VRIB 4UAOB 1T0MA 3ZE0B 1DQIA 3NA4A 2N3JA 3WOVA 1I1AA 2PNDA 1AIFA 3QIWC 4UM8A 2XQBL 1R3JB 2D31B 3T3MB 3BH8B 3QUMA 1HSBA 4ZSOE 1T1XA 3N50A 4LHJB 2BHUA 2XVGA 4UNUA 2BS8A 1U2HA 3A4FA 4GAGH 3C5ZA 4MWFA 5DHYA 4UQ9A 4BKSC 3QRGL 4P3DB 4FHJA 3EYFB 3VM5A 1D7BA 4IHBA 1UACL 2WVUA 1W16A 3TIDA 4PJFF 4Q9RH 1V7ML 2V2TB 3ATEA 3ARBD 2X4RA 4LEOB 1CG9B 1ULVA 1WIPA 5J89A 3DUHA 3LEVL 3QDMB 1I3GL 2EXTA 3EJZC 4L2YA 1DVFA 1JV2B 2B4CC 3OGCA 4ZTPH 2J7LA 4YHNA 3OMIB 4DPRA 2EDQA 4LSSH 4PG2A 4WEEA 1D6EA 2Q7YB 1AJ7L 4J3OC 3TZVA 2JF1A 2FH6A 2LFGA 3UMNA 1IFHL 4BJLA 4PP2A 4LQ1A 4KXAA 1TEYA 3DIFB 3PWLB 1B4LA 3LNGA 1KZQA 3H53A 3M1BB 4GXUM 4ODHH 3L95B 5FKAA 4NOBA 4LSTH 5C9JA 3P3YA 4E41D 1U8PB 2YUWA 5IHZA 5GJTL 2P48B 2Z3FA 5AYUH 3VFTB 2ZYIA 3RA7H 4F8OA 5EF0A 4UNVA 3RUGE 3VUAA 4WCYL 4JG1L 4NT6A 3UAEA 4FYQA 4IOFC 1KTJA 4A04A 4HUNB 5IHUL 2VTFA 5E6IB 4N8PA 2YK1L 1NCDL 4IDLA 1CGSH 5FEBA 5TD4A 4UTBH 4FQJH 2J6WA 2VO8A 4R4ND 5LO7A 1V27A 4ZI8A 5I1LB 1JF5A 2BP8A 3KLHC 2J2ZB 4NIKB 2R0WL 1HSAB 1BQ5A 1PZ3A 4NKMB 2RHEA 4TSBL 4FQIL 2DLFL 1OOWA 2DDQL 1T66D 1R3JA 2AGJH 3RTQD 1M3JA 1E2ZA 3BH8A 3QCTL 1KXQE 4LASL 2QFRA 5AAPA 3DUUB 3NRPA 1XCXA 1P53A 4Y4FB 3P02A 3Q6GL 4A1RA 3HZMB 5TE4L 2EE6A 2R4RH 4ZFGH 4OF5A 1PY4A 3SJVE 1H6EA 2ENPA 2WTPA 3I50H 3L2LA 4P3DA 1NKGA 2CHZA 5JIPA 5GGRA 3EYFA 5C0GB 4EE2A 1UADC 2L7QA 3CU7A 3B7TA 1ND0B 4LF3B 4YUEL 3HC2A 2QPEB 4XNUH 3VGBA 4BE5A 5D1QE 1AXIB 2V2TA 4LEOA 1K4CB 4Y9BA 1CG9A 4G42B 5EOQL 3WJLC 4K0OA 4E42B 3QDMA 4PJHB 1QPKA 1JV2A 1OAKL 3U7YL 3A6OA 2Q7YA 1BD2E 1ITBB 4FEMA 4HFUL 1QLEL 5MEQB 1HZKA 1XH2A 2NXZD 3UBFA 4JO1H 5KVFL 3LB6D 5JXAH 3DGGB 2H6UA 2V5MA 5E94B 4FNTA 1FLRL 3BDYL 3LEXB 5DVPA 5BVJB 3DIFA 3PWLA 1J48A 5I24A 5B4MD 3M1BA 1AR1B 4WWOA 3L95A 1YYLL 4PJEB 2AJVL 2YRPA 2W0KA 2R69H 1U8PA 4YBLB 4BCXA 2YPVH 2C34A 2P5WD 3BVUA 5DJXB 3VFTA 2ESVB 1G6RL 2CM6A 2IWEA 3RPIA 3KJ6L 1I75A 1ZXKA 4U3CA 1YNTF 4M62H 4QXGL 3FT4B 3UXFA 3UZVB 5E6IA 5C86A 5TE6L 4ZFOL 5DC2A 1UURA 3WIAA 1YQ2A 2UZXB 4D9LL 1OF0A 1TLKA 4AUYA 4ABUA 5AOLA 5I1LA 4XHJC 5FUZH 2J2ZA 1EHNA 1SF5A 1HSAA 3L3GB 4NKMA 2LTQB 3QZOA 2EVJA 2Y06L 1D5XB 3ABKB 4TNEA 3VXRB 5KYUB 1BXUA 4DP6X 4JHAL 5C7XL 5DRXB 5DVNA 4ATWA 1RVFH 2XIIA 1L0QA 2DH2A 3DUUA 2XUWA 3K46A 3NJKA 2AJXL 4FQXC 1KJ2L 1RU9L 2WQ8A 2V37A 3ZUNC 4N2KA 1UT2A 1AGBB 5HYSB 2CJSA 3CPUA 1UD6A 1LEIB 4MQXC 3HOGA 3E1ZA 4L3AA 5C0GA 3OSKA 3M1OA 3UBHA 4ODUB 4M7ZB 1ND0A 4LF3A 4IK6A 3C09B 1SFHA 2F1EA 3CQFA 2EO7A 5BS0E 2PP8A 2W9LA 5FYLE 3S37H 4BGLA 1K4CA 4G42A 3ZE2B 3K6SB 1E67A 4E42A 4PJHA 1GC1H 2EUWA 2Q3ZA 4PRBA 4OFYA 4AV5A 4KITB 4TOYH 4ATTA 3N06B 4XCNB 1LO0L 1CU4H 4A6YL 3NPSC 4V2CB 5MEQA 3HN5A 3JWDL 4YSDA 2Y07L 1EVTC 2A77H 4PWKA 4LP5A 1IQWL 4XC3H 5DFTA 3HHSB 3M7FB 2H3KA 3D4GA 5E94A 5AAMA 3LEXA 5BVJA 2OMZA 2AV7B 4KVCL 3HZKB 3QEHB 4PJEA 1GMIA 4G82A 4NO5B 4FZEH 3QHTC 3BSZH 2DQIL 5SV3A 5E6ZA 1FAKT 2R1YA 2ZXEB 3DX0A 3PJLA 4X9IA 2ESVA 1INDL 3FT9A 1GAFL 2HFTA 1NANI 4U6YB 1F8TH 1Z0NA 1QBML 4UV7L 3V0IA 3H3KA 2J4WH 3AU1B 3VGAB 3ULUC 1MCBA 3UZVA 1L7IL 3KWWB 3QHZL 1XR8B 1JUFB 1CBVL 1R46A 2UZXA 3K91A 3TA3B 1XH0A 1JYNA 3ESNA 3VXSD 3LIZL 3U0WL 4K3DL 1IEHA 2XKNB 3L3GA 3HC4H 2XPZA 1D5XA 2CLVA 2VLJD 3F2LA 3VXRA 5KYUA 1TJGH 2YD2A 3T08A 4BFBD 1QMUA 4LOUD 5T3ZH 1YYML 3FN3A 4DEPB 5JPMB 5IMOB 2FWUA 5DRXA 1FL5B 5IF0B 4UQIM 2ZXAA 1CDBA 3IN0A 5IBLD 1ZV9A 3IETB 3OSVA 1SYSB 2MRYA 5I8KH 3LZFL 4NUGL 1AGBA 5AG9A 3R0NA 1ZV2A 4PSPA 2BNRE 3GHEL 1LEIA 4HZLB 4NENB 3NT0A 2PR4H 2QGDA 2MJWA 2E9JA 4GRWB 4MLIA 4ODUA 4P2OD 4XVOA 3E8UL 5D4JA 4JMNA 5DMIH 3PHAA 1ZKAA 2F68X 1Q9WB 3BQUC 4XP4H 1TMQA 2APWA 4RFOH 3NSFA 2FYYB 3K6SA 3HG2A 1NGPL 3B5GA 1QFUH 2AANA 2V8MA 3W0WD 2VOTA 5A6LA 4GXVH 2DI9A 3EJYD 4HISA 2O4EA 4XCNA 4WFEE 1MOEA 2WUBH 4FRWA 3HHSA 3D39D 1FFNB 1IGCL 1DSFL 2E8ZA 4JDEB 2MHAB 3P3RA 1SOKA 3O45B 2AV7A 4P2QD 1F58H 3HZKA 3QEHA 4NM4L 2Q20A 3RWFB 4MMXB 4NO5A 4YSUA 3MBXH 3SPGA 1DJHA 4RSVA 3D50A 3BCFA 1IBZA 5LWYL 1SHWA 3QQ9C 4U6YA 1XGZA 5DD3L 1E2VA 3TFKC 3DOHA 5A2IH 2GJRA 1N9PA 2IGFH 3AU1A 4WI2A 4JFDE 1KXVA 5CP3H 1UM6L 3KWWA 3D34A 1XR8A 2OMVA 3AUVA 1JUFA 3L5HA 3TBTB 5IEHB 4N9GB 3S5LB 3P0GB 3TA3A 2GBAA 3L9YA 2WXMA 4XP6H 1NFIB 1QSEE 4YFLI 2R9HC 4E5XG 5FM8A 1OCCB 2XKNA 3AB0C 1PZBA 3MBED 3QVAA 4E9SA 5CU9A 4UOW1 2ZOKB 3NDZE 4UM9B 3SDXF 2LLNA 2MQ3A 4G7YL 3RY6A 5JPMA 4PJXE 5F9OH 1FL5A 5IF0A 1DUYB 1MSPA 2KMWA 3LH2L 4F2MB 3H3PH 3OAWA 1YEKL 1JZ7A 3IETA 3ZW3A 1SYSA 3KE0A 3NCMA 2D0FA 2WLHA 3HNVH 4NFDA 1NGQH 4YSQA 2CA4A 4EI5A 1PX4A 2EICA 1U8HB 4UQDA 4HZLA 4NENA 1Y18B 4ZUVB 3LMJL 4NAJA 2X7LB 1EHAA 1H19A 4WV1B 5CHNB 5L2KD 4TQPA 1Q9WA 2APBA 2PR9A 4DF9A 3H85A 1N4XL 2WN2A 2FYYA 2GI7A 5KJRH 4WWKC 3RWCB 4CKQA 1J1OH 2E27L 4LPWA 1PTZA 1R33A 2EXYC 4RX4D 3HJ0A 5HSFA 1DVTA 4JFED 4LARL 3UJIL 2WXKA 5I73C 1ZVYA 2D0GA 4JFPB 3P3UA 1DQML 5DZVA 1T03L 2VR6A 1YECL 2VB5A 4H20H 4KFMA 3QAZB 1MFEH 3PHQA 2EO1A 5IVXE 1FFNA 1TQWA 3KPNB 4OAWA 2WW8A 3FQYA 4K4KA 2P5ED 1TTRA 3RZCC 4HS8H 4PEEA 3O45A 2YUXA 3EYVB 1X5MA 3E6HB 3PAUA 3RWFA 5KW9H 5GRWA 3V0WH 3V4VL 3EFDH 2VDNB 4MMXA 4U3SA 3O0RL 1VEPA 4M1DL 1AMYA 4HGKC 3WHXB 4XODA 2BIMA 3H6AA 2ZOOA 3IMSA 5H37H 1EXGA 4OLZH 5J6HB 3M46A 1O9VA 1L3WA 3MLXL 2Y2WA 4X6EB 1UB6B 4XVSH 4TTDD 3H3BC 1WGVA 4JRYE 3TBTA 5IW6B 1OAXL 1NIAA 1WEJH 2NSQA 3JV4B 4N9GA 4R26H 5IEHA 3N43B 3OXRB 3Q9PA 1T5WB 2NY1D 2Y7OA 4L23A 3JSSA 1NFIA 4UQAA 1UA6H 5BW7A 2G75B 1MREL 3SO3C 2E7MA 4CBPA 4GH7B 2ZOKA 4FMVA 1G9ML 4UM9A 1BQLH 5GZOC 3U30B 2VSCA 2A9CA 3QNZB 4Z7QF 1DUYA 2HG0A 2D9QB 1QLRB 1I8LC 5MEPB 3FYIB 3OJMB 4WFGE 1F56A 1YG9A 3NCCB 5F6HI 3B6SB 4F2MA 5JW3L 4PLJD 5E2WL 4K73A 3L5WB 2NY6D 3TN0D 2W81C 4F8QA 1NMCC 2XVLA 1G7PB 1F1DA 1U8HA 4KDWA 3SQOL 1Y18A 4QOKB 4ZUVA 1UENA 1NEPA 4P9ML 3ZE1E 1NTDA 2EDOA 4HFWB 4OT1L 4C56B 2CBMA 4YS4A 3VWKC 3GIZL 5JMOC 4BFEA 5CHNA 4WV1A 3VFPB 4PB9H 3D87B 3GK8L 2CMRL 4NZTL 3RWCA 1QZ1A 5FYLH 5DVOA 3S8GB 3JYBA 1RXLA 1QSFE 3IDIB 1G6VK 4XPAH 3VFGH 1OY3B 2D3VA 3LS5L 3MGTB 4AYEC 1LMKA 4XCCH 1AZZC 3BAEH 3H0TB 1UJ3C 1E4XL 4OV5B 2F7QA 3KPNA 1J8RA 5E9DD 3D1MC 4JKPH 2OA9A 4A7GF 4XX1G 3TTSA 4P2AA 3EYVA 3E6HA 1XIWA 2D3JA 2P26A 1AACA 3LAFA 4HMEA 5I1JH 1DJIA 3DSNB 2V4LA 4MJ2A 3KHOA 1C5DB 3WHXA 3CFUA 4N2LA 1QRNE 5D6DA 5DR5H 3SDAD 3FRUB 4YDIL 2ILLA 5I1DB 4YXHL 5ALBL 4U1GB 1HNFA 3DI2B 5I74C 5J6HA 5KEZA 3RWEB 4X6EA 1UB6A 4QRRB 5IW6A 3JV4A 5AALA 1HEHC 4TLSA 3OXRA 1T5WA 1MUJB 3DVGB 4S1DD 1FNGA 2A1WL 3EXLA 4DN3H 1EFXD 2WTRB 2G75A 4U0QB 4YE4L 2YBRB 5DTFB 1PW3A 1YUHB 2WYZA 4WTXA 1AO7E 1RZQA 3KHQA 2VLRD 1XH3A 3IE4A 3QNZA 1VLXA 5A3IC 5MEPA 4M7JH 3I9AA 4RMUA 3B6SA 1XCQB 4G8AC 2BVPB 2ZAGA 2AJ3B 4KTYA 4J3VA 5H8DA 1HH6B 2OM5A 3O3AB 4LRIA 1MXGA 3D0VB 4L4JA 5DJCB 4AVJA 5T3ZD 3B9VA 4FNPA 3F7KA 2DQTL 3E6FB 4QOKA 5A2FA 1DO5A 1A7PH 4FULA 5A2LH 4C56A 1NUNB 4HFWA 1J5IA 3QCUL 2H41A 1RULH 4J3TA 1VF5C 4P46D 3VFPA 1QLFA 3TJHC 5I8OH 4Y19E 3UTTD 2YD7A 2XN0A 3QS3A 2ZX6A 4D94A 5JZ7C 1YEWA 4F58L 2KLRA 1MEXL 2JKXA 3FN0H 2R1XB 1T4WA 1CF8L 1FI8C 2YRBA 3DRTB 2R23B 3IDIA 4U31A 1CYXA 1AQMA 3GBML 4P9HH 1XB8A 3CDYA 3MGTA 5A2BA 4Z7OF 5JR1H 2HJFB 3QXAB 5AWNL 3ZDZE 3H0TA 4UT9A 4DFIA 4XCFH 1SHMA 4OV5A 4PGCB 4QLWA 4KI5F 4DCQB 4MXQD 3CH1B 3VMPA 3THML 1CXLA 4IRSC 2HKHH 5EUOB 3GSUB 1MHCB 4JEGB 2DQDL 4M5TA 3CBJB 5F9WB 5EC2B 2VXQA 1JGDA 3DSNA 4UF7C 4R5XA 4Y1AA 3LRLA 1C5DA 3ATAA 4PRHE 3IEAA 4GAJH 4YQXH 1I9JH 3FRUA 2NY6C 5I1DA 3EIFA 1PDKB 2EDXA 4ZMTA 2H9GB 3TJEH 2OMUB 4R97C 1COBA 5EU6E 1JNHB 1S8DB 3RWEA 1YN6B 4LSUH 3CN0A 4EI6B 1BMWA 4QRRA 3V5DB 3SDCD 4RNRB 3RB5A 5AW3B 4E5XA 3DTXB 1MUJA 3DVGA 4L9DA 5AW2B 1ZANL 1U3JA 2WWNA 3BP7B 2WTRA 4WI4A 3FHEA 3WTVA 1A7QH 3D33A 2YBRA 5DTFA 3ARDD 5F88B 4FNSA 5E2UL 1YUHA 5DMGD 3FCSB 2FYVA 2GSIB 4K5OA 4P2CG 5EIVA 4WW1B 3FUEA 5JHLL 3QUYB 1XCQA 2BVPA 5FO7B 2J8UE 2OJZL 2JB6B 1UOVA 2AJ3A 4UT7H 5SX5H 1CLOH 2C1OB 1X3DA 3O3AA 3D0VA 5DJCA 4ZZKA 1ZLVH 5ILTH 4RA0C 1HKLL 1T7ZA 1O5DT 4U1IB 2CO6B 2Y5TB 3E6FA 3VXTA 1FCGA 4HIQA 1LK3L 4OCYH 4XMLH 1I1CA 5HDWA 2D4DA 4JKLA 1NC2D 1CTMA 4S11A 3P0VL 4I3GA 5L0QC 3SDAC 3V0EA 4Z8FH 2XN2A 4OVVA 1NL0L 4MJIB 2CKNA 4ZNCD 4ES9A 1OT1A 3MV7B 3O8XD 2R1XA 4P4RB 3W9EB 1BEYL 1HCZA 4X6CF 3DRTA 2R23A 1WZMA 5FB8B 4FXGB 2ADJA 3L4WA 4KRPB 2HJFA 3QXAA 4JO2H 2Z7WA 3GKWH 5D1QD 4PGCA 1MCFA 1IGIH 4DCQA 2UV3A 4DQOH 3CH1A 1QTSA 3BOVA 4PJFE 5GGQL 1UKSA 5EUOA 3GSUA 4JQVC 3ZO9A 4TS6A 1MFBH 1BD2D 5EC2A 1WIUA 3S3DB 4J4PD 3APFA 1DQDL 2WSDA 3JZ7A 3IFOB 3DARA 3V6ZB 3EYSH 1PDKA 2LHAA 1LGVA 2YFOA 4IOSD 2EDNA 2OMUA 2CGYA 4X4ZA 1S8DA 4N3UA 2DWDB 3MCYA 4HV8A 1YN6A 3T9WA 3B2UC 4OTXH 2OV0A 1A4BA 4OD1L 1FC1A 1P84K 3V5DA 4RNRA 2DQUL 2Y1AA 2Z9TA 3DTXA 4Z7VB 3ZGIA 4N0YH 3LKOB 2WNKA 3QQXA 3BP7A 2OCCB 3WIHL 1FNFA 3WDJA 4B7LA 1ZIAA 3V4PH 2P3YA 5F88A 4FOMA 1HU8A 5CIPH 3G08B 3L6FB 3LXBA 4FQ1H 5DVKA 4TUJA 2DL9A 4FX5A 3RRQA 3TM6A 1AGCB 2GC7C 2IAMD 3FCSA 3VB8A 2GSIA 2VJ8A 2A9NL 2CR6A 4WW1A 1KYDA 3OKEB 3ULAB 2ADGB 2L3BA 3QUYA 5JXEA 4JM0A 5FO7A 5L7XH 2X5PA 2H0JA 2JB6A 1J0JA 1CD1B 4PJ7F 2C1OA 4GAGL 2CRIA 1JHKH 2VO5A 4XN7A 2BM3A 2CO6A 2Y5TA 3D0LB 3U4EB 1MF2H 5IBTL 4PLOB 3RI5F 3QDGD 3N1MC 4BD4A 4ELDA 1WWWX 2A9BA 1KFAH 1J0YA 3CGTA 1KELH 1WYJA 3GMPB 1J88A 1KJ2B 1TZIB 4MJIA 1HIML 2V2XB 3FZUC 5DA0B 2ZCHL 4CC4A 3QORB 2NX5B 3DJ9A 4P4RA 2X4NB 5EOCJ 5EZPA 3W9EA 2K7PA 1THAA 4JG9A 4FTVB 5FB8A 1L6XA 4FXGA 1RLBA 5BRPA 4PTTB 1MRFH 1VA9A 2NQDA 2CCWA 1B2WH 4IU3B 5BS0D 3FT2B 5BQ7B 2XV2A 2X28A 1DSYA 4R90L 5KSBF 2TSBA 4KHXL 5CU5A 1NCNA 3E2HB 2VCOA 5D1ZI 5TJWK 2XZCL 4PLNC 1OE1A 4LSTL 3RQ3A 1LM8V 3UBXI 2BK8A 3DIVA 3OMZA 2IDTA 4GT7A 5AW5B 3IFOA 4A6YB 5AYUL 2N7SA 3V6ZA 4DZBB 3VDBA 4MVBC 4NLAA 3FFOA 3HUJE 3HZVB 3W56A 2D0HA 2OSYA 4YFEA 5K5YA 1UHVA 3D25A 3SIKA 4GQPH 2DWDA 2JKLA 3L4ZA 3Q01A 3VXOB 3VMNA 1JN6B 3QEUB 4FHBD 5LBSH 4FQCL 4JY4B 2A6IB 2XZQL 3CDFA 5CN2A 1GZPB 4PV9B 1CGSL 5GSVB 2G3NA 5TFSH 4Z7VA 3NSJA 5CO1A 4FI7A 2HT3C 5EBWB 5GSRA 2HX9A 2G3ZA 3LKOA 3O6FC 5D1XE 1CE6B 1NBZB 3R18A 2JWYA 1WZ1H 1SUJA 5BXFA 1Q0YH 1U8CB 1VGEL 12E8H 3G08A 2JSFA 3L6FA 1U58B 4MA7L 2I27N 4TUUA 1AGCA 3JTSB 4D7PA 4YDLB 4PRAB 3WN5A 4L8BB 5E9NA 5IT2H 2YZ1A 4AGOA 2HN7B 5MEND 3HVNA 2ADFH 2ADGA 3HFMH 4PJCA 4RMRA 4C54A 3H6JA 1XSIA 2ZIDA 1HX0A 4PS3A 1CD1A 4LO9A 1NFAA 1KLFB 4J1UB 5KG9B 1U3HC 3EJRA 1VESA 3I50L 3D0LA 4OFPA 3U4EA 1LO5B 3NIDB 2I26N 2EIMB 3ZTJG 3CSTA 4H26B 4OCXH 3QZPA 3DURA 1SOSA 3KJ4B 5C0RL 1CD8A 1UZ6F 3ZHFA 4HF5H 5J57B 3D2UB 4XNUL 3GMPA 1KJ2A 1TZIA 4R2GD 2V2XA 3K80A 4M61B 3T77B 4LLQB 4U1JB 1FYTE 3QORA 2BNRD 2NX5A 2X4NA 5FHBH 4I1NB 1L7TH 2DZEA 1XL4A 5KJ4A 4FTVA 4IM8A 3V6OE 3I74A 4YMPA 4EKJA 2GBVA 3B1UA 4NQUA 4PTTA 3DIDA 4ZMAT 3Q44A 3VXNB 3U36B 4IU3A 3FT2A 4DTGL 1YEGH 2Z65C 3POCA 5IJKA 2FDBP 3MLRL 5JXAL 4H8UA 3MRQB 3ZBMA 3WAJA 3FTSA 5LLIC 2JKSA 2MNUA 4FG6D 5FLUA 7PAZA 3FO9B 3NYKA 4NPKA 3ZE0F 4BWUA 2ATPB 3QAQA 5F89B 4O9HH 3PF2A 3ZVVA 3AMKA 3W39B 2YPVL 5C0ND 1PFCA 3R4RA 4A6YA 2WSPA 4DZBA 1JYVA 5E2TH 1FF5A 2HT2C 3AQZA 3HZVA 4HVBA 5DGRA 4NSKB 2DQMA 3VXOA 4RCAA 3FB6B 1JN6A 3QEUA 1IEBB 3II1A 3ZSSA 2UXTA 1ZPUA 3OKYA 4JY4A 1RSYA 2A6IA 5D2LB 1OTSC 1GZPA 2GUOB 5D7LA 5GSVA 3TBWB 3GSNL 4N2OA 5EBWA 2EDRA 3GDBA 2P52A 1CE6A 1NBZA 3HRZB 4GO8A 4A2LA 5C0BE 2P8PB 4JFDD 1U8CA 5DSCB 2ZUVA 5F7UA 1U58A 2JQAA 1UXLA 3GLZA 3JTSA 3T0XA 1H5BB 4P57A 4PRAA 5DHVH 1S7QB 1ZLWK 3VNZA 2PXYB 2HN7A 3MLWL 1TZ8A 4KGLA 2D7OA 1MCEA 3REVB 2R0LL 3S3SA 2DIEA 2DOCA 4MNHB 4QRSB 2UVEA 4F2EA 3CFDB 4BE6A 1R24B 1KLFA 4B0MB 4J1UA 4J2QA 3BISA 3MYJB 4WSGA 4NGHH 5F7KC 3SB3A 5KG9A 2F2HA 3BD5A 4OD3H 3EDEA 4H26A 5AENA 3L7EA 3MRDB 1IQDB 2A3TA 3AS2A 1IE5A 3D2UA 3KZ8A 4QHLB 1OSPH 2ZKWA 3T0BA 1YJDH 3T77A 4P5MB 4LLQA 4U1JA 4EF3A 2W5PA 4AGQA 3FT0A 3SPVB 1GC1L 3WTWA 3MA9L 4ZQTA 3LEYL 4Q6IC 5AZEH 2VJ0A 5SX4I 2XN9E 2Y69B 3VSVA 3BPOC 4TOYL 2AMGA 4KKCD 3B5HA 4NXSA 3VXNA 2UXFA 2KZWA 3U36A 2BP5M 5F2FA 3PNRB 2A77L 4Z7IA 2EIBA 5L2JB 4KK9C 3MRQA 3KLSA 4NZRL 1VERA 1JZIA 4G6JH 4WU5B 1I9IH 1KC5H 5A6IA 3FO9A 2ZSVB 4UMGA 2ATPA 1E5UI 4W4NA 3KH4A 1E9QB 3ME0B 4HW6A 4W9ZA 5EZIL 1GOGA 3W39A 4FZEL 5C08B 5EV7A 3OAUH 5DRWB 2EEDA 3GXDA 2DEXX 1LDPL 4C8XA 1SF3A 3P4OB 3WFCH 4BRJA 1QFHA 5FR3A 1EGJL 4NSKA 1YEDB 2VNCA 2Y3NA 2VXTH 5IVZB 4OB5L 3FB6A 4PREB 2WBWB 1IEBA 2G0KA 3EO1A 5FYJE 4YNYB 3VI4B 2XV6B 5D2LA 4EDXB 3V4VB 4LXFA 2CXGA 1NCGA 3VQMA 2GUOA 3AQXA 4Y89A 5HBBA 2QADD 2CNZA 5I6LA 3HRZA 3NA9L 2X2UA 2P8PA 3HC4L 5DSCA 3NEEA 4RRPA 1TVHB 1AZVA 1NEUA 3RKDD 4LCIL 3BE1L 1YEJH 3POHA 4PJHF 3B9KC 5L4MA 2A4CA 1GSKA 1H5BA 5D71H 5T3ZL 1JVOA 1S7QA 2K9UA 2PXYA 1N6VA 1GZHA 4LU5H 3MFGB 3ARXA 2WCSA 3V0GA 2K78A 4QT5B 2OMXB 2QJDA 4MNHA 4N8VG 1WRFA 1CXKA 5I8KL 3D4ZA 3QFJD 3K6DA 4QNPF 3NIGB 1Y1UA 4P23C 3MYJA 4ZX3A 3W2DH 3PP3H 4XNBA 1QEWB 2DQGH 1H8OA 2PR4L 4HH8A 3QIBD 1UUNA 2F7PA 4FI6A 3SDXE 1W9XA 3MRDA 4WFGD 5DMIL 1IQDA 3S5YA 2ODIA 1CXIA 3ALWA 4HP5A 4QHLA 5TE7H 4PGDA 5C9KA 4RFOL 4AK1A 1TZGH 4P5MA 1AKJD 3SCMC 2BOLA 1A6TB 1WT5A 4JQIH 5DK2B 4N0FA 5E5LA 5EPMB 1QFUL 4PR5B 3SPVA 4J7RA 1ZJBA 3HS8A 1CR9H 1H3WM 3LHPH 3ARBB 3ARRA 3D4YA 4R4FH 4F7TB 4GXVL 4QHNB 3FU6A 1DQVA 1TO4A 4FP8H 2WUBL 4L3CB 5C09E 5L2JA 1JRHI 5E8DL 3CV5A 1QUPA 3QJQB 4URKA 3O6KL 4WU5A 1CICC 2OLDA 2AQQA 1KYOJ 3KGUA 2V3EA 3PABB 3ISWA 2AVGA 1E9QA 3ME0A 2VZOA 2PUQT 3L3OC 4YO0B 1DN2A 1X5LA 5C08A 3C5JB 3MBXL 5DRWA 2BRRL 3AT9A 3B7YA 4KTEL 2IPTH 4E41B 3P4OA 1F3RB 4ODWB 3WNLA 5SX4H 2IGFL 4OF8A 4ZUTB 3TBVB 4D3CL 1YEDA 5IVZA 43C9B 3CSYB 4PREA 4XAWL 3VI4A 4EDXA 4YNYA 4L18A 1PG7H 2ZX8A 4LBEB 3E38A 3JUYA 1EAQA 2AEPL 4H0HB 3V4VA 5BV7L 1A6VH 4G8IB 3BGFC 1KWKA 3WUWG 4EIBA 1AS6A 4JCWA 4XP6L 4V11A 2JLPA 1ADQH 3I9PA 1VB9A 2YRLA 2J21A 3MRNB 4NQVB 3S6CA 1NDMB 1TVHA 1I1FB 4CN6A 4LSRH 4KVPA 1Z66A 5ANMB 1R3HB 4N8CH 1D3CA 5F9OL 1SMDA 3HS9A 3HKFA 2WHVA 3IXTA 5FCSH 3H3PL 3EGDB 4QT5A 4WTWA 5PCYA 4KUZH 1NGQL 1KEGH 3DO4A 2CSPA 4GP8B 4ZMPA 5E8OB 1QEWA 4U7MA 4OUOA 3TT3H 4LESA 4CUCA 4DEUA 1JNJA 1RERA 1NAMH 2YEVB 3EJTA 3OV6A 5I1IH 3OAZK 2HRHA 3GTTA 3OKOB 3P4MB 3MN8A 5DQDH 5KJRL 1A6TA 5DK2A 5HI5D 1J1OL 5EPMA 3MRIB 2A9MH 4PR5A 2HLAB 3IM1A 3V6BR 3U0PA 3DPDA 3ARBA 1SBSL 5IKCB 4HIXH 4X4MA 2ETWA 1CI5A 3L5IA 4QHNA 5IFAL 4Y19D 5BZXA 4F5CE 4H20L 3EOBB 2NY2D 4L3CA 1DVXA 3LNFA 1IBBA 1Z5LA 1MJUH 5B39G 3HW7A 3I84A 3IFPB 3ESPA 1QVOA 2NY4B 3PABA 4KHTH 2NXZB 5GGVL 1YVLA 5C97A 3V0WL 4Y9GA 1M42A 1MWAH 1EJFA 3C5JA 4AXWB 1ACXA 3QBTB 1NBVH 4PS8A 3SD2A 3NCFB 4NUPA 3EYUL 3BQVA 1EJ6A 1RFDL 4ODWA 2P5WB 2BVUA 4ZUTA 4M5SA 1S9WB 1ODAA 3TBVA 2HPOA 3U9WA 3VU1A 43C9A 1JNLH 3CSYA 1BFVH 4XVSL 5DFVC 3NZUA 1WEJL 4OLYL 4R26L 2J71A 2SODB 3OKNB 4G8IA 4L1HA 2FAUA 1JRHH 1MFAH 3BP5B 5FOJA 4N2HA 1MFDL 4UUJB 1EZSA 4AQ1A 4AVKA 2NW2B 3LS4H 4NQVA 4TPRH 5ADOL 1NDMA 4ODXB 1U36A 1I1FA 1BQLL 1R3HA 3WY2A 4Z7NF 4LFHG 4G6MH 5I5JA 4N8VB 4MA8L 1RZFL 3CFBB 4L4TE 4Q4IA 1SYVB 3EGDA 4AC2A 4DUWA 3V52H 4KVNL 2W1NA 5ABZA 1E27B 5K9KA 5GZNA 4Y16C 4CGUB 1A1OB 1HL8A 3IKCB 5E8OA 3QPQC 4HIHB 2EADA 5F7WC 3N0PB 1G0YR 3PWUB 1HJCA 2GK2A 1BMGA 3WEXB 3C6SB 3OKOA 3P4MA 4HQQH 4RLDA 3TT1H 2X4TB 5DC9B 4K7PH 3MRIA 5DS1A 2HLAA 4AI7A 1ZDQA 1UWFA 3HE6D 3DO3A 3PYCA 3CZKA 2QGBA 2ZX9A 4QWWC 4QMEA 4OZGF 4XPAL 3VFGL 1YDPB 3ZTNL 4DGYL 3RWGA 1BBDH 5IKCA 4G6FB 3W81A 1QNIA 3BAEL 4KY1H 2LAAA 5HHNB 3SDYH 3TVMD 3EOBA 3T09A 5CSBA 5D7IB 2WBXA 1JPTH 2W9DL 2KT6A 3IFPA 2MCMA 3CZNA 4QKXB 1XMWA 2A74C 5D7JB 1A65A 3Q6FB 3HAEG 1I3VA 1CFTA 3TFBA 4IKLA 4AXWA 4WY7L 2XWBB 5DVMA 5DR5L 1GA2A 5F1NB 1KJ3H 3S0PA 4LRNH 4Y4KC 1UWXH 4F27A 1CXHA 2P5WA 4KI5E 4EOWH 5I1HL 1S9WA 4W4OC 5GS3A 1MZYA 1R6VA 3BN9D 1TVBB 4N20A 3WUWB 5C92A 2NPLX 5HD8D 3OKNA 5FYJH 3BP5A 2XTLA 4WDIA 4X7TB 1BW8A 1MHPL 4UUJA 1IO4C 3QK0A 1KGIA 2OW6A 2B3RA 2NW2A 2IADB 3HC3L 2Q6WB 5I1CH 1TYJA 4Q58C 1FNSL 5ELIA 4OJFH 3CDGB 1BECA 3VSUA 5DI8B 2J5WA 2VLJB 1F3DJ 4N8VA 4M7JL 5T33H 1CGUA 3CFBA 1SYVA 3FUHA 4X7CC 2J1WA 4IBWA 4UYQA 4KPHL 3JV6B 1E27A 5AVSB 2YQGA 4N0UE 1A1OA 3IKCA 2DF3A 2AJYH 3MRGB 4HIHA 4LGPB 4HIJB 1A7PL 1NOFA 4PCSA 1AR2A 1L5GA 1RULL 4WHYH 2AQRA 3IJ9A 2XFXA 4ZS6C 4JHZA 4MAYC 4EIUA 1BYPA 1U30A 2HLFC 4MJ6B 2VLKB 3G5XA 3PWUA 4PCTA 3U6XA 5IHLB 3WEXA 4BZ1L 3C6SA 1ACYH 1V8HA 3KPMB 5CM1A 2X4TA 4KUCD 4S0TD 3TEYA 3HA0A 3EADA 5BVPH 3SBQA 4WSJA 4KMLB 4J3UA 3OKKB 3WLBB 1J9SA 3I9GH 2O30A 4P9HL 1YDPA 5JR1L 1M71B 4W9EC 1CD9B 2G2RB 4CVWA 4AL8H 2NR6C 3FHAA 1LJMA 5IUCA 5D7IA 3QH3B 2C9AA 1SVCP 1OK0A 4S1QH 4C4UA 3FTXA 5D7JA 4GBXD 4PH8A 1TQUA 3D39B 1FH5H 3Q6FA 4X6CE 5FYJU 3PAZA 1NINA 4OH2A 2OTPA 5D1ZC 1X6LA 2KHAA 2DYSB 2XWBA 4GAJL 4P2QB 4PJBE 3DV4B 2PWGA 5F1NA 4YQXL 1PKQB 5CBAB 1Y0LB 3TX4A 5KYNA 2HXAA 5HDBB 3O41B 4M5ZH 3U82B 5AVVB 3SBWA 4B9GA 4WTZG 1TVBA 3WUWA 1J8SA 4JZOB 4HWNA 1OM9A 1JV5B 2MNWA 3ET9F 4X7TA 4XE0A 5DO2C 2H0EA 5BO1L 3D08A 2E7DA 1EO5A 4MJ5A 2Q6WA 1HYRC 2IADA 3IBOA 3QZLA 2PPCA 2QZ5A 4I0PD 3GC3A 3CDGA 5DI8A 5HHME 3IDYB 3HTLX 4JRXD 1YJDC 1NCCL 2W80C 2VLJA 3S37X 4ZXBC 5CEZE 4FQ2H 4QTHB 5ITBL 2NZ1A 5SWZD 3JV6A 4UT7L 2IF7A 1CLOL 5B7EA 1UB5B 3CDZB 3ZZSA 4NQCE 1PFOA 3PP4L 5C0EB 2RCSL 5KVDE 3A23A 4YE0A 2C9PA 2ICWB 4LKCB 5DD0H 3JWOC 3MRGA 4HIJA 1HL4A 4K71B 3IPFA 5I0ZA 1C5CH 3LKSB 1UD4A 3VFUB 3AZUA 3OWRA 5LAXB 5INDB 4PJGA 4NQDD 5B8CC 4NN5C 4MJ6A 2XXMB 2VLKA 3KL5A 4BKTC 2XIBA 4YHOL 2K1MA 2EYTB 5IIEB 1OTTD 2AJUH 4PJ7E 3TTYA 4F3FB 3EBGA 3ZGHA 4ZODA 3OKKA 5BZDA 4JK0D 3WLBA 3MROB 2NXYC 2EYSB 4HEPA 2A5UA 1M71A 3FQNB 4NO0D 4JO2L 4B9YA 3R4DA 2G2RA 3B2DC 2WWKT 3K5RA 4QRAA 4WFHD 3F3HA 4JFEB 1IGIL 2B77A 1FYTD 2DJ4A 3L81A 1WBXB 3QH3A 4G70B 1BVNT 1HE7A 3HAEB 2HYMA 2R15A 3WU1A 1MFBL 2NMSA 3D39A 3JVGC 2DW5A 4FMKA 3LKPB 5CILH 5IUSA 2P5EB 3S35H 4P2QA 1V5JA 3DV4A 1VKXB 3LZOA 5CBAA 1Y0LA 2I60H 4YOKA 4IRZH 3TNNB 5J56B 4L0ZA 4HUMB 1G7LB 3K1DA 4GXFA 1H15B 5BRZD 5J3HD 4JZOA 4QD2E 4XWOD 4Y5YB 3S3JA 1JV5A 1QPPA 2Y24A 4PN6A 5I0DA 4K3JH 1MJ7H 1W15A 4N0YL 4Z6AT 2BSCA 3TV8A 4K23L 3AW5A 2DQHL 1RLWA 3GMRB 4I4WA 3WO4C 5HYQB 1HVXA 3SOBL 4W9CC 3V4PL 2NY1B 5KUMA 2X1PA 1IIIA 1S7WB 3Q13A 5K69A 4K3EH 4NWUH 3K6NA 1USQA 1JGIA 2G60L 3KGSA 3W82A 2IG2H 4YHPB 1WWBX 3NABL 4IRJD 2MH4A 3GSNB 4QTHA 5L7XL 4EUPB 2IWKA 4XWGH 2COVD 1FG9C 2ORBH 1UB5A 3CDZA 4J6RL 1JHKL 4LLDB 5C0EA 4LKCA 3UZQB 4GBXC 1WAAF 3GRBA 5EUOF 2CIIB 3UCQA 4C59B 5JO5B 4LLYB 3TN0B 3FTVA 3VFUA 5IROD 5CGTA 5LAXA 3DX3A 5INDA 5FGRA 5FDYA 4KKAD 1KFAL 2J55A 3AQDA 5C0IB 4PJ5D 3NK4A 4MCZB 2EYTA 2VDPH 4H1LH 5E4AA 5IIEA 3FSZA 1S7RB 1I7RB 2X4UB 1F3DH 2FVNA 4OFIA 4F3FA 4O02B 4X4YB 3DXAB 2O5NA 4ANWA 1XF2B 2XU9A 2KH2B 4XNYH 3MROA 2EYSA 5C0FB 1MRFL 1TYRA 3FQNA 3RIAF 1W0WB 3ZX1A 1B2WL 2I5YH 3V2AR 4JFEA 4YHMH 1UZ6E 2VT0A 3TWCH 4TVUA 2L04A 3X13B 2WQUA 5DD1L 4H40A 2LE9A 3VRLF 3ZPDA 3S8FB 1WBXA 1INEH 4AGNA 2X6VA 5AVZB 3HAEA 1H3GA 4NO2B 3BUTA 3MCLH 3LD8B 2XN9D 3BZDA 4ELMB 4LL4A 4NI6A 5K33A 3LKPA 5JW4R 2J5LB 3NP4A 4ECNA 2P5EA 3MLPA 1ZD6A 1WUNT 2EDTA 2EIJB 5D1XC 3WE1A 1OHQA 5HGBB 1VKXA 1BIIB 2XTJD 2YFNA 3VW3L 3WKPA 4DEWA 4BGDA 1G7LA 3KEDA 4X7SH 1H15A 4Q89A 4Y5YA 5LBSL 3CX2A 3ZE0E 3ARUA 3QT2A 4DIXA 3SE4A 1ZT4B 1DR9A 4XPBH 3SGKC 2HFFA 1OAQH 3T3ME 5IJVB 1R5VB 3N2JA 4PJ8C 3GMRA 4Y4HC 5HYQA 2DBLH 4HJUA 1Q0YL 4ABVA 5HGDB 3D8MA 1S7WA 3SBRA 2H32B 1IAOB 1EFXB 1KBGL 2VUYA 5E7BA 5C2BH 2X9ZA 7FABH 4YHPA 2ADFL 2PWFA 4X2UA 3GSNA 2GAZA 4EUPA 1UXMA 2VLRB 1ZHLB 2UZIH 3H8NA 4KI1A 3CC1A 2CDFB 4N0RA 3R8BB 4LLDA 5FOBB 3ZK0A 3V6OC 3MRPA 1G4RA 4CVZB 5DMKB 3UZQA 1U4EA 4PD4K 3PHOB 2CIIA 4GIPD 1HHKA 1SRDA 5JO5A 4LLYA 5AKTA 4OCXL 1BJ1H 3QDME 2V9RA 3IFNH 2WGXA 2Q9OA 5C0IA 3KBEA 3DHPA 4MCZA 1RCYA 3L5XL 1R3IL 1S7RA 5J0BA 1I7RA 2X4UA 4P46B 1HXKA 4HOZA 2Q5BA 2E7LA 1L7TL 4O02A 3DXAA 1C7SA 3UTTB 1OP5H 4X4YA 1MCIA 1XF2A 4X80H 5AB9A 2XWRA 4YN3A 3IYLW 4PG9B 4XAKD 4XT1C 1W0WA 3ARYA 4AQ8A 4POZD 5AAWA 1YEGL 2C7UB 3KPLB 4Z7VF 3NK3A 1D5IL 4TLKA 4QRFA 4HXBH 2G3MA 2VKXA 4RGMB 3X13A 1XV8A 2H5UA 1I9RL 5LJYH 2FJGB 1HAWA 2W59A 5HHVH 3GPEA 1JGLH 4NO2A 2F54B 3LDBC 3WKMH 4CU7A 3BMWA 3E9TA 4DW2L 4ELMA 5JW4M 3P11H 4F33B 5I18H 1JXDA 2QVIA 5C6TH 4RESB 2CCLA 4IRJC 4APQD 4AY0A 1Q72L 4PJAB 1OGAD 1WFTA 4P2YA 5C09D 5HGBA 1GRWA 1BIIA 5E2TL 4ZAKC 1UWGH 4PJCF 3INOA 4WTZA 5KANI 3A4DA 2EVHA 2O6CA 4GINA 1JCVA 4KKNA 4GG6B 1J5CA 2VJXA 2PW2B 3RGVC 4NEHB 4YXLH 1P4BH 5IROC 2YJLA 3N85H 3BJLA 4JGJA 4KKAC 2HRPH 1ZT4A 4KJQC 3TCXA 4AV0A 1DZ0A 2JCCA 3QRFM 1LK2B 3NIFE 3TXAA 1A66A 2DM7A 4WJG3 5IJVA 1R5VA 5FS5A 3FULA 1U8QB 1QATA 3ISRA 3SDCB 1OGPA 4U0RC 4UT6H 1BGXH 4FKKA 4GQQA 4AITA 3MRHB 1PYWB 1EGJA 2H32A 1IAOA 1EFXA 3KNBB 2VQ1A 3LKNB 5CJOH 3U2SB 4K55A 5BV7B 2H0FA 2XX1A 3CLFL 5ICYB 3OZLA 1RD6A 3ARDB 4HJJH 4KTDL 5JQ6H 1QW9A 3H9YA 3UOAB 4LPVA 5LGKA 1AP2B 1BVKB 2VLRA 1ZHLA 3P4LA 2CDFA 5CR1A 5CEZH 4JR9H 5JQIB 2R4SH 2VRKA 2WZAA 4G8FA 5FOBA 4WQOA 2FEDC 3ZDXE 1UKTA 4NGHL 5DMKA 3WIIL 2X40A 4CVZA 3TF7C 3QXDB 2YAPA 3PHOA 4OD3L 5IQNA 4I0KA 1MJ8H 4PJHE 3TF4A 4JVPA 4NJ9H 4JLRB 2IGLA 1HS6A 1MW3A 2QHRL 4G72B 1OSPL 1TENA 1NC2B 5I8EB 3HG1D 3O9WC 4P46A 2APTA 1SN0A 3UTTA 4QNPE 2R0KH 4UANA 1HL9A 1OHZA 3FO1B 4CADB 4CSPA 4PG9A 3O8XB 3P4NB 1CL7I 1SXSA 2P49B 2XWTB 3J8F7 5AL0A 2C7UA 5I19H 3KPLA 4PJEE 1QTYT 4JFHE 5I1AB 1TSHA 3PY9A 4AYBA 3MLSH 4JPKH 2FGWH 2V5TA 3OKDB 2FJGA 4G6JL 2YAEA 2F54A 2CJUH 2VDLL 2ESVE 1QPXA 4KRMB 4ABWA 5L0QB 2YPKB 4F33A 1Z3GH 3OAUL 1GS6X 3WHE0 1E7UA 4PJAA 2E9GA 5GRVK 2DLIA 2FEEL 1M7XA 1R5WB 3QRLA 3WFCL 2GIYA 3E80A 4OQTA 4TNFA 4GG6A 1I3UA 3MJ9L 2OX5A 2PW2A 1KCKA 4OLWL 1XWVA 2BCKB 3NIDF 5FFGA 1UCBH