2X1BA

Structure of rna15 rrm
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
GPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the RNA15 Rrm-RNA Complex Reveals the Molecular Basis of Gu Specificity in Transcriptional 3-End Processing Factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords MRNA 3'-END-PROCESSING PROTEIN RNA15
total genus 22
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2x1bA00
3UD4P 3V4MA 2DK2A 2ADBA 2MZSA 1FHTA 2LEBA 1P1TA 3R27A 1YJ9S 1YJWS 1KOOA 1B7FA 3MOJB 2CPJA 2CQ1A 1WHVA 2MZRA 1U1KA 3S8SA 2RS2A 4WIIA 4BS2A 1U1OA 2XS7A 1ZZNA 2AYBA 4QU6A 3JB9k 1SXLA 1WEZA 3CD6S 2MB0B 1NJIT 3UCZP 4CH0S 1YITS 1SJRA 2DNPA 1WI6A 1VQ6S 2MYFA 1O0PA 2EVZA 3Q2SC 1X4CA 3IRWP 2A3JA 2MQPA 4C7QA 3CCJS 5FJ4A 3CPWR 3RW7A 1AUDA 2D9PA 3G96A 3VAFA 2YH1A 1X4AA 3B4MA 2LA4A 2RS8A 2M70A 3CCSS 2DHXA 2AYGA 5LXRA 1NO8A 3CC4S 3TYTA 2XNQA 1UAWA 4YUDA 2D9OA 3NNCA 2M52A 1WG5A 1WG4A 2DGOA 1U1QA 4UY8T 2DIUA 3CC2S 2DGUA 1SJ4P 2LECA 2KM8B 1U2FA 1S79A 1HD1A 2VOPA 3MUMP 1KC8T 2MMYA 2J0QD 5DDPC 1ZH5A 1QVGR 4RU2A 1UP1A 3L3CA 1VQ8S 2U2FA 2KT5A 2YWKA 3U1MA 1FJCA 2MQNA 2MY8A 2M9KA 4QQBA 5JVHQ 3NNHA 3J7YU 1N52B 2M7SA 1VQ4S 1WF1A 1D8ZA 1R8HA 4CIOA 5LSLA 1M90T 2DO0A 5DDOC 1P27B 2CPYA 5CYJA 2J76E 1W2BR 5HO4A 5D78A 2CQDA 1RK8A 1IQTA 1HL6A 5IM0A 3MUTP 1L3KA 4WCEQ 4C0OC 1WI8A 2M2BA 4FXVA 2KM8C 4F26A 1U1PA 2F9JA 1DZ5A 1KD1T 1HD0A 1VQ5S 3UD3P 3PIPQ 4Y0FA 3EGZA 2SXLA 1X4BA 1YWXA 3R1HA 2XS2A 2KH9A 2N3LA 2L9WA 4TU9A 2XS5A 1VQNS 2MXYA 3G8SA 2MKIA 3CC7S 1F9FA 1N88A 1X4HA 2K3KA 5GMKa 1U1LA 1K8AT 2FY1A 2ZJRQ 2LXUA 3CTRA 1FNXH 2CQ2A 3DXBA 1OWXA 1X4GA 1X5SA 2DISA 1FT8A 2NLWA 1M5PC 1R8PA 2MZQA 2HGMA 2YTCA 3CCQS 5DM7Q 2KVIA 3SXLA 2DH7A 2K8GA 2JVOA 1DRZA 2KXHA 5CXTA 3MUVP 1U6FA 1WF0A 3NS5A 2X1AA 4YOEA 2MSTA 3VAKA 2RRBA 3ULHA 2MZJA 4OZ1A 3BO2A 3MI7X 2KRBA 3VALA 2MQOA 2G1DA 2CQCA 1X4EA 1M1KT 1U1MA 4WFAQ 1DHMA 4WKRA 2FC9A 3VAMA 1FO1A 2CQHA 1WHWA 2N3OA 3CCVS 2I38A 2ERRA 2DNGA 1VBXA 2KG0A 2CJKA 1H2UX 3S7RA 2CQ3A 2MZTA 2DNYA 2KRRA 1OPIA 2HGLA 2HGNA 2LXIA 5GAEU 1S72S 2DHGA 2DITA 2LQ5A 1A9NB 3DLLQ 4WFBQ 1JJHA 2E5JA 3CCMS 3D2WA 2FPHX 3G4SS 2CPEA 2QFJA 1M5VC 2OTJS 2RNEA 2N82B 3SDEA 3I55S 2CPIA 1RKJA 2YH0A 3TP2A 2RVJA 2FC8A 1H2VZ 3PIOQ 5EN1A 3US5A 4IOAQ 3J7ZT 5CA5A 2MGZA 1K73T 1ZZFA 2CPZA 3NMRA 2DNMA 2JVRA 2RQCA 2RU3A 3UE2A 3UCUP 2DGVA 1H6KX 5DM6Q 2YKAA 1WHXA 4V19X 2CPDA 1VC5A 2QA4S 2CQ0A 2MJUA 2DGXA 1DBDA 5DETA 3MD3A 2JX2A 2NZ4A 5H1SV 4W92B 1SJQA 3VF0B 2ZJPQ 3CF5Q 1WTBA 1Q86T 2DNKA 1Q82T 2OSRA 1WF2A 2L41A 2M8DB 4A8XA 2LCWA 2UP1A 1XN9A 4Z2XA 2CPFA 2U1AA 3FEXB 3VAJA 2DHAA 2G4BA 2X1FA 2KU7A 3BEGB 1SJ3P 3Q2TC 1U1NA 3EX7B 1OO0B 4LIRA 3THTA 2RQ4A 2HZCA 1YIJS 1U1RA 2MSSA 3ZZZA 2GHPA 1WEYA 2M4MA 1M5OC 1VQPS 2DNNA 2DGSA 2ZJQQ 3G9CA 1BY9A 4U67Q 1OIAA 2DB1A 5IQQA 3G6ES 2LA6A 1VQLS 3P49B 3I56S 3CMAS 4C4WA 2MJNA 2I2YA 2JWNA 2FHOB 2BZ2A 2KXNB 2D3OR 1Q81T 5GADU 3B4DA 4ZKAA 1YJNS 4TU8A 4PRFA 3P5TL 3S6EA 3EGNA 4J5OA 2BOPA 4IUFA 2DH8A 4WFNQ 3SDEB 2JRSA 2KHCA 3G71S 2MZ1A 2CQIA 2CQBA 1KOHA 2MKJA 1VQ7S 5ITHA 3N9UC 4QPTA 2DNQA 5GAHU 2OJ3A 1Q7YT 4FXWA 2RRAA 2KI2A 2DIVA 1QVFR 2LEAA 1A7GE 3S01A 4Y00A 5IM0B 3CULA 3IWNC 1FJ7A 1HA1A 3CCLS 3NNAA 2X1GA 3CCES 1YHQS 3CUNA 2DGTA 1QM9A 2M8HA 2F9DA 5LXYA 3ZZYA 3CCRS 4IO9Q 2GO9A 3K0JA 3OW2R 2PEHA 1X4FA 2KN4A 1N8RT 1X0FA 2G0CA 2MKKA 2VODA 3H2UB 2CQ4A 2MKSA 4M5DB 1WWHA 2VOOA 4TLQA 3FEYB 1URNA 1M5KC 2DH9A 1N54B 3CCUS 1JJ2R 2MKHA 1JJ4A 1D9AA 1FJEB 1VQOS 1UW4A 2M88A 2L08A 4P6QA 3U1LA 2DGQA 4CH1A 2MPUA 5LSOA 1JMTA 2MQLA 2KFYA 4LMZA 1U6BA 5HL7Q 2E44A 2MGZB 2XSFA 3UWTA 4WF9Q 3MURP 2CQPA 2DO4A 5D77A 2HVZA 2CPHA 2V94A 3BS9A 2N7CA 2ADCA 1YTYA 2QEXS 2HYIB 2MQQA 1NU4A 3HI9A 1WELA 2E5IA 4PR6A 2CPXA 2AYEA 2DGWA 2EK1A 1X5PA 2OSQA 1VC6A 1X5OA 2DNHA 1VC0A 2DNRA 2B0GA 1UFWA 3VAIA 1KQSR 2XB2D 1WEXA 1SJFA 1PGZA 5MLCV 3MXHP 2O3DA 2MKCA 2LYVA 3NS6A 2MY7A 1VBZA 4CQ1A 2DNOA 3P6YC 4W90B 3UCGA 2AYMA 3LPYA 4PKDB 2J8AA 3LQVA 2PE8A 2WBRA 3VAGA 2E5HA 3BO4A 1VQMS 1WG1A 3CMES 1K9MT 5BJRA 2OIHA 2DNLA 2XNRA 5DDRC 3BO3A 1H2TZ 4LJMA 2X1BA 3H2VE 1VBYA 2Q79A 1G2EA 5IFMA 4YB1P 3CXCR 3THPA 4F02A 3SMZA 3MD1A 4TU7A 2VONA 4IOCQ 3G8TA 5LJ5Y 2CQGA 1YI2S 4UQTA 2MQMA 5GAGU 1WHYA 2AD9A 2RUGA 3HHNB 1VQ9S 3VAHA 4F25A 5JVGQ 2KG1A 1VQKS 2DNZA 1FXLA 2KXFA 4OZ0A 4QU7A 2F3JA 4ED5A 1X5TA 5LJ3Y 2OTLS 3TO8A 3R1LA 2MHNA 1X4DA 4ERDA 2RT3A 2J0SD 2KYXA 2LKZA 5GVQA 4EGLA 1PO6A 3RW6A 3P3DA 2DHSA 3MDFA 2LMIA 2M0GB 5DDQC 2E5GA 1CVJA 2EK6A
chains in the Genus database with same CATH superfamily
2GQQA 2OLWA 1Y7PA 3AXKA 3BKFA 3Q8VA 2V34A 3V4MA 4AT1B 8ATCB 4X64F 3LP0A 3OQ2A 2QMUB 1GX5A 1NRKA 2HFOA 2CNOB 4FZVA 2UXBJ 3D0IE 3R27A 1YJWS 1B7FA 4ZLLA 3I31A 1NUEA 2VG7A 2HHHJ 2FGCA 2FTRA 3MMJA 4D3HA 3MOJB 1CJVB 5HLFB 5KG7A 2R8GA 5H9FK 3KNAA 4F04B 2UXCF 1IXKA 3FGVA 2NXUA 4NMXA 1CJTB 2HS3A 2PC6A 1FFSB 1I51B 3TZXA 3H5XA 4X4TA 1HBUA 3WX4A 2WONB 2OAUA 3GSIA 5HQMA 1KDNA 2MB0B 1ZM2A 1MN7A 4Q0BB 1SJRA 3LGNA 4LBHA 4USTA 2ZZMA 2DNPA 2BQUA 1WI6A 5BYSA 1GMWD 1S1WB 2GHWA 3CJ2A 2OPPB 3FBBA 3PO5A 2EVZA 2F8MA 4IR1A 2IAJB 4KHMA 3BO3A 3ICLA 3Q2SC 2O66A 3CNQP 3PRVA 2VBYA 5CZXA 3M9NB 4PXEA 3JSMB 3V2UC 3VWSA 2J0XA 1HNVA 3HHLD 3TX0A 3VZHA 5HN0A 4QYZJ 3QT6A 1JLAA 2ILZA 4DPOA 3UN5A 4F0KA 4C7QA 2X3GA 2ZOGA 3CCJS 2Y1IA 4ECZA 3BQ2A 2B7CB 2G2OA 4FN5A 3RU0A 1S1XB 3RW7A 3GFYA 1KQGB 4DL2A 3HVTA 4NLXA 1RTDB 2AEMA 2YH1A 1X4AA 4Z7YA 2LQ8A 4R0EA 3CCSS 3NOCA 5KFAA 2AYGA 1NJXA 1BE4A 4B3MJ 1FDDA 2DEJA 5F0WA 3TYTA 5A8WA 3CC4S 2H9ZA 3BF4A 3QGGA 4JI6F 1UWBB 2D3O1 2R7SA 1FRMA 1CQMA 3NGSA 4YUDA 2BJ8A 3O6QA 3D3CJ 1XNQJ 4WU2A 3NNCA 4LF6F 4DU7A 3I0SA 1WG5A 3H42A 4RW6A 5IT4A 1WG4A 2DCLA 4DCJB 1KVJA 3DMJA 1F5AA 1FE4A 3ZTPA 3CC2S 4LRBA 2HFZA 2DGUA 1DLOB 4ICLB 4C6AA 4TQSA 2XMAA 1RT2B 2YKNB 3HVRA 4A8QA 2ZDPA 3MAQA 3O44A 1GK8A 3TEHB 2KM8B 4DSFA 1U2FA 3OXFA 3AA8A 5L9XA 5KFNA 3FSIA 3KK1A 2HRYA 4NLYA 4RW9A 4F4KA 1BQMB 2F7VA 4F7VA 5HSPA 1GMVA 2VBXA 2HQCA 5B09A 5J2QA 4BCAA 4NXNF 1CLFA 3HCXA 3X3UA 1CS4A 1TKTB 2RKIA 3EYZA 2HNYA 4NXNJ 2I5JB 1AB8A 1XJWB 4X62F 2NR0A 3KMQA 5AE1A 3QSIA 4EYHB 4Q0BA 2VL1A 2YWFA 3DLGB 4NEZA 2IRUA 3GIIA 3EPGA 4FF2A 5E3CA 5HAOA 1HW8A 4DR2J 2P6SA 1MU2A 5A6PA 3J7YI 4QQBA 1Q5YA 2LFVA 4Y2MA 5JVHQ 2UUWA 4MKBA 2BQ3A 2EG2A 2JEGA 2B7BB 1NJWA 1KNZA 1N52B 3QGPA 2M7SA 3CIMA 2GVDB 2YX1A 3CJQA 1WF1A 2F63A 3KLGA 1VQ4S 4JI1F 1D8ZA 1S99A 2AX1A 1N56A 1M5SA 5BXIA 5LSLA 4JBCA 3FUYA 3L7OA 3M1VB 5IS2A 5KG5A 5DG7A 4J9LA 2UXDF 1F9HA 5CYJA 2GJIA 5F3TA 4Y28C 3GJQB 1HNWJ 1F5BA 3KXDA 4TY9A 1YBUA 4WTOB 1AA1B 3H25A 3VCDA 4M5HA 5IM0A 2VPZB 1HKAA 2EBGA 3DOMA 4X4VA 2KM8C 2GJ2A 2MEWA 1BQNB 4KYZA 4TYBA 2FVCA 1KD1T 2ZBRA 3D54A 2W9BA 2OEJA 1NZAA 3RRKA 5CYMB 3PIPQ 5ETPA 1RCOB 1SIZA 1YWXA 2AJ1A 1RT7A 2BUNA 1U2CA 2F4FA 4X84A 4J9PA 3R1HA 1S1VA 4JI2J 5DG9A 3UD5A 2KT3A 1RE1B 5C25B 4DFKA 2Y0BB 4UZCA 2KHDA 4KH1B 2RE1A 2ZD1B 3M30A 3SCIE 5KFRA 2XS5A 2MXYA 4CWBA 3MPUB 2FVSA 3GR0A 3Q8PB 4OI4A 2MKIA 1FEEA 2IRYA 3NGRA 1N88A 1X4HA 2B43A 3C16A 3CJ8A 1U1LA 1SC3B 1K8AT 2E5LJ 2FY1A 3GCXP 2WTFA 2HBRB 5KG1A 4AQYJ 2APOA 2ZKUA 2A18A 2CQ2A 3TW0A 1RT4A 1OWXA 1X4GA 2GQ2A 1KP6A 1Y0HA 2F40A 4KFBB 4PWWA 3GG1A 2WVCA 5K5MA 1TV6B 1FT8A 4QR2A 1H3DA 1PBUA 4ZP8A 4OZLA 4CLKA 2MQ8A 3HM9A 1T03A 2J5AA 4C8MA 3W2VA 3OTOJ 1SVDA 2ZH7A 2NREA 5IWAF 1QTMA 3HKZD 1RBOB 2UXCJ 4NPOA 4N8OA 3RTVA 4OI2A 4KHPF 4DOZA 2KVIA 2VDHA 1UWAA 4QW8A 1S57A 5DZ6A 1LW2B 3ETOA 4H4OA 4X66F 2LU1A 3BV8A 5SZTA 2PIIA 3H5YA 5KT4A 1ZM4A 1DRZA 5KFUA 2KXHA 2VG5B 2WW4A 5F0UA 1Z4UA 2YX7A 4KHRA 3NS5A 2IDLA 4FYVB 4ZPDA 2X1AA 3T1HF 4HEA9 1HARA 3ULHA 2BMBA 2OO4A 1LFWA 3FQLA 3GV8B 3I5AA 3N0VA 2CQCA 4LR7A 3W8GA 2YNGB 1JQGA 3HHLA 3I9ZA 1FKAF 3E3XA 4ELVA 1RTIA 1RHUB 2BANB 2EI5A 2ZVSA 1JLCB 3NCPA 5AT1B 4R8UA 3VAMA 4X4UA 2Z2LA 2CQHA 3CCVS 2HQ3A 2I38A 3QLHB 2DNGA 4HL9A 4CDIA 1NKBA 4NLVA 1JB0C 4NI2A 2YWWA 5K14B 3W5ZA 4NOHA 3MECA 3S7RA 2CQ3A 3ITHA 2IFXA 5DGBA 1Q79A 2DKOB 3NEKA 5EUHA 4J7CA 3DRPB 3JTNA 2V2ZA 5C24A 2HFNA 2H5JB 5A2QU 1ZM3A 3TEGA 1OPIA 2V5HG 1R8BA 4KRWA 1RA7A 1W26A 4IFYB 3KKFA 2HGLA 2PMHA 4OX7A 4AL6A 3T5KA 2IMWP 2HURA 3DHWC 1RTHB 4RW4A 3KMSA 1B0PA 3NGDA 3DU5A 3MAAA 4WP8A 1CC7A 3CCMS 1IBMJ 4JV1A 1H7WA 4LF6J 2C22A 3HDSA 1XNQF 2RH3A 3L09A 4K4ZA 3KLFB 1CJKB 1MWQA 2RNEA 3KG0A 1X9MA 2PI5A 2FZCB 4B02A 2VFRA 1JNZB 4NCBA 3A8EA 3LTOA 2AIRB 3J7A1 3R2DJ 3CJ0A 3CJ5A 4B3RF 2CKWA 3PCOB 5LSRA 2RVJA 2IM2A 3FSXA 1H2VZ 3PIOQ 4QWDA 5EN1A 2LDIA 2IM0A 4NLWA 4IOAQ 3E01B 3WC2A 1ZZFA 2CPZA 2B5JA 4LSNA 1JKHB 1RTJA 3R7NB 4E98A 3RB4A 2DRDA 1Q8BA 2VB6A 3MCOA 4WWSA 4HDGA 4DR4J 2RQMA 2QC3A 2DGVA 1H6KX 1VR6A 2JJ4D 3HKWA 4RWXA 5KT3A 3ZZRA 4P2XA 1DTTA 4QWCA 4UOCA 4EO8A 4G6VB 3DI6A 1TZ0A 1LWFA 2CQ0A 3CT9A 2XBPA 3HZGA 4OYWA 4CLTA 5I3UB 3A8IA 1KS2A 2FQQB 1VLOA 4I2PB 4X4SA 1S76D 4OI6A 4USWA 1RT5B 4YMEA 3Q8QB 4GC7A 4ECTA 4EZ6A 4PQUA 2XSJA 3HP6A 5CHCB 3OFGA 3CF5Q 5EWGA 1DFDA 1QUVA 1Y4ZB 2MLXA 1Q82T 3KLEA 3PV8A 1G1XA 1N5QA 1WJ9A 3QO9A 2M8DB 4KHPJ 2A2CA 2IIHA 1TL4A 2LCWA 2QL7B 1XN9A 4MT1A 4Z2XA 4K2JA 4ZN3A 1HR0F 1REGX 3ENVA 5F8JA 3T6JA 3RB0A 3IM8A 3C6UB 1UMJA 3FEXB 3FCWA 3VAJA 2DHAA 2W2MP 1LWCA 1PYTA 2KU7A 3BGRA 3GFXA 2HFUA 1NK9A 3Q2TC 3EX7B 1VBZA 2Z8QA 3T1YJ 2FGOA 1W25A 4ER8A 1NHKL 3THTA 3IBFB 1RAHB 2BRKA 4F0HA 3R5DA 1NSAA 1HNZJ 2HRUA 4MTPA 1WEYA 2ROGA 4Q2MA 3HT0A 2P9GA 5KFDA 4P71A 3M8SA 7AT1B 2QYGA 3K5NA 2FB0A 4UY85 3VTIA 1IUJA 1LWXA 1LWEA 2QSFA 3BGFA 3DLHA 4HT7A 4I2PA 3G9CA 5C2CA 5I3UA 5E33A 5KT6A 2B9YA 4U67Q 4FF3A 1LWFB 1UVMA 1FTRA 4P73A 3QAUA 3J7Z5 1S6QB 4EI2A 2PD1A 3G6ES 2LA6A 2QG9B 4B9LA 2LDYA 4OZJA 4XAKA 1OYEA 2IM1A 2RU9A 2YWGA 2XLJA 4J9SA 2MHEA 3K8VA 1IVZA 5DGAA 2B5JB 4LSNB 4YHHF 2R7OA 1Q81T 4DCOB 1QDUB 1R31A 3NGTA 3B4DA 2ZH8A 3E01A 2PFFB 3G86A 1BGXT 1QAIA 2ABYA 5IT0A 2BKOA 4WPAA 4DLGA 3EGNA 1C0UA 1WD6A 3MMAA 2KVQE 2RHSB 1OY9A 5HQ8A 1X31C 4K5SA 2E7VA 2C2MB 2VJVA 1NB7A 3OFEA 2BE7D 2YQ1A 4NA3A 2DH8A 4LFCJ 1KTQA 4DV0F 1S9EB 2RDDA 2ZITA 4IG3B 4WE1A 2IC3A 1ZOTA 1FWPA 4R25A 4DV0J 4KKOA 1R89A 2CQBA 2YPYA 2GC8A 1KOHA 5LMUF 2VA3A 4X4PA 3K8WA 2Z2ZA 4NYPA 3WX8A 1AROP 5ITHA 5KFCA 1S4FA 3HXMA 2V8GA 4QWBA 4DUZJ 4OFZA 2G2ZA 3M7VA 4X65J 4RZRA 3BN4A 4HH0A 1Q7YT 2VFSA 5HVGA 1VMBA 2WVBA 3LGMA 4DWIA 4LVNP 2IPOB 1QVFR 2H51B 1RDRA 3JSBA 1YVFA 1A7GE 3PRDA 1T9VA 4PYDA 2A6OA 1HA1A 4M5NA 5DDRC 2LLZA 3RJMB 4L75A 3CCES 2HHXA 1VK8A 3TAMB 2DGTA 3D6FB 2F9DA 3LO3A 1K0VA 3UDCA 3I96A 2AV5A 2F8HA 5F8MA 3HMJG 3JSRA 4NRTA 2OHDA 1RT3A 4YR0A 3PR4A 1KBRA 1HHSA 1R43A 3BH6B 5EX0A 3OJUA 2VODA 2HKEA 1VRTA 2CQ4A 5H9EJ 2MDAA 4P72A 3G6YA 2R2TA 1KRPA 2UUTA 2Q6BA 1Q8LA 1RAOA 3R8YA 4DPWA 5CABA 3OR2B 2FHJD 3H4DA 1JJ4A 4ECQA 4K4YA 4DV6F 1VJWA 2OPRA 4FNHA 2GIRA 1S9EA 3HHDA 2DGQA 2J9DA 2V63A 2XMVA 3U1LA 3BSNA 3NXZA 3PTWA 1HQ2A 3I4PA 3UPFA 1IM6A 1H98A 2F4VJ 4ZHRA 1GMWA 3P8BB 2WOMA 5HL7Q 4EWTA 4KFBA 2MGZB 4OHWA 2J7WA 5GAGI 2XSFA 1S1TA 4USKA 5L39A 4DV7F 4WF9Q 5D77A 4B17A 1IBKJ 5HMXA 4JI7F 3THVA 2EKYA 4ZVHA 3HI9A 4ZVGA 4W4MA 1RUSA 3X1LB 1T7PA 3U7JA 1FK9B 4LF2A 4PQAA 5LOQA 5RUBA 3DM2A 3KJFB 2XYGB 4P2MA 4IFVA 3RRGA 5IOLA 1FD2A 2AYEA 2DGWA 2EK1A 3CDWA 3QJPA 1Y5LB 3MAHA 2DNHA 3O3LA 3UQSA 1ZTTA 4UZBA 1OY6A 3TUIC 1UFWA 1KN6A 3HJFA 4DR7J 3QRRA 1EP4A 5HVFA 4DPYA 1SJFA 4Z7CA 1VHIA 2HNZA 2Y0SD 1TVRB 3DOMB 3FJ2A 4ATNA 2DJWA 2R7QA 4K8RA 3IWLA 2J7KA 1AFJA 3IAM9 2BVZA 3K89A 1E6YB 1J27A 1I1GA 3G82B 2MY7A 4K5RA 3KHRA 2AZ3A 3BGUA 3C6UA 4RBVA 3JTOA 2HWHA 4UOHA 5M2UA 2DNOA 4O44A 2HMIB 2VBWA 1RWMB 2ZM6J 3M32A 1ZA2B 3JQMA 3MPWA 4TYAA 3N28A 2AF6A 4LF4F 4LF4J 1AFIA 4LF7J 2XSJB 4F4WA 2HNDA 4HI2A 4QYZK 2BM0A 5KG4A 1SV5A 3Q83A 3QRQA 4ZP7A 3LP2A 2JEFA 4DHVA 2W2NP 3H5UA 1JLQB 3M2RA 1MU2B 4C11A 4ZLNA 1GMUA 3DI6B 1IM4A 1OSCA 4URQU 1JLGA 1DTTB 1SKWA 3H2VE 4OJ3A 3H7HB 2FIUA 2PA3A 3L95X 1RTZA 4K0KJ 1HBNA 3CXCR 4NLDA 3SMZA 2ZUAA 3DGPA 1A6LA 3AJDA 3R6LB 3W8PA 4V1Ak 5CD4A 1X9WA 2BJ7A 4ECVA 4DS5A 4NMLA 2CQGA 5CZVA 3DKDA 4WTYA 1HBOA 2EFGA 1YI2S 2JOQA 1TUWA 3KLHA 4GKKF 2AEFA 4CLLA 3LF0A 4ICLA 3AD9C 2B3TB 4OYMA 3VAHA 3RRHA 1R8CA 1WC5A 1XNRJ 1WC1A 3BSCA 3N01A 2DVIA 2KXFA 1N5VA 4OZ0A 1HNZF 4QU7A 4RW6B 5GMDA 1YKWA 1NHVA 4ED5A 5LJ3Y 1CJKA 3A3PB 1GTEA 2C3PA 2K3IA 3CCTA 3R1LA 1IWAA 4B3SF 1C1BA 3K5MA 4RW4B 2Y8YA 1AW0A 3KJVA 2CADA 1N36F 4EYIB 3I87A 3CD5A 2LU2A 2VQFF 1C1BB 3RW6A 1T05B 4JI5J 2R8IA 2CWXA 1P1LA 4OYXA 4CLUA 3W60A 5F41A 3MDFA 4MK8A 5BR8J 3HVTB 5KFJA 5KFTA 3TUJC 1TUVA 5DDQC 3OUYB 4PABA 3SQGA 3JQKA 4U9RA 2Z57B 3MECB 3PDNA 2AJ0A 4ZCKA 4DV5F 2COLA 4YR3A 3G6VA 1JWWA 2ADBA 1FF2A 3K17A 3RBDA 2LEBA 5D3GA 4HT5A 4H4MB 4K4UA 2YY3A 2ASLA 1JLCA 4M5KA 2AWZA 2CQ1A 4CO0A 1OYDA 1Q5VA 1RWVB 2IAJA 4DV4J 1UTAA 2YKPA 3UW1A 2R3VA 2ZC3A 3S8SA 2VICA 4LR9A 4DSKA 4O3NA 5HVHA 4ECRA 1SIWB 3LPEA 1HI1A 3WQPA 3OVSA 1JLGB 3DU6A 5ETOA 4NA2A 3QQCD 3HX9A 2NUHA 1YBTA 3C6TA 1HBMB 1F0XA 1RAEB 2VG5A 1SXLA 3FKBA 1WEZA 1OQ3A 1R0CB 2QFIA 3I5BA 4QIFA 4WP3A 2WONA 4K4XA 1NJIT 2WSEC 3DCAA 3MEEB 4CH0S 1V3ZA 1VJQA 3KYLA 4OI0A 5DG8A 2E1RA 3FCVA 3PRBA 4YN3B 1F2GA 5F8GA 1UVKA 4TXSA 3EGWB 4CT8A 3PW0A 1RT6A 1S0MA 5HANA 1LV5A 3BR8A 1CJVA 3MMBB 5HLFA 1FNMA 2OPQB 1HWJA 2VG7B 4OX9F 3MR5A 3SI8A 3IRWP 4A8WA 2LQJA 3OJSA 3M2UA 3OLAA 3H98A 2MQPA 3G82A 3L7PA 2B8PA 2GFFA 3I5CA 2IVFB 4M5LA 4OJ1A 4NXMJ 2CJQA 3NLCA 1AUDA 2Y1JA 1TL1A 3ILOA 3GIKA 3HT3A 3T9ZA 3HZEA 3VAFA 3J7AN 3B4MA 2C3UA 2RS8A 4YHHJ 4KGKA 3W64A 2DHXA 1RZMA 4NLUA 2C1EB 5I42B 4IQXA 2OP5A 3OVBA 4CLSA 2IJNA 2Z2MA 4HACB 1UAWA 2F65A 2C2RA 1D9FA 4NLOA 3D9BA 4IFVB 1RXOB 1JK9B 2HVHA 1CG2A 5G0RB 4C8NA 4ZPTR 4XO0A 3SSSA 1TL1B 2PSZA 4JI8J 4XK8C 1HR0J 2L9NA 2QL5B 3OR1A 3SSRA 1SJ4P 3BO2A 1NDKA 5F8NA 2QZ8A 3BN7A 2LECA 4O23A 3GCWP 2WVEA 1S6PB 3I4HX 1ZYQA 1VGYA 3KUGA 3TQEA 2WOMB 1S79A 4OLPA 5KAKA 1JLBA 1Y00A 3MUMP 2KT2A 3MMBA 1FWLA 2MMYA 2DY1A 2J0QD 2R7UA 1S0VA 2R7TA 4X62J 4DR4F 1R27B 1YK9A 2RB7A 4LSZB 1SH2A 1UP1A 1IWGA 1V6HA 3RBEA 1VQ8S 2U2FA 2NSBA 1U02A 2XMUA 2QMXA 1FJCA 2B9EA 2MQNA 2MY8A 1HBMA 4RPFA 3W1YC 2M9KA 3FMWA 2Z0GA 4GMKA 2UXBF 3NNHA 3DLGA 5F9LA 1LK5A 5FDLA 1R0AB 5U47A 4I67A 3AAWB 1RWPB 3JS9A 2XWXA 1TTHB 4ES1A 1UA0A 1TU0B 3D67A 4DX8H 1FCAA 2NZCA 2ZBCA 3D0GE 4RW9B 4Z37A 1TKXB 4H4MA 5LMNF 2JNJA 4DL3A 3TI0A 4FF1A 3PACA 2J76E 4NEYA 3EDRB 1W2BR 2YQ3A 3OD2A 1RT2A 3RUBL 2VG6B 5KG3A 5HROA 4AXJA 4A8OA 1L3TA 3RZAA 2CA9A 3MUTP 4X4RA 2DYAA 1L3KA 3AOCA 4WCEQ 4I6WA 4QW9A 1ICEB 3HFKA 2M2BA 1WKJA 4FXVA 4L3NA 4F3OA 2BJEA 1VQ5S 4K59A 3POTA 4DV1F 3IGNA 4LIWA 1IR0A 4Y0FA 2SXLA 2ZOMA 3M6UA 3DLEA 4J9OA 4ELUA 3IP0A 3LP1A 1MWYA 3FBEA 5HQLA 5D8HB 1F3VA 4ZDNA 2KZZA 1H7XA 4PCQA 1IBKF 3FDSA 4ZS6A 4AYBD 2ROEA 5LM7E 3UR0A 3G8SA 4RUAA 5HMYA 1HI0P 3H20A 4FXDA 1FXDA 5GMKa 3LOUA 1HFEL 2V2QA 4PYAA 4RU9A 1N5TA 1N32F 4M5JA 3RAQA 2B4VA 4N76A 2LXUA 2W25A 3UDVA 4CYUB 1FNXH 1IN0A 2IM3A 4KV8B 4OQJA 1KLNA 3LW5C 3E2EA 3C46A 1GAOA 2G1HA 3GWCA 3ZTQA 4RUHA 4KE5A 3KLHB 2HHQA 1HNVB 1NNDA 1X5SA 2EFQA 4XPEA 4MH8A 3QPIA 1S48A 4PG5A 4QBUA 2XC9A 2RHQB 4NCAA 1M5PC 2Y3YA 4YDXA 3MMCB 2H5EA 3P4UB 1HQEA 4C3KA 2OELA 3W63A 3NCRA 4EBEA 2HZVA 3G2XA 3OHAA 1S6QA 1SQGA 3SXLA 3VR1A 1PC4A 4JI8F 4X66J 4ES2A 1PJ6A 2IYIA 2K8GA 4C11B 3Q0AA 3M2RB 2UV8G 4RW7A 3TZYA 3LP2B 5KFBA 2J9CA 3VAKA 1SV5B 2RRBA 8AT1B 4NZ6A 4NRUA 2G1DA 1X4EA 2V4JA 3MWBA 2ATLA 1U1MA 2KB2A 3LANA 4WFAQ 3K58A 2QA2A 4WKRA 1WSRA 3A3OB 1ROFA 2FC9A 2QO3A 2V68A 4N47A 3UN3A 3DRXA 3WDOA 3I6PA 1KLMB 1WHWA 3R5AA 1UVLA 4RW8B 3M8QB 4LT6A 4WP9A 3LP0B 5L1LA 2CJKA 3KK2A 1H2UX 3MM8A 1NK6A 4DV6J 2EFNA 3T5JA 1J5EF 3FQKA 4N8NA 5ADZA 4DS4A 2FJXA 2ASJA 2HNZB 3D1OA 4CO1A 2FLOA 3V6KA 1OQ6A 4NE9C 1VK3A 2KKHA 5D4PA 3V6HA 4JOUA 1HNIB 2LXIA 3KJNB 2DHGA 2VFTA 2LQ5A 3QZ7A 3QJLA 2E5JA 1G6BA 3D2WA 2UV8A 1DTQA 2BM1A 3CJKA 5KFWA 2QFJA 3DYAB 5J2NB 4CT9A 1U0SA 2LP4A 2OTJS 3KOAA 3SDEA 3HSDA 4RUBA 2JSXA 2ZNYA 1R6VA 1S0NA 5A8RB 1FJGJ 2PEBA 2XMKA 1ZPWX 3AJ2A 3M2VA 4QWAA 1HW9A 2IBKA 4B3SJ 5E41A 3E51A 3TARA 2FC8A 5C5JA 4CLZA 3DLJA 5C42B 4ED8A 3A13A 5CA5A 2MGZA 3RR8A 1P6TA 2UUCF 5J2QB 1QE1B 3NMRA 3NY0A 2DNMA 1FWKA 3ZTRA 3H59A 4DCPB 4EO6A 4ZVSB 3EMTA 5FLXY 4DN0A 3K5LA 3EM1A 5DM6Q 3JYTB 4DR3J 5J2PB 3KHHA 4V19X 2CPDA 2X3DA 3BKUA 3ENWA 3FSYA 3MCNA 3D6MB 3MTKA 1RHKB 2QA4S 3D0HE 3F56A 2IHR1 4PWDB 4OHVA 1FERA 2GMJA 2VV5A 4XDDA 1FRJA 3OR2A 1HQUA 5CD4H 2UUBF 3C8YA 5J2MA 2JX2A 3OHBA 4QR1A 5H1SV 2XGPA 4C3MA 4DQSA 2BOAA 2NZ4A 2H4YB 3VZIA 1SJQA 2N7YA 4CLYA 2AU0A 1LW0A 1NKCA 3FZBA 5ETSA 4JI1J 2W8KA 3R9LA 2OSRA 4M95A 1RT3B 1S6OA 3NOGA 1RHRB 4A8XA 1U0HB 1IKXB 5I3PA 2E9ZA 1E6VA 2U1AA 1NK8A 5K14A 4WFXA 2E1AA 3BBFA 4IOBA 3MR3A 2GS8A 1U1NA 1SJ3P 3BJYA 3I0RA 4ZVOB 3EVMA 2ZM6F 1QAXA 1U0HA 1VLYA 3EWGA 3IR7B 3QMQA 2HZCA 3CB4A 2BYCA 4GVBB 1DY3A 1N0UA 1RTIB 3M8YA 5D4NA 2MSSA 3TJ8A 1YIJS 1XMOJ 3BM7A 1NKEA 4EK2A 4ZPWR 1SC1B 1AT1B 4EMDA 2UUAJ 4JI4F 3ELHA 5BYQA 2G9OA 3SIPB 4QPXA 4GRSA 4QWEA 4F36A 2W9CA 4Y6IA 2AW0A 3ZNJ1 5L46A 5KFXA 2ALZA 5KT7A 5HMZA 4FBUA 4QOTA 2HK3A 2PFDA 3HLUA 1U24A 2A2DA 1Q16B 4CZCA 4DV3F 4WE1B 4C8OA 1Y11A 1Q8IA 1RGVA 1ZAWA 3TUPA 2V9KA 1N5SA 2MJNA 4G1IA 4CNZA 4ES3A 2JWNA 1HPZA 1Q1KA 2W4DA 3UVJB 3W2VB 2BA9A 4A47A 4ECXA 2AGPA 1CBKA 1MLAA 2WBMA 3FRYA 3MMAB 2D3OR 4C8LA 1Q53A 3PFEA 1DQAA 1FX4A 4QCLA 1B0VA 3D3BJ 5F9NA 3PHTA 2P6TA 2H5IB 3KJQB 2EPIA 1KONA 3BGLA 1Q95G 5MAOA 1HMVA 3SBMA 4O4GA 4J5OA 1RQ0A 5D4LA 2VQEF 4B3OB 3GV7B 2EEYA 2CJXB 1BXNA 1RT1B 4P52A 5DQIA 4CI0B 2AMCB 2PGCA 5FD1A 5EGYA 3NKYA 2GO8A 3CJKB 2AP6A 1RHJB 3A8KA 3G71S 5DS7A 2DXEA 1P9QC 4B9VA 2PO4A 1VQ7S 1JX4A 4RL1A 4LF9J 2XM3A 2G2YA 4MIBA 3TNVA 2GVZB 4Y65A 1RA6A 3I9V9 3W5XA 5L38A 2GCFA 4QIWD 5GAHU 4DF8A 2OJ3A 4X2BA 2LEPA 1QJHA 3BKTA 4FXWA 2VFVA 2A0FB 1FJGF 2D69A 1N0VC 4HHJA 1HWIA 1BWVA 2H65B 2J7UA 2QTWA 4Y00A 5IC4B 4DUYF 1JXVA 1N5YB 5ETMA 5IM0B 4LVOP 1O51A 4G1QB 3V5RA 2ZWOA 1Z2LA 4XPCA 3CULA 2XZTB 1AZSB 4MIWA 4JV5J 4ED3A 4G3IA 4ANDA 3CUNA 2M8HA 2IVYA 1BC6A 5LXYA 3N79A 4IO9Q 1T95A 2F1FA 3ENQA 4RW8A 3QIPA 1S10A 3OW2R 4MKYA 1MNEA 1X4FA 2KN4A 1N8RT 4ZVRB 1IKWB 3PW5A 2BJDA 4I0WA 4ZLPA 3R3TA 1X0FA 2BDPA 4DR6F 2G0CA 5EWFA 4KJIA 1EX8A 3H2UB 4DX6A 2MKSA 4M5DB 1F60B 2X7IA 3MEDA 4YR2A 3VHQA 2NUUG 4IDKB 4UW2A 4ZPAA 4ZVUB 2W1BA 4EZ9A 1M5KC 1K0TA 2ZKTA 3K59A 2RF2B 4Y2KA 1SC4B 3PYDA 4RW7B 4JI3J 3I82A 3SCKE 1CULA 2XEXA 2GQCA 1U25A 3PXGa 1H38A 4RBTA 1FKPB 2M88A 1N6QB 4F4YA 2BJ9A 1KHVA 3V4IB 2BKNA 2HNYB 1R0BG 3IAS9 1XMQF 4DR1J 1TKZB 1VQYA 1JMTA 1O6XA 3MMCA 5ETKA 2MQLA 5K8PA 4DFMA 1TP7A 2BW2A 2NXCA 3EVOA 2KFYA 1U6BA 3AD8C 1WC6A 4P2FA 4PPZA 2P8IA 4OX9J 1HMVB 2BBEA 5HP1A 1N36J 2DR9A 3MF5A 2I9SA 3FK4A 3TA0A 4IG0A 2CQPA 1A0OB 2YKNA 3A12A 2JC1A 3N6MA 4KV8A 2QRRA 5K9FA 5J1EB 3V6JA 3TJ9A 2B4PA 3J81j 2N7CA 4DFPA 1QSLA 1HWKA 1NDPA 5B0GA 1SI9A 2C42A 2HYIB 3IS9A 1YZ7A 3UVJA 4ZLJA 3TQ1A 4O3RA 2V8HA 2E5LF 1YJVA 4ZPCA 2CIMA 3KLFA 3CE8A 2DD8S 3F41A 2B4UA 4PR6A 3Q89A 2XY6A 4OLOA 4ZPVR 1O5JA 4PAAA 2J8SA 2UU9J 1UWBA 3DHXA 1VC6A 1SL2A 5A8WB 3AQPA 1VC0A 5KOWA 2Q3PA 2DNRA 4IFYA 2B0GA 3VAIA 5KFQA 2FY8A 1WEXA 4ZVTB 2XB2D 1S1UB 3CSKA 3DRPA 2ZH4A 1RWOB 3ILIA 3KDNA 2CDRB 4N7TA 3BGOP 4ZK7M 2FJBB 4DX7A 3GJRB 4BC9A 3ITHB 1FFWB 3TZZA 3EPIA 4KGZB 2YBVA 2JLGA 2WHOA 4IQMA 1KEKA 3PW4A 2VG6A 2OGUA 3TWZA 1KR4A 2QLJB 1YJUA 3I32A 4U95A 1JIHA 4DBQA 3P5BP 1HNWF 2AEJA 3MPYA 1IKXA 3DLBA 3IM9A 3QGIA 3J81U 4RLEA 4UTGA 2IA6A 4H54A 2AYMA 2XHCA 4LSLB 3VAGA 1IKVB 1MMLA 2ZVIA 2DR8A 1VQMS 2C2NA 4JI0J 3WBZA 4ANCA 2BX6A 1K9MT 5JXSA 4CP5A 1CEZA 5BJRA 4WYLA 2GJFA 1FDNA 2DNLA 1LW2A 3NG8A 5HMWA 4FP9A 1JLFB 1NPRA 1WC4A 2CJ9A 2LQ9A 3MM6B 1H2TZ 3GP9A 2D3ZA 4KIAA 2W7AA 1W2IA 4LJMA 5HBMA 3JYTA 2ZH1A 4LF5F 4YB1P 1G2EA 1RU2A 4U8YA 4ZPBA 2RD5C 2V50A 4F4ZA 3BQ1A 1V5IB 3CD0A 5THWA 1K1SA 2EC0A 2NPIA 1JLBB 1TV6A 1QE1A 3IG1B 2PMWA 4PEOA 3ISNC 2VONA 1ZM9A 3CJTA 3DOKB 1T02A 3T6BA 3HHLC 2XMWA 1HIYA 4LFBF 4FYWB 1WHYA 2UVVA 3KLIB 1P8GA 1SKRA 1NZ8A 2OPSB 2JLEA 3HHNB 2JZ5A 4USVA 1XR6A 3MOZA 4X4OA 4RR5A 4QYRA 3B82A 2YWHA 5AJ3J 2JLFA 3MM5A 1VQKS 2DNZA 4DJBA 3RB3A 1JLEA 1CJUA 5ETRA 2F3JA 3HF5A 2ZH5A 1R8AA 5EDWA 4DV1J 4O3SA 1NXIA 4N56A 1X4DA 2RAQA 2FDNA 3H2LA 2WK4A 5HJYA 1RAIB 4HACA 4UF4A 1R6YA 3TUZC 4DF4A 3PYEA 2GX8A 5GVQA 3EZOA 4WZMA 4EGLA 1UJ5A 4G65A 1SB6A 2D74B 2ILYA 5IV4A 3BSOA 4ECUA 3DRYA 1BQNA 2XYPB 2FVPA 4A8FA 4MKAA 3GLJA 3MM5B 1RADB 2EK6A 2LXFA 4I7FA 3ZNUA 1XEZA 1RABB 3F44A 1V3RA 5A0YB 2W2OP 4KR0B 4LF8F 3M8QA 3M2UB 1FHTA 3VV2B 4LFAJ 2UVRA 4ZIWA 3DOKA 3BB5A 1YJ9S 3O8WA 3PJXA 4BBYA 4DR7F 3IG1A 2DXFA 3M1VA 5KFVA 4U7CA 4O3OA 3F73A 3GR1A 4BLGA 1WHVA 1U1KA 4RO0A 1TQLA 2RS2A 4WIIA 3OTBA 4LF1A 5A2QY 4BS2A 5CYQA 1KVIA 3MM6A 1ZZNA 1PCAA 4QU6A 3JB9k 1RCXB 3PVXA 1LXJA 2VASA 2ZFHA 4M94A 1FNOA 1X7VA 2AZ1A 2B6AA 2OKQA 3DFEA 3FFIB 4J90A 1G3OA 4ID5A 2XI2A 1YITS 5KFYA 1ZAVA 2I5JA 2AJQA 1DURA 3OFHA 2MYFA 2W2PP 3A8JA 2NCKL 1HQEB 3AOBA 1RHQB 4OZ2A 2YNIB 5B0AA 4DR1F 1MSWD 1EZZB 3W7BA 2HSEB 4OYAA 2W01A 3CGIA 1FE0A 3LGHA 1X4CA 3R7SB 2ZHBA 2HQFA 1Y9OA 4L6V3 3KUEA 4IR9A 2NS1B 2GMLA 2V2KA 1WSVA 3PJWA 3BDEA 1DLOA 5FJ4A 3D68A 4ILMA 3NBPA 2EFVA 3A3NB 3CPWR 3DMJB 3G96A 9ATCB 4ED1A 4FYYB 1S1UA 1SKSA 3GV5B 2LA4A 4AQYF 2M70A 5M2PA 2HBYB 4QIVA 5LMNJ 2HHUA 4PXCA 2BJ1A 4CTAA 4X64J 4L74A 3HD1A 2FVRA 3TR5A 3B78A 2QGFB 3D7SB 3P96A 4A8MP 3C3LA 4ED7A 4P74A 3T5HA 1IJFB 2ALYB 2D9OA 1QAYA 2Y1RI 4L72B 5CCLA 4R5PA 4FYDA 3BZQA 3JXOA 4C9DA 2QA1A 2R8KA 2DHHA 1S1XA 4I69A 1APSA 2ZZNA 1AXQA 3TA2A 5IT9Y 3PKMA 1MMDA 1SQEA 5AXMA 2AKWB 2HQGA 4ZN1A 3KDOA 2CDQA 2XI3A 1HBOB 1N48A 4C0BA 1LQ9A 4ZVFA 3WC0A 1SL0A 2UUCJ 2GIQA 3W62A 4X65F 1KC8T 3DLKB 4ED0A 1D0EA 1QLNA 2VC0A 2XLKA 1B64A 5DDPC 4MK9A 1FVSA 1TKZA 1QVGR 4JI4J 1Y5IB 4RU2A 3GYNA 5T41A 3T5LA 1FESA 1U8WA 3NAHA 1I5OB 1FKPA 1XIQA 2E1MC 1KQFB 1FVQA 2CZ9A 1Y3KA 3M6WA 2KT5A 2V4QA 2BE2B 4DN9A 1BLUA 2C28A 4N41A 3EGVA 5KG2A 3ZZTA 4AUKA 4OX8A 1OJ4A 4XTTA 1NM2A 3J7YU 2HNDB 2DY9A 2HS4A 2NXNA 5KTQA 1CJTA 1RAGB 3MEDB 3OT9A 4DV4F 4K4TA 1SUQB 2FZKB 2ZBPA 4L76A 4M5DA 4M5MA 1QY7A 1R8HA 1NMEB 4OYBA 4WU3A 5D6GA 4IO1A 4CIOA 4RKUC 1Q8KA 4DL5A 4K7QA 3V6DA 2K7JA 1YDLA 1M90T 2FHKA 3NGUA 5DDOC 1SKUB 4GO7X 4BWMA 3TX8A 1P27B 2DR5A 4M1KA 2YKMB 4IKAA 1RISA 4LRAA 4Y3CA 2HMIA 1H72C 1Z1ZA 5D0EA 2Z58B 1HWUA 1VIOA 1VFJA 1T8EA 4CNYA 5D78A 2KYZA 3FCHA 2QSWA 4X4QA 4NLRA 3OVAA 3TANA 1B7YB 3J81Y 2ZH6A 2E66A 4C0OC 1SBRA 3T19A 4F26A 2F9JA 4UT4A 3IR6B 1EB0A 1KHWA 2GMHA 3QNWB 4TKTA 5H9EK 3EGZA 1SPBP 3OTCA 3ZTOA 2XS2A 5T14A 2YPZA 2ZE2B 3MM7B 3HPOA 4QIEA 4J9UE 2KH9A 3CEDA 2N3LA 4F4AA 2L9WA 2RDJA 3ET6B 4I2QB 3DM2B 2GV1A 4ZOSA 1IKYB 3CC7S 2KFNA 3L9ZA 3OL8A 1TAQA 5EX3A 5HI7A 1F9FA 3MFHA 1SL1A 9RUBA 2ZJRQ 4F3QA 3RBZA 1GT8A 2XYHB 3GG0A 4GKKJ 2FJEB 4ILLA 3MZIA 1UVNA 3KLIA 3HHKA 1HHTP 3B8HA 2DISA 3DDKA 3FC9A 4J37A 1Y10A 1TK0A 2NLWA 4ZHRB 3CJSA 4DR6J 5E3PA 4WKYA 2MZQA 4ZJQA 4QZVB 2YTCA 3QYYA 4GC6A 1HPZB 4KAIA 2J6UA 4F2RA 5AXNA 5HBMB 1T9TA 3IA0A 5B0EA 1IBLJ 3R6GB 1JLFA 2R7VA 1DAXA 3UNYA 1NB2A 1XTZA 2HHPA 2P9EA 3FEZA 3R7BB 1OMSA 5D0HA 5DZ7A 5CXTA 5DLFA 5L8RC 3C6TB 1U6FA 2HAFA 2QJ3A 4DPUA 2HRTA 2XQCA 2HIYA 2P9CA 5ETNA 7FD1A 2W9CB 2HFSA 4DSEA 4YOEA 2Z2YB 1VYAA 4NL5A 1IKVA 2KRBA 3M4XA 1KQKA 5JMNA 2IJFA 3IC1A 3IMQJ 2MQOA 3ISND 1PSDA 7FDRA 4RUCA 3KK3B 1M1KT 1UVIA 4Y2CA 2K1RB 2CVIA 2BRLA 2ZEJA 1V5VA 1J5OB 1KVKA 1FRKA 2AT1B 2F5GA 3N6LA 3QWPA 2QIFA 3AJ1A 2ERRA 4ZCLA 2KG0A 1QTNB 2O5DA 2QA4G 1PKUA 4GVLA 3OFFA 3PX4A 2UZAA 2HHHF 3RAMA 4YS2A 3OUYA 3ENAA 4OZNA 3DRRA 2FLNA 1U6ZA 4MFBB 1LW0B 2DNYA 1C0TA 1T05A 4JI3F 5KFPA 3FRZA 3HO1A 3MCSA 4NASA 4NLQA 2JFKA 4C0HA 4Y2IA 1S72S 1J5OA 4F8RA 4FYXB 3OTDA 4FF4A 1TL3A 1UZHA 3DLLQ 1A9NB 3N4WA 4YQWA 4WFBQ 1JJHA 4LFBJ 2FPHX 3G4SS 2CPEA 3E8OA 4WFZA 3K57A 1M5VC 4URGA 2HQIA 3PEHA 4YEAA 2N82B 3MR6A 1I6JA 4CCHA 4NWBA 3I55S 4OYOA 1HHQA 2BW7A 3FVYA 2GHVC 1NLKL 5HATA 3W9HA 1PAUB 1SC6A 4RX6A 2CPIA 1EIYB 1NSQA 4FS2A 4NLGA 2HK2A 2QX0A 3HSJA 3UDLA 5J1EA 1CPZA 3D6HB 1F3FA 3TZWA 1NAQA 4JI2F 1S97A 1N4LA 2DXDA 4ALZA 2EKNA 2RSQA 4ZJLA 4EUVA 4B3TJ 1FKOB 1K73T 2BABA 1RJJA 5CAAA 3LWMA 3M2VB 3W61A 4JI7J 2RU3A 4USMA 1D8YA 3UE2A 5A8RA 1TL7A 2QLFB 1HBNB 2HVDA 3TVZA 2I1RA 3NS7B 5A8KA 1WHXA 1XQIA 3IBCB 2FJAB 1WORA 4KT0C 4DR3F 3DYAA 5J2NA 5GAEI 1N6QA 1VC5A 2POKA 3O1LA 3T9NA 3QZ8A 5D0GA 3ZZOA 1CULB 2DGXA 2VPYB 1JLQA 5K8MA 1PBAA 2CG8A 3D1QA 1S77D 2B9XA 2L9DA 3IRXB 3MD3A 4J9KA 2DRBA 1EKSA 1XBWA 3UFCX 3HFVA 3J80Y 3RAXA 2WB1D 2J9EA 3VF0B 1WTBA 1X8DA 4DPTA 2DNKA 2HWIA 2DPJA 4A46A 3EICA 4DUTA 2R8JA 4JYAJ 2N4DA 4DR5F 3B54A 1WF2A 2L41A 4DEZA 4NX9A 1YLXA 2CJBA 2XO7A 2UP1A 4DSIA 5IT9U 4ZITA 4O44B 2RRNA 5JUMA 1F5CA 3KK2B 2X1FA 1J2VA 3BEGB 2VUGA 1E6YA 5F3ZA 4NLPA 1AZSA 4E8UA 1KLMA 4B08A 4DUZF 1RAJA 1OO0B 1T11A 2BV3A 4G1QA 5KFIA 4BDPA 3DNCA 4LIRA 2RQ4A 1QD1A 2HFVA 3MFIA 2WSCC 4U7UD 4NYOA 2V4JB 1WC3A 3MGJA 3LUYA 2E7WA 3EUNA 2R42A 1NHUA 2E9TA 2KJVA 3V81B 1M5OC 4PQUB 1OSDA 3EE3A 3GIRA 3DC2A 4JI0F 4I1TA 2HHWA 2DGSA 1BD6A 3CO0P 4NZ0A 4XDCA 2Q66A 4ID8A 2W24A 2ZJQQ 1BY9A 2AGOA 2YX4A 3HSGA 4LRCA 1L3UA 5J1NA 3M8ZA 2DB1A 5F8IA 3UR3C 5L1IA 3VQTA 1FK9A 5KFOA 3SZ2A 1VQLS 4C4WA 3BR9A 1I3OB 1TL7B 3CJ4A 2I2YA 2FHOB 4UUXA 2BXJA 4FNIA 5B0DA 3O2IA 2YNFB 2BZ2A 4B3OA 2IMOA 1WC0A 2A1BA 4B9TA 1B70B 4O4GB 2KXNB 2B4OA 2P2CB 2RIJA 2P5VA 3OXGA 1FXRA 1TMMA 3DN9A 5GADU 2ZH3A 3SV4A 4ZKAA 4PUOB 4TU8A 1S1TB 3EVWA 2LQBA 1RWUA 2FLLA 2JEJA 3BDPA 3OTEA 3P5TL 4KO0B 2W4CA 2FHJA 2EWHA 3S6EA 3RYLA 4YFUA 1LKZA 1TFWA 1YJ7A 3RG6A 1SCJB 3AB2B 2XMJA 2XCPA 3GB0A 3N5FA 2FUG9 5ETQA 5KFFA 1NK7A 2KDOA 2NYIA 2R7XA 2OUGA 1REVA 5GAHI 2KHCA 1YZ6A 3KUHA 2H1YA 2OPRB 3JSYA 5KFMA 2FZGB 1MWZA 2MTLA 2YNHA 2MZ1A 2OMOA 3BREA 3JQJA 3WHIA 2CQIA 3MAAB 1UL3A 1RTHA 3PJ9A 4UOFA 4U6PA 4FVCA 3N9UC 4HR2A 2JFDA 3DLEB 4CH7A 2L3MA 8RUCA 5F8LA 4B3TF 3C2PA 4H4KC 3OBIA 5EHHA 3W66A 1RLCL 3QFWA 4PG7A 2ZNZA 4ZP6A 5F8HA 5BR8F 3GIMA 4O0IA 3DRRB 4LREA 1B0TA 3S01A 4R0JA 1N32J 2DCUB 4ED6A 4DQPA 4FBTA 1FJ7A 4B9SA 2X1GA 4CLWA 1YHQS 3TAPA 2VA2A 4JV5F 3MTJA 1QM9A 3TAMA 3AFGA 4ZP9A 3ZZYA 4ENOA 3K0JA 4X4NA 1E6VB 2PEHA 1UEUA 3FBCA 1RLDA 3ZO7A 2V8VA 4R8UB 2IDEA 4ZVPB 4A8YA 1RSCA 1RKIA 2CNLB 2YNGA 4I68A 2VOOA 2HW3A 1S9GA 1F2HA 3M05A 1URNA 4MIAA 1TAUA 1KTVA 2LVWA 3ZTSA 1YJRA 2C3YA 2V8DA 5J2MB 1XR5A 4I6YA 1OPZA 4U8VA 5T7LA 3ADAC 4BHQA 3CCUS 2V9WA 4PWDA 1D9AA 1FJEB 3AHPA 3DGVA 5D0RA 1UW4A 5B0FA 2YNHB 3UNGC 4ETXA 2XMTA 4IG3A 2RJZA 2VU5A 5J2PA 1REVB 3NWRA 4ZJOA 3IGVA 5A76A 2Y9HA 4CH1A 5LSOA 1K47A 2W7PA 4C98A 1LXNA 3VQSA 2OFHX 3CIZA 4Y34A 4J9VA 1T03B 1V3SA 1B4SA 4YP3A 4URSA 3OL7A 2PA8D 4TY8A 2E44A 4KO0A 2C3OA 2HS0A 3GJTB 3Q8UA 1WOSA 3LAKA 4RJVA 4YB7A 5B08A 1NJZA 4JV2A 3GU0A 4ZVEA 3UWTA 5IQ6A 2DO4A 2Q43A 1I94F 2HVZA 4GKJF 3OR1B 2CPHA 2V94A 2ZHOA 2O67A 3BS9A 3SFGA 1LFPA 2ZBIA 4XIUA 1YTYA 2QEXS 3C16B 2MQQA 1ZA1B 2HBQB 1IKYA 1CC8A 2EFPA 3PKYA 2Q1LA 1W7WA 2Z4PA 2XZDB 1N33J 4EBCA 2ZD1A 2RDIA 1T0TV 1WDDA 2CPXA 4FDFA 3IBWA 3KLVA 2QLWA 3LA0A 4FVMA 2DR7A 3UN2A 4LF8J 4P9SA 5DRKA 1S1VB 2C2OB 1LWEB 3CDBA 2G0JA 1C1CA 3PHEA 3SCJE 2W8LA 2BJ3A 3PZPA 4C8KA 4ELTA 2YQ0A 2V67A 4ANEA 1GXLA 4OV6A 3CDUA 3U27A 2W9BB 1SQFA 3V81A 1YX2A 1KQSR 2VQEJ 3CW2C 4YY3F 3AT1B 1FFGB 1HYSB 2X51A 3M8RA 5AE2A 4PPDA 1M1GA 3PX6A 2O3DA 3RB6A 4KB7A 2QMWA 3MR2A 3MM8B 3ISZA 2VFUA 3N5BA 3N6NA 2OD6A 1S7IA 1S4EA 4P2SA 3UDEA 1GEHA 4HI1A 5KT2A 1JXLA 3T1HJ 1WKLA 3NCQA 1U26A 3P6YC 3CCWA 2OPQA 2JEIA 4USJC 3OLBA 4W90B 3QO9B 3U02A 1NJYA 4FPRA 2WVDA 1RT6B 2J8AA 4MMOA 3LQVA 2KO1A 2CG4A 2PE8A 2WBRA 5E0OA 4I56A 2E5HA 4HTIA 1XC9A 2UUAF 1WOOA 2QLBB 1K1QA 3BO4A 3WIUA 4EFAC 1RT5A 1PJ5A 3MEEA 4QIGA 1EETA 2EC2A 2RILA 3PYGA 4KH0B 1S7HA 1LNQA 3SSQA 3CMES 5D15A 2AJ4A 2CJAA 2E29A 3HFZB 4KGXB 4N77A 1HNXJ 4NXMF 4Q8EA 1FEHA 5DLGA 2XNRA 1ITPA 3L7UA 1VOMA 2HVEA 4DV3J 2X1BA 3HULA 3A1YG 1U4BA 1VBYA 5A8KB 5GMEA 1RAFB 2Q79A 3J80U 4BC7A 2KJWA 3ZZPA 1LOUA 2JHEA 1JKHA 1RTJB 2H54B 2C2DA 4IOCQ 4ZIVA 5DQGA 1S5ZA 5LJ5Y 5AXKA 2MQMA 2XGQA 2QT7A 4OYZA 2CJYB 5GAGU 2R2SA 2MLYA 3TVYA 2M5YA 4C8YA 4RNFA 2HPUA 3QT5A 5DJBA 4PRFA 1VQ9S 3PR5B 2Z56B 1BUXA 2OMLA 5KFHA 2KG1A 2PDAA 2R2UA 2H3EB 4F2SA 4JB8B 1FXLA 2O01C 1G4CA 2Y1LB 2J9DE 1R7IA 2I8EA 4O4RA 1MG7A 1M0SA 3DRSA 3TO8A 4R5PB 3AD7C 1U8SA 1IBLF 2OTLS 2F4VF 4DX5A 2J0SD 1V9OA 2RT3A 3AXMA 1PIEA 1UKUA 4LBPA 2WZ1A 3NWGA 4F0MA 2VJUA 2KYXA 4LBIA 1QSYA 3KJVB 2LKZA 3L4BC 3LP1B 4DV7J 1K44A 3ZFVA 2VKRA 5KFLA 1UJ6A 1PO6A 3P3DA 1M1HA 1Q0NA 3WIVA 3POTB 4Q2LA 3LWLA 2DHSA 2FJDB 4MFBA 1YGYA 4F67A 1FRIA 1SH3A 2EW9A 2E5GA 1F9EB 2W4PA 3NBPB 4P7TA 4USHA 4PG8A 1CVJA 4A8SA 3O5TB 4WIQA 3ZZ0A 3UD4P 2DK2A 4O0NA 3SEOA 4YDDB 3M9OB 1JLAB 2UU9F 1N34F 1F6TA 2MZSA 4KY3A 4DLEA 3PM9A 1P1TA 1KOOA 1RBLA 2C2ZB 4CM0A 2BANA 4K2XA 5IXUA 3JSMA 2CPJA 1L3VA 3R5JB 3HSZA 5KOXA 3BSAA 3HHLB 2MZRA 2HQDA 1ELOA 4OI3A 2C2KB 2W2QP 5B0CA 4KC5A 1Y3JA 1U1OA 4LRDA 1R0AA 2XS7A 3FFIA 4PXDA 1IQZA 4DL0C 3IFEA 5G4DA 2HAIA 2AYBA 2KL8A 2M3DA 3TRGA 1T9YA 2XO6A 2IA0A 3CD6S 1EETB 3ZC4A 3UCZP 1TUGB 1JJCB 2XULA 3BBBA 2DT9A 5CYQB 4Q8FA 4RNOA 1TL5A 3Q8YA 3BYRA 1VQ6S 1N34J 1O0PA 1HI8A 2WVFA 3GIJA 1RI7A 1UEKA 5KFGA 4L73A 1XR7A 2RUSA 1FD8A 4ED4A 1WNEA 4A4JA 4ED2A 1ZETA 1LK7A 3D28A 4IRDA 1D9DA 2NSCA 2VD3A 2A3JA 1RT4B 3IXQA 4DQIA 3H4BA 4J9RA 4TN2A 5A0YA 2V6AA 2ZH9A 5ETVA 1NH7A 1TMJA 3JAMU 2OEKA 2FVQA 4KPYA 4HH1A 1ACMB 4WXWA 3IN5A 6FD1A 2V8PA 3Q23A 2GIFA 5FLXU 5IC6B 3B6BA 1TVRA 2D9PA 1MW7A 3GE9A 1HYSA 2VHGA 4KGVB 4LRFA 4PG6A 3DDNA 5G0RA 1EP4B 2A6MA 1EQMA 2OFGX 4DZDA 5LXRA 2XMMA 4RNMA 1NO8A 1U7LA 2KZMA 2D1CA 3PY8A 4AFFA 2B56A 1PAEX 2ZE2A 2GNKA 2ACYA 3MM7A 4UUWA 2W9AA 4NZ7A 1U1PA 2XNQA 2IYGA 1Q78A 5CYMA 5B7WA 1YBAA 2XTJP 2I6WA 1NBEB 3D4JA 4A48A 2M52A 3M9MB 1FI4A 4QR0A 5SUHA 3Q24A 3C14A 4I4BA 1JLEB 4JYAF 2DGOA 4OHXA 1VIXA 1XWLA 1U1QA 4UY8T 3QGHA 3VGSA 2DIUA 2MLZA 3QWUA 5CQGA 4E0DA 4MKVA 4U7UK 2IBOA 2OPSA 3H5SA 3MEKA 3D5MA 3AB4B 2CYYA 5LMUJ 2ZH2A 4IRKA 3W9IA 3HVAA 4BWJA 3T1YF 4TY8B 1HD1A 2FYXA 3TVKA 3V6DB 2VOPA 5AE3A 3IO1A 3LH2S 1ZH5A 3KLGB 2IRXA 3UO0A 4AD6A 3FMBA 3CVKA 4HHHA 3CO9A 3IR5B 4KSEB 1NK5A 4C8ZA 1UEVA 2K06A 3L3CA 2E1CA 4DV5J 5KFKA 2HEKA 1PG5B 5M2RA 1Q7LB 3PX0A 2YWKA 4JP8A 1ULRA 1OS5A 2BKPA 4TLRA 5T7LB 3U1MA 3KFWX 5DQHA 2I0XA 4LFAF 3KHLA 2C2EA 3W2WB 1HNXF 3ZXWA 1UPPA 4LQ9A 2CUYA 4J9NA 4FKYA 1S9GB 4S0MA 4YY3J 1C4CA 2KFZA 1YRUA 2AGQA 4DV2F 4USIA 2MKYA 2NPFA 3DLKA 5E5NA 2XCAA 1BQMA 2IY5B 4CO4A 2DO0A 4PWUA 4C2MA 3GSDA 3BH7B 4J9MA 1S12A 1GNKA 2CPYA 1MMNA 2GW8A 3FZ2A 5D3GB 1YQHA 3CMQA 2PN6A 2YXLA 2CNKB 1G7CB 3AH6A 5HO4A 2AJFE 3TOQA 1GTHA 1VDHA 3EZUA 1IR1A 1RK8A 2CQDA 3RR7A 1S59A 1IQTA 1HL6A 2XWYA 3SQGB 5AJ3F 4IRCA 4DL7A 3R2CJ 1WI8A 3IWXA 2R7WA 2DBBA 3ILJA 5HJXA 4P75A 4B3RJ 1DZ5A 1U47A 1HD0A 2YWEA 3UD3P 2VC1A 4OYPA 4J91A 1RYRA 1X4BA 4YB5A 2KTQA 4DG1B 4HTJA 1R3NA 1I94J 4KKOB 4TU9A 4DZ6A 1VQNS 2CZVC 1RACB 3DRSB 3AY0A 3PNIA 3D66A 1CSJA 4P10A 1VI7A 3GFZA 2K3KA 3IS9B 1MROB 5E2QA 1TR0A 1C0UB 3CTRA 3H0PA 2GAHC 3OXLA 1SH0A 4D3GA 3DXBA 2UUBJ 4IG0B 1RWWB 2NXJA 4FKXA 4TNOA 2B51A 1EQ0A 3JTPA 3AA9A 4PUOA 2J0WA 3PFOA 4DXLA 3SV3A 5FIIA 1U09A 3DGPB 3QBCA 1R8PA 2YNFA 3W9JA 3KHGA 2HGMA 5I3QA 5IWAJ 2YNIA 4ZA1A 1AUSL 3OTOF 2OPPA 2K7KA 3CWJA 2UVUA 3ONQA 2ROPA 3CCQS 4M5GA 3V4IA 5DM7Q 4LFCF 3W3SA 2DH7A 1FRXA 4GO5X 1S6UA 4HVZA 4OYIA 1UA1A 4ZVQB 2JVOA 4HHUA 4PXBA 3MUVP 2RMLA 2N4CA 1WF0A 1NK0A 1HBUB 1T9UA 2RF2A 4FPIA 2MSTA 2MZJA 5ETLA 3G87A 2CXEA 4OZ1A 3MI7X 3SYZA 3TJAA 2J6SA 2JH3A 1HLWA 1DHMA 3F0NA 3CJRA 3BYPA 3M32B 1FO1A 2ASDA 4OV1A 2OH2A 2VF3A 1NEEA 3RGIA 2N3OA 3QIPB 2HBZB 2GGPB 4AXIA 1H73A 1FDBA 1RB0A 3MPDA 4F3MA 1VBXA 3CDAA 3BGRB 4DMZA 4DR2F 1T94A 5LT5A 5IV3A 3OL6A 3VGUA 1UFLA 1X0PA 5GADI 4K4VA 4Q43A 6AT1B 3NRBA 4OJHA 1RWXB 2MZTA 2NXEA 3PG9A 1N5YA 2XLIA 1J5EJ 2J6TA 1GX6A 5C7PA 2F8EX 3MM9B 3OSNA 2KRRA 2BE9B 1FDAA 1UW9A 3DOLB 3OPKA 4MAKA 2YKOA 5ETTA 1TK8A 2E1PA 3IRXA 1C1CB 4OHZA 2HGNA 3KG1A 2ATCB 4JUZA 2DITA 5GAEU 2DPIA 4RBUA 3CCZA 3HVWA 2UVWA 4TVAB 4L3KA 1JNRB 5IZHA 1DQ8A 2QLXA 4M5IA 3M8PB 4Q44A 2VZ9A 2AQ4A 2Z30B 3H90A 4OX6A 1XNRF 3G8QA 1CJUB 3QAEA 3HD2A 3GFHA 1DQ9A 4I64A 2FHMA 1RKJA 2EFOA 5E3AA 2YH0A 1X60A 3TP2A 3NL0A 3D1HA 1UFKA 1S49A 4FS1A 1X9SA 4N5SA 3DXSX 1FKOA 5L1KA 1U2RA 3US5A 2JDJA 2DTJA 4LQ3A 4HKQA 3J7ZT 4NCGB 3A4TA 3KWMA 5H9FJ 3C15A 2WB4A 3QSYB 1RU1A 5KG0A 1VRUA 3JAMY 3PW7A 2AJ2A 2ASYA 2JVRA 3GYXB 2RQCA 1WACA 1UJ4A 4PG4A 4WBFA 4OZ3A 4WK1A 3UCUP 4CO5A 2BR0A 1OY8A 2W7OA 1URRA 2XZWA 3VALA 2YKAA 2PI4A 1EKRA 1VRQC 2ZWPA 3M6VA 2Q6CA 2ZHAA 1T3OA 2VH7A 1CQNA 2MJUA 1NSKL 5CCMA 1TL3B 1YRXA 1XERA 1QSSA 1DBDA 4MYUA 3BBCA 1ZAXA 3AOAA 4K4SA 5DETA 5HK4A 3EDQB 3OSPA 4CLPA 4W92B 1VBKA 1T9XA 2ZJPQ 4DV2J 1KWMA 4LSLA 1Q86T 1RBAA 1VRTB 3VVUA 4DR5J 1BWEA 1PJ7A 2ZZTA 1PYSB 4ECWA 1T3NA 2HHTA 4ZMMA 4GVBA 1Y5NB 3QIDA 4IH6A 2OD4A 3T41A 1M5HA 2FD2A 3EJMA 4K50A 2CPFA 4KPCA 4OMFG 1WUUA 1D1UA 4NI2B 3GILA 1RHMB 3QLHA 1BMQB 5KT5A 1KSPA 5K8OA 4Q5VA 2YVSA 4O3QA 2QV6A 1EHWA 4DSJA 2CFXA 3R5BA 2JC0A 1EJ7L 4DL6A 4HDHA 2K1RA 3K5OA 1U1RA 3ZZZA 1YRTA 2GHPA 4RNHA 4C97A 2M4MA 1Q4RA 2R2RA 4F50A 4EBDA 1VQPS 2DNNA 1H0HB 1T9WA 2ZOFA 3AQOA 3QRPA 3QATA 3K7RA 3MPVA 5AXLA 2DEIA 4GKJJ 4I6AA 1OIAA 2OI2A 4H4OB 3GPAA 2IC3B 4CO3A 2EXUA 5IQQA 3KG4A 3PYFA 1RP5A 3FBFA 5B0BA 3I56S 3H40A 3CMAS 4B9UA 3P49B 2V2VA 2R9LA 2CWKA 3SQOP 4RWWA 2XHWA 1NDCA 4HLBA 1FA0A 2NQPA 4ECYA 4YB6A 3QFHA 4HYKA 4LR8A 4CRJA 2L48A 2G4BA 1VRUB 2B9WA 4W98A 3Q22A 2JL9A 4DI6A 1EARA 3C15B 2A10A 4UOGA 2BACA 4OZ5A 1YJNS 4B9NA 3NMAA 3C66A 5C42A 2GZOA 5HP1B 4JI6J 1VCTA 4H4KA 3K5PA 1BHNA 1QUPA 1IBMF 2BOPA 4Q7AA 4KGMA 4ECSA 5J1PA 4IUFA 1ZTWA 2AX0A 4WFNQ 3SDEB 1TFYA 2JRSA 3ILLA 3OL9A 2CVEA 4NA1A 1FTCA 4OJGA 1ZPVA 2WSFC 3LALA 3MEGA 2HG4A 2PT0A 1PYOB 5A6WA 5I4MA 3QJJA 2MKJA 4IH5A 1HNIA 4UQGA 4QPTA 4AL5A 1WDTA 1VS3A 2DNQA 3DOLA 4IDKA 5E3QA 5L9NA 4DL4A 3EXYA 3EZ5A 3MM9A 4F4XA 3TAQA 3OV7A 2RRAA 2KI2A 2DIVA 3DDIA 2LEAA 3PEJA 4KBIA 1L5UA 2HLTA 3D6TB 5BYRA 3GONA 4DUYJ 1GXUA 1IKWA 3MCMA 3S1TA 1N33F 2GA7A 1NK4A 3CCLS 2FJVA 3NNAA 4WZQA 1KFDA 3PO4A 1LWCB 3GTYX 4PZVA 1PC5A 2GGPA 2GO9A 2YKMA 3CCRS 3GQCA 3BQ0A 1S0OA 4CO2A 1NDLA 2CNNB 4WXOA 4LF5J 4IYQA 4MK7A 2B8QA 4DPXA 1XMBA 4DU8A 1XK8A 5C2GA 2MKKA 4CM2A 3KLEB 1TK5A 4LUBA 1WWHA 4TLQA 1SUQA 3FEYB 2GVDA 1KKHA 3U1NA 1GFWB 4M8LA 2FJWA 1F1BB 2DH9A 1NCLA 3G6XA 2GVZA 1TELA 4C3LA 4P7VA 2UXDJ 1N54B 1GQEA 3M6XA 1JJ2R 2MKHA 2BE2A 5DO2A 4WYWA 3R5CA 4B9MA 2Y8WA 3MEGB 3RBXA 1VQOS 5KFEA 2CAJA 3NAIA 2O1PA 2L08A 4P6QA 5KFSA 3IWNC 2RQKA 3T1AA 4EU0A 3W5YA 1PILA 1CS4B 1RT1A 1TKTA 2EG1A 2RKIB 2MPUA 4DFJA 1XMQJ 2H48B 1UETA 2CRLA 1NH8A 4C48A 4KTQA 4LMZA 2DR6A 4OI1A 1JXEA 3GZ7A 4E2FB 3BPDA 1S9FA 3KK1B 1RWNB 2G0IA 2D7SA 3K2YA 1WOPA 2E9RX 2HHSA 4DQQA 1MN9A 2C3MA 2HZAA 1GH8A 2WW8A 3HHEA 2ZC4A 3MURP 2VBZA 4CYUA 5D4OA 3ZZUA 4DQRA 3HK2A 2XY7A 2YKQA 3Q8SB 4JI5F 2ZUGA 2ADCA 1MROA 1O8BA 2QN6B 1Z2ZA 1NU4A 4NLSA 3CJ3A 4K4WA 1WELA 4G1PA 2E5IA 2H4WB 4DSLA 3NGKA 1YJTA 3I0SB 2R8HA 5L1JA 3VGVA 2WAQD 1UCNA 1WTFA 2HWTA 3HJVA 3M8WA 3NP5A 1X5PA 3GMGA 2OSQA 1X5OA 4DG1A 4AL7A 2ACMA 1D09B 2D41A 4USUA 1C4AA 4CTAB 2G13A 3P45B 1RWKB 1C0TB 2WRMA 5C24B 1VQSA 5CH7B 1PGZA 5MLCV 1RAAB 1YSJA 1RTDA 4MJKA 1YG0A 2HLUA 3MXHP 2QYCA 3T3FA 4KQZA 3KNGA 3R5GA 2MKCA 4NLTA 2PMZD 2LYVA 3ETMA 2VPXB 3I0RB 2XY5A 4OL8A 4ETZA 1HWLA 1NPPA 1P9YA 3NS6A 4AE5A 5HROB 4LF9F 1LEOA 4Q45A 2CZ4A 5E7OB 4CQ1A 3QT8A 4ILRA 1TKXA 2XG8A 3GJSB 4WJBA 5E3RA 3WZ0A 1H74A 5EWEA 4OHYA 4EEYA 1U48A 2V69A 1ZBTA 3UCGA 1B99A 3PW2A 4J9QA 3LPYA 4PKDB 3KK3A 2VPWB 1S1WA 1UZDA 1B3TA 3EXCX 4ID5B 1AYEA 3MR7A 5FDLB 6FDRA 1NSPA 1WG1A 2B6AB 4QJVA 1HQUB 3W65A 3W2WA 2V4RA 1KFSA 1IR2A 2EBEA 3C19A 1TKDA 2HIQA 1EAYC 2QE5A 1L3SA 2OIHA 4IH7A 1IBCB 1RYSA 3FNNA 3MHYA 1BQXA 1U45A 4NYZA 4WK3A 3BPSP 5IFMA 2GAGC 3THPA 3VGTA 4WFYA 4ZCIA 2DRAA 4F02A 2VDIA 3AODA 4V19J 4K0KF 1UPMB 3MD1A 3LAMA 3GYGA 2VKZG 2ZBQA 4U96A 4TU7A 2IVMA 2K2PA 3SCLE 2OEMA 3G8TA 4B3MF 4UQTA 1S6PA 2HHVA 4NCGA 2R4FA 1VISA 2V0NA 2QL9B 2BQRA 1C2PA 3Q86A 3Q8RB 2AD9A 1SJ1A 2AHOB 2RUGA 2HVIA 2WCXA 4I7FB 4F25A 5JVGQ 4OIXA 1FRLA 1UVJA 1XMOF 3C14B 5K8NA 3UI3A 1X5TA 3ET6A 3M8PA 2E7XA 1VHFA 1DJ0A 1DTQB 2MHNA 2BEFA 3M30B 4I2QA 1QAJA 4ERDA 1ZS6A 1GXTA 4M63A 5C25A 4DDFA 4A8KA 2D3UA 1WKKA 4JV0A 2IJRA 4O3PA 4CLFA 1FX2A 1U49A 1NPKA 1D3WA 1RT7B 4TQRA 2VQFJ 3CD7A 3R97A 4MYTA 5KFZA 5I42A 5K20B 5LL6d 5JJBA 4ITSA 1FRHA 3H8YA 3TA1A 4Y2AA 2NYHA 1DARA 2FLPA 2LMIA 2M0GB 5KG6A 4RNNA 2R7RA 3CDEA 1IJEB 2ZDOA 2VIHA 3VVTA 3KTQA 4ZCMA 4LF7F 3QT7A 3SFUA
chains in the Genus database with same CATH topology
2GQQA 2OLWA 1Y7PA 4X64F 3V4MA 3LP0A 3OQ2A 1GX5A 1NRKA 2HFOA 4FZVA 3D0IE 3R27A 1YJWS 1B7FA 3I31A 2VG7A 2FGCA 2FTRA 3MMJA 4D3HA 3MOJB 5HLFB 2R8GA 5KG7A 3KNAA 2UXCF 1IXKA 3FGVA 2NXUA 2HS3A 2PC6A 3H5XA 4X4TA 1HBUA 3WX4A 2WONB 2OAUA 2MB0B 1ZM2A 4Q0BB 1SJRA 3LGNA 2ZZMA 2DNPA 2BQUA 1WI6A 5BYSA 1S1WB 2GHWA 3CJ2A 2OPPB 3PO5A 2EVZA 2F8MA 4IR1A 2IAJB 4KHMA 3BO3A 3ICLA 3Q2SC 2O66A 5CZXA 3M9NB 2VBYA 4LQ3A 4PXEA 3JSMB 3V2UC 3VWSA 2J0XA 1HNVA 3HHLD 3VZHA 5HN0A 4QYZJ 1JLAA 2ILZA 4DPOA 4C7QA 2X3GA 2ZOGA 3CCJS 2Y1IA 4ECZA 3BQ2A 2B7CB 4FN5A 3RU0A 1S1XB 3RW7A 3GFYA 1KQGB 4DL2A 3HVTA 4NLXA 1RTDB 2YH1A 1X4AA 4R0EA 3CCSS 5KFAA 2AYGA 1NJXA 1FDDA 5F0WA 3TYTA 5A8WA 3CC4S 2R7SA 2H9ZA 3BF4A 3QGGA 4JI6F 1UWBB 1FRMA 1CQMA 4YUDA 3O6QA 3NNCA 4WU2A 4LF6F 3I0SA 1WG5A 4RW6A 5IT4A 1WG4A 2DCLA 1KVJA 3DMJA 1F5AA 1FE4A 3CC2S 2HFZA 2DGUA 1DLOB 4ICLB 4TQSA 3HVRA 4A8QA 1RT2B 2YKNB 2ZDPA 3MAQA 3O44A 2KM8B 4DSFA 1U2FA 3OXFA 3AA8A 5L9XA 5KFNA 3FSIA 3KK1A 2HRYA 4NLYA 4RW9A 4F4KA 1BQMB 2F7VA 2VBXA 5B09A 5J2QA 4NXNF 4BCAA 1CLFA 3X3UA 1TKTB 2RKIA 2NR0A 3EYZA 2HNYA 2I5JB 4X62F 3KMQA 5AE1A 4Q0BA 4EYHB 2VL1A 3DLGB 2YWFA 2IRUA 3GIIA 3EPGA 4FF2A 5E3CA 1HW8A 2P6SA 1MU2A 5A6PA 3J7YI 4QQBA 2BQ3A 4Y2MA 5JVHQ 2UUWA 4MKBA 2JEGA 2EG2A 2B7BB 1NJWA 1KNZA 1N52B 3QGPA 2M7SA 3CIMA 2YX1A 1VQ4S 1WF1A 4JI1F 3KLGA 1D8ZA 1S99A 2AX1A 1N56A 1M5SA 5LSLA 4JBCA 5IS2A 3L7OA 3M1VB 5DG7A 5KG5A 4J9LA 2UXDF 5CYJA 2GJIA 5F3TA 4Y28C 1F5BA 4TY9A 3H25A 3VCDA 5IM0A 2VPZB 2EBGA 3DOMA 4X4VA 2KM8C 2GJ2A 1BQNB 4TYBA 2FVCA 1KD1T 3D54A 2W9BA 1NZAA 3RRKA 5CYMB 3PIPQ 1SIZA 1YWXA 2AJ1A 1RT7A 2BUNA 4X84A 4J9PA 3R1HA 1S1VA 5DG9A 2KT3A 4DFKA 5C25B 2KHDA 2RE1A 2ZD1B 3M30A 3SCIE 5KFRA 2XS5A 2MXYA 2FVSA 3GR0A 3Q8PB 4OI4A 2MKIA 1FEEA 2IRYA 1N88A 1X4HA 2B43A 1U1LA 1K8AT 2FY1A 2WTFA 5KG1A 2APOA 2ZKUA 2A18A 2CQ2A 3TW0A 1RT4A 1OWXA 1X4GA 2GQ2A 1Y0HA 2F40A 4KFBB 3GG1A 5K5MA 1TV6B 1FT8A 4QR2A 1H3DA 4ZP8A 1T03A 4OZLA 3HM9A 2J5AA 4C8MA 3W2VA 2NREA 2ZH7A 5IWAF 1QTMA 3HKZD 4NPOA 4N8OA 3RTVA 4OI2A 4KHPF 4DOZA 2KVIA 4QW8A 1LW2B 3ETOA 4H4OA 4X66F 2LU1A 5SZTA 3H5YA 2PIIA 5KT4A 1ZM4A 1DRZA 5KFUA 2KXHA 2VG5B 5F0UA 1Z4UA 2YX7A 4KHRA 3NS5A 4ZPDA 2X1AA 3T1HF 4HEA9 1HARA 3ULHA 2OO4A 1LFWA 3FQLA 3GV8B 3I5AA 3N0VA 2CQCA 1FKAF 2YNGB 3I9ZA 3HHLA 4ELVA 3E3XA 1RTIA 2BANB 2EI5A 2ZVSA 3NCPA 1JLCB 4R8UA 3VAMA 4X4UA 2Z2LA 2CQHA 3CCVS 2HQ3A 2I38A 3QLHB 2DNGA 4HL9A 1NKBA 4NLVA 1JB0C 5K14B 4NOHA 3MECA 3S7RA 2CQ3A 3ITHA 2IFXA 5DGBA 1Q79A 5EUHA 3DRPB 3JTNA 5C24A 2HFNA 4HYKA 1ZM3A 1OPIA 2V5HG 1R8BA 4KRWA 1RA7A 3TR5A 4IFYB 3KKFA 2HGLA 2PMHA 4OX7A 4AL6A 3T5KA 2IMWP 3DHWC 1RTHB 4RW4A 3KMSA 1B0PA 3NGDA 3DU5A 3CCMS 4JV1A 1CC7A 1H7WA 2C22A 3HDSA 1XNQF 2RH3A 3L09A 4K4ZA 3KLFB 2RNEA 3KG0A 1X9MA 2PI5A 4B02A 2VFRA 1JNZB 4NCBA 3A8EA 3J7A1 3CJ0A 3CJ5A 4B3RF 2CKWA 5LSRA 2RVJA 2IM2A 3FSXA 1H2VZ 3PIOQ 4QWDA 5EN1A 2LDIA 2IM0A 4NLWA 4IOAQ 3E01B 3WC2A 1ZZFA 2CPZA 2B5JA 4LSNA 1JKHB 1RTJA 3RB4A 4E98A 1Q8BA 2VB6A 4HDGA 2RQMA 2DGVA 1H6KX 2JJ4D 4RWXA 3HKWA 5KT3A 3ZZRA 1DTTA 4QWCA 4UOCA 4EO8A 4G6VB 3DI6A 1TZ0A 3CT9A 1LWFA 2CQ0A 2XBPA 3HZGA 5I3UB 1KS2A 4X4SA 4I2PB 1S76D 4OI6A 1RT5B 4YMEA 3Q8QB 4GC7A 4ECTA 4EZ6A 4PQUA 2XSJA 3HP6A 5CHCB 3OFGA 3CF5Q 5EWGA 1DFDA 1QUVA 1Y4ZB 1Q82T 3KLEA 3PV8A 1G1XA 1N5QA 3QO9A 2M8DB 2A2CA 1TL4A 2LCWA 1XN9A 4Z2XA 1HR0F 3ENVA 5F8JA 3T6JA 3RB0A 3C6UB 1UMJA 3FEXB 3VAJA 2DHAA 3BGRA 1LWCA 2G4BA 2KU7A 3Q2TC 3GFXA 1NK9A 3EX7B 2Z8QA 2FGOA 1W25A 3THTA 2BRKA 3R5DA 2HRUA 4MTPA 1WEYA 2ROGA 4Q2MA 5KFDA 2P9GA 3M8SA 3K5NA 2FB0A 4UY85 3VTIA 1IUJA 2QSFA 1LWEA 3BGFA 3DLHA 4HT7A 4I2PA 3G9CA 5I3UA 5E33A 5KT6A 2B9YA 4U67Q 4FF3A 1LWFB 1UVMA 1FTRA 3QAUA 3J7Z5 1S6QB 2PD1A 3G6ES 2LA6A 4B9LA 2LDYA 4OZJA 4XAKA 2IM1A 2YWGA 2RU9A 2XLJA 4J9SA 2MHEA 3K8VA 5DGAA 2B5JB 4LSNB 4YHHF 2R7OA 1Q81T 1R31A 3B4DA 3E01A 2PFFB 3G86A 1BGXT 1QAIA 2ABYA 5IT0A 4DLGA 3EGNA 1C0UA 1WD6A 3MMAA 5HQ8A 4K5SA 1NB7A 3OFEA 4NA3A 2DH8A 1KTQA 4DV0F 1S9EB 4WE1A 2ZITA 4IG3B 2IC3A 1ZOTA 4R25A 4KKOA 1R89A 2CQBA 2GC8A 1KOHA 5LMUF 2VA3A 4X4PA 3K8WA 4NYPA 5KFCA 5ITHA 1AROP 3HXMA 1S4FA 2V8GA 4QWBA 4OFZA 4RZRA 3BN4A 4HH0A 1Q7YT 2VFSA 1VMBA 4DWIA 3LGMA 4LVNP 1QVFR 1RDRA 3JSBA 1YVFA 1A7GE 3PRDA 1HA1A 2LLZA 3CCES 2HHXA 1VK8A 3TAMB 2DGTA 2F9DA 3LO3A 1K0VA 3UDCA 3I96A 2AV5A 2F8HA 5F8MA 3HMJG 3JSRA 4NRTA 1RT3A 4YR0A 3PR4A 1R43A 1HHSA 3OJUA 5EX0A 2VODA 1VRTA 2CQ4A 5H9EJ 2MDAA 3G6YA 2R2TA 1KRPA 2UUTA 2Q6BA 1Q8LA 3OR2B 2FHJD 3H4DA 1JJ4A 4ECQA 4K4YA 1VJWA 2OPRA 4FNHA 2GIRA 1S9EA 3HHDA 2DGQA 2XMVA 2J9DA 3U1LA 3BSNA 3I4PA 3UPFA 1H98A 4ZHRA 2WOMA 5HL7Q 4EWTA 4KFBA 2MGZB 4OHWA 2J7WA 5GAGI 2XSFA 1S1TA 5L39A 4DV7F 4WF9Q 5D77A 4B17A 5HMXA 4JI7F 3THVA 2EKYA 4ZVHA 3HI9A 4ZVGA 3X1LB 1T7PA 3U7JA<