2X1AA

Structure of rna15 rrm with rna bound (g)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
GPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA 3'-END-PROCESSING PROTEIN RNA15
publication title Structure of the RNA15 Rrm-RNA Complex Reveals the Molecular Basis of Gu Specificity in Transcriptional 3-End Processing Factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/rna
total genus 19
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2x1aA00
4U67Q 2MZ1A 1ZH5A 5LSLA 4BS2A 1U6BA 3K0JA 4M5DB 2MQLA 4YOEA 3G96A 3UCUP 3S7RA 4F26A 1WHWA 2MY7A 1QVFR 3U1MA 1SJ3P 1X5OA 2CPHA 1RKJA 2MJNA 4OZ0A 2DHAA 2FY1A 2YWKA 2ADBA 3MI7X 1KQSR 3CCSS 1O0PA 5EN1A 5MLCV 1M5PC 2DNHA 1Q82T 4RU2A 3UCGA 5CXTA 2KN4A 2M7SA 1YJWS 1K9MT 3THPA 2MGZA 4CH1A 2DNPA 2MXYA 2YH0A 3CMAS 3J7ZT 1X4FA 2MPUA 2DNNA 3D2WA 1SJ4P 1U1NA 3SXLA 1IQTA 1N54B 2DB1A 3VAFA 2ZJPQ 2X1GA 3CPWR 2N3OA 4IOAQ 2V94A 4ZKAA 1M1KT 1JJ4A 3CC2S 2F3JA 4W92B 5LSOA 1WHVA 4ERDA 1X5PA 3RW7A 4EGLA 2CJKA 2DGOA 2BOPA 1ZZNA 2JWNA 2MQMA 2MSSA 3P6YC 3ULHA 5GMKa 2CQGA 3VAJA 1VQKS 3CD6S 3CCVS 1SJRA 1SXLA 4CH0S 1W2BR 3FEXB 4PKDB 3I56S 2DHSA 1G2EA 2SXLA 3CC7S 4C4WA 2M52A 2RNEA 5CYJA 2AYMA 2AYEA 2G1DA 4WFNQ 3L3CA 1X5TA 1KOOA 2NLWA 2DNMA 4V19X 2DHXA 2FC8A 4LIRA 1S79A 2U2FA 1R8PA 4CIOA 1U6FA 5DDOC 2KYXA 3UCZP 4TU9A 2CQ2A 3EGNA 4J5OA 2L08A 3P3DA 3CCJS 1YJNS 1R8HA 3TO8A 2KHCA 5BJRA 5IQQA 2A3JA 2XS2A 2KH9A 4OZ1A 1OIAA 2RRBA 3UD4P 3RW6A 1FJCA 2RUGA 2RQCA 3VALA 4Z2XA 2CQ0A 2F9DA 2CPZA 2KVIA 2LQ5A 4PRFA 2N7CA 2QFJA 5DM7Q 2DH7A 2LECA 2DNZA 2MY8A 3EGZA 3G71S 1OWXA 1VQMS 1X4AA 2KXFA 2FC9A 3MD1A 2KG0A 4WKRA 1NJIT 1WHYA 1NO8A 2CPEA 3JB9k 2KM8C 2CQCA 3H2UB 4TU7A 2RS8A 1FJ7A 4CQ1A 2J0SD 2LXIA 2PE8A 1YIJS 3SMZA 1Q86T 3VAHA 5DDPC 3NNHA 1OPIA 1X4GA 2DGXA 1WEXA 1VQPS 1SJFA 2DNKA 2CPXA 2DH9A 2E5IA 1HD1A 2E5GA 2CPIA 2MKKA 2DNQA 2VONA 5FJ4A 2RRAA 2K3KA 1WEZA 1OO0B 5CA5A 2DGUA 1Q7YT 5JVHQ 1WTBA 2I38A 3VAKA 2M4MA 2DHGA 3DXBA 3FEYB 1U1LA 1U2FA 3MUVP 2VOOA 3CXCR 4LMZA 3MUTP 1FJEB 2KXNB 2OSQA 2MQQA 2M8HA 2U1AA 3I55S 2JRSA 3R1LA 1DZ5A 2DIUA 1X5SA 2YKAA 2X1FA 2KRRA 2PEHA 2VODA 2LXUA 2DGWA 2LEAA 2MJUA 1FHTA 2DNYA 1XN9A 3S8SA 5DDQC 2RQ4A 3CUNA 4P6QA 2CQ1A 1PO6A 1VQ6S 1YJ9S 2CPYA 2B0GA 2MQPA 2KXHA 3G6ES 2G4BA 3TYTA 2CPFA 2MSTA 1WG1A 1KD1T 2M9KA 1P27B 1WG5A 5HO4A 2LEBA 1WF0A 3BS9A 2KI2A 3IRWP 2RVJA 2RS2A 1K73T 5ITHA 3CCLS 1SJQA 2ZJRQ 3CCQS 3CCRS 3G4SS 1N8RT 1QVGR 2MZTA 4TU8A 2MMYA 3ZZYA 1FT8A 5GAHU 1UW4A 3B4DA 5GADU 3MURP 2KFYA 5IM0A 3PIOQ 1VQ7S 1YWXA 1M5VC 2QA4S 2HVZA 2D9OA 5GVQA 2M2BA 2CPDA 2MKIA 1X0FA 1WF1A 1D8ZA 4IO9Q 3CC4S 4C7QA 2DISA 5HL7Q 1X4BA 3IWNC 4WCEQ 1HL6A 4W90B 2CQBA 4WFBQ 1U1KA 1F9FA 2CQ4A 4UQTA 1WELA 2HGNA 2DGTA 1HA1A 3MD3A 4YUDA 4F02A 3MUMP 1H2UX 2XS7A 2F9JA 2DO0A 2CQPA 5H1SV 1M5KC 2KU7A 2M0GB 2HZCA 4TLQA 3EX7B 2FPHX 2MQNA 2AYBA 3P5TL 2J0QD 3BO3A 3R27A 4WIIA 2HGLA 3SDEA 3BO4A 1FO1A 2MKHA 1YTYA 5LXYA 3CULA 3CF5Q 2LMIA 3UD3P 2E44A 4FXVA 2O3DA 2KT5A 2LCWA 2MKJA 5LJ3Y 1X4EA 1P1TA 3CCUS 3H2VE 4YB1P 1URNA 3ZZZA 1VQ9S 3MXHP 2MYFA 1WG4A 3HHNB 2ADCA 2Q79A 2WBRA 1U1RA 5DDRC 1X4DA 2JVOA 1AUDA 1N52B 2E5JA 2MZSA 2KG1A 3CCES 2HYIB 1D9AA 2LKZA 1H6KX 1RK8A 5D78A 2MQOA 3R1HA 1X4HA 2MHNA 1NU4A 3NMRA 2ZJQQ 3NNCA 5JVGQ 2DO4A 2RU3A 1A7GE 2NZ4A 3Q2TC 5IFMA 3CMES 2G0CA 2QEXS 1H2VZ 5GAGU 1H2TZ 2DNGA 2MGZB 1DBDA 2GHPA 3B4MA 3Q2SC 1U1MA 1U1QA 1VC6A 3VF0B 1UFWA 2KRBA 1WI6A 3PIPQ 2X1BA 1QM9A 2MZJA 3LPYA 2OIHA 4QU6A 1M90T 2EVZA 3US5A 2YTCA 2HGMA 4LJMA 3OW2R 2RT3A 2FHOB 1JJ2R 3G8TA 2I2YA 2J76E 2N3LA 5D77A 2VOPA 1K8AT 3S01A 2XSFA 1WI8A 4ED5A 3THTA 1DHMA 1FNXH 3LQVA 2CQHA 2AD9A 1U1PA 2M8DB 4C0OC 4WF9Q 3CCMS 2XB2D 4UY8T 2LA4A 2CQ3A 2DH8A 1PGZA 2OTLS 1YITS 2LA6A 3G8SA 2DGSA 2J8AA 5GAEU 1VBXA 2D9PA 1FXLA 3BEGB 1YHQS 1ZZFA 1VQ8S 1VQNS 2DK2A 5IM0B 2MZRA 4PR6A 3TP2A 2MKSA 3VAGA 4QPTA 1VC0A 2XS5A 1WWHA 1Q81T 2EK1A 2M88A 1JJHA 1VBZA 4F25A 2YH1A 2MKCA 2DNLA 4Y0FA 3NNAA 1UP1A 1BY9A 2DGVA 4WFAQ 2XNQA 1VQLS 1X4CA 2MZQA 1CVJA 3CTRA 5DM6Q 1VBYA 4Y00A 4A8XA 2EK6A 3UE2A 5LXRA 3VAIA 1S72S 3G9CA 2ERRA 2DGQA 3DLLQ 1JMTA 1KC8T 1VQ4S 2XNRA 2JX2A 3U1LA 1DRZA 2BZ2A 5DETA 2DIVA 2KM8B 2X1AA 2D3OR 1VQ5S 3MOJB 3SDEB 3N9UC 3J7YU 4IOCQ 1U1OA 4QU7A 2N82B 3BO2A 2CPJA 3MDFA 2CQDA 2DITA 4IUFA 2LYVA 1L3KA 1B7FA 3P49B 3VAMA 1WF2A 1WHXA 1VQOS 2OSRA 2DNOA 3HI9A 1A9NB 2OJ3A 4FXWA 2M70A 3S6EA 1VC5A 2E5HA 2OTJS 2UP1A 5LJ5Y 3V4MA 2L41A 3NS6A 1WEYA 2MB0B 1M5OC 2AYGA 1YI2S 2L9WA 1UAWA 3NS5A 2DNRA 1HD0A 1KOHA 2CQIA 2JVRA 2K8GA 1N88A 3UWTA 2GO9A 4QQBA
chains in the Genus database with same CATH superfamily
1U8SA 1KP6A 4OMFG 2BYCA 5F9NA 5F8GA 4O3PA 1GFWB 1RWUA 1XMQF 3UCUP 1SB6A 2DXEA 3LAMA 2EG2A 1TKTB 5KFRA 3RB3A 4WXWA 2MJNA 2XZTB 3DHXA 4X4QA 2YWKA 3GFZA 2NZCA 2XHCA 5MLCV 3DU5A 3OLBA 3BKFA 1EB0A 2OO4A 3OFGA 1T9XA 1HWLA 3ZTPA 3HHLA 3AA8A 3HFZB 4NXMF 5LMUJ 1CJVB 5LSOA 3RB6A 3ZC4A 3G82A 2EXUA 1R8CA 4X4OA 1PJ6A 3KJVB 4C4WA 2VU5A 2Q3PA 2ZH5A 5FDLB 3NY0A 1IM4A 2R7XA 1T9WA 2IYGA 4IFYA 3M2VA 4X4RA 1R8HA 3GE9A 4QWCA 3HD2A 4EWTA 3LUYA 2CNLB 4Y34A 3TZXA 1X7VA 2D69A 3DI6A 1NJIT 2DJWA 4K4SA 4L3NA 1EX8A 4ZVPB 2BE9B 2OPPA 1J5OA 5J1NA 3QLHA 2J9CA 2EFVA 2HEKA 1JLCA 3IS9A 3LANA 3KHRA 5JXSA 5E3RA 2R8JA 3WX8A 1VR6A 1N56A 1R8BA 1U1LA 4M5DA 4MK7A 1N4LA 1V3ZA 2HNYA 2MLXA 3DYAA 1SUQB 1TELA 1R31A 2RB7A 1KWMA 3R1LA 4OHYA 4X65F 4QIFA 3GMGA 5J2QA 3OFEA 3S8SA 1UVIA 4H4OB 3EXCX 1WOOA 3D0GE 1F2GA 3RR7A 1KD1T 4IR1A 2LEBA 4TY8B 5ITHA 3CCRS 1IJFB 3OJUA 4A4JA 1N8RT 3M30B 3KHGA 3KKFA 2BBEA 2D7SA 2OFHX 2AJ1A 2PIIA 1VQ7S 3EMTA 3I31A 2ASDA 4ZPCA 2CPDA 1N5VA 2LDIA 4MH8A 3T1HJ 4WFBQ 3GU0A 4QIEA 3LGNA 4F02A 2F9JA 5I42A 4OYWA 2Z58B 3GFYA 4DR1F 2UVRA 2XMWA 3LWLA 4ILMA 2LMIA 2B4VA 2G0JA 2NXEA 4IFVB 1RLDA 2UUBJ 3G8QA 4NZ0A 3MXHP 4ZVQB 5HATA 2Q79A 2WBRA 3PFOA 4ZVTB 3CCES 1WSRA 1MW7A 1RK8A 1UEKA 5DLGA 3U02A 2PC6A 2NXNA 4RW6A 3HVWA 2C2NA 3R5JB 2W9AA 2AQ4A 1N0UA 4XDDA 4URSA 4PEOA 1Y9OA 4MKAA 2AZ3A 3SQGB 1FFSB 1WC0A 4QU6A 1M90T 3LGMA 4DL7A 4FPRA 5B0EA 3B54A 2XGQA 1IM6A 3HO1A 1W25A 2J76E 1GT8A 5HI7A 3S01A 1VLOA 2UXBJ 4ZHRA 4BLGA 4DV4F 2RH3A 4E0DA 2FYXA 2XMJA 1RT2B 4ZVSB 3BZQA 1ZS6A 2VG7A 3HFKA 3J7YI 5H9EK 4LT6A 1FESA 4OX9F 1PGZA 4WXOA 4X62J 5E3CA 4NA2A 3EVMA 1MG7A 1Y3KA 3GIIA 1TV6B 3DLHA 3HHLC 4ALZA 5ETOA 4PR6A 2M88A 1UJ4A 1I5OB 1HNZJ 2IDLA 5EX3A 3ZNJ1 3POTB 2IRYA 4LF9F 5THWA 3TAMA 5KFJA 1IWAA 3PDNA 1J5EJ 1HNXF 1N5TA 2ERRA 1VQ4S 4RW4A 2VG5B 1RWVB 5LOQA 3D9BA 1VMBA 2APOA 4JI1J 4Q2LA 3MM8B 3OVSA 2VG6A 5KFNA 1C1CB 4ZA1A 3F73A 3MEDB 1L3SA 2IJRA 3H40A 5C5JA 2AYGA 5KFKA 1IBLJ 2L9WA 2NREA 3QFWA 2GO9A 4O4GB 1P9YA 4U67Q 3DGPB 1IN0A 3FCVA 4B3OB 1DTTA 1SKWA 3QWPA 3G96A 2HVDA 3W9JA 4CYUA 3PKMA 2JSXA 5CABA 5B0DA 5IXUA 3HHLD 1RKJA 4KTQA 3ZO7A 2V2ZA 4IOBA 1RTDB 4ED0A 1LWCB 3CCSS 1YKWA 5FLXY 1J27A 5M2UA 4MKVA 2MDAA 1GK8A 1YJWS 3TZYA 4DZ6A 2IMOA 2QO3A 3J7ZT 3KOAA 3DLEA 3D2WA 4ED2A 1SJ4P 3MR3A 3ILOA 1E6YA 3RG6A 2V4RA 1FA0A 1M1KT 5E3AA 4ERDA 3FDSA 2KJVA 5GMKa 3LA0A 3E8OA 2RE1A 3IP0A 1MMLA 1XR7A 2H3EB 3CCVS 1SJRA 2V2KA 3LWMA 1XNRJ 4LR8A 1MSWD 2CRLA 4ZPDA 5F0UA 5CYJA 1TK0A 1CS4B 4N77A 4L6V3 1KOOA 3TJAA 2OD4A 4JI8J 1P8GA 3N6MA 4JOUA 3LH2S 4TU9A 2Y0SD 4Q45A 2ZBRA 1Q8IA 2XC9A 2CUYA 2Y8WA 2RSQA 5J2MB 2HBZB 2WHOA 3N0VA 1OIAA 1U6ZA 2ILYA 5KFMA 4A8SA 2FVSA 4Y6IA 4USWA 4MFBB 2LQ5A 4PRFA 4A47A 2LECA 1MN9A 2E29A 4I2QA 1DFDA 3BQ1A 1U49A 2DRDA 1SC3B 5KFTA 3ILLA 4B3RJ 5ADZA 3T6BA 5HLFA 2ZH2A 4WFYA 2BRLA 2ZH9A 1OQ6A 4ENOA 4X66F 2HRUA 3VAKA 4A48A 4MIBA 4XTTA 5ETQA 3CXCR 1UA0A 4LMZA 3Q23A 4K8RA 1GEHA 4WK3A 2YKAA 3KK1B 2HQIA 4UZCA 4DX7A 4WJBA 1X60A 4V19J 2HNDA 1FEHA 3RRGA 1BUXA 3SV3A 5DDQC 4M5GA 4K2XA 1XC9A 1ZPWX 4ZN1A 3KG4A 3VVTA 3BBBA 3HF5A 3GJSB 4NLQA 1RQ0A 1NBEB 4DR3J 2AKWB 2FGCA 2EW9A 2PA8D 3AOAA 5GAHU 4A8OA 1UTAA 2ASJA 2GGPA 2F65A 2ZWOA 2XWYA 1IBKF 1WF1A 4YDXA 1NPPA 3IWNC 4WCEQ 4P75A 2CQBA 1BE4A 3VZHA 4ECVA 2K7JA 4DWIA 1RWMB 4TLQA 4URGA 2HPUA 2AYBA 3A13A 3TVZA 4WIIA 1PJ7A 3DI6B 2P9EA 2RF2B 3KLIB 2E44A 1J5OB 2Z2MA 2WW8A 2HHHF 5KFPA 1H74A 2PT0A 3PYFA 4I6AA 1QUVA 3QT5A 4FF2A 2K2PA 4MK9A 3HLUA 4ZMMA 1G3OA 4DL3A 5D3GA 5HVHA 1S7HA 2RU3A 3Q2TC 1TK8A 2C22A 1AA1B 2ROPA 4N41A 4LF7F 3DYAB 1TL4A 3MFHA 5KTQA 2CG4A 2CJQA 3AXKA 3B78A 4CTAA 1RU1A 3PIPQ 3US5A 4MKBA 3PXGa 4DXLA 2L3MA 4DSKA 3T19A 2N3LA 1CEZA 5KT2A 4C8KA 3HX9A 3SQOP 3DHWC 3RBZA 3LQVA 3G86A 4MKYA 5KFDA 3ZTQA 1TMJA 2YKMA 1NNDA 4PXBA 2VQFF 2PI4A 2DR6A 3R5DA 2HAIA 4LREA 4X4SA 1SIZA 1VQ8S 5CYQB 1NDKA 3TOQA 2WSFC 2MKSA 2QL5B 3CD0A 2IAJA 2YH1A 3BSAA 4UT4A 3OTBA 2VQEJ 2HS3A 3SCIE 2CVEA 4OYAA 4O23A 3HZEA 4LFCF 3AHPA 3TAQA 5GAGI 4M8LA 2EWHA 3ZZRA 4NLGA 3M32A 4A8KA 2DIVA 2DKOB 3C6TA 4YY3J 4EYHB 3D0IE 5LMNJ 3D3BJ 1WF2A 4DL0C 2HLTA 3QPIA 4NL5A 3HZGA 1VDHA 3KYLA 3K17A 4OI0A 4F2RA 1Y5IB 5BYRA 4PPZA 2IY5B 3W1YC 2HS4A 2QG9B 3RAMA 4RW6B 5GAEI 2EBEA 2QMXA 1KNZA 1SQGA 3BB5A 4PG4A 4OZ0A 2FY1A 5A76A 3FRZA 2BM1A 1RABB 4TYAA 4RU2A 3OR2B 1RCXB 1C0UA 1DQ9A 4D3HA 2M7SA 3QRPA 4O44A 1IKVA 2GVZB 5A2QU 2KYZA 2DNPA 2VG7B 2H5EA 2B8QA 2MXYA 1SKSA 3DGVA 4PUOB 3FQLA 1SKRA 4LBIA 1N54B 4DQRA 2J7UA 2ZH4A 4EK2A 1JJ4A 2JNJA 2F3JA 2FGOA 3HSZA 4LRCA 1CJTA 5AXKA 1RADB 2F8EX 2C42A 1C4CA 3VAJA 3GG0A 4B9SA 3WC2A 3FCWA 1OJ4A 1HWJA 4I2PB 4DHVA 2GNKA 4RNNA 1B0PA 4RWWA 3FJ2A 2FJVA 2Z30B 3QNWB 2R7OA 5KFYA 1TL7A 1RT7A 1TAQA 2B7CB 2JFKA 4I6YA 5C2GA 3RBXA 3UDLA 2OPSB 2XCAA 2F9DA 2KVIA 3BKUA 5DM7Q 2DH7A 3K5OA 1VQSA 2C3MA 1RAOA 2YQ0A 3UFCX 1LW0A 5ETNA 3UVJB 1M5SA 2VZ9A 4TYBA 4CQ1A 1F3VA 3MCSA 1DTTB 2UUCJ 1U0SA 1N0VC 4Q44A 2E9TA 3M8SA 3AFGA 1VCTA 2DGUA 1K1SA 4JV0A 2HMIB 4A8FA 3D6MB 1TKDA 2I38A 3C6UB 3B8HA 2C1EB 2QLJB 1U2RA 5L9XA 2F1FA 1PC4A 3DLBA 2OSQA 3EWGA 5CD4H 3UO0A 3BBFA 1RHUB 1NM2A 4ZLLA 3QAUA 3Q24A 1RA6A 1YGYA 2DNYA 1FNOA 2XMKA 4BCAA 1YJ9S 3JTOA 3DDNA 1YQHA 1LFWA 4KHPJ 1S1WA 3MMCB 3IRWP 2RVJA 4C6AA 1PBUA 2BJ1A 3IAM9 5ETSA 1B70B 1URRA 3H5SA 1I51B 2ZC3A 2KFYA 1CJKA 1LEOA 2IM1A 1GX5A 3FBBA 4K0KF 4G1IA 1X4BA 1RJJA 4PXDA 1HA1A 2NPFA 4DR6F 4UZBA 2BJ7A 1VJQA 4JI6F 5HMZA 2VPYB 5ETLA 4I2QB 3UDEA 2B6AA 2KT5A 1YBTA 3DRPB 3H2VE 3I0SB 1U02A 4PWWA 3R9LA 1SL1A 1HHQA 1ULRA 4UQGA 3RRKA 1TUGB 1N52B 1EP4B 2LKZA 4B3SJ 4LVNP 2K06A 4NLRA 2NZ4A 2E7XA 2YX1A 3CJ3A 4OJHA 5GAGU 3PCOB 1FKAF 3KXDA 2D3O1 2WBMA 1U1MA 4NRUA 1GTEA 3AOBA 4H54A 2QMUB 2NSBA 2VBZA 4RJVA 3MAHA 1LV5A 3OW2R 2HS0A 1ZM9A 1CULA 3GJQB 4LBPA 1DHMA 3QO9B 4KJIA 2AD9A 4B9MA 2AT1B 2LA4A 2GQ2A 3GR0A 2MLZA 3I5CA 5GAEU 4FBUA 3T1HF 4DPOA 4QWAA 4OZJA 1YHQS 4WTOB 1RU2A 2B4PA 1SVDA 1VC0A 1FK9A 4DPXA 3J80U 1VBZA 1YJVA 1N33J 4OLPA 4ZP8A 4JI0F 2JZ5A 1EIYB 5C25B 3C14A 1JX4A 2ZBCA 3UE2A 1VRTB 3F56A 4F04B 2V8VA 4HACA 4QU7A 1OSCA 1F2HA 2CPJA 4NI2A 3GR1A 1TAUA 2DCLA 5BR8F 4K4TA 4PQUB 2YPZA 4DS4A 2D41A 2GHWA 1VC5A 4P2MA 2R7RA 2UP1A 4DU8A 1QJHA 3TVKA 5EHHA 5D6GA 1U45A 4HTIA 3UWTA 4RL1A 3CCZA 2RRNA 3PW2A 4N7TA 3VGTA 4ELUA 1WHWA 1QVFR 1X5OA 2R7SA 2HWIA 3V4IA 4MK8A 2QL9B 4RW9A 2HQFA 3MI7X 3HSDA 4KFBA 1M5PC 4X62F 3UCGA 1KR4A 1RSCA 4IYQA 1L3VA 2RILA 1VIOA 5GMEA 3LF0A 3BGUA 2M5YA 4DX5A 3VAFA 3CPWR 4ZITA 5B0CA 3JTNA 5F8MA 2CJKA 5B09A 4DR4J 2WVDA 5KFXA 4ED7A 2ZUAA 2ALYB 3T41A 4KHMA 3M1VA 3M6UA 4JI1F 4F4KA 3HD1A 5HQLA 3K2YA 3DKDA 4NXNJ 1IBLF 2YKPA 2VICA 4F4WA 2HHPA 5KT6A 2Z8QA 5C24B 2V4JB 2XLJA 5AXMA 3ZFVA 4R5PB 1UKUA 1T11A 1UETA 1V3SA 4DR7F 2KG0A 2CPEA 3RR8A 2GVDA 5HROB 5LM7E 4AD6A 2J6UA 5C42B 1SL2A 2W9CA 2QIFA 5D0RA 4HEA9 3KLFA 2C3UA 4LIWA 1ZM4A 1F3FA 3PRDA 1S1XB 2KHDA 2V0NA 4YP3A 1I6JA 1C0UB 5F9LA 1U2FA 4B3MJ 4X64J 2PDAA 3EXYA 4RW8B 4K4VA 4NX9A 4Y2MA 1HR0J 3AOCA 3TWZA 2KRRA 3KG1A 3RB0A 2MJUA 5T7LA 2ALZA 4NPOA 2A0FB 1CJTB 2CIMA 2KL8A 2QJ3A 1T8EA 4C11A 3G6ES 4OHVA 1VRUB 3DLGB 1GMWA 3NXZA 3U27A 1AFJA 1U7LA 2E1CA 1T9UA 1HW8A 4ECWA 1FTRA 5IT9Y 7FD1A 2ZWPA 2FDNA 2BKOA 5HSPA 3AXMA 2XY7A 2DISA 1TL7B 3MR7A 1F9FA 4A8MP 5KG7A 1LW2A 1ZM2A 1HNIA 2CQPA 1JLAA 5H1SV 2M0GB 4H4KA 3MECA 3MR2A 3JQKA 1VJWA 1LW0B 5KG1A 4TKTA 2N4DA 4RBVA 1XR5A 4DL6A 3ZZZA 4B9VA 2MYFA 2ADCA 3AD8C 2WB4A 4Y2AA 2OEMA 5DDRC 4GRSA 1RT3B 3CJ5A 3VV2B 4ECRA 3I5BA 1X4HA 1C2PA 1VLYA 3PY8A 4LF1A 3KLEA 3DFEA 5IFMA 2QEXS 2UV8A 2MGZB 2ZVIA 2ASYA 3GWCA 4OV6A 3MMBA 3LP0A 2KRBA 3VGUA 5A8KA 3CJ0A 4U6PA 4QIWD 1S1VA 2VC1A 4C0HA 3AQOA 2HFVA 2HZVA 2P9CA 1FERA 2V68A 1FRJA 2NXUA 2YNHA 1S1WB 2UUWA 2NR0A 1BGXT 1R0AB 2V5HG 4RUBA 5K8NA 4G1QA 4GO7X 3K7RA 4QIVA 3A8JA 2JH3A 3VAGA 4LFAJ 1YZ7A 3CIMA 3DN9A 2WCXA 5DQIA 3EUNA 3CD7A 3QWUA 3I5AA 1MWYA 3PW4A 4USTA 3J81j 3R6LB 3HP6A 4I64A 5A6WA 1EETB 4Y2KA 2D3OR 3V81A 5HJXA 2LYVA 5U47A 2DEIA 4KH1B 4OZ3A 2XWXA 5E5NA 3LAKA 2FLNA 2KO1A 4TN2A 4HYKA 1RBLA 3HI9A 5KFUA 5A8RA 3QSYB 3IWLA 2VASA 4DFMA 3W2WA 3DOMA 2EKYA 2CDQA 3PR4A 1AUSL 1AROP 3RAXA 2K8GA 1Z2ZA 1N88A 4QQBA 4MIAA 1CQNA 8ATCB 4EBEA 2MLYA 2VBWA 2VF3A 3J7AN 4HHJA 4JI5F 2AW0A 3AAWB 3S7RA 1HYSB 2AGQA 1CLFA 4DV1J 3TUIC 1ZBTA 3UDVA 3C3LA 2CZ9A 2B7BB 2HFOA 1PBAA 1R0BG 4HR2A 4AT1B 1FRLA 5KOWA 3KG0A 3UR0A 1RBAA 4ETXA 2BVZA 4F0MA 2AZ1A 2HQ3A 2CJAA 3I0RB 3UI3A 4MIWA 2RDIA 3I4HX 4MMOA 2FJBB 3CC2S 2W9BA 2YNIB 2ZE2A 4B9TA 2HVHA 4AUKA 5T14A 5D15A 1W2BR 4HDHA 3TA1A 3HDSA 2P9GA 5BYQA 5LMNF 3GYXB 2E9RX 1X9MA 1NSKL 3OHAA 2G1DA 2A2CA 3M2UA 3HMJG 3PYEA 1FJGF 4NI2B 1VBKA 2CQ2A 4J91A 1N5YA 3BM7A 1P9QC 1B4SA 4X4VA 1Y7PA 3OD2A 3LGHA 4IH6A 3M8YA 1SH3A 1O5JA 1JLEB 2UUTA 3EGZA 3G71S 1I94J 1QAYA 4LF5F 3DRRA 4H4KC 3QYYA 3TQEA 1NK6A 3FBFA 2VPXB 3C16B 2HIQA 3CJKB 1WEXA 4JBCA 4Y65A 4O3SA 2MKKA 2VONA 4RW9B 4ZVOB 4C8ZA 4KFBB 3T5HA 4YHHJ 2DHGA 1JWWA 3FEYB 5KT5A 1KTVA 1GMWD 1YG0A 1S1UA 3MM7B 1ZA1B 2Z57B 1GH8A 1RGVA 3KK2B 4LF4F 2YPYA 1HBNA 2BJDA 4RZRA 2Y9HA 4J9KA 1O51A 1XMQJ 4YR2A 1ZAXA 2NYHA 1BQNA 4CO1A 4ETZA 2LFVA 5I3UA 3LO3A 1JLQB 3PHEA 3CCLS 1XWLA 1SQEA 1W2IA 1VIXA 3GV8B 3QT8A 3ENAA 1M5VC 2HVZA 2FVRA 4ZLNA 3DOLA 1HIYA 4L73A 1UPMB 5L1LA 2VBYA 3GYNA 1T3OA 4AQYF 1HMVB 2WOMB 4PG8A 2QA4G 4DCPB 1FF2A 1YSJA 3M6WA 2XLIA 2MQNA 2HBYB 1YX2A 3LALA 1UCNA 1TVRA 4KV8A 2AJ2A 2HBRB 2H5IB 5GMDA 2PMWA 5C7PA 4FXVA 1PYOB 4HI1A 2MKJA 3CCUS 2W9CB 2AX0A 4OZNA 5IV4A 3KLFB 3MZIA 1PAEX 1X4DA 3DCAA 2GJ2A 1H6KX 2J7KA 2GMLA 2MHNA 5IZHA 3J7A1 2ZJQQ 3NNCA 3R5CA 4K4UA 5IWAJ 3IWXA 1PG5B 2O5DA 2HK3A 1DBDA 3DMJA 2GW8A 3HSGA 1JNRB 1GX6A 2ZD1A 3GZ7A 2QMWA 2R9LA 4XAKA 2BOAA 3KTQA 4CO4A 1OSDA 1U48A 4U95A 4NLOA 4XO0A 1WC4A 3A8EA 5EWFA 4FDFA 1S7IA 1QD1A 1RT1A 5HP1A 3G8SA 3T1YF 1RT5A 3H4DA 3NBPA 3FFIA 1JXVA 1JKHA 2IHR1 4QPTA 4X65J 1GQEA 4KGZB 3AJ1A 2Y0BB 1RBOB 2EFNA 2H9ZA 5E2QA 1JLAB 1HQUB 1DRZA 2BZ2A 4OI2A 5JUMA 5CCLA 2QFIA 4B3SF 4E98A 2AX1A 4FYVB 2ASLA 5F0WA 1R6VA 3IBFB 1FFGB 1MN7A 2MB0B 1SV5A 3SYZA 4FKYA 3GCWP 3PVXA 2R7WA 2Z4PA 1KOHA 1RTHB 3TARA 4DQSA 2H65B 2EEYA 2AMCB 3D6TB 4IG0A 8AT1B 2YVSA 3AB4B 3LP0B 1TL1A 2BE2B 2JJ4D 2B56A 2QE5A 3RU0A 3U1MA 5A8KB 4J9UE 5EWEA 4NLYA 1TQLA 2OPRB 3TJ9A 1HNVB 2YNHB 3EPGA 2YQ3A 2FZCB 4IQMA 3GP9A 2GMJA 3PX6A 4WE1A 4C2MA 1AFIA 3OXGA 3VGVA 3B6BA 3PM9A 3N5FA 1N33F 4ANEA 4IR9A 3GSIA 2UVVA 5K20B 2H4WB 2JWNA 4EUVA 4WKYA 4AL6A 2CQGA 2LXFA 1D1UA 3GV5B 7AT1B 4HI2A 2UUAJ 4DV4J 1XEZA 1FE0A 5J2PB 3W64A 3M7VA 3KK3A 3UDCA 3VCDA 2LQJA 2FC8A 4NLSA 4LIRA 3V81B 4HH0A 1JK9B 1REVA 3D68A 2FY8A 2UU9J 3ET6A 4PWDA 5G0RB 5BXIA 3BH7B 3OPKA 1LXJA 4Q8FA 1YLXA 5HK4A 1C0TA 1FJCA 1H98A 5CHCB 1R89A 1KS2A 1Z2LA 2HWTA 4A8YA 1RHQB 2A18A 2ZITA 4PXCA 1N5SA 2IBKA 2EG1A 1YDLA 4KGVB 1HNXJ 1DAXA 4DV0F 4RWXA 4KHRA 4LSNA 2QC3A 3OUYA 1FKPA 1SJFA 4QJVA 2CPIA 4QYRA 5LL6d 5B0AA 1VRQC 2DYAA 2VL1A 2H1YA 1Q8BA 1ZYQA 5DGAA 1FJEB 4C48A 4J90A 1JLBB 4DR4F 1W7WA 3AQPA 1PYSB 1LK5A 1TKTA 1DZ5A 4J9LA 1HNWJ 2KFZA 2IPOB 1FHTA 2HHXA 2ZE2B 4ZVGA 1XN9A 1TFYA 1TKZA 3MM5A 4O0NA 2R7VA 1CJUA 2F5GA 5CAAA 2VA3A 4R25A 1P27B 1ICEB 1LQ9A 2QA2A 2V8HA 4TU8A 2K1RA 1CJVA 3W9HA 5L8RC 4ED8A 3FMBA 4I0WA 4KO0B 5I3QA 3A8KA 3EZOA 3Q8QB 1D8ZA 2P6TA 2IM2A 4C7QA 5LSRA 4ECTA 2HFZA 1N5YB 3L7OA 2AV5A 1U1KA 4LF6J 2CQ4A 1GMVA 2YWHA 5KOXA 5A0YB 3QJJA 3AJ2A 2B4UA 4QR2A 2HHQA 3SDEA 1NEEA 1CPZA 5E0OA 2I1RA 4ANDA 3L09A 3HT3A 3R3TA 2P6SA 3CEDA 3M8PB 1NK5A 2HBQB 2W7PA 2A6MA 3IFEA 3KUGA 2L9DA 2Z2LA 4CDIA 1S48A 4B3MF 2MZSA 3K57A 2FJXA 3R1HA 1NU4A 4KKOA 1WJ9A 3DRXA 3NWGA 4GMKA 4ID5A 1S1UB 3CE8A 4OIXA 5GADI 2IVYA 3GTYX 2UXCF 1N36J 1VISA 1LWXA 2I2YA 2CXEA 1NDPA 2CJBA 3MR6A 4ED5A 2VD3A 2WSEC 1UVJA 3LOUA 2M8DB 1RUSA 4EMDA 2DH8A 1SUQA 4LRBA 4OZ2A 4X66J 4C8NA 2PA3A 4LR7A 2FVPA 4ES1A 3EZ5A 4G65A 3K8WA 1F0XA 4L76A 4OJGA 4CO5A 2XNQA 3DC2A 4TY8A 4J37A 3M30A 2EK6A 4Z7YA 2RUSA 3BQ0A 2V9KA 4FYDA 2DGQA 2QL7B 1NB7A 2AJ4A 2F40A 5A2QY 2B9EA 3OFHA 4ZVHA 4P2FA 1N34F 1EKRA 1U4BA 1BWVA 2E5LF 1EKSA 2OJ3A 4FXWA 1TTHB 1IBKJ 1H7WA 1NJXA 2GQQA 4Q7AA 2ZHAA 2IM3A 2VFRA 4OI4A 5KG6A 2DNRA 3NL0A 3C2PA 1HBMB 4RNMA 5KFQA 1NHUA 1XBWA 4NCGB 1QAXA 4Q8EA 4ECXA 4OHZA 2PMZD 3GILA 1HQ2A 3HULA 1NCLA 2HHHJ 2ADBA 1UEVA 1FXDA 3D5MA 3Q8UA 2OD6A 3QZ7A 3IR7B 5CXTA 2OGUA 4LFAF 4QOTA 4BHQA 3CDUA 3SQGA 2Q6BA 3NS7B 3AD9C 3FFIB 4IQXA 4LFBJ 2V94A 3HKZD 1JKHB 2QLBB 4LF7J 6FD1A 1MNEA 1SC4B 3RJMB 4JI2J 1U47A 3RUBL 4ED1A 4EGLA 2IIHA 1PSDA 2MQMA 1P1LA 2AEMA 2E7WA 1S1TB 4U8YA 2BANB 2OPQB 3FEXB 4PKDB 4C8OA 4OHWA 4UOCA 2SXLA 2GS8A 2CYYA 4ECYA 1DLOB 4F2SA 4DSLA 3IRXB 5M2PA 4K59A 2QT7A 5D8HB 1TV6A 4YS2A 2VQFJ 1U6FA 2WW4A 2ZKTA 4DFKA 3JSBA 3EVOA 1KEKA 2DT9A 1JXEA 4ED3A 4AE5A 3W62A 3SCLE 2EBGA 2RUGA 2W4PA 2RQCA 1SV5B 2VG5A 4U7CA 2GFFA 2QFJA 2WVEA 5FIIA 4EFAC 3CDAA 2XYGB 1UEUA 3MM8A 4DV1F 4LFCJ 2GQCA 4IG0B 3DXSX 4QYZJ 1C1CA 3HFVA 1TL1B 2FJWA 1HD1A 4JI4F 4DL4A 1S10A 1NSAA 4ZVUB 2MQ8A 1T05B 3PX0A 2RDDA 3DGPA 3JXOA 1HBUA 4YB6A 3PW7A 3TR5A 4YFUA 3DNCA 2ACYA 1F1BB 2ZC4A 1V5VA 1KFDA 4DV2F 1UWAA 3H42A 4ATNA 4LRDA 2VODA 2HFNA 1LWCA 3M2RB 1RAFB 2VFSA 4P6QA 1VQ6S 3EE3A 2Q66A 2B0GA 3QGHA 1RTZA 2ZH1A 3ADAC 5ETKA 2KXHA 2MSTA 1N6QA 1R6YA 3C46A 3NAHA 4OJ1A 4DSEA 2K7KA 2MMYA 4IH5A 5GADU 2FHJA 4QPXA 1REVB 2M2BA 3HXMA 3Q8SB 1WELA 2ZM6F 3M8QA 2DGTA 3T5LA 2RQKA 2D3ZA 2C28A 2F7VA 2KTQA 1CS4A 2KU7A 4E8UA 3P5TL 3BO3A 1QSSA 1SJ1A 4Z37A 4L72B 4GC7A 1FD8A 4LSNB 4F4XA 3JAMU 1X4EA 5HVFA 1H0HB 4YB1P 4YHHF 1URNA 3VVUA 3KLHB 4HT5A 3TUJC 1FKPB 4ECQA 2BXJA 4MFBA 1AUDA 2KG1A 2H5JB 3J80Y 5D78A 3RBDA 3RZAA 3H59A 1NKBA 5CZVA 3WQPA 1A7GE 2I5JB 4ZOSA 5D0HA 1G7CB 1ZPVA 1FRMA 2A2DA 2AWZA 1U1QA 3JTPA 4JUZA 1QM9A 2QSFA 3DM2B 1CQMA 1RHMB 4M5HA 3TAPA 5IC6B 1TKZB 2D74B 3MM5B 2R2SA 4A46A 2PSZA 4ID8A 1CJUB 2BQ3A 4FF1A 3FSXA 1K44A 2YWWA 3T5KA 4J9VA 3KK1A 2BR0A 2ROGA 2K1RB 3PYGA 4KPCA 3E51A 2IFXA 1HPZB 1CSJA 2P5VA 1RDRA 3BYPA 3Q86A 2XO7A 2BW7A 3K58A 2EKNA 1BY9A 2DGVA 1Y3JA 5SZTA 3LP1B 4RKUC 4DJBA 4A8WA 2YQ1A 5LXRA 4ZVEA 1S72S 3TA2A 1VQ5S 5F8NA 2DPJA 3SDEB 3PW5A 3KWMA 2N82B 2JC0A 4QBUA 3AD7C 3PTWA 5DZ6A 3P49B 1GTHA 2M70A 1RISA 3P8BB 5IWAF 2E5HA 4K50A 3PJ9A 4DPYA 4IRDA 4K0KJ 1FRKA 2W2PP 3L4BC 4KKOB 2HQCA 1ZM3A 2ZDOA 4DR6J 3ZNUA 2HRTA 4DUYJ 3FKBA 3OT9A 2RF2A 3KLIA 4NLDA 4JI6J 3I32A 4ID5B 4NMLA 3CCTA 1Q78A 3NEKA 2MY7A 2CPHA 1R3NA 3J7Z5 3CGIA 2OMOA 4P71A 4L75A 2DNHA 1Q82T 3UN5A 2HKEA 4KC5A 3MCNA 2O01C 1KRPA 3THPA 1X9SA 3CB4A 1TU0B 1Y0HA 3QBCA 3MCOA 1Y10A 3O5TB 5DG8A 1S76D 4RPFA 2B8PA 5L38A 3L9ZA 1DY3A 4W92B 3FMWA 1X5PA 1BQMA 3ILIA 1S6OA 4EEYA 5AXNA 3D66A 4BC7A 4WP9A 2QLWA 5KFFA 3NMAA 3CD6S 4CLUA 3MEEA 2CJYB 1VK3A 1S0NA 2RNEA 2V9WA 1Q53A 3F0NA 4PQAA 5CYQA 1NB2A 1X5TA 4I4BA 5KFVA 4AL5A 3AT1B 4ANCA 2POKA 3P3DA 2XS2A 3UD4P 2V50A 2WVCA 3JYTB 4NCAA 5HBMB 1XNQJ 4JI0J 4DDFA 2MY8A 3UW1A 1WHYA 1RXOB 3ISNC 4DX6A 2RS8A 4HDGA 2J0SD 2RQMA 3VAHA 1OPIA 2R7QA 4DR5J 3IBWA 5BR8J 2J6TA 2DNQA 1IWGA 1FWPA 3SIPB 2EFPA 4ZCLA 3MMAA 5GAHI 1ITPA 1NLKL 4D3GA 3MUTP 4DV5F 4DFPA 1TK5A 3OTCA 1T0TV 2QLXA 2JHEA 3PJXA 5IT4A 2KJWA 3JQMA 5JJBA 3WDOA 3EDQB 2FHJD 3OL6A 4ECZA 2UUAF 2DRAA 4MYUA 1LXNA 3OR2A 2BX6A 4OYIA 2GVZA 3TYTA 4DS5A 2C2ZB 4PUOA 3W8PA 3EJMA 3PJWA 2RS2A 4NLTA 1K73T 4LF8F 2UU9F 3R5AA 5D4OA 2MZTA 3I9ZA 2CZ4A 1WKLA 1S6QA 3ISND 3PIOQ 1QTMA 3D67A 3CC4S 3KJFB 2IJFA 2K3IA 4UQTA 4Q2MA 4I2PA 4EO6A 3CT9A 4FPIA 4USUA 2G2OA 4C98A 4UOGA 2YKNA 2XO6A 1K47A 3V5RA 2DY9A 2Q43A 1MWZA 4N8NA 1IKXB 2LCWA 4NZ7A 3D54A 2R4FA 4FVMA 2ZOFA 5EUHA 2XYPB 4C97A 2OPSA 2JVOA 2OI2A 2JLGA 1RAIB 1S99A 4WBFA 3KNGA 2WB1D 3UVJA 3RAQA 2DO4A 1HNWF 1HBUB 1ZA2B 1NSPA 5CYMB 4IRCA 4DR7J 1VC6A 3N5BA 1IKYB 3HJVA 2H48B 2J6SA 4PYAA 3QATA 2HMIA 2OEJA 3C6UA 1UVMA 4YN3B 1TP7A 4WF9Q 2XB2D 3HVTB 1N6QB 1HWKA 3VHQA 4FNHA 2EFOA 2XGPA 3G2XA 2CWXA 1UPPA 2HAFA 3OLAA 4FNIA 4LF6F 1RYSA 1ZZFA 2DK2A 2LLZA 3TP2A 3GIRA 3WHIA 5AE1A 1RTIB 3TX0A 1NZ8A 3GFHA 3MMCA 3A3OB 3M8QB 2OUGA 4DV3F 1KDNA 5DM6Q 2G2ZA 1VBYA 3W61A 3QRRA 1NUEA 2OAUA 2VIHA 3A4TA 1OY9A 2V8DA 1B64A 3I96A 5ETVA 4YDDB 4FS1A 3JSMB 5KG0A 1WHXA 2C2MB 3DOKA 4ZJQA 2NSCA 3MHYA 1B3TA 1EQMA 4MAKA 5L1IA 4LBHA 2AIRB 4IKAA 1YI2S 2A10A 1DQAA 5J1EA 1N36F 2Z56B 2HHUA 2J9DE 2WAQD 2FZGB 3DRPA 1NMEB 3I0SA 4XDCA 4EZ9A 2C2EA 4DV7J 1NJZA 3J81U 3SCJE 3CSKA 3WIVA 1EP4A 3NCRA 5KT7A 3SSSA 4FKXA 4LSZB 5DJBA 4DR2F 2CADA 4ZIWA 4CH1A 4WZMA 3QZ8A 2E1AA 2BJ9A 3JS9A 2J5AA 4N47A 3G6VA 1U1NA 1ZETA 5J2NA 2VC0A 2W2MP 1T03B 4E2FB 3Q83A 3KUHA 4WYWA 4QR0A 1Y11A 2AGPA 3QO9A 3R5BA 2QYCA 1U2CA 1ZZNA 2BABA 4L74A 3ULHA 1UVLA 1VQKS 1LK7A 2YWFA 1WKKA 2X3DA 4NYOA 3FUYA 4NYZA 3X1LB 3T9NA 2V2VA 1Y5NB 3W3SA 3CDEA 1S79A 2R8HA 1FWKA 2BKNA 2XBPA 4PZVA 1TL3A 4J5OA 2GZOA 3QGGA 1YJNS 2KHCA 2JEFA 5C25A 1F9EB 4FF3A 1NK9A 2XY5A 1VRTA 1LWFB 1R27B 3R7SB 1IXKA 3QT6A 4FP9A 1OWXA 1KQKA 4DPWA 3NRBA 3P45B 3SSRA 4PQUA 1D8YA 1Q86T 3N28A 1X0PA 3R97A 3D6FB 2DNKA 1EJ7L 2CPXA 2YNGB 2E5GA 2V34A 2FTRA 3OSNA 2BJ3A 2BDPA 2R7UA 4LQ9A 3DXBA 2J9DA 4LFBF 4ZCMA 4RNHA 1M5HA 4WK1A 2KXNB 4JI2F 1G6BA 4NA1A 4Q43A 3I55S 4TXSA 2JEGA 4J9MA 3OJSA 4JI5J 3THVA 3R7NB 1T9VA 2RQ4A 4NLXA 1BQMB 3OR1A 4CLKA 3O6QA 1RAHB 3TUZC 2W2NP 3MEEB 4UUXA 3GIJA 4FF4A 4USJC 2UXDF 4QW8A 2AF6A 3T5JA 3TZZA 3IG1A 3U1NA 1FT8A 1FTCA 3V2UC 1UW4A 3PHTA 1NK7A 3I82A 2D9OA 2YNFB 2KDOA 1FEEA 1H38A 5HL7Q 1CG2A 4USVA 2IBOA 1D9DA 4DQIA 4YUDA 2W7AA 3QIPA 1EAYC 4ZN3A 4DLEA 4ED4A 1XMOF 5ETTA 3OL8A 4P52A 3CULA 2R2RA 1WKJA 4LSLB 1RT6B 4R8UB 5CQGA 4F8RA 1FJGJ 3L7UA 3H4BA 5C24A 2V8GA 2Y3YA 4Z7CA 2V4JA 5J1PA 2FVQA 4JV5J 5D0EA 4R5PA 1QE1A 1JQGA 2BJEA 1WOPA 4USIA 2GAGC 5JVGQ 1AXQA 1FDDA 1VGYA 1I1GA 2B5JA 1PC5A 3MMAB 5HROA 5ETRA 4CWBA 5C42A 4RU9A 2KT2A 1UMJA 5HJYA 4LF5J 1WI6A 4NYPA 3CW2C 2YTCA 2HGMA 4A8QA 1S1XA 3AJDA 2XI2A 3CJ4A 2X51A 2PN6A 5KFZA 2NUHA 4UY8T 3X3UA 2ZH7A 4RW8A 1N48A 4TQSA 3KUEA 4QYZK 3MAQA 4QIGA 1FXLA 1TKXB 2DR7A 3NWRA 1VQNS 1S6QB 4CH7A 1U24A 3BF4A 3CVKA 1Q81T 4DPUA 1KKHA 2EK1A 2YX4A 2HG4A 2B4OA 5KFAA 4BWMA 3UR3C 3MEKA 2DD8S 4LF4J 3H90A 1VRUA 3DLGA 2BM0A 2DRBA 3ITHA 4WFAQ 1CVJA 4JI3J 1T94A 4A8XA 2ABYA 3V6DA 2YKNB 3U1LA 2OEKA 3H98A 1U1OA 1L3KA 1S0OA 3VZIA 4MYTA 3ZZOA 3S6EA 2OTJS 1FDAA 1S9EB 1ZAWA 3V4MA 4Q0BA 2E7VA 5EGYA 4AQYJ 1HW9A 7FDRA 1D09B 2FHMA 2R42A 1PAUB 3FZBA 3AODA 4O0IA 3CO0P 3K59A 3P5BP 1RT3A 3TQ1A 1LFPA 5T41A 3SCKE 5EN1A 5KFLA 3CO9A 1HI8A 1C1BB 4P10A 3BGRB 5H9FJ 2MGZA 4P2SA 1Q79A 4PXEA 3ZZ0A 3GB0A 4NA3A 2DB1A 3FRYA 2RJZA 2W4CA 4IOAQ 2DY1A 2QRRA 2KT3A 4RLEA 4DLGA 1R0AA 3IO1A 1SXLA 3ZZTA 4CNYA 3HSJA 2DHSA 2VFVA 3VGSA 3ZZUA 1APSA 4J9NA 2NCKL 2OMLA 2WVBA 2HW3A 2NLWA 4V19X 2HVEA 1R8PA 4UUWA 5DDOC 3T1YJ 5D0GA 4ER8A 2KYXA 3KDNA 4DN0A 3DOKB 5IQQA 1NDCA 1SL0A 2JEIA 4DUYF 4EBCA 4FZVA 2XZWA 2XMAA 4M5LA 2CQ0A 1Z4UA 1EETA 1RZMA 1A0OB 4KYZA 2N7CA 4IRKA 4ZDNA 1H73A 5J1EB 1WORA 3TX8A 2GMHA 1KVIA 5DDPC 2FLLA 5L1KA 3W60A 1OS5A 2DH9A 4OYZA 4ES2A 4K4ZA 1UVKA 4AL7A 1NK8A 2RHQB 1SCJB 2BJ8A 3MMJA 5FD1A 1Y5LB 4JP8A 5HQ8A 2QYGA 3K89A 3FCHA 1HYSA 2M8HA 3DRSA 5J2NB 1A6LA 5E3QA 2GA7A 1IQZA 5AXLA 2HRYA 3TEGA 2FZKB 1BQXA 5EDWA 2QLFB 2CNNB 3ONQA 3C66A 2XMMA 3RYLA 2NXCA 2YKQA 3BR9A 3PO4A 4JV2A 4MTPA 2ZZMA 3I0RA 3G4SS 1N5QA 3GPAA 2YNIA 2E1PA 3MURP 2PEBA 2R8IA 1KSPA 1BXNA 4JV1A 4IO9Q 3MEGB 1FFWB 4GVBA 1YZ6A 4WP8A 1TL3B 3PEHA 1XNQF 4MT1A 5E33A 3BSCA 2HGNA 1WACA 1H2UX 3SSQA 2ZH8A 3HVAA 1NSQA 2HSEB 1AB8A 3EX7B 9RUBA 2IVFB 1UW9A 3G6XA 1TZ0A 4NASA 2DPIA 3BO4A 2BV3A 1UZDA 3BSNA 4DR5F 3H5XA 2OFGX 5LXYA 3CF5Q 2XM3A 1RAGB 2LQ9A 4ZPVR 1S9GA 1JLEA 1WSVA 2GV1A 3NMRA 1SC6A 4WWSA 4I67A 2CJXB 4ED6A 1H2VZ 2V2QA 3C16A 3CJKA 3M8RA 3BN7A 4DV0J 2B9YA 2HFSA 2JDJA 2VOPA 4K4XA 3OR1B 2WZ1A 1SIWB 2CQHA 3ZTSA 1SKUB 2LP4A 4LVOP 3MM7A 3PEJA 1IVZA 1S49A 1X31C 2D1CA 1YITS 1TUVA 4J9PA 1VFJA 3KK2A 1HHSA 3W2VB 3IG1B 2PMHA 2ZBIA 1OY6A 4AFFA 1WNEA 2HQDA 3IMQJ 4Y0FA 1E6VB 1F5BA 4UOFA 1JLQA 3GIMA 3NLCA 3IC1A 4LR9A 4Y00A 1PJ5A 3QIPB 4P73A 3G9CA 4ZVFA 2ZNZA 4KY3A 2JX2A 4NZ6A 4NMXA 2LVWA 3GSDA 3LTOA 3MPUB 4B9LA 3BPSP 2R3VA 5KFWA 4IOCQ 5B0FA 2DITA 4IUFA 3Q0AA 2DEJA 3TEHB 2Z2YB 1HMVA 2WOMA 1K0TA 4LQ3A 2O1PA 5EWGA 1NK0A 3Q8RB 3EGVA 1QE1B 1S0VA 1RT4B 1LKZA 2RMLA 1UAWA 5HMXA 3OXFA 2B9XA 2B5JB 5LSLA 2Y1RI 2CAJA 3QMQA 3G87A 3OHBA 4ELVA 4YR0A 3NGRA 3Q22A 1MLAA 2ZEJA 2YXLA 2JLEA 1HQEB 1QDUB 3MFIA 1KQSR 3PFEA 2GHVC 4Y3CA 4M5IA 2I6WA 3PZPA 3PO5A 3E2EA 4NLUA 1NKCA 1YK9A 4ZK7M 4F36A 1KLMB 1Q7LB 3RTVA 1RI7A 1HWIA 3C19A 2ZJPQ 4OYOA 3R2DJ 1TFWA 3RB4A 4M94A 4ZKAA 4F67A 2UXCJ 4KE5A 4IH7A 1ZTTA 3ITHB 4OYBA 5KG2A 2M3DA 5I4MA 4J9QA 3TJ8A 3N6NA 1XJWB 3V6DB 3W66A 2DNMA 1RKIA 3FBCA 2U2FA 4NLVA 4UOHA 4DL5A 3N4WA 4RUAA 1QUPA 3FEZA 3B82A 2A3JA 4RUHA 2HNZB 1HQUA 2DR8A 4Q0BB 2ZHOA 4KBIA 2Y1JA 3KMSA 2DR9A 1PCAA 4DV7F 1KLNA 4WKRA 4CM2A 3H2UB 4V1Ak 1RYRA 3D3CJ 1F6TA 3SV4A 3MM6B 4HLBA 1JXLA 1FCAA 3BQ2A 1T95A 2RKIA 4OJ3A 1N34J 4NLWA 4HL9A 2E5IA 3VQTA 4JYAF 4U7UD 3PACA 2E5LJ 3AY0A 2RRAA 1UWBB 2K3KA 1NPKA 1RTHA 5JVHQ 2QV6A 2W4DA 5L9NA 4BBYA 4RX6A 2VJUA 3NG8A 3MAAB 5A8WB 4NRTA 2KZMA 2BE2A 3Q8PB 5KFEA 2WSCC 4PG7A 2DIUA 2X1FA 3CDWA 3SEOA 4QW9A 5IQ6A 2DGWA 2V63A 1XK8A 2F4VF 2OPRA 2IM0A 1HNVA 2CPYA 3JAMY 3UN3A 2W8LA 2G4BA 3C15B 2PFDA 2CPFA 1R7IA 3T3FA 4KAIA 2KI2A 2AJQA 5KT3A 2ZJRQ 1JIHA 3OTOF 2XHWA 3B4DA 5IM0A 2QA4S 1RWXB 4K5RA 1X0FA 1RWOB 1T02A 2IVMA 2PO4A 1Q8LA 2E66A 4ILRA 2C2DA 5J2PA 1TUWA 3DU6A 3D0HE 2G2YA 4ZCKA 3KLVA 2J0QD 3BDEA 3ILJA 1K0VA 4I6WA 2W2QP 2BW2A 4FXDA 3UD3P 2HVIA 5G0RA 1P1TA 2KKHA 2VPZB 1S4EA 1RAAB 4FYYB 4Y2CA 2HYIB 5CH7B 4RBTA 4C0BA 1ROFA 4GO5X 3K5LA 4B08A 2JL9A 3ISZA 4MJKA 2BRKA 1NDLA 3OFFA 4GKKJ 3RGIA 3Q2SC 4P74A 1UFWA 3FNNA 3DRSB 3LPYA 2XG8A 3OV7A 3FC9A 2EVZA 2CJ9A 2BACA 3HHLB 4G1PA 3QJLA 1UJ6A 1NAQA 1D0EA 4HTJA 2CNKB 3PRBA 3WC0A 1FNXH 4JI4J 1IBCB 3MGJA 4EZ6A 1JLBA 5ETMA 3G82B 5D4NA 2ACMA 4AXIA 4FVCA 4WU3A 2BQUA 1FRHA 3BEGB 2MZRA 1YJ7A 2HWHA 1WWHA 4DV2J 4CO2A 3TNVA 4DF8A 4GVBB 4BC9A 1WC3A 5L1JA 4IFYB 4TY9A 3M2VB 1VQLS 2I0XA 2LU1A 3KNAA 2GIFA 1VHIA 2L48A 4N56A 5KT4A 2XNRA 4KO0A 3MOJB 3J7YU 1NH7A 2CQDA 4ITSA 2HQGA 4JV5F 3BJYA 3ENVA 1QTNB 5HMWA 2QZ8A 2X7IA 2OPPB 5A0YA 3CJ8A 1B0VA 3QLHB 1S9GB 3CDBA 4OZ5A 1HARA 1HFEL 4DSJA 3F41A 1M5OC 2EC0A 4IG3A 1JLCB 3IS9B 2ZM6J 3GONA 4M1KA 3P4UB 2CA9A 4CM0A 5DQHA 1FWLA 4BS2A 3M8PA 1N32F 1NKEA 4M5DB 2HHSA 1TR0A 2HNYB 9ATCB 4QWBA 5J2QB 4UF4A 4I68A 4O3QA 4XPCA 1H72C 2VDIA 4OX8A 2MKYA 5K8PA 4X4PA 1K9MT 3LPEA 3BKTA 2XLKA 3CMAS 2XI3A 2DNNA 2J0WA 2VJVA 3IR5B 1TL5A 2DCUB 3UQSA 3NCQA 4JI3F 1OQ3A 3RW7A 2DGOA 2BOPA 1S5ZA 1QSYA 2MSSA 2VUGA 2XZDB 4K5SA 3TZWA 2EFGA 2FJAB 1GXTA 2A6OA 3W5ZA 1G2EA 4U7UK 1Y00A 3NGDA 3ZTRA 2AYMA 5I42B 3MM9A 1FKOA 2Z2ZA 1AW0A 1H7XA 1LNQA 2BA9A 1BC6A 2VFTA 3HCXA 3TUPA 3CCJS 3TO8A 4WYLA 1XR6A 2VPWB 3D7SB 2W01A 4DI6A 4OZ1A 4X84A 3RW6A 2GCFA 1YBUA 3MWBA 2Z0GA 2FC9A 5HQMA 3MD1A 2IC3A 1QAJA 2JEJA 4CZCA 4WTYA 3PYDA 2V67A 4M5MA 4USKA 4DUZF 1QAIA 3MPDA 2GIRA 4OZLA 3DLJA 1WEZA 5CA5A 2G1HA 4ZHRB 1HBMA 2C2OB 1WOSA 4NCGA 2FLPA 2E1MC 1WD6A 4GC6A 2U1AA 3H0PA 1NZAA 2GIQA 1IJEB 2RIJA 2LXUA 4ZLPA 1FVSA 3NOGA 2W1BA 3T6JA 3BPDA 3SI8A 2W8KA 3IM8A 2OLWA 1OMSA 5MAOA 2F8HA 3BS9A 3R2CJ 1JJCB 3TAMB 3ZZYA 2J7WA 1V6HA 3RBEA 2CWKA 4RW4B 1REGX 3GJRB 1SC1B 3D28A 5B08A 1S1TA 2UVWA 2BANA 3IAS9 4U9RA 4W90B 2OPQA 2VG6B 1EARA 2GJFA 1DLOA 3MD3A 5H9FK 3IRXA 4EYIB 1DARA 3IN5A 4B3TJ 5F8LA 4NWBA 2ROEA 4NLPA 3V6HA 2PD1A 1RAJA 4LUBA 4ZPAA 2HGLA 2MKHA 4KPYA 4QCLA 4S0MA 1DURA 5K5MA 5IOLA 2RKIB 1WG4A 1YJUA 4CYUB 1XQIA 3QFHA 1V3RA 5RUBA 5CD4A 1FD2A 3HT0A 2MQOA 1WC5A 3FZ2A 2HHWA 3F44A 3CJSA 2KFNA 1S9FA 3NGKA 1FE4A 1YJRA 5HVGA 5LMUF 3DLEB 4K4YA 4RO0A 2RT3A 1E6YB 1T05A 1NXIA 4RNOA 1UFKA 3WZ0A 4R0JA 1I3OB 3R8YA 4DV6J 2W25A 3HJFA 1RWPB 1Q95G 2JC1A 2FJEB 2VH7A 3PW0A 2D9PA 4DV5J 2IA6A 5IM0B 3M2RA 3GJTB 4M5JA 3CCWA 4WU2A 1PYTA 3MTJA 1S77D 1FX4A 1UJ5A 2MKCA 2C3OA 3J81Y 2CDRB 3CTRA 1YBAA 3UNGC 5DRKA 1U26A 3E01A 2LDYA 3M05A 4LF8J 3EVWA 4K7QA 3BO2A 4F0HA 2WVFA 3M4XA 4OYMA 2FQQB 5K14A 5B0BA 3MPWA 5DO2A 1L3TA 5HLFB 4PAAA 1WEYA 5AE2A 3RRHA 3NGTA 4ECSA 2OP5A 2JFDA 2W7OA 3FSYA 3SZ2A 1U6BA 2NPIA 1M1GA 3KLHA 3HHKA 2MQLA 2F8MA 1RACB 2Q6CA 1KQFB 4ZVRB 3DDKA 2HNDB 2ZBQA 3WIUA 5KFOA 4DOZA 1O0PA 2AHOB 3NCPA 2I5JA 1KVJA 1NHKL 4Q5VA 1FDBA 3V6KA 2DVIA 3CJTA 4CLZA 5HANA 3DM2A 1IQTA 4KGXB 5KFSA 1WDTA 1DTQA 5K8OA 1XIQA 2GGPB 4UW2A 4J9SA 3P6YC 4KB7A 2Q1LA 1RTJA 4DSIA 4C9DA 4FN5A 2COLA 3I56S 2N7YA 3N79A 4W98A 3EM1A 2VBXA 2AYEA 4W4MA 1FX2A 1QLNA 2UUBF 1HPZA 4CI0B 4CIOA 2YX7A 4GKJJ 1DJ0A 2DXDA 2IYIA 2L08A 3LP1A 1ZAVA 4OFZA 1EQ0A 3IGVA 2B3TB 4QZVB 4IG3B 4O3OA 4DV3J 2RU9A 1RHRB 4Y2IA 1X4AA 5I3PA 3JB9k 5D3GB 1Q0NA 3JSRA 2FD2A 3D4JA 4PYDA 5SUHA 2V8PA 2UXBF 2ZZNA 3BGOP 4CTAB 3I87A 2AJ0A 3H5UA 4ZP9A 4QWEA 3AA9A 2M4MA 2CZVC 4DEZA 4CNZA 1KBRA 4JI7J 2YKMB 5E3PA 2BEFA 1HNZF 2GO8A 4TNOA 5F8IA 3IR6B 1BD6A 2IMWP 4F3OA 4DMZA 2E1RA 1KN6A 4ZP7A 3O8WA 1J5EF 2IAJB 2HHTA 3KJNB 3MPVA 3I9V9 2HLUA 3MR5A 3CCQS 4DR2J 4CO0A 2NXJA 1YRXA 3MM9B 4DCOB 3A12A 1FKOB 1PKUA 5ETPA 2WONA 3M32B 3C6TB 5GVQA 1R43A 3CJQA 1S97A 3OTEA 2XEXA 4HT7A 2ZVSA 3MUMP 2DTJA 2XS7A 2ATLA 4U96A 3H5YA 4P7TA 1M5KC 1B7YB 3W8GA 4ES3A 2IC3B 3E3XA 3IXQA 4LRFA 1HBOA 2C2KB 1VQ9S 4ZCIA 3JYTA 4ZS6A 1O8BA 3GCXP 4L3KA 3MPYA 6AT1B 2E5JA 5HBMA 3QQCD 2C3YA 3EGWB 4C8YA 4ILLA 2G0CA 3EICA 4NOHA 4O44B 1IKVB 3OXLA 2GHPA 1RWNB 5JMNA 1UZHA 5F41A 3VF0B 1VOMA 2MZJA 5AJ3J 1VK8A 3ZTOA 3G8TA 2KZZA 1RHJB 1XNRF 1IR1A 4KRWA 3FGVA 3QIDA 2QX0A 1U8WA 4C0OC 5CCMA 4FS2A 1VYAA 3SFUA 1UVNA 2CQ3A 2OTLS 2LA6A 2BUNA 3K8VA 2O67A 4JI8F 4FYXB 1VBXA 2BQRA 5DZ7A 5B0GA 4URQU 3TANA 1SQFA 2DNLA 1RT7B 1L3UA 4CRJA 1X4CA 2QSWA 2MZQA 3VQSA 1U0HA 1VI7A 1D9FA 2IDEA 3BDPA 3DLLQ 4B3RF 3QJPA 4OI1A 3N9UC 2ZKUA 2UXDJ 2WTFA 3CNQP 1HI1A 2DNOA 2J0XA 3N01A 4WPAA 4OQJA 2X3GA 4OLOA 1RB0A 3H25A 4GKKF 3MTKA 3TVYA 3NS5A 2JVRA 4CCHA 1LWEA 1IKXA 1AZSA 3BSOA 2HHVA 3GQCA 3GFXA 1W26A 4NCBA 4J9RA 1XMOJ 4EU0A 2DHAA 3LW5C 2GAHC 1SH2A 2ZOGA 2AJFE 2FHKA 1OYEA 1WDDA 3BH6B 4DR3F 5IS2A 1XTZA 5A6PA 1Q4RA 1X9WA 3U7JA 5CYMA 4HH1A 1GXLA 1X4FA 1IKYA 4I7FA 2VB6A 2N3OA 5DGBA 1CJKB 2MTLA 2V69A 2FIUA 1GNKA 3HVTA 4DU7A 4USMA 3NGSA 1KHWA 4I56A 4USHA 3E01B 2LQ8A 5IV3A 5DG9A 4ZJLA 4ZIVA 1RTIA 2XYHB 4G3IA 1Q8KA 2B6AB 3HHEA 2A1BA 5K14B 3BR8A 1T7PA 5FLXU 5BJRA 5KG3A 2CNOB 2KH9A 2NUUG 1Y4ZB 1SH0A 1NPRA 3CD5A 4PCQA 3VALA 2VFUA 4Z2XA 3KLGA 1NK4A 4X2BA 4C3KA 3D1HA 1RE1B 1GXUA 3BBCA 3I6PA 2JLFA 3OBIA 4NEYA 4PWUA 3NAIA 3JSMA 4OX7A 1FJ7A 1VQYA 4H4MA 2GC8A 4N5SA 1ZOTA 2EFQA 3NNHA 4PG5A 2DGXA 1VQPS 4UTGA 1WC1A 1KTQA 5F8JA 3IM9A 2ZDPA 4DN9A 5BYSA 1OO0B 4IDKA 4K2JA 1Q7YT 4N76A 1CULB 3QGIA 2C2RA 3K5PA 3D1QA 2XMUA 1DQ8A 3S1TA 2XSJA 3OQ2A 2JRSA 1X5SA 1AYEA 2I8EA 1DTQB 4DCJB 2PEHA 2LEAA 2VQEF 3BGFA 5DG7A 1ZTWA 2ZBPA 4YMEA 3CUNA 1PO6A 2CQ1A 4OL8A 1FK9B 1U09A 4OHXA 2MQPA 4O3RA 3FBEA 4C8MA 1WG1A 1RTJB 5HO4A 4ZLJA 4YY3F 4ICLA 2VKRA 4TQRA 1RP5A 3C14B 1T03A 1IUJA 1AT1B 1S59A 3FVYA 4B9NA 1F5CA 4HACB 4KT0C 2ZNYA 1HL6A 3NP5A 4NEZA 2ILZA 5IT0A 3TA0A 1GMUA 2HZCA 2FPHX 4DX8H 3R27A 2N4CA 3ZZPA 1IBMJ 2EPIA 3MCMA 1M0SA 4TVAB 3KHHA 5LJ3Y 4C3LA 1P6TA 4ZPTR 3HKWA 3CMQA 3HHNB 1LWFA 2ZUGA 1TMMA 4I69A 1JNZB 1S4FA 4WP3A 3V4IB 3L95X 2R2UA 4FBTA 1B0TA 2VV5A 3SBMA 4ZP6A 2AGOA 1MMNA 2UV8G 3CMES 1QY7A 2V4QA 1H2TZ 3H8YA 1GAOA 3HHDA 2OH2A 3OL7A 2IRXA 2YNGA 1KVKA 4P7VA 4ZPBA 4OI3A 1YRUA 3H7HB 3THTA 4DBQA 1HKAA 4RW7A 4F4YA 3D6HB 3NGUA 3EYZA 8RUCA 3O2IA 3N6LA 2J8SA 3M8ZA 3M9OB 2J8AA 3M1VB 5HMYA 4HVZA 2MEWA 2DHHA 2WONB 2AP6A 4C3MA 5KFGA 3FK4A 3W65A 2IJNA 2HK2A 4B3TF 3TRGA 1JJHA 4OX6A 4F25A 3CJ2A 1HI0P 4NXMJ 3VTIA 2CVIA 2MHEA 2XY6A 5DLFA 1VS3A 4DUTA 2W2OP 3OL9A 4M5KA 3G6YA 2AEJA 4ECUA 1JMTA 1MMDA 2X1AA 2YNFA 4BDPA 1JLGA 2UUCF 4DQQA 3MDFA 2YY3A 2IRUA 2G13A 2GVDB 3PR5B 4IO1A 1R8AA 1HBOB 3CJRA 2OSRA 4ZJOA 1BMQB 3H20A 2GJIA 2XMTA 2C3PA 1F9HA 3PRVA 2WK4A 2FJDB 4X4NA 4TLRA 3Q89A 1OY8A 4OYPA 1U25A 3VWSA 2CQIA 4LSLA 1RT6A 1ZH5A 1L5UA 1YJTA 4R8UA 1FXRA 5F8HA 3GG1A 4YOEA 4F26A 1SJ3P 4F4ZA 4KHPF 1MROA 2VA2A 4DV6F 1Q1KA 5T7LB 1S0MA 2CFXA 4C8LA 3R6GB 4CLWA 1NHVA 3FQKA 2ZH6A 2GX8A 2KN4A 5KAKA 4C11B 1FDNA 4YR3A 4J7CA 2CG8A 1XERA 2R8KA 3ICLA 4RBUA 4K4WA 2X1GA 2NQPA 1S6UA 2XCPA 2ZZTA 4HKQA 5G4DA 2B51A 1S12A 4O4RA 5K9FA 3BYRA 2HZAA 1UL3A 4CH0S 5D4PA 1BWEA 1U0HB 1LW2B 2QA1A 1HNIB 1TKXA 3L3CA 3A3PB 1S6PA 4KIAA 3MECB 4OYXA 1KFSA 4N8OA 1PILA 3PX4A 2OKQA 3EGNA 4RR5A 3V6JA 1ELOA 4PPDA 4DQPA 1WUUA 3M6XA 2ZFHA 4XIUA 2E9ZA 4DSFA 2CPZA 2RAQA 2DNZA 1VQMS 2KXFA 2ZHBA 5KFBA 4OI6A 1B99A 1LWEB 1NO8A 5H9EJ 1AZSB 2H51B 3KLEB 4M95A 2JOQA 3GIKA 2PE8A 2QGFB 4CT8A 3CWJA 3SMZA 3BV8A 3DDIA 2DBBA 3AB2B 3MMBB 2RHSB 3PG9A 4DR1J 1S9EA 1X4GA 3W63A 2B43A 2FUG9 3DLKA 2YWGA 5FJ4A 5KFHA 1S1VB 1RWWB 2ZH3A 3KDOA 3W7BA 3QT7A 1IR0A 1SI9A 1KHVA 3BGLA 3MUVP 2VOOA 3HK2A 2KVQE 4JB8B 2FB0A 3PV8A 2I9SA 4G6VB 4I7FB 4CT9A 5LT5A 3O1LA 4G1QB 5AT1B 3O44A 2R7TA 3EPIA 1C1BA 4P9SA 4YEAA 4DG1A 3BGRA 2VHGA 4KH0B 4AYBD 1OYDA 1WG5A 4GKJF 2B9WA 5KFCA 1SJQA 1SBRA 4X4TA 1IKWA 4EO8A 4EI2A 1YWXA 4ELTA 3W9IA 4OX9J 4EBDA 1JLFA 1T9YA 2YBVA 2KB2A 2HIYA 3UN2A 5C2CA 5A8RB 3ENQA 2D3UA 3W2WB 4O3NA 3DOMB 3KLGB 1D3WA 5EX0A 3GLJA 2UZAA 1H3DA 1YTYA 4LF9J 1QSLA 4YB5A 1UA1A 2G9OA 4P2XA 1C4AA 3LP2A 4H4MB 1IR2A 1S57A 1CC8A 2H4YB 4WFXA 2IA0A 1R0CB 1D9AA 1MU2A 4IDKB 4JI7F 1V5IB 1FRIA 3NOCA 2FVCA 4M5NA 4M63A 2DNGA 3HM9A 4KQZA 3B4MA 1RHKB 2XSJB 5F3TA 3AH6A 3D1OA 5E41A 2X1BA 3IBCB 5DQGA 4I1TA 4UY85 4PG6A 3TI0A 1RLCL 2R2TA 1JJ2R 3MF5A 3TW0A 2PGCA 2W9BB 1U1PA 4JYAJ 2OELA 2F4FA 1RWKB 3EZUA 1MWQA 3L7PA 3W5XA 4U8VA 4DFJA 3A8IA 1J2VA 4ICLB 2DGSA 2DXFA 3O3LA 1WC6A 3ELHA 4NXNF 1Z1ZA 3M2UB 2XS5A 3OTDA 3T9ZA 1FNMA 2NYIA 2LU2A 4YQWA 2F4VJ 5E7OB 3KJQB 3KJVA 3JQJA 2O66A 5FDLA 1KC8T 1T9TA 5KG5A 4CLTA 3EDRB 2W24A 3A1YG 3PNIA 3MEGA 3DRRB 1O6XA 1Q5YA 3OTOJ 1B7FA 2F63A 1OPZA 3T1AA 3WX4A 3VAMA 3OSPA 1VQOS 1HHTP 2PI5A 5KFIA 1CBKA 3C8YA 4OV1A 1Q16B 2L41A 4DZDA 3NS6A 3JSYA 4KR0B 3BREA 1X8DA 4X64F 1HD0A 2HURA 4KGMA 5AJ3F 2MZ1A 1HR0F 3K0JA 5HAOA 2OHDA 3P96A 2LQBA 4CLLA 1V9OA 1F5AA 1HBNB 3CIZA 4WZQA 1FVQA 2BMBA 4ZPWR 1WTFA 3DRYA 2EI5A 5K8MA 5B7WA 4RW7B 1BQNB 3UD5A 1HWUA 3OVBA 2YH0A 5I3UB 4B9UA 4CO3A 2MPUA 3KHLA 2XQCA 5KG4A 3SXLA 2V6AA 2L9NA 1WHVA 2P2CB 4RUCA 3UNYA 4H4OA 2EC2A 3UPFA 3DOLB 3W5YA 1NH8A 3K5NA 1UFLA 5CZXA 1RCOB 3CC7S 3W2VA 2M52A 1YVFA 1NJYA 4WFNQ 1BHNA 1XMBA 2DHXA 2XTJP 1JLGB 3QGPA 1TVRB 4HHHA 4KV8B 3UCZP 1E6VA 1FI4A 5IC4B 5L39A 4YB7A 2VKZG 2Y8YA 3ETOA 4Y28C 3M9MB 2RRBA 2FLOA 2J9EA 1SPBP 2ZOMA 4F50A 2KM8C 2CQCA 1RA7A 4TU7A 3QAEA 3KFWX 3OVAA 2LXIA 1YIJS 4IFVA 3M9NB 3NKYA 1F60B 3DMJB 2ZD1B 4DPTA 2HFUA 1MROB 1RT4A 3ZXWA 2DR5A 2AEFA 1WTBA 2YKOA 1BLUA 1PIEA 3K5MA 2MQQA 2ATCB 1RT1B 5HP1B 3HVRA 2G0IA 1RT5B 3NBPB 1N32J 4PABA 1HQEA 1EZZB 1JB0C 1G4CA 4XK8C 1RT2A 1CC7A 3ENWA 3VR1A 1KLMA 2M9KA 4WFZA 5M2RA 1WF0A 3M6VA 1KQGB 4HHUA 2XULA 1QVGR 2UVUA 5L46A 3GYGA 2AU0A 3HPOA 1S6PB 4GVLA 3IA0A 4WIQA 4CP5A 2MKIA 2WRMA 2Y1LB 4FYWB 3KMQA 2YWEA 2PFFB 3QSIA 3POTA 2DO0A 3Q8VA 1EHWA 3I4PA 1FO1A 4BWJA 5HN0A 3IGNA 3BN4A 2O3DA 3Q8YA 5DS7A 2HNZA 2BKPA 4CLYA 2R8GA 1U1RA 4CLPA 4KGKA 3MEDA 3DLKB 2H54B 6FDRA 3PKYA 5IT9U 4CLSA 1YRTA 4O4GA 3H2LA 2LEPA 3MM6A 4B3OA 4WE1B 3M8WA 1NJWA 2OIHA 2RD5C 1T3NA 3WBZA 1UWBA 2Y1IA 4LJMA 2FHOB 5D77A 1K8AT 3MOZA 1KONA 2XSFA 1RTDA 1WI8A 4DUZJ 4DG1B 3MAAA 1RAEB 2VDHA 3CCMS 4CLFA 3R7BB 5A8WA 1Q5VA 4X4UA 3GV7B 4B17A 4RNFA 1LOUA 4AXJA 1IKWB 3R5GA 3KK3B 2BE7D 4LRAA 4DL2A 3FSIA 5F3ZA 4F7VA 1JLFB 2QN6B 3C15A 2NS1B 3ET6B 3NNAA 1UP1A 4B02A 2CKWA 5AE3A 4PWDB 1VHFA 1IBMF 1I94F 4QR1A 4NE9C 3VAIA 5D4LA 4QWDA 1C0TB 4F3MA 1HLWA 1ACMB 1NRKA 1FRXA 4R0EA 2KM8B 5DETA 4J9OA 3ETMA 4F0KA 2QTWA 4DF4A 3LP2B 4F3QA 4KSEB 2P8IA 1A9NB 2XMVA 3SFGA 1M1HA 1G1XA 5J2MA 4F4AA 3OUYB 3A3NB 4LF2A 5LJ5Y 2RDJA 4XPEA 3QRQA 1K1QA 1MU2B 4P72A
chains in the Genus database with same CATH topology
4MIAA 1CQNA 2HHUA 2W7OA 1U8SA 4EBEA 3FSYA 2J9DE 2VBWA 2WAQD 4OMFG 2BYCA 5F9NA 5F8GA 3SZ2A 1U6BA 2NPIA 4HHJA 4O3PA 3DRPA 3I0SA 4JI5F 4XDCA 4EZ9A 2AW0A 2C2EA 3KLHA 3HHKA 1RWUA 2MQLA 1XMQF 3AAWB 2F8MA 3UCUP 1SB6A 3S7RA 1HYSB 1NJZA 2Q6CA 3LAMA 1KQFB 2EG2A 3SCJE 3DDKA 3CSKA 1TKTB 5KFRA 2AGQA 3RB3A 4WXWA 1CLFA 2MJNA 1EP4A 3NCRA 3DHXA 4X4QA 3TUIC 1ZBTA 3C3LA 5KT7A 2YWKA 2HNDB 5KFOA 4DOZA 2B7BB 3SSSA 2HFOA 3GFZA 1O0PA 3NCPA 5MLCV 3DU5A 2I5JA 5DJBA 4DR2F 3OLBA 1KVJA 1FRLA 4CH1A 4Q5VA 4WZMA 1FDBA 2OO4A 3QZ8A 3V6KA 2DVIA 3OFGA 2E1AA 5KOWA 3KG0A 3UR0A 2J5AA 1HWLA 4N47A 3G6VA 1U1NA 3DM2A 1ZETA 1IQTA 4ETXA 2BVZA 5J2NA 3HHLA 5KFSA 2HQ3A 2CJAA 3AA8A 3I0RB 1DTQA 4MIWA 3UI3A 4NXMF 2RDIA 2VC0A 3I4HX 5K8OA 1T03B 4MMOA 2FJBB 3CC2S 2W9BA 2YNIB 5LSOA 2ZE2A 4WYWA 4QR0A 2GGPB 4UW2A 2AGPA 3QO9A 4B9TA 3R5BA 2QYCA 4J9SA 1ZZNA 3P6YC 2HVHA 2BABA 3ULHA 1UVLA 4KB7A 1LK7A 4AUKA 3ZC4A 3RB6A 1VQKS 2YWFA 2Q1LA 5T14A 1W2BR 1RTJA 4DSIA 4C9DA 4FN5A 2COLA 4NYOA 3I56S 1R8CA 2N7YA 3N79A 4HDHA 4X4OA 3TA1A 3KJVB 4C4WA 3HDSA 2P9GA 5BYQA 4NYZA 2VBXA 5LMNF 3GYXB 3X1LB 2Q3PA 2E9RX 2AYEA 3T9NA 2ZH5A 1X9MA 5FDLB 3OHAA 2G1DA 1QLNA 2A2CA 1Y5NB 3M2UA 2UUBF 3W3SA 3HMJG 1FJGF 1HPZA 1S79A 1IM4A 3CDEA 4CI0B 4CIOA 2R8HA 2R7XA 2YX7A 2IYGA 2XBPA 1DJ0A 4IFYA 3M2VA 4X4RA 2CQ2A 1TL3A 4J5OA 2IYIA 2L08A 1N5YA 3BM7A 1P9QC 1R8HA 3LP1A 2KHCA 1ZAVA 3QGGA 3GE9A 1YJNS 2JEFA 4X4VA 1Y7PA 4QWCA 5C25A 4OFZA 4EWTA 4FF3A 4IH6A 2XY5A 3LUYA 1NK9A 1VRTA 4Y34A 3IGVA 1LWFB 2B3TB 1R27B 4QZVB 1SH3A 4IG3B 4O3OA 1O5JA 1JLEB 1IXKA 2UUTA 1X7VA 2RU9A 4Y2IA 4FP9A 3EGZA 3G71S 1OWXA 1X4AA 5I3PA 1QAYA 1KQKA 3NRBA 3DI6A 4LF5F 1NJIT 3DRRA 2DJWA 4H4KC 3JB9k 4K4SA 4L3NA 5D3GB 3QYYA 3JSRA 2FD2A 1NK6A 3SSRA 4PQUA 1D8YA 2OPPA 1J5OA 1Q86T 5SUHA 2VPXB 3N28A 1X0PA 5J1NA 2UXBF 2HIQA 3QLHA 3CJKB 2ZZNA 2J9CA 1WEXA 2DNKA 3I87A 4CTAB 4JBCA 2CPXA 4Y65A 2EFVA 2YNGB 4O3SA 2E5GA 2MKKA 2VONA 1JLCA 3IS9A 2FTRA 2AJ0A 3LANA 3KHRA 4RW9B 3H5UA 5JXSA 4ZP9A 4QWEA 3OSNA 2BDPA 4C8ZA 4KFBB 3AA9A 3T5HA 2R7UA 5E3RA 4LQ9A 2M4MA 2DHGA 2R8JA 1JWWA 3DXBA 2J9DA 1N56A 1R8BA 3FEYB 4LFBF 4ZCMA 1U1LA 2CZVC 4RNHA 4DEZA 5KT5A 1KTVA 4CNZA 4M5DA 1M5HA 4MK7A 4WK1A 2KXNB 4JI2F 1G6BA 1S1UA 1YG0A 3MM7B 1N4LA 1V3ZA 2HNYA 3DYAA 2YKMB 1SUQB 4NA1A 5E3PA 1R31A 4Q43A 2RB7A 1GH8A 3I55S 4TXSA 3R1LA 1RGVA 4OHYA 3KK2B 4X65F 1HNZF 2JEGA 4QIFA 2GO8A 4J9MA 4TNOA 3OJSA 3GMGA 5F8IA 1HBNA 2BJDA 3IR6B 4RZRA 5J2QA 1BD6A 2IMWP 4J9KA 4F3OA 4DMZA 2E1RA 3OFEA 3THVA 3S8SA 1O51A 2RQ4A 4NLXA 1UVIA 1BQMB 3OR1A 4H4OB 4YR2A 1KN6A 1ZAXA 4ZP7A 3O6QA 1BQNA 3O8WA 1J5EF 2IAJB 3EXCX 2HHTA 4CO1A 4ETZA 3TUZC 3D0GE 1F2GA 5I3UA 3RR7A 1KD1T 4IR1A 3MPVA 3I9V9 3MEEB 4UUXA 2LEBA 3LO3A 3GIJA 1JLQB 3PHEA 4FF4A 4TY8B 5ITHA 3CCLS 2HLUA 3MR5A 3CCQS 4USJC 4CO0A 4QW8A 3CCRS 2UXDF 1IJFB 1XWLA 1YRXA 2AF6A 3M30B 1SQEA 4A4JA 3OJUA 3T5JA 1N8RT 1W2IA 3KHGA 3IG1A 3KKFA 1VIXA 3MM9B 3GV8B 3U1NA 2BBEA 1FT8A 1FKOB 1FTCA 2D7SA 3V2UC 1UW4A 2OFHX 2AJ1A 2PIIA 1VQ7S 2WONA 3M32B 1NK7A 1M5VC 3I31A 3C6TB 2HVZA 3I82A 2D9OA 2ASDA 2YNFB 4ZPCA 5GVQA 2CPDA 2KDOA 1N5VA 2FVRA 3DOLA 1R43A 2LDIA 4MH8A 1FEEA 1S97A 1H38A 5HL7Q 1CG2A 2IBOA 3OTEA 2XEXA 4WFBQ 5L1LA 2VBYA 3GYNA 1T3OA 4AQYF 1D9DA 1HMVB 2WOMB 4HT7A 4QIEA 4PG8A 4DQIA 2ZVSA 3LGNA 4YUDA 4F02A 3MUMP 2DTJA 2QA4G 2F9JA 2XS7A 2ATLA 2W7AA 3QIPA 5I42A 3H5YA 4P7TA 1M5KC 1FF2A 1YSJA 3M6WA 2XLIA 2MQNA 3GFYA 3LALA 4DR1F 4DLEA 1TVRA 2UVRA 4ES3A 2XMWA 4KV8A 1XMOF 3OL8A 3LWLA 4ILMA 3CULA 2IC3B 2LMIA 2R2RA 4LSLB 1RT6B 4FXVA 2B4VA 4HI1A 4IFVB 2MKJA 3E3XA 4R8UB 3IXQA 5CQGA 3G8QA 4F8RA 4NZ0A 1HBOA 3CCUS 3MXHP 1VQ9S 2W9CB 4ZCIA 3H4BA 3JYTA 4ZS6A 2AX0A 2Q79A 1O8BA 2V8GA 4OZNA 5C24A 2V4JA 2WBRA 3KLFB 3MZIA 3PFOA 5J1PA 2FVQA 3MPYA 1X4DA 3DCAA 4R5PA 1QE1A 3CCES 2E5JA 2GJ2A 5HBMA 1MW7A 2BJEA 1H6KX 1RK8A 2J7KA 2GMLA 4USIA 5DLGA 3U02A 2PC6A 2MHNA 4RW6A 5IZHA 3J7A1 2C3YA 3HVWA 2ZJQQ 3NNCA 3R5CA 5JVGQ 4K4UA 3EGWB 4C8YA 1AXQA 1FDDA 1VGYA 4ILLA 2G0CA 1I1GA 2W9AA 2B5JA 4NOHA 1PC5A 3IWXA 3MMAB 5HROA 2AQ4A 2O5DA 5C42A 1N0UA 1IKVB 4O44B 3OXLA 4XDDA 1DBDA 3DMJA 4URSA 2GHPA 2GW8A 1JNRB 1Y9OA 4MKAA 4RU9A 2KT2A 1GX6A 2ZD1A 3GZ7A 2QMWA 1UMJA 5F41A 3VF0B 2R9LA 1WI6A 4XAKA 3SQGB 1VOMA 2MZJA 4QU6A 4NYPA 1M90T 3LGMA 4DL7A 4FPRA 5B0EA 2YTCA 2XGQA 2HGMA 3HO1A 1W25A 4A8QA 1VK8A 1S1XA 3G8TA 2J76E 3KTQA 4CO4A 1GT8A 1OSDA 5HI7A 3S01A 2XI2A 1U48A 2KZZA 1XNRF 4ZHRA 4KRWA 3FGVA 4NLOA 3CJ4A 2X51A 4DV4F 2RH3A 4XO0A 3QIDA 4E0DA 2PN6A 5KFZA 2XMJA 1RT2B 4C0OC 5CCMA 3A8EA 2NUHA 3BZQA 5EWFA 4UY8T 3X3UA 4FS2A 3SFUA 1UVNA 2ZH7A 3HFKA 2CQ3A 2VG7A 3J7YI 4RW8A 4LT6A 1N48A 4TQSA 1FESA 4OX9F 1RT1A 1PGZA 2OTLS 5HP1A 2LA6A 2BUNA 3K8VA 3G8SA 2O67A 4WXOA 4JI8F 3T1YF 3MAQA 5E3CA 1VBXA 1RT5A 3H4DA