2X1BA

Structure of rna15 rrm
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
GPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA 3'-END-PROCESSING PROTEIN RNA15
publication title Structure of the RNA15 Rrm-RNA Complex Reveals the Molecular Basis of Gu Specificity in Transcriptional 3-End Processing Factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 22
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2x1bA00
5LXYA 5D78A 3IWNC 1FJ7A 2DGXA 5IM0B 3CPWR 2ERRA 1SJ4P 3R1HA 2MKHA 4A8XA 1VQLS 1HD1A 2LCWA 1VC5A 1YTYA 2MZTA 5LJ5Y 3BO2A 2KHCA 3G4SS 3UD4P 1VQOS 2I2YA 3P6YC 2CQ2A 1VBYA 3CC7S 3P3DA 4M5DB 3BO4A 1QVFR 3CC4S 2KRRA 4IUFA 3CTRA 1WG5A 4CQ1A 1YI2S 2DHGA 2CPJA 2MQMA 2E5JA 3I55S 1K73T 2DNGA 2HYIB 2MPUA 3S6EA 4F25A 3NNCA 2CPDA 3LPYA 3OW2R 2YH1A 2U1AA 1M90T 4UY8T 2BOPA 4F02A 2MZJA 1S72S 2RRBA 3ZZZA 1U1MA 4IOAQ 4WKRA 5FJ4A 4YOEA 1W2BR 2F9JA 1YIJS 1JJ2R 1OWXA 2CPEA 3IRWP 1YJWS 2M70A 2LXUA 2D9OA 2AD9A 1DZ5A 3NS6A 3UCGA 2MJUA 1UFWA 2CPYA 3S7RA 2X1GA 2YKAA 1WTBA 2CQ3A 2JWNA 1VQ6S 2V94A 4WFNQ 3MUVP 3UCZP 4FXVA 3I56S 1WF0A 2KYXA 2O3DA 2JVRA 2PEHA 3H2VE 3SMZA 1WHWA 3EGZA 4OZ1A 2CQGA 2YWKA 2D3OR 1N8RT 2HZCA 2G4BA 3Q2SC 4TU7A 1ZZNA 2MQPA 2CPXA 2MSTA 2DNQA 1U1NA 5DM6Q 1KC8T 2CQDA 1JJHA 2MQQA 3THTA 3NMRA 2MZSA 5JVGQ 1XN9A 1VQ4S 1N88A 3S8SA 2KM8B 2DISA 2L08A 4WIIA 1H6KX 4CH0S 2DGWA 1RKJA 1VQNS 2MKSA 2ADCA 2LEAA 2LA6A 1UW4A 3TYTA 3MUMP 4ERDA 2CPFA 2FHOB 2I38A 1VQPS 3CCES 4Y0FA 1K9MT 3BO3A 1DBDA 5BJRA 3DXBA 2CQ0A 5ITHA 1BY9A 2EK6A 4UQTA 3CCJS 3FEYB 1P1TA 2G1DA 2FC9A 2KH9A 1FO1A 3CUNA 2J76E 1UAWA 1X4EA 1X4CA 3HHNB 2MXYA 3SDEA 3MURP 1HA1A 3B4DA 5CXTA 4Y00A 2K3KA 1H2TZ 2RS8A 1X5SA 3THPA 4QQBA 5GAGU 5HL7Q 3S01A 2DGUA 1SJ3P 1PGZA 3RW6A 4W90B 1YHQS 2DNPA 4WFBQ 1DHMA 2NZ4A 1JMTA 1DRZA 3TO8A 2DH9A 1WEZA 3EX7B 3MOJB 2CQ4A 3V4MA 2DNYA 2M2BA 3G71S 3CULA 2CPZA 2DNNA 1SJQA 3VAHA 2XSFA 3HI9A 5DDOC 3P5TL 2MQOA 5JVHQ 1VQ8S 2F9DA 1WELA 2MKIA 3CC2S 2LKZA 2XNRA 2L9WA 2RT3A 1G2EA 2DITA 1YJ9S 1Q82T 1OIAA 5LSOA 5H1SV 1OO0B 1X5PA 5GADU 2DHXA 3MI7X 3NS5A 1FJCA 3U1MA 1KOOA 2EK1A 3CMES 2VONA 1L3KA 3CCMS 1X4HA 4C7QA 2KT5A 1FHTA 4Z2XA 2MZ1A 1NJIT 2EVZA 1A9NB 2DNOA 3RW7A 2CQ1A 1OPIA 3CCRS 1WG1A 2J0SD 3UCUP 1VBXA 2DNHA 2F3JA 2RS2A 1QM9A 5IM0A 3SXLA 2CQPA 3VAIA 5IFMA 2DO0A 2N3OA 1WG4A 2M52A 5MLCV 2X1AA 3U1LA 3CXCR 4CIOA 4FXWA 3G6ES 2FY1A 2RNEA 2J8AA 2D9PA 1NO8A 3G8TA 2M7SA 3VAMA 5CA5A 3CCSS 1WHYA 1M5OC 5GAHU 1H2UX 1U1QA 1KD1T 1P27B 2RU3A 1RK8A 2CPHA 3VAJA 2ADBA 1IQTA 3JB9k 1UP1A 2OSRA 2SXLA 2DO4A 3ULHA 2AYEA 2DK2A 5D77A 2DHAA 2MQLA 3CCUS 2U2FA 4U67Q 3N9UC 1X4GA 1WEYA 4QU7A 1WF2A 5DDQC 4PKDB 2QEXS 2LQ5A 1YJNS 1D8ZA 2K8GA 4W92B 1NU4A 1VQ7S 1PO6A 1M1KT 1X4BA 1X5OA 1M5PC 2N82B 1H2VZ 3CCVS 3VAKA 2KXNB 2OJ3A 3ZZYA 3VAGA 2MGZB 5CYJA 4F26A 1WF1A 1X5TA 2DB1A 2DNKA 2QA4S 1Q81T 2ZJQQ 1FNXH 2M4MA 2OIHA 4QPTA 2CQHA 1U1OA 1R8HA 2DNMA 2FPHX 2BZ2A 2DGTA 2LECA 3MDFA 2KVIA 2G0CA 2CQIA 4LJMA 3VF0B 3BEGB 4YUDA 3G9CA 2E5HA 2B0GA 3MD3A 3J7ZT 4BS2A 2MZRA 2NLWA 3G8SA 4V19X 2QFJA 3G96A 4RU2A 2VOOA 4EGLA 1FXLA 2LMIA 3L3CA 2DH8A 2UP1A 2GHPA 2E5IA 4IOCQ 1Q86T 2GO9A 1CVJA 1URNA 1VQ9S 1X4AA 2RQCA 5LXRA 1WHXA 3UWTA 1ZZFA 2M88A 2MKJA 2XS7A 1KOHA 2DGQA 2A3JA 3CMAS 2VODA 5LJ3Y 2MSSA 4WCEQ 2ZJPQ 2J0QD 2AYMA 2JRSA 4LMZA 1VQ5S 2CJKA 2DNLA 2JX2A 5GVQA 2MQNA 2M9KA 4C0OC 1ZH5A 2VOPA 3CF5Q 4OZ0A 2DNZA 2OTJS 2KN4A 3TP2A 2PE8A 1YWXA 3EGNA 4LIRA 4WF9Q 2WBRA 5DETA 4PR6A 2LA4A 1HD0A 2Q79A 3H2UB 1VQKS 2RVJA 2KG1A 2X1FA 2LYVA 2YTCA 1SXLA 3NNHA 5GAEU 2DGOA 1N52B 3R27A 3MXHP 3BS9A 1Q7YT 1JJ4A 1WHVA 1AUDA 3VALA 4J5OA 2KFYA 2AYGA 5LSLA 3UE2A 1K8AT 1U1RA 3Q2TC 1X0FA 1FJEB 2KXHA 1VBZA 2XB2D 1M5KC 3DLLQ 2FC8A 4PRFA 1U6FA 5DM7Q 1U1LA 1U6BA 2XS2A 2KG0A 2RUGA 1X4DA 1VC6A 3FEXB 1YITS 1SJFA 1SJRA 4IO9Q 1WEXA 2E44A 2KI2A 3K0JA 1S79A 2CQBA 4WFAQ 4YB1P 2KU7A 2DGVA 2DIVA 2MYFA 1M5VC 2YH0A 2HVZA 2DNRA 2MB0B 2MMYA 2LXIA 4ZKAA 1D9AA 1X4FA 2DHSA 3MUTP 3P49B 2JVOA 1VC0A 4QU6A 4ED5A 5EN1A 1F9FA 2KM8C 2HGMA 3LQVA 1QVGR 1U2FA 2KXFA 3SDEB 2E5GA 1HL6A 2AYBA 2XNQA 1WI6A 2HGNA 3PIPQ 2LEBA 1VQMS 1WWHA 2MJNA 2L41A 3NNAA 1FT8A 4P6QA 5GMKa 5HO4A 1KQSR 2M8DB 2MY7A 2OSQA 3J7YU 2CPIA 5IQQA 2RRAA 2DGSA 2M0GB 3US5A 1WI8A 3B4MA 2RQ4A 3UD3P 2CQCA 2M8HA 3D2WA 2ZJRQ 2DH7A 2N3LA 2XS5A 1U1KA 2MZQA 2HGLA 3MD1A 1N54B 1O0PA 3CCLS 1U1PA 2X1BA 2OTLS 2MGZA 3PIOQ 2MHNA 1B7FA 4CH1A 4C4WA 4TU8A 3VAFA 2DIUA 2N7CA 4TU9A 2MKCA 4TLQA 3CCQS 1R8PA 3R1LA 3CD6S 2KRBA 5DDRC 5DDPC 2MKKA 1A7GE 2MY8A
chains in the Genus database with same CATH superfamily
5F8IA 4NLVA 4J9NA 5J2NA 4DR4J 2RAQA 3ZTQA 2LVWA 1X31C 2RHQB 4NI2A 4EZ9A 2IM2A 2I2YA 4C3MA 1CJUA 2HBQB 3RYLA 3CC7S 3CC4S 4B9NA 1HNZJ 4IUFA 1SKUB 2VPZB 4FKYA 2G2OA 1M90T 1I94J 3BREA 2KKHA 4NEZA 1U1MA 5DGBA 3ET6A 3LGNA 4OYPA 4AFFA 4B9UA 4ZVRB 3BGRB 2YPZA 2QL7B 1J5OA 4P2FA 1T0TV 2M70A 3TUJC 3D66A 5EX0A 3KUGA 5KT6A 4DV1F 3O44A 1GAOA 2UXBF 5A8RA 3K5MA 1KN6A 2VC1A 4OZ1A 4JP8A 2UUBF 4JI8J 4ZHRB 4ZVHA 4PXEA 5JMNA 2F4FA 4OYZA 5T41A 2AQ4A 5K8PA 2AGOA 3UNYA 3TOQA 1N88A 3CJ3A 3G86A 1HBNA 1TKTA 3DRSB 1HWJA 1QSLA 4FF3A 2WCXA 1EX8A 1RWMB 3CJ4A 4USUA 5BJRA 3OVSA 2FC9A 3UR3C 2Y3YA 4FP9A 3TWZA 1MMLA 2E1PA 4RU9A 2DY9A 2B4UA 2QSFA 4ED4A 4GMKA 2MKYA 3D6HB 3BBFA 2W4DA 2UV8G 2XI2A 3EVOA 4I0WA 1ZBTA 2GFFA 2VA2A 1SJQA 1XJWB 3SI8A 2HFNA 3PW4A 5KFJA 4ECQA 2RT3A 3P8BB 1Z4UA 1OO0B 2MTLA 3H42A 2EK1A 2VONA 1X4HA 2FZKB 4M1KA 1T9XA 1IBMF 1TP7A 2CQ1A 2C2MB 2AEFA 3GILA 3HZEA 5B08A 3BYPA 1IJFB 3CXCR 1Q8BA 4QJVA 2EW9A 3G8TA 3VAMA 3KK1B 3EGVA 4DV5F 3K5NA 4DX5A 4N8NA 2R4FA 4DJBA 1HQUA 3MFIA 1R0CB 4F3QA 3PZPA 1HBMA 3V6DB 4W92B 1ZAVA 2IDEA 4PXCA 3FMBA 2OJ3A 1YRXA 2MGZB 5KT4A 4F26A 3EVMA 5JXSA 5F3ZA 3ETOA 2ZJQQ 2OIHA 3OLBA 1RT2B 3JSMA 3UVJA 3DXSX 1FX4A 3UW1A 1T8EA 4UQGA 1HWIA 4K0KJ 2WOMB 4C8ZA 4B9LA 4UOHA 5IT9U 4P52A 3EICA 2OD4A 3G96A 2XMJA 1R7IA 3HO1A 4PG4A 1P1LA 5E3QA 4B3MF 1FEEA 3QAEA 4A8QA 3NEKA 1HR0F 4F4ZA 3IG1A 1LXNA 3HK2A 3UWTA 1VS3A 4DSJA 1KOHA 2AYMA 2W24A 3HSJA 2HRYA 4K4WA 1BQNB 1FDAA 1R27B 4NLXA 1UETA 4ZVUB 2DXDA 1JKHB 4DFKA 2FQQB 2Z56B 3UI3A 3WQPA 3H2UB 1QTMA 5HJYA 1NKCA 4YEAA 3KLFA 2ZZTA 3ILOA 4EEYA 2ZNZA 1NNDA 4J91A 2C3OA 3L7UA 4A8FA 1U6BA 3DLKB 1Z1ZA 3LTOA 1QDUB 2NXEA 3BH7B 3HHEA 2B56A 1S1XA 4NLRA 2YNIB 4P2MA 6FDRA 1R31A 2IAJB 2MMYA 3BKFA 3MUTP 4AL5A 1UVJA 1ROFA 1XK8A 1LW2A 1L3TA 1UVKA 3R3TA 5CD4A 3MEDA 4DR2J 2ZC3A 1RCOB 3Q8SB 4DF8A 3CD0A 3P5BP 4OYXA 5GAHI 4F8RA 2WONB 5IZHA 2LU1A 1MNEA 1VRUA 4ZPVR 2X1BA 3J81Y 3KJQB 2YNFB 4GKKF 2D3UA 3C14A 2VL1A 3DI6A 1KFDA 1SL2A 4ELUA 4O4GA 3LP1A 2XWYA 4DV6F 3AOBA 2B8PA 1SJ4P 3CPWR 2ERRA 1KR4A 1VQLS 1YTYA 4LF4F 4UOGA 1UJ4A 4OZ2A 3DM2A 4M5DB 3PYGA 3ILJA 2UZAA 1RU2A 3NNCA 3D4JA 1HWLA 4O23A 3LA0A 1WNEA 2FJVA 2MZJA 2PT0A 2FYXA 2WW4A 5BR8F 4CLFA 3QLHA 3PG9A 3FFIA 4KHPF 3IO1A 1TMJA 4XIUA 2JEGA 1J5EF 2ASLA 1MU2A 1WC0A 1U2CA 3IM8A 4USHA 5A8WA 2HBRB 2X1GA 1IVZA 4DU8A 4WE1A 3HVTB 3WIVA 2IHR1 4G1QA 5HJXA 1AA1B 4USTA 4C3LA 2BM1A 3CDWA 1X9MA 4ELTA 1FDBA 4MFBB 4C97A 2ZFHA 1WUUA 2C2KB 3M05A 4TKTA 3RBEA 3F44A 2UUTA 3LP2B 3AA8A 5FLXU 2E9RX 2CNLB 1XN9A 5CQGA 4WIIA 3GONA 1VQNS 2CPFA 5DQGA 1MSWD 4BLGA 3EXYA 1U8SA 1C0UB 4ECZA 2HNYA 5KFOA 1FRIA 1X4CA 3T9NA 5KG3A 2XG8A 1FXDA 5CXTA 4GVBA 3C8YA 4CWBA 2BXJA 5IXUA 2W9BB 5HBMA 1C2PA 2DD8S 4I6YA 3L09A 3CWJA 3KJVA 2RILA 4U7UD 5A6PA 1BQMB 4KBIA 4Y6IA 1E6VA 2CPZA 4EFAC 5KFVA 2W9AA 4M5NA 5C24B 2OI2A 4IR1A 4DCOB 2YVSA 4L74A 4CO4A 2J9EA 4OHVA 2HQGA 4H4MA 2ZM6F 4X4VA 3RW7A 1KTVA 3MMJA 3MCOA 2J0SD 2FUG9 1HMVB 2GCFA 4NZ0A 1SKWA 3OPKA 1IQTA 2EC0A 3E51A 5ETVA 3EMTA 4ED0A 2DCLA 1IKWB 4NXNF 5E33A 4CO2A 1YJNS 2J0XA 1CULA 2F40A 4N8OA 1X5OA 4OZ3A 3CCVS 3MOZA 2KXNB 4B3TJ 3ZFVA 3SSSA 3DLEB 3TVYA 1WACA 4DR6J 2DNMA 1NK5A 2DTJA 3JTPA 5A8KA 2KVIA 1LK7A 4LJMA 2PC6A 3GFZA 1WDDA 2MZRA 3ZTSA 2NLWA 3IAS9 5H9FK 1TUGB 1IBCB 2PD1A 2PI4A 2MQ8A 1EZZB 2R8HA 3W9IA 5AXKA 2JLFA 4J90A 4A8KA 4KKOB 1G1XA 1XEZA 4LQ3A 1U2RA 4DL6A 2X51A 2GJFA 5KFIA 3GG1A 2W9CA 2DXFA 5IQ6A 4AD6A 3CJTA 4DPWA 4J9VA 4YR3A 1REVB 2YQ1A 1TL7A 1IN0A 3IMQJ 5KG5A 4M95A 1C1BB 2D74B 4WU2A 4OMFG 1T05B 1YBTA 1ZAWA 4I6AA 2PFDA 3AXMA 4OHYA 5D3GA 2EG2A 2NXUA 2H5EA 4QIFA 4K2XA 3JYTA 3OVAA 4PRFA 3M6XA 4IRDA 3LF0A 2WSEC 2L9DA 3H98A 3RB6A 4JI1F 3GTYX 3I9V9 1VI7A 3I31A 3QQCD 4DWIA 1VQYA 4V1Ak 3OFHA 3I32A 2BKNA 2YH0A 4JI4J 1B70B 3N6LA 5LMUF 2JSXA 3T5LA 3SCIE 4CLTA 4DCPB 3OTOF 4JI3F 1FX2A 3T41A 3ENAA 4X4PA 3O3LA 5KFAA 5HO4A 4CLUA 1N6QB 4DR1J 3ZNUA 2JFKA 2RE1A 3KUEA 1BMQB 2NCKL 2NS1B 4MK8A 5ETRA 4U96A 1BGXT 4URQU 2VKRA 2I0XA 4LSLB 4CRJA 1YSJA 2HIQA 4TLQA 3VZIA 1Q0NA 2LEPA 3ISNC 2IDLA 1JLCB 2OEMA 4ZCLA 2O5DA 5LM7E 3IBFB 3R1HA 2E66A 1VC5A 1HIYA 5J2QA 2HAIA 2BE2A 2V68A 3ZZOA 2ZOMA 4I64A 8ATCB 3I55S 4JB8B 2VKZG 4F0KA 3OSPA 1RACB 2ATLA 4ANCA 1S72S 1PBAA 3OHBA 3MM9A 3ZTPA 1OWXA 3KUHA 1RP5A 1K47A 4PG8A 2B4PA 3GV7B 1BWVA 2E9ZA 3EPIA 4NL5A 4DLGA 4AUKA 1KSPA 4OZJA 3IWLA 2JL9A 3UFCX 3HJVA 3MAQA 2ASYA 5J2MA 4USMA 5I42A 1Y7PA 4DEZA 4LSNB 3KK2A 1ITPA 4TU7A 2R7RA 4HT5A 4NASA 3TAPA 4C11A 2CNKB 4L6V3 2L08A 2HNDB 3HHLB 2I38A 1ZM9A 4NYPA 3J80Y 2EK6A 1OMSA 1S6QA 4KYZA 4CNYA 5LMNJ 4P2SA 4F0MA 1EETA 3MURP 4ZVQB 4ELVA 4UOCA 2AEMA 1PYSB 4Q8FA 4ZCMA 3MMAB 3TO8A 2J0WA 3V4MA 2XO6A 4JI2F 2GVDA 1G2EA 2HFSA 5IC4B 4ECRA 3KDNA 5IWAJ 2IM1A 2BRLA 2O67A 2VJVA 1M1GA 2X1AA 4CO0A 1GFWB 4WK1A 1ZPWX 4OLPA 1M5OC 3IAM9 2DR5A 2FY8A 1RK8A 3LAKA 4C6AA 5DZ7A 3SQOP 2OSRA 1JLQB 2HHPA 2XMAA 5DDQC 3OTBA 3ENQA 2C28A 1LFWA 4MH8A 4MIBA 2HHTA 4F4KA 1DFDA 4OI1A 4DUTA 3KLHA 4AE5A 5L38A 4HACA 1Q81T 2QA4S 4UW2A 4RW4B 2Z0GA 2UXCF 4A46A 1HBOB 5F41A 4QWDA 3AD9C 1G3OA 4X64J 4IFVB 3ZZTA 2ZE2B 1HNIB 3PFOA 1NK0A 2QFJA 4EGLA 1KHWA 1GMWA 4I2PB 4XPEA 3AT1B 2DEIA 2GHPA 3KLEB 1R6YA 3BV8A 3M8RA 3JAMY 3KYLA 1F6TA 2ZVSA 2IJNA 4OX9J 5LXRA 4ED1A 4G1IA 3AOAA 1S1UA 3TZZA 6FD1A 1WC3A 5LJ3Y 1NB2A 2MSSA 1U4BA 3M8PB 2J7KA 4F7VA 1Q53A 2IMWP 2J8SA 4ZPCA 1AFJA 4C0OC 2DNZA 5BYSA 3GLJA 2Z57B 3ITHA 4JV5J 2IM3A 3CMQA 3HKWA 2Q79A 3R5GA 4IH5A 5HVFA 4Y2IA 3I0SB 5GAEU 2OD6A 1SH2A 5LSLA 2AIRB 2EFPA 3BQ0A 1VBZA 4IG0B 2FVQA 3FGVA 2RUGA 5KG0A 1VC6A 3FEXB 1SJFA 2ROEA 3MZIA 3DNCA 3KJFB 4KFBB 2B4OA 1HFEL 1TVRB 2BE7D 3K0JA 3WC2A 4B9MA 2H4YB 2BBEA 1CSJA 3G82B 4X65J 3PFEA 1F5AA 3PHTA 3EJMA 4FS1A 1FERA 3OFEA 3GIIA 3J7AN 3MMBB 1QY7A 4LFCF 2ZZMA 3O5TB 4U6PA 3J7YU 1IJEB 3QSIA 4QYZJ 2CJXB 3OQ2A 3U27A 1PG5B 2XHCA 4OQJA 1TKDA 3IBWA 3J81U 3CIMA 4IOBA 1IR0A 1B0VA 3AD7C 3GCWP 4OYMA 2V8PA 1S6PA 4FF2A 5IM0B 2OPRA 1PJ6A 2D3O1 4OHZA 3UNGC 4IRKA 4DFPA 1VBYA 4OYWA 4ZLLA 1GX6A 5HN0A 4P74A 4MJKA 4ZCKA 1Y3JA 1JLEA 2HVEA 5F9LA 3DRXA 1CG2A 5J1EA 2C1EB 4MK9A 2IRYA 4IOAQ 3OXGA 2W7AA 1NJXA 1FJGF 4I1TA 2E7VA 2BANB 2JEFA 2UU9J 4EWTA 4ECVA 1FKPA 2O01C 3SV4A 3FUYA 3HXMA 4J9OA 3HFKA 2XMTA 4JI7J 2PI5A 4N7TA 2YNHB 2FHMA 2VQFF 5L8RC 1FD8A 2B5JA 2ZDOA 2O3DA 2C22A 2XO7A 4V19J 3VGUA 2WZ1A 2CQDA 4DS5A 5F3TA 2OPPB 4PPZA 3THTA 4ZP7A 2BKOA 4K4UA 2KTQA 4Q0BB 1TL1B 4Y0FA 4CLWA 4ZN3A 1N5TA 3H7HB 2IVFB 1UPPA 4FVMA 3MAHA 4MKVA 1FO1A 3SBMA 5B0GA 1JNZB 4F2RA 3V4IA 2DR8A 4U7CA 2KJWA 4QR2A 3RW6A 4W90B 3DRRA 1V3SA 1LW0B 3W7BA 2DH9A 2DYAA 4DU7A 2CQ4A 2HHHJ 1ZPVA 2Z58B 2AJ1A 4KO0B 1VQ8S 3L7PA 3H25A 4ID8A 2DHXA 1OSCA 1SQGA 4RWXA 4KPCA 2NUUG 3I0RB 1FHTA 2Z2YB 2IC3A 3R5CA 3UCUP 2RS2A 3EZUA 4F4XA 3H59A 4N47A 3TEGA 2N3OA 2RMLA 3TJ8A 4DL2A 4YFUA 1I51B 4QPXA 1UP1A 2DHAA 4OIXA 3LGMA 2ZNYA 1JLGA 4LVNP 4DOZA 3B78A 3TW0A 1NPKA 5HQ8A 4A8MP 4WKYA 1N36J 4PWDA 3A8KA 2XULA 2I9SA 2HQIA 2A2DA 2CKWA 2DNKA 1T03A 1VJQA 3MWBA 1FNXH 2DBBA 1RCXB 2BZ2A 2FHJA 2AF6A 3GQCA 2HWTA 1GQEA 4RW9B 1JLBA 3MHYA 3CW2C 3IR6B 2RRNA 1DURA 4FYVB 4L3KA 5I3UA 2VG5B 3A12A 3MR3A 4IG3A 3ZZPA 1FK9B 1YJVA 5E3CA 2W2MP 2P6TA 4FPRA 4WCEQ 3DCAA 1URRA 3TANA 5HVHA 4RKUC 4ZN1A 4P9SA 4PCQA 3GV5B 1O51A 2HURA 4OZ0A 2VG7A 2JLGA 1RYSA 4X4TA 4ZPTR 2Z2MA 2HS3A 1AUDA 1HNVA 5ETNA 1U1RA 2IA0A 2BJEA 4I69A 2CADA 3D6FB 4OZ5A 5E5NA 3VGTA 5CD4H 3CDBA 4HTIA 2JEIA 4PXDA 4M5KA 2DGVA 5A2QY 1VR6A 3MM5A 2V5HG 1JQGA 2V69A 2MB0B 2VPXB 4ZKAA 2HLTA 1RABB 1CJVB 1F9EB 2OGUA 4CO1A 3NBPB 2Q1LA 2W1BA 1ZS6A 2OPQB 4PZVA 2B9XA 3VWSA 3NKYA 2HGNA 5KFCA 1FT8A 2RHSB 3HLUA 4K59A 1VLOA 1KQSR 2OSQA 5HMYA 4LRAA 2B51A 2B6AB 3M8QA 4EK2A 2DH7A 1HQEB 1S1VA 4ZHRA 1TMMA 4CLLA 4LFAF 1KNZA 1S49A 1O0PA 4K5SA 1S0MA 2AKWB 4CDIA 4FZVA 1RAIB 5ETTA 4ZVOB 3PM9A 3TUIC 3FMWA 1YDLA 2MKHA 1NM2A 3EDRB 5AJ3J 1VQOS 2J6SA 4DX6A 4ZLPA 4NZ7A 1TV6B 5HROB 3GE9A 1HI0P 2BDPA 3GJRB 2KHDA 1PC5A 5J1PA 4KAIA 3OW2R 1NDKA 4QYRA 4P7TA 5H9EK 1WSRA 2ZUGA 1FF2A 2F9JA 3MCMA 1OQ3A 4I2QA 2HKEA 3W1YC 4IKAA 4LF6F 1TELA 1H0HB 2VQEJ 3MM8B 3GCXP 3W60A 3VVUA 3S7RA 1SB6A 2PA3A 4DR3J 1CQMA 2FHJD 1SCJB 3QT5A 4P75A 5F8MA 4H4KC 2EKNA 3Q2SC 2LP4A 2QLBB 5HP1A 1KC8T 1Q95G 2BM0A 3TJ9A 2X3GA 3KLVA 2XGQA 4TY8B 1IKXB 2HHXA 4RZRA 2IVYA 4KH1B 5T14A 4QCLA 4HDHA 3CCES 3J80U 3NCPA 1WOPA 1P9QC 5EUHA 2CQ0A 2FHKA 3FEYB 4PQUA 4ES3A 2ZH3A 2J76E 1UAWA 1AW0A 3B4DA 5BXIA 3H5UA 1RT2A 2RB7A 4ZJQA 3W2VB 4QWBA 2HVDA 2BJ9A 1RT5A 2DNPA 2WOMA 3DOLB 2ALYB 1RTIA 3ZXWA 2DNNA 3VAHA 2PEBA 5DDOC 3AOCA 2EFQA 4Z37A 4J9SA 2UVRA 4OI0A 1EJ7L 5LSOA 4ZP8A 5CZVA 3ISZA 4CLYA 1RAJA 3CMES 3BR8A 4C7QA 2LFVA 1UKUA 3W64A 1WG1A 5HI7A 3Q8QB 1QM9A 3EPGA 4WZMA 1ZYQA 2VDIA 2X3DA 1OY8A 2I5JA 2C3YA 3DLGA 2XY6A 1WHYA 1P27B 2OPSB 2GGPA 4KIAA 2E9TA 1TL5A 2DK2A 4OZNA 1RAAB 1N34J 3IRXA 2R2UA 2B4VA 4QU7A 3BN4A 2GHWA 1NU4A 3W2WA 3E2EA 3PO4A 4EO8A 1H2VZ 2IY5B 4A47A 4R0EA 4DQRA 2VG6B 3DOKA 4RJVA 2C3MA 7FDRA 2M4MA 2LQJA 3OXLA 4X4OA 1NRKA 1S9EA 5B0CA 4KJIA 2RH3A 4K4TA 1VQSA 3I5CA 4X2BA 3TQEA 3AJDA 1NB7A 1VISA 1UVMA 3ELHA 4DV4F 3M1VA 2VBZA 1S9GA 3UDVA 3JAMU 3PV8A 2ZDPA 3GR0A 2NQPA 1RADB 4B9VA 4IO1A 4ZLNA 4DV2J 2JNJA 4DUZJ 3K8VA 3GSIA 2YKMB 1V3RA 2VODA 4Q7AA 4F67A 3KK3B 2ZEJA 3QT8A 3DRPB 4HLBA 3HULA 4WFXA 4PG7A 3GIRA 1YRUA 4TQRA 1N5YA 1ELOA 4WF9Q 4IRCA 2KG1A 2X1FA 2LYVA 1SH0A 4KGMA 3MM7A 2HW3A 3BS9A 3MPVA 4PQAA 4NRTA 2HWHA 3MPDA 3QMQA 4M5DA 1WC6A 2XBPA 1H74A 5CH7B 1C1CA 2MEWA 2IIHA 1IKVA 2QX0A 2FJBB 2YQ3A 2Y0SD 2ZVIA 4OJ1A 1QAJA 2EFNA 2KFNA 4WYWA 3MAAA 1D9AA 3P49B 2JVOA 5KFGA 4USVA 3WC0A 5KFTA 5DG8A 4F2SA 4ALZA 3SDEB 2F65A 2YNGB 2GS8A 1WI6A 3HVTA 2N4DA 2F4VF 3QIPA 1LKZA 5IOLA 1YVFA 1W2IA 4MFBA 1GNKA 3R2DJ 5K14B 4P73A 4LF5F 1Q5VA 4IR9A 1JLAB 2XC9A 2EEYA 3THVA 3CCLS 2JC0A 1R43A 1U1PA 2AWZA 3QT6A 2FVSA 1QUVA 2R7OA 2BQRA 4TU8A 1ZA1B 3KLIA 2HHQA 2WVBA 3CCQS 1L5UA 4F4YA 4DI6A 1RU1A 3R5DA 1F5CA 3QJJA 2N7YA 5E3RA 3A1YG 3DYAA 1TKXB 3GWCA 3ZZ0A 1S59A 5IS2A 4Q43A 4L75A 3ENWA 2BQ3A 4DSEA 4LUBA 1VK3A 2ZBQA 3PW2A 2CPJA 2DNGA 1RTDA 2F1FA 2VC0A 2UV8A 4MMOA 3E8OA 3M6UA 4F02A 2RRBA 5FJ4A 4YY3F 1DLOB 2ASDA 1NKBA 4B3RJ 1UEKA 3CE8A 3N6MA 1LWXA 1DQ8A 3T9ZA 4ER8A 5KFDA 3UCGA 2BR0A 4G65A 1N32J 4K4SA 1WTBA 1VRTB 1F1BB 5B0AA 4YDXA 2JVRA 3H2VE 1MWZA 4FDFA 3EGZA 2D3OR 4LT6A 1RZMA 2CRLA 4ICLB 1E6YB 1QE1A 3DDKA 1HWUA 3DLHA 4ILLA 2HSEB 2FGCA 5EWFA 1CQNA 1TZ0A 1UW4A 4ERDA 1B0TA 3QPIA 2QLJB 4HTJA 3O8WA 2XEXA 4WXOA 3V2UC 3JS9A 1KFSA 2W8LA 4LF8J 4J9RA 1FRHA 4NRUA 2K3KA 1X5SA 4IFYB 2HNZA 2HZAA 3TI0A 5I3PA 3Q8VA 3EX7B 4DR7J 5D4NA 2WTFA 1RT3A 4FBTA 3TRGA 3P5TL 4A8OA 3F41A 4YN3B 2FLNA 1FE4A 3PVXA 2CA9A 3BH6B 3MTJA 3CJ0A 1YLXA 5J2PB 1K44A 5GADU 1ZM3A 2IPOB 3H2LA 1KOOA 2BMBA 2A1BA 3LALA 3OUYB 4QIEA 4H4OA 5DS7A 4OX6A 3HP6A 2C2DA 3RG6A 3CJKB 4KQZA 4RNFA 5IFMA 2DRBA 2HQFA 3BZQA 1S1WB 2FY1A 1HNWF 3W61A 7AT1B 2KL8A 3K57A 1C1BA 3DGPA 2R9LA 2CPHA 2HZVA 3SQGA 2C42A 3JSBA 2WVDA 4MIAA 3DU5A 2BJ3A 3N9UC 4O44B 5G0RB 5K9FA 1D8ZA 3POTA 4OZLA 4JI0F 3VGSA 1O5JA 2EFGA 1KHVA 3VAKA 4JI6F 2PMZD 3VAGA 4QZVB 5HMZA 4ZPAA 3PKYA 4KSEB 1EIYB 3PY8A 3BKUA 2LECA 1RQ0A 5J2NB 1C0TA 4ED8A 2HPUA 1NSPA 4NI2B 2HFOA 1XNRF 4DXLA 1FXLA 3M2RA 1PSDA 4WP3A 1WKJA 2RDIA 2CFXA 1Q86T 1N6QA 3T1HJ 2HHUA 1CS4A 2Y1IA 2M88A 3D1QA 4DV3F 3ET6B 2V0NA 2DT9A 4C0BA 2BOAA 1S57A 1ULRA 3L95X 2IM0A 3MR2A 1J5OB 2AU0A 4YMEA 1TU0B 2VFUA 3TA2A 7FD1A 2KN4A 3TP2A 4DN9A 3EGNA 2H54B 1JLCA 2WBRA 2HBZB 4KGXB 5A8RB 4C8KA 1IWGA 4YHHJ 4DG1A 1RT7A 3VALA 4WP9A 4TQSA 3FCHA 1X0PA 4JYAF 1FJEB 3A13A 2FDNA 3RJMB 5CZXA 3DLLQ 3QIDA 2OMLA 4J37A 5DM7Q 4X4NA 2XS2A 1RI7A 4FYYB 2FJWA 2GMJA 1R0AA 3X3UA 1SJRA 2YWGA 2BVZA 4IO9Q 1HBNB 1TKTB 1S0OA 2V50A 4YR2A 4OJHA 5A2QU 2KU7A 1FNMA 5AE3A 3RB3A 1HL6A 1DARA 2AT1B 3AY0A 1TKZA 2HLUA 4ILMA 1WC1A 1K0VA 1DJ0A 1NPPA 3OTCA 4Q44A 3SIPB 3GIJA 4DL3A 2ZC4A 2VHGA 4LF7J 3DRYA 3OR1A 1IQZA 2ZH8A 2KT3A 4TN2A 3TAMB 1UJ6A 3KLGA 1H72C 3QSYB 4OX8A 1T11A 2E1MC 2XLIA 4FS2A 2V4QA 3HHDA 1LNQA 3VVTA 3HHLA 1U25A 3M2VA 5F9NA 3ICLA 1ZOTA 3M9NB 1U24A 3R9LA 2NSCA 2ZHOA 2HWIA 4ECUA 1HBUB 2MZTA 3FRYA 1SV5A 4LRDA 2KHCA 1HHSA 3BO4A 4WWSA 2R3VA 3D7SB 4CQ1A 4J7CA 5C2GA 5KFMA 1M5HA 1HQUB 3BB5A 3KWMA 4QIVA 3PNIA 4MT1A 1OYDA 4IYQA 2HRUA 3ZZZA 1UJ5A 3FZ2A 1VLYA 4NLOA 1LK5A 5D15A 3R5BA 3H40A 5B0BA 1RB0A 3E01A 4K50A 4PUOA 3NGUA 1S6UA 2MJUA 5C7PA 5F8HA 3UVJB 2JWNA 3K7RA 1RHMB 2Y1LB 2V4JA 2CDRB 2XSJA 1X8DA 1Q16B 1U7LA 1ZZNA 4YP3A 1KP6A 2IBOA 3Q22A 1JJHA 2FLPA 1FWKA 3C6UA 1JLQA 2RQKA 3F0NA 3PEHA 3IG1B 4IH6A 1QSSA 3TYTA 3HX9A 2IBKA 4DL0C 3EM1A 2WSCC 4LRFA 1KVKA 2J9CA 1PAUB 3ONQA 2UXDJ 3HFVA 4LF9J 1LWCA 1P1TA 3NGRA 4ZPDA 3RU0A 3CUNA 4O0NA 4HR2A 1YJ7A 1SQFA 1S6OA 4EYIB 3C2PA 2YWEA 5T7LA 3JXOA 2WAQD 5DG9A 4IFVA 3K8WA 3KLFB 2RJZA 1RT4A 2F5GA 4EUVA 2KO1A 2GQQA 1HNIA 1JJCB 3FSXA 1HQ2A 3WIUA 1D9DA 2F9DA 4I2PA 3CC2S 2LKZA 4M5LA 1QSYA 3KLEA 2L9WA 1R8CA 3BSAA 3QAUA 1S1XB 3MEGA 4LFBJ 1S7IA 2JHEA 1OJ4A 1X7VA 1LW2B 1KLMA 3MEDB 3R7BB 1NO8A 3EXCX 2YWFA 4Y2KA 5GAHU 3RAQA 3JB9k 2SXLA 2V8VA 2XZDB 4GKJJ 2PMWA 1WEYA 3M9MB 4E2FB 1WF2A 2CXEA 1VRUB 5JJBA 1F2HA 1S77D 4RBUA 3CB4A 3K58A 2MLXA 1R8HA 3WX8A 1TVRA 4O4GB 3SV3A 2ZBPA 4B3OA 3G6VA 3DHWC 2ZWPA 3HHLD 3MDFA 1FNOA 2GIFA 3BEGB 3FNNA 1YK9A 3BF4A 4BS2A 1UTAA 2L48A 3DM2B 2E5LJ 3DLJA 1FRJA 1HLWA 1SC4B 2VBWA 4DUYF 4ZP6A 1HW8A 4H4KA 3HMJG 5KFLA 2XY5A 4WP8A 3QO9A 1PILA 3FFIB 2C3UA 2DNLA 1MU2B 2W8KA 2W4CA 4J9PA 5A8WB 1EP4B 1RWWB 2I1RA 2WHOA 4LF2A 4G1QB 4PR6A 4HT7A 4KHMA 5C5JA 1R3NA 5D0HA 3LP0A 3R27A 2CVEA 2E1AA 4I67A 2RSQA 1K8AT 1T02A 4EI2A 2VICA 3BM7A 1T9YA 3T1YF 4UT4A 4NEYA 3NWGA 1I3OB 5KG1A 1Y0HA 4RW7B 4WU3A 2K7KA 4FNIA 3BQ2A 3TX0A 3W5ZA 2HNYB 5U47A 3NLCA 2MYFA 2MLZA 2UUWA 1YBUA 4ED5A 3AJ2A 5C42A 1TAQA 2HGMA 1QVGR 1U2FA 2JLEA 2R7WA 4GVBB 5IT0A 5HBMB 1FCAA 1WWHA 2AV5A 1Y5IB 3KJVB 2R7TA 3D2WA 2K1RB 1XNQF 2K06A 1GH8A 2V6AA 3IS9B 2OPPA 3QJLA 3PIOQ 1S1TB 3MCSA 4MKBA 1IWAA 3MPUB 1UL3A 5HQMA 4NLWA 1IBKF 5EWEA 3ZO7A 2ROPA 1LWEA 1NAQA 1BD6A 3NGSA 4NLDA 1OSDA 2DGXA 4RUCA 1XMOJ 3W63A 2AJQA 2Q6CA 3T1AA 5KFHA 1N33J 4DS4A 3P6YC 2P8IA 2RIJA 2L9NA 3KOAA 4UF4A 1TL4A 4W4MA 5AXLA 4DZ6A 1FESA 1CULB 4C98A 5D4PA 1S9FA 2DR6A 1U8WA 1N4LA 2GMHA 4JI5J 2UUAF 4AQYF 3EGWB 4BDPA 4LR7A 4M63A 2AGQA 1HI8A 1T9TA 2YX1A 1GTEA 3N4WA 2F7VA 2CPYA 2YKPA 3RR7A 1NSQA 4TYBA 3K59A 2FVPA 5A8KB 2H5JB 2NXNA 2BW7A 4Y3CA 1FFWB 5KFYA 4DV0J 4NXMJ 2CZVC 2JC1A 2DNQA 1RT1B 2GVZB 3PCOB 5GMEA 2UUCF 2KVQE 3NMRA 1CLFA 3IWXA 3I87A 3F56A 1PJ5A 3K17A 2LA6A 1RBOB 3DOMA 4ZDNA 1YZ7A 4RO0A 2CJQA 5E2QA 2K7JA 5HK4A 2ZOGA 2F8EX 1TL7B 2CNNB 3K2YA 1PCAA 5K8MA 2ZBCA 2MXYA 3C6TB 3V6KA 3THPA 1RT6A 1BLUA 1IBLJ 2A10A 1JMTA 1K1SA 3AODA 3OD2A 4NA3A 3R5AA 1JXVA 2XSFA 3JYTB 3DHXA 1WJ9A 4OI3A 3FSIA 3BBBA 3WZ0A 1HPZA 2GW8A 2P6SA 4CLKA 3M4XA 2DY1A 1IR2A 3AXKA 1ZETA 4FYXB 2NXJA 3H5YA 5L46A 2J9DA 1H7XA 3VZHA 2QIFA 2EWHA 2M52A 2IFXA 2ILYA 3OL8A 2QZ8A 3NMAA 4HEA9 1U1QA 1EQMA 1CJKA 2RD5C 2MQLA 3CCUS 4U67Q 4ECYA 2ZH7A 1I5OB 4K4XA 3IM9A 4ECWA 3H4DA 1BC6A 1EHWA 2DB1A 1X5TA 1ZM2A 3G8QA 4AL7A 1WTFA 5C25A 4ZS6A 1JK9B 1GT8A 3M30B 4J9KA 4DV7J 3MD3A 3QT7A 1B4SA 3NOCA 1ZTWA 5J2QB 3G8SA 3RB4A 1MN7A 2KDOA 2LMIA 3PX0A 1KQGB 3HHKA 3BR9A 2YKNA 3DC2A 1URNA 1WHXA 2MKJA 4O3SA 4GRSA 5M2RA 2A3JA 5EGYA 2N4CA 2FJEB 5CYMB 2HMIB 4FF4A 3DKDA 2VOPA 4G3IA 2OTJS 1LWFA 3VGVA 1JXLA 3GV8B 2O1PA 4X62J 4P7VA 4MTPA 2QA4G 3NNHA 1N52B 4DSIA 2QL9B 5J2MB 2QFIA 2RQMA 4DR5F 4X66F 4F4AA 3KK2B 3CEDA 3FZBA 3I82A 2XB2D 1VIOA 2FC8A 4NLUA 4C11B 1DQ9A 4KGZB 2QV6A 1UEUA 5HROA 4NA1A 1YITS 3V81A 2Z30B 5LSRA 1VK8A 4YB5A 1WEXA 2NZCA 4B3SF 3OLAA 4M8LA 1UWBB 2KI2A 3HT0A 4YB1P 2EKYA 1FTRA 2V34A 3BPDA 1S6QB 3NWRA 2HFVA 4FN5A 2AX1A 2C2ZB 3MM8A 1EETB 4BHQA 5DO2A 3J7A1 2FZGB 2E29A 3O1LA 3PXGa 4ED7A 2MJNA 3SEOA 5GMKa 8RUCA 1HW9A 5BYQA 1SL0A 3N01A 2DVIA 2ACYA 3OTEA 2GVDB 1L3VA 1N54B 1VRQC 2Y0BB 1NMEB 3D5MA 2MHEA 1IKXA 2FVCA 1HNXF 4LIWA 1V9OA 5L39A 3LH2S 3K5LA 1MROA 4KC5A 4DV1J 3H5SA 5CAAA 4TYAA 2UXBJ 3KMSA 1UCNA 4NCGA 1V5IB 5LJ5Y 1EKRA 2PFFB 4KGKA 1TR0A 5KFKA 2BKPA 3MECA 2UUBJ 3P3DA 1NCLA 1RE1B 4R8UA 1XMQF 4DPYA 2VBYA 3TAQA 3LPYA 5L1JA 3C16A 3M2UB 1NDLA 2RF2A 2XMUA 3QBCA 1XQIA 1JJ2R 2XZTB 2KB2A 4HACB 4ECTA 2WBMA 2JZ5A 1XMBA 2V2VA 2AZ1A 4RNMA 4K4YA 3NS6A 3PW5A 1QTNB 3RZAA 4AXJA 1G6BA 1VQ6S 3I96A 4DR4F 2D7SA 3PYFA 1U0HA 4FBUA 4KPYA 1EQ0A 4QYZK 2R8KA 4ECSA 2R8IA 2XYPB 5FDLA 3G6XA 1HNZF 4UUXA 2MQPA 2C3PA 3MCNA 4NZ6A 3PW7A 2OPSA 3MFHA 2HK2A 2VUGA 4ZP9A 5KG4A 1I94F 1S1UB 5B0EA 1IKYB 3H4BA 3VR1A 3RAMA 3HVAA 1IBMJ 4HH1A 3DXBA 1UZHA 3TVKA 1IUJA 2VG6A 2Z2ZA 2QO3A 2C2EA 8AT1B 1JXEA 3PRDA 2FIUA 3ITHB 3MR5A 4F3MA 3CT9A 1Y5NB 1H2TZ 2RS8A 4QBUA 2W25A 2H48B 4O3QA 4GO7X 4DV5J 2HS4A 1Y3KA 3A8JA 4MIWA 1SC6A 1Q5YA 2P5VA 4X4QA 4JI8F 2XWXA 2Y8YA 3NG8A 1JNRB 2VB6A 2DPIA 1SQEA 4J9UE 3C46A 3NP5A 2JEJA 4WBFA 3PX4A 2KT5A 5B09A 1A9NB 2BJDA 1D9FA 3HF5A 1RHUB 5ETOA 3CCRS 4A4JA 4XPCA 2RDJA 5K20B 1FRLA 2HRTA 5A0YA 2YKOA 1RTJA 2WB4A 4CIOA 4ID5B 3I4HX 2HVIA 2WVFA 1KBRA 3G6YA 5D77A 3U1NA 4B3MJ 1HR0J 3KHGA 3LW5C 4RUHA 4DSFA 5HMXA 1VQ7S 4HL9A 4R0JA 4ZMMA 4QR1A 4K4VA 3EYZA 3AA9A 3LUYA 2LXFA 1RTZA 4ES1A 4OHWA 4QPTA 1S6PB 4F4WA 2IYIA 1ZAXA 4JI5F 4USKA 1P9YA 2CQIA 3CNQP 4J9QA 2OH2A 4PXBA 4QR0A 4M5JA 2QL5B 3M32A 3TJAA 3LO3A 2DXEA 1T3OA 5FD1A 3VHQA 1JLEB 3MM6A 4IOCQ 2RDDA 4S0MA 5D0EA 3N0VA 3HSDA 5ETMA 1S99A 1VQ9S 5J1EB 5BYRA 3BYRA 5HATA 1SJ1A 3DMJB 1KVIA 3RB0A 2ZWOA 3GFYA 3PJWA 2GQCA 5GVQA 2QC3A 2M9KA 3CD5A 5L1LA 5I4MA 1FKPB 4OI2A 3GFHA 1LV5A 3CJQA 1OQ6A 3QZ7A 1VQKS 4CTAB 3AD8C 4EMDA 5CYQA 4Q2MA 2B5JB 2DGOA 4K0KF 1G4CA 1JJ4A 2R7UA 1TKXA 1QD1A 2R8JA 1VOMA 3BGFA 2OO4A 4CLPA 3VQTA 2ZZNA 3B6BA 2JDJA 1K1QA 2DPJA 5E0OA 4GKKJ 1F5BA 3KXDA 4U8YA 4FXDA 1RAEB 3GG0A 4EYHB 2KFZA 2XMWA 2DIVA 1WKKA 2PIIA 4Y2AA 2G2ZA 4HVZA 4DV6J 1XR7A 4CCHA 4NCBA 5E41A 4B02A 2PA8D 4P72A 3MGJA 2KXFA 2QSWA 3LAMA 4LF4J 3BGUA 2GAGC 4J9MA 1VRTA 3QATA 3DRRB 4P6QA 4WFZA 1UEVA 5DG7A 3OT9A 1LXJA 3HT3A 2RQ4A 1R8AA 2N3LA 1U1KA 3MEEA 3PR4A 1EAYC 5BR8J 1FRMA 4X84A 1D0EA 4KHPJ 1OS5A 2MHNA 1ZA2B 1B7FA 4C4WA 3KHHA 1XBWA 1J5EJ 1T3NA 3Q23A 3TARA 3R1LA 2RKIB 1X9WA 3N79A 2IC3B 2WK4A 5KFBA 1S4FA 4DBQA 4A8XA 3WHIA 4ED2A 1T94A 3A3OB 3VTIA 4DR2F 3BO2A 2KRRA 3CTRA 1WG5A 4IFYA 4DL5A 3B8HA 2ZKTA 1FI4A 3S6EA 1J2VA 5HQLA 1TUVA 4RW6B 1JWWA 1YGYA 1YZ6A 1RGVA 3QNWB 4PWDB 3CDAA 3SCKE 4JUZA 3UDEA 3LWMA 3Q8RB 5LT5A 3T3FA 2AP6A 1T03B 1K0TA 2YQ0A 4WIQA 3HSGA 2BX6A 2HK3A 2YKAA 2CQ3A 4OL8A 2V94A 5E3AA 1NDCA 2ACMA 5IC6B 3QWUA 2KYXA 3DGVA 1JB0C 4LRBA 4N77A 4O4RA 5KG2A 2MSTA 1U1NA 3CJRA 2W01A 4U8VA 3SYZA 5I3UB 1JLFB 4IG3B 2FB0A 3C15A 3K89A 1N5VA 2FHOB 2OP5A 2POKA 2ZM6J 3ZTOA 3L4BC 2AHOB 3EZ5A 3Q24A 3A3NB 2VJUA 2DEJA 4TY9A 4YB6A 2COLA 3I5AA 2F8MA 3E3XA 3SCJE 4EBCA 2VG7B 4TXSA 2QYCA 3A3PB 1FKAF 3ZZRA 2OEKA 2W2PP 1ZM4A 1HYSB 3NCRA 4XAKA 3AB4B 1DRZA 4NXNJ 1HNVB 1S5ZA 3CULA 4L3NA 4YS2A 4Z7CA 2DR9A 1V3ZA 4M5IA 4W98A 4RW8A 4RR5A 2HVHA 1AZSA 3T6BA 4BWMA 5M2UA 1YJ9S 2W2QP 3HDSA 2DHHA 2XCPA 5HLFB 2AJ4A 1U49A 3MM5B 1VBXA 4RWWA 2QMXA 4DFJA 1GXTA 3U1LA 3T5KA 3QFHA 4GVLA 4FXWA 1AYEA 1NK7A 3SSQA 2IJFA 4ANDA 3ULHA 1FD2A 4ANEA 3M8QB 2FGOA 1KS2A 1S1VB 1U47A 1UA1A 1S0NA 3JSYA 3RBDA 2CDQA 3IBCB 2Z8QA 1WOSA 2CQHA 3CGIA 1A0OB 3OR2A 4I68A 4OFZA 1AB8A 1N0VC 1TL3A 1FDNA 3FC9A 4CNZA 2E5HA 3J7ZT 3HZGA 3MPYA 3OVBA 1C4CA 4RU2A 1YJUA 2E5IA 3BGLA 4ZVSB 3R6LB 2CAJA 2GO9A 3D68A 4JI1J 4ZVFA 2JOQA 3KJNB 2ZOFA 2XQCA 1RAHB 5AXNA 2XS7A 3GYXB 3IA0A 4UZBA 4HKQA 5HANA 3PRVA 3P4UB 5THWA 4B3TF 1OY6A 3TNVA 2LQ8A 4I2QB 2EXUA 4ECXA 3TAMA 1RTHA 4ENOA 3D54A 4IDKA 4DR6F 5LMUJ 4NLYA 3I4PA 2M3DA 4BCAA 3OTOJ 4DL4A 4JI3J 4LIRA 4RLEA 4R5PB 3MMCA 5DETA 3AH6A 2RVJA 2YTCA 4BC9A 3BQ1A 2YX4A 1HBUA 9RUBA 3BSOA 2AYGA 3HVWA 2XMMA 3MF5A 5HP1B 1U6FA 4C2MA 5L9NA 2VFVA 2W4PA 1TQLA 4ZVEA 2FD2A 3R8YA 1S79A 2AJ0A 4XDDA 3LGHA 1L3SA 4PQUB 2DNRA 2ABYA 5EN1A 4DQQA 2KM8C 3LQVA 3MTKA 2E7XA 2ZH4A 1Q1KA 1RT5B 4URGA 5IQQA 1VCTA 2VPWB 1RTIB 4NLTA 1XTZA 1Q78A 2IRUA 4WTOB 3M8SA 2R7SA 1KWMA 4DPUA 1YX2A 3GJSB 4CH1A 3D9BA 2QG9B 5DDRC 1A7GE 4Y65A 2OAUA 4JI4F 1RAOA 3HPOA 1KRPA 1S12A 2VD3A 2LCWA 1T9UA 4KY3A 2I5JB 2DR7A 1D8YA 1UVNA 3DLGB 1YQHA 3MPWA 2CQ2A 1FTCA 2GGPB 2MQMA 4DR1F 3D67A 5MAOA 3IRXB 2CPDA 5AXMA 4AL6A 4ZPWR 2U1AA 3C19A 5KFSA 4RX6A 3W2WB 4M5HA 4EBDA 3VQSA 3DOKB 2ILZA 2Q66A 2ZHBA 1S9EB 3AFGA 3RBXA 4O3NA 1SUQA 4U9RA 4EO6A 4XO0A 4MYUA 3M1VB 3LPEA 3HHLC 1GMVA 1S9GB 3FBFA 4JI2J 4NYZA 1MWYA 3CVKA 2XGPA 2MZSA 1RA6A 1VQ4S 4CH0S 3QGGA 1BWEA 3UN3A 3FCWA 5D6GA 5ITHA 3QWPA 4B9SA 2KH9A 5DZ6A 4CYUA 3D3CJ 1YJTA 1N5YB 3KG1A 3NAIA 3O6QA 3CDEA 4FKXA 4P10A 3MM7B 2CJYB 5E7OB 4I7FB 3S1TA 2J7WA 5E3PA 1BE4A 3HI9A 3KHLA 1PC4A 1F3FA 1C1CB 4NWBA 3W66A 2DITA 1IKVB 1X5PA 3ILLA 1UVLA 1F0XA 5CHCB 2MZ1A 1NJIT 2EVZA 2UXCJ 5ADZA 1R8BA 1SKSA 4KT0C 2JH3A 3MAAB 1FXRA 2H3EB 4U7UK 3J7Z5 4WFYA 3BBCA 5EWGA 5D0RA 5LMNF 5SZTA 2M5YA 1WG4A 2YY3A 2V9WA 1S76D 1EP4A 2APOA 2M7SA 1LQ9A 5CA5A 3QIPB 2BJ8A 2Z4PA 3IGNA 3RRKA 1X4GA 4AYBD 4DZDA 4YB7A 1TAUA 3NS7B 1RWNB 1H98A 3CCTA 1M5PC 1XIQA 4F50A 4CO5A 1H73A 3BGRA 2VBXA 1IM4A 4IH7A 3KLIB 2IYGA 3B82A 4RW7A 1VMBA 2BE9B 3D0GE 5IWAF 3B54A 2YWHA 3KKFA 5LOQA 3CCZA 1KONA 1MMNA 2GHVC 3DYAB 1CJTB 3CJ5A 2O66A 2FLLA 1XR6A 5D4LA 1W7WA 4L76A 5DLFA 1Y11A 1UMJA 2UP1A 3L7OA 1RTDB 5B0FA 3NGDA 3JSRA 3BSNA 1JIHA 4KGVB 3DRSA 2K1RA 5G4DA 2Q43A 3UD5A 4Q45A 3IS9A 2YWWA 1RLDA 3NCQA 4LQ9A 5JUMA 1S1TA 2FTRA 2QLXA 2HQ3A 4CM2A 2ZH6A 4J9LA 2D1CA 2DRAA 1TUWA 2B3TB 4X64F 5KG6A 1S10A 3DDIA 1B3TA 1NPRA 2AZ3A 4LFCJ 2KFYA 1QE1B 1UZDA 4KRWA 1M5KC 3GPAA 3V5RA 5D4OA 2ZH5A 4Q2LA 4OX9F 1UFKA 1V6HA 1Z2LA 2GMLA 3W9HA 4ZLJA 2AX0A 1DTTB 3HD1A 5L1IA 3AQOA 4IQMA 1F9FA 4JV5F 4LBHA 3KK1A 4GO5X 4DQIA 2HNZB 2L41A 2VASA 4B17A 2CPIA 1RKIA 1WI8A 1RT3B 3V6DA 1FRKA 2B7BB 1S7HA 1RT1A 2GVZA 2DRDA 2UVWA 2MGZA 1FJGJ 5KT3A 2Q6BA 3VAFA 1U26A 5LL6d 4O0IA 1KLNA 1R8PA 3SFGA 4H4OB 3FBEA 1RBLA 1FJ7A 1PJ7A 4X65F 1NKEA 1UVIA 3JTOA 2VQFJ 1Y5LB 4AXIA 2B7CB 3C6TA 1BHNA 2VPYB 3DGPB 2D41A 3HSZA 3SQGB 4TNOA 5CCLA 1WOOA 3AHPA 3GJQB 5K5MA 1MW7A 1K73T 3IN5A 5FIIA 3V6HA 2BACA 2V9KA 3POTB 2VFSA 4WKRA 3R2CJ 1C4AA 1CC7A 1BQNA 2QE5A 2R42A 1IM6A 2K3IA 4B08A 1DZ5A 4BC7A 2AJ2A 1JKHA 2K2PA 1UWAA 2GO8A 3UDCA 3UR0A 1C0TB 4DSLA 1WF0A 3CJSA 3KNAA 1YG0A 1FDDA 4UUWA 2YWKA 3OJSA 1N8RT 1Q8KA 2HZCA 2XYGB 4X4UA 3M2RB 2ZD1B 2WVCA 1RAGB 3TA0A 5DM6Q 3DLKA 1CS4B 3ZZUA 2OMOA 2KM8B 1WDTA 1H6KX 1XERA 2DGWA 2XMKA 3SCLE 2YNIA 4UQTA 2IAJA 2VH7A 2BUNA 2UU9F 3D28A 1SPBP 2A6OA 1X4EA 1SBRA 2H51B 3HHNB 1SIWB 3FK4A 1HA1A 4JI7F 1CBKA 2GJ2A 4CH7A 3M30A 1DTQB 3ILIA 4DG1B 1RT7B 2H4WB 2G1HA 2NZ4A 3FQKA 2W7OA 2WONA 2MKIA 1CC8A 3DN9A 1R0AB 2NSBA 1OIAA 2PGCA 3U02A 2YNFA 3VCDA 3AAWB 4Z2XA 5A76A 5L1KA 3WDOA 4NOHA 1KDNA 3FKBA 5CYMA 2YPYA 2HMIA 1B99A 1OY9A 1KQKA 4DCJB 1TKZB 1RWOB 2XHWA 2IRXA 1SC3B 1H2UX 2XTJP 4HI2A 1KD1T 2V4RA 4C9DA 2P9GA 2KZZA 2QT7A 2DO4A 1RHQB 1AXQA 4DMZA 4CZCA 1DAXA 3JTNA 3T5HA 2HHHF 1OYEA 4FF1A 1PO6A 3OR1B 2H1YA 2WSFC 3KLGB 3ZZYA 4C0HA 1NK9A 3MEKA 5KOWA 4FPIA 4I4BA 4PEOA 3M2VB 1UWBA 2DGTA 4USWA 4ZA1A 1F60B 1FKOB 1SV5B 4WZQA 2BRKA 5ETLA 1HI1A 3I9ZA 4TLRA 2UVUA 2DH8A 4CT9A 2AW0A 3LP2A 1NZ8A 4HHUA 1FFSB 4DQSA 2H9ZA 3JQJA 3PYEA 2YKQA 2DJWA 1N36F 3Q8PB 1C0UA 1A6LA 2VDHA 4LMZA 2HQDA 2XI3A 1VQ5S 2CG4A 3TZYA 2CJKA 2ZH2A 3E01B 4PUOB 3QRPA 3R7NB 2G2YA 3QYYA 4CLSA 1HWKA 3M8ZA 2J7UA 1VHIA 2W9BA 2OHDA 3FCVA 4FNHA 1SXLA 3MXHP 2V4JB 4J5OA 2XSJB 1BQMA 4C8YA 2OELA 1BXNA 5C24A 4LFAJ 1QLNA 3C6UB 4USJC 4OJGA 2FJDB 2XZWA 4O3PA 4ZOSA 3M2UA 4L72B 2I6WA 3TVZA 1S97A 1J27A 3GP9A 4TVAB 2CQBA 2CJ9A 4G1PA 3JQMA 4URSA 1I6JA 1LWCB 1HMVA 3IP0A 3KFWX 2E5GA 2PDAA 4A8SA 2AYBA 5T7LB 4ZVPB 3CCWA 1NZAA 2IJRA 5DLGA 4DX7A 1R89A 1IKWA 2DGSA 3US5A 1RT4B 2B43A 2QGFB 2CQCA 3UDLA 2MZQA 4ILRA 3PACA 4FYWB 4KV8B 4LF6J 3DLEA 2KT2A 1RBAA 4ZVTB 3MEGB 3PTWA 2DKOB 2KRBA 3G87A 3HVRA 1IKYA 3ZNJ1 1RUSA 4GC6A 4M5GA 2HFZA 2NPFA 5D0GA 4N41A 3CJ8A 1KLMB 1P8GA 1UFLA 4I6WA 3HJFA 5ETPA 4Q8EA 1OPZA 2UVVA 4ES2A 2A2CA 3BJYA 5DJBA 3BKTA 1WD6A 2E5JA 1LOUA 3FQLA 2CWKA 2AGPA 2JFDA 2VFTA 4KKOA 5KFFA 4O3OA 1O6XA 2V67A 4QW9A 1PAEX 4YOEA 1TK0A 4DPXA 1RLCL 3FBBA 1NJYA 3K5OA 3TZWA 4PG6A 1RSCA 1FVQA 3BGOP 1REVA 3TUZC 4A8YA 1SI9A 1UFWA 3CJ2A 4B3OB 2BQUA 3UN5A 4OHXA 3CO0P 1T05A 5I3QA 5AJ3F 4OI6A 2CQGA 3D6MB 4ID5A 5EX3A 5KFXA 3AJ1A 4E8UA 1RHKB 3KTQA 3GB0A 3EE3A 4Y28C 1VQPS 2QA1A 1K9MT 2ZBRA 3QO9B 4H54A 4PYAA 1VFJA 1FA0A 1M0SA 2QTWA 5K8OA 1RJJA 1WC4A 2VQEF 1CJUB 3GMGA 4JV2A 4Y00A 1BQXA 4DR3F 2C2NA 3KHRA 5GAGU 1PGZA 2RU9A 3LP0B 4OYAA 1N5SA 4F04B 5CCMA 4P2XA 5H9FJ 3NXZA 2M2BA 4L73A 1KTQA 2XCAA 3PYDA 4C8OA 2XNRA 3F73A 4CM0A 4LSLA 5H1SV 4DFMA 4NLGA 2ZBIA 4LBPA 1TK5A 2HFUA 1OPIA 4LREA 3DMJA 3EDQB 4PYDA 2DNHA 4RL1A 2OFGX 2Y9HA 3SXLA 3J81j 3TUPA 3ZTRA 2HHSA 5C42B 2NUHA 4WK3A 4QOTA 4OX7A 3FJ2A 4DV4J 1R6VA 1PBUA 2NPIA 4CTAA 4QIGA 4PKDB 2CJAA 2R7VA 4JOUA 1M1KT 1X4BA 1JX4A 2ROGA 4Z7YA 4DL7A 2CJBA 5M2PA 1QAXA 3H0PA 3DDNA 1GMWD 5ETKA 3IFEA 2YBVA 4KB7A 4DN0A 1LWEB 1QAIA 1TK8A 1RHJB 3DLBA 5KT2A 1NBEB 3HCXA 3EWGA 1VGYA 2B0GA 2MLYA 4KHRA 2OEJA 2V8GA 4LSNA 2VOOA 1QUPA 4RUAA 2BV3A 2G9OA 1N34F 4RBTA 1X4AA 9ATCB 2EBGA 1T95A 2HNDA 2HBYB 2DGQA 3OJUA 4QWEA 4Q5VA 2J0QD 2JRSA 1ZTTA 1EARA 4CO3A 1WC5A 2JX2A 2GIRA 2Z2LA 5D8HB 3P45B 2I8EA 2PE8A 2RKIA 2V2QA 2LA4A 3LWLA 2F4VJ 3RRGA 2QMUB 3C66A 4X4RA 1Q7YT 1WHVA 2C2OB 1GK8A 2HHWA 3N28A 1YJRA 1HBMB 3MMAA 2B9EA 1GMUA 3Q2TC 3NAHA 3N5FA 4MKYA 2KXHA 1YBAA 4LF5J 3GFXA 2J9DE 1CEZA 2Y1JA 4K2JA 4DV2F 2E7WA 3IXQA 3O2IA 1NH7A 4DUZF 3W8GA 4RW6A 2GAHC 3DOMB 2E44A 1M5SA 3JSMB 5KAKA 1D3WA 5HSPA 3OL6A 2GX8A 3ADAC 4HYKA 2DHSA 2GC8A 4NX9A 3HFZB 2WRMA 3FSYA 5RUBA 4ZVGA 1NJZA 3RTVA 1RT6B 2G13A 1Z2ZA 4NLPA 2M8DB 1U6ZA 3GYNA 2RRAA 1G7CB 1U48A 2M0GB 3UD3P 5KFUA 2ZJRQ 5KFRA 2P9EA 4YY3J 3IR5B 1JLFA 4X4SA 3W5XA 3IR7B 3R5JB 4RW4A 1HPZB 3QGIA 5DDPC 1HBOA 4RBVA 2MY8A 5IV3A 5D78A 1GTHA 1LEOA 4K5RA 1Q8LA 3OV7A 2ZE2A 1HHQA 2V2ZA 1ICEB 2LU2A 1YI2S 5EHHA 1CJKB 4BWJA 2HYIB 1H3DA 4F25A 2YH1A 1HYSA 5K8NA 3GSDA 3HD2A 1U09A 4ZITA 3M8PA 3RRHA 2QN6B 4DPOA 4EZ6A 1VYAA 1YJWS 4NCAA 2ZHAA 2AD9A 2D69A 3AB2B 1FWLA 5HLFA 1LFPA 1P6TA 5C25B 2IVMA 4N5SA 2BA9A 3A4TA 4E0DA 4FXVA 3I0SA 3H20A 1Q79A 1WHWA 3SMZA 3SSRA 1RWVB 4C8NA 1KKHA 2G4BA 2Y8WA 5KFPA 2XMVA 4IG0A 5GAEI 3PKMA 2YKNB 2PMHA 5KFZA 1T7PA 2DISA 4C8LA 3C14B 2MKSA 2ADCA 2LEAA 4KFBA 2R8GA 3DI6B 1VIXA 3AQPA 4GC7A 3LP1B 2EC2A 2YXLA 4B3RF 3WX4A 2ALZA 2G1DA 3G82A 4ZJOA 2B9WA 2WB1D 3W3SA 3TEHB 1N32F 1LWFB 1QJHA 1VHFA 1HNWJ 2WW8A 3S01A 2DGUA 1NEEA 4MAKA 5KT5A 3MMBA 4WFBQ 1DHMA 1CPZA 5F8JA 3FDSA 4DPTA 1KVJA 5C2CA 3QLHB 4JI0J 1MLAA 3R97A 2R7XA 3J7YI 3W5YA 4JI6J 3V81B 4R25A 1RWPB 3W62A 1B64A 4HI1A 2H65B 4KR0B 4QIWD 3ETMA 2NREA 4WE1B 4PABA 3W8PA 3MR7A 2KJVA 3TR5A 5IM0A 2QLWA 2CG8A 3BPSP 4LF8F 2GV1A 4QWCA 3LANA 4F0HA 1EB0A 4ITSA 2RNEA 1NLKL 5GAGI 3M9OB 1XNRJ 3CCSS 5EDWA 3RBZA 4QW8A 4R5PA 3VAJA 1D09B 3Q89A 3OHAA 5SUHA 3A8EA 3Q83A 4B9TA 3UPFA 4DR7F 2QEXS 1WSVA 3HM9A 2VFRA 1U0SA 4DV3J 1H38A 1X60A 2N82B 2AJFE 4DHVA 1V5VA 2W7PA 5DQIA 2VA3A 5CYJA 3A8IA 3OL9A 2IA6A 2BANA 3KG0A 4K7QA 2GZOA 3GU0A 1MROB 1TTHB 1SL1A 2GQ2A 2F63A 4RNHA 1EKSA 1SIZA 3OBIA 3PDNA 2YNHA 5AE2A 4NCGB 1E6VB 2H5IB 4F3OA 3MECB 4JYAJ 4HHJA 1KQFB 4R8UB 3BDEA 4O3RA 5J1NA 4NPOA 1CVJA 2QYGA 3C16B 3QGHA 2A0FB 2RF2B 4H4MB 5ETQA 4Q0BA 1RHRB 4JBCA 4ZIWA 1TL1A 3CMAS 4ED6A 2ZJPQ 2CZ4A 1L3UA 1XWLA 4LF1A 1IXKA 3N6NA 4NYOA 2J6TA 3CO9A 1FE0A 3CF5Q 4XK8C 1S48A 2BABA 3QFWA 1YWXA 4DSKA 5F8GA 4C48A 4OV1A 1HD0A 4DDFA 1PIEA 1U0HB 5F8LA 1LW0A 5KT7A 3UE2A 2HHVA 1F2GA 5FDLB 4UTGA 5GMDA 2PN6A 3RAXA 3RR8A 4KO0A 1U1LA 1D1UA 2KG0A 2OUGA 3T1HF 3EVWA 4WTYA 4AT1B 3I0RA 2CVIA 1DQAA 3ZC4A 3Q8UA 2W2NP 1PKUA 2BJ7A 4C3KA 2HS0A 5B0DA 4IQXA 1SH3A 3Q0AA 2LEBA 1NK4A 1VQMS 4KH0B 4YHHF 1T9WA 2VU5A 1NXIA 4MK7A 2MY7A 2LQBA 2R2TA 1WKLA 1MG7A 1AUSL 2M8HA 2HAFA 4A8WA 2XS5A 1PYTA 2R2SA 5HVGA 2HGLA 2OFHX 2W9CB 2IMOA 1FFGB 3GIKA 2MDAA 1NUEA 2X7IA 3D6TB 4NMXA 4PPDA 3QRQA 5LXYA 2KZMA 3I6PA 3IWNC 4CT8A 3TA1A 5CABA 5A0YB 1RA7A 1HD1A 1RTJB 3PHEA 5D3GB 4LSZB 1NHKL 4RW9A 1YKWA 2EFVA 1FVSA 3GR1A 1O8BA 1SKRA 2GIQA 2VG5A 3NY0A 1GEHA 6AT1B 1FK9A 2EG1A 2BOPA 4I7FA 4LF7F 4MYTA 3QRRA 1M1HA 2G0JA 2CPEA 1RAFB 4F36A 4EBEA 4ED3A 3VV2B 3KDOA 2LXUA 1RWKB 2D9OA 5IV4A 4OI4A 3SFUA 4WFNQ 4OV6A 3MUVP 3QZ8A 3GJTB 1Y9OA 3UCZP 3I56S 1YRTA 4NA2A 3DFEA 2VV5A 4Y2MA 3M32B 2BJ1A 2C2RA 2NR0A 3MM6B 2MQQA 3CDUA 3OFFA 4U95A 3PEJA 3S8SA 2HQCA 1RKJA 4DQPA 3MUMP 2A6MA 4OYOA 3DU6A 3W9JA 3KMQA 1DBDA 2J6UA 3CCJS 1T9VA 2XM3A 2FVRA 1CJVA 1Y10A 2BE2B 1NSKL 5KFNA 3NBPA 2OPQA 3UN2A 4QQBA 1F3VA 5CYQB 4CP5A 3K5PA 3QJPA 2YX7A 1CJTA 1U45A 2B6AA 3MOJB 2CWXA 1REGX 3EUNA 4M5MA 1S0VA 1HQEA 3MM9B 5AT1B 1WELA 3ISND 4QWAA 3N5BA 3MI7X 1FJCA 1L3KA 2P2CB 3CCMS 1TFYA 3PX6A 2QMWA 2B9YA 2PO4A 3PJ9A 2UXDF 4LF9F 2F3JA 5KTQA 2DO0A 5I42B 3IGVA 5MLCV 1N48A 1VJWA 2XYHB 3G6ES 2J8AA 3JQKA 2RU3A 1TV6A 1KEKA 2QLFB 4YR0A 4DUYJ 1S4EA 2PSZA 1B7YB 5KOXA 2LQ5A 2BW2A 4MKAA 2K8GA 1ACMB 4LRCA 5A6WA 2ZH1A 3MEEB 1F9HA 1APSA 3IC1A 4ETZA 3NL0A 4UZCA 4Y34A 4LFBF 2FPHX 4ZPBA 3GYGA 3T19A 2KYZA 1NHVA 2G0CA 1AFIA 1W26A 4CLZA 4YUDA 3G9CA 1DTTA 3NRBA 4E98A 3FRZA 4V19X 4ATNA 5IT9Y 3FVYA 4GKJF 3T1YJ 3PO5A 4TY8A 4WJBA 4NMLA 2RUSA 1AROP 1N56A 2LDYA 2V8HA 1ZH5A 2R7QA 5AE1A 1MN9A 5HAOA 3EZOA 1HKAA 4JV0A 3MR6A 1AT1B 3W2VA 4HDGA 2HIYA 3DOLA 3NGTA 2FJXA 3X1LB 2E5LF 5KFWA 2AMCB 1X0FA 1MWQA 1XNQJ 3KLHB 3M8YA 3C15B 1X4DA 3L9ZA 5F0WA 3PR5B 2ZUAA 4LR8A 3UO0A 3CD7A 5H9EJ 3T5JA 4NE9C 3BDPA 4WFAQ 1IBKJ 2Y1RI 4HH0A 4D3HA 2HVZA 2GNKA 3BN7A 4OJ3A 2XNQA 3PIPQ 3NNAA 4ZJLA 3QGPA 1NSAA 4PWWA 4LR9A 3NGKA 2JJ4D 3B4MA 3M8WA 5KG7A 3RGIA 2OKQA 2ZD1A 4RW8B 2LDIA 1RWUA 4WPAA 1AZSB 4DF4A 2OTLS 2UUAJ 4AQYJ 3NOGA 2NYIA 2N7CA 4TU9A 2MKCA 2VZ9A 4KTQA 2EI5A 3R7SB 3OSNA 2CNOB 3OXFA 4P71A 4ZIVA 2WVEA 2D3ZA 1WORA 4ETXA 3G4SS 3UD4P 1QVFR 2VIHA 3KG4A 2DHGA 2MPUA 2UUCJ 1DTQA 3GZ7A 1HHTP 4UY8T 1UPMB 2F8HA 2CIMA 2YKMA 5IT4A 1W2BR 1YIJS 1NK8A 1B0PA 4G6VB 4UOFA 3KK3A 2DCUB 3DRPA 4RNOA 3IRWP 2E1RA 1VDHA 4USIA 3OR2B 1TL3B 2W2OP 5B7WA 1XMOF 3FBCA 1RDRA 1I1GA 2LLZA 1N33F 2PEHA 1Y4ZB 2CPXA 4RUBA 4N56A 1FEHA 2V2KA 3KNGA 5JVGQ 5FLXY 3CSKA 3M6WA 4N76A 1RISA 1NH8A 4WXWA 5ETSA 3M6VA 4LVOP 4ZCIA 3BO3A 2OPRB 1BY9A 1RTHB 4IDKB 1TFWA 3T6JA 3PJXA 2LQ9A 2HG4A 2QJ3A 4DLEA 4LBIA 3SDEA 3D1HA 2BYCA 4FYDA 2A18A 3MMCB 2YNGA 2EPIA 5HL7Q 4RPFA 1SJ3P 1UA0A 1YHQS 2QA2A 2GA7A 5DQHA 1FKOA 4OYIA 2ZH9A 2R2RA 4D3GA 4DV0F 3M7VA 4NXMF 1WEZA 2DNYA 3G71S 4OLOA 2EFOA 5K14A 1W25A 3Q86A 1N0UA 2BEFA 2MQOA 2VF3A 5JVHQ 1X9SA 1JLAA 2ASJA 3HKZD 4NLSA 1Q82T 3H8YA 3NS5A 3U1MA 4ZK7M 3PW0A 5KFQA 1DY3A 2DNOA 4M94A 3FEZA 4BBYA 4Y2CA 4XTTA 2CQPA 3D0IE 2GJIA 4CI0B 3VAIA 4YQWA 2CZ9A 2D9PA 3V6JA 2ZKUA 1IBLF 2ADBA 2NYHA 1VBKA 2XLKA 4HHHA 2AYEA 2CUYA 1U02A 5KFEA 2U2FA 3OFGA 1UW9A 3GIMA 1R0BG 1QAYA 3WBZA 3D3BJ 2QRRA 4OYBA 1DLOA 4YDDB 2L3MA 2CYYA 4K8RA 5HMWA 1SVDA 2OLWA 1WF1A 2V8DA 3W65A 3V4IB 4I56A 1U1OA 3H90A 3OL7A 2E1CA 2HEKA 3VF0B 2P9CA 2FZCB 3OTDA 5L9XA 4XDCA 4EU0A 1XC9A 4PG5A 4DR5J 4X66J 4ICLA 5F8NA 1E6YA 2J5AA 5F0UA 3L3CA 3H5XA 1Q7LB 2XY7A 2Q3PA 3P96A 2RQCA 4PAAA 1NHUA 1ZZFA 4B3SJ 1NJWA 3ENVA 4KV8A 2MQNA 2FLOA 3U7JA 3R6GB 1XR5A 2B8QA 3I5BA 5DGAA 1HARA 1GX5A 4JV1A 1NDPA 4DV7F 2XLJA 1Y00A 1RXOB 1SUQB 3TZXA 4DX8H 4C8MA 2ZITA 4PWUA 1JLGB 2G0IA 1IR1A 3UQSA 2EBEA 2FJAB 3Q8YA 4A48A 3CIZA 1Q8IA 5J2PA 1HNXJ 4K4ZA 3D1OA 4KE5A 4NLQA 1RYRA 1NK6A 3OUYA 1PYOB 3G2XA 1SC1B 3RUBL 1H7WA 1M5VC 1N5QA 3CJKA 5GADI 4RNNA 2LXIA 3PRBA 1GXLA 1X4FA 1FRXA 4CYUB 1VC0A 4QU6A 1S1WA 3D0HE 3BSCA 1FWPA 1JLBB 4X62F 1BUXA 1MMDA 2ATCB 3TQ1A 2V63A 1GXUA 1Q4RA 1XMQJ 4UY85 3C3LA 2NXCA 4O44A 5G0RA 3LOUA 3SZ2A 5DRKA 3MD1A 3TX8A 4WYLA 4FVCA 2AEJA 1RWXB 2DIUA 3CD6S 2MKKA
chains in the Genus database with same CATH topology
3PM9A 3TUIC 3H5SA 4GC6A 4TYAA 3FMWA 5F8IA 4NLVA 2MKHA 4J9NA 5J2NA 2HFZA 3KMSA 2NPFA 4N41A 4NCGA 2LVWA 1KLMB 1P8GA 1UFLA 4I6WA 5LJ5Y 2PFFB 3HJFA 4KGKA 1TR0A 4EZ9A 2IM2A 5KFKA 1VQOS 2I2YA 4Q8EA 4C3MA 2J6SA 1OPZA 3RYLA 3CC7S 3MECA 2UVVA 3P3DA 4ZLPA 4ES2A 3CC4S 4B9NA 4IUFA 4NZ7A 1TV6B 2A2CA 3BJYA 5HROB 2VPZB 5DJBA 3GE9A 1WD6A 4R8UA 1XMQF 1HI0P 2E5JA 2BDPA 2KHDA 1LOUA 2VBYA 1PC5A 3FQLA 5J1PA 4KAIA 3TAQA 3LPYA 3OW2R 2AGPA 2JFDA 2VFTA 4KKOA 5L1JA 5KFFA 3M2UB 4O3OA 2RF2A 1M90T 3BREA 2KKHA 4QYRA 4P7TA 4QW9A 1U1MA 5DGBA 4YOEA 2ZUGA 1TK0A 2XMUA 1FF2A 2F9JA 1OQ3A 3LGNA 1NJYA 4AFFA 4B9UA 4I2QA 1JJ2R 3K5OA 3BGRB 4IKAA 2KB2A 4ECTA 2WBMA 4LF6F 2JZ5A 1J5OA 1XMBA 4PG6A 1H0HB 4RNMA 4K4YA 2M70A 3MM8B 1FVQA 1REVA 3TUJC 3TUZC 4A8YA 3NS6A 1SI9A 5EX0A 3PW5A 1UFWA 3RZAA 5KT6A 4DV1F 3CJ2A 3S7RA 4B3OB 1SB6A 3O44A 1G6BA 4AXJA 1VQ6S 2PA3A 1GAOA 1CQMA 3I96A 2BQUA 4DR4F 2UXBF 5A8RA 4OHXA 3K5MA 2D7SA 2FHJD 1KN6A 4FBUA 1T05A 5I3QA 4KPYA 5AJ3F 2VC1A 4OZ1A 4OI6A 5F8MA 2CQGA 2R8KA 4H4KC 4ECSA 2R8IA 4ID5A 2UUBF 3Q2SC 5EX3A 4ZHRB 5FDLA 4PXEA 4ZVHA 3G6XA 1HNZF 4UUXA 2MQPA 2C3PA 5HP1A 5KFXA 1KC8T 4NZ6A 3PW7A 2BM0A 2X3GA 2OPSA 5T41A 3KLVA 3MFHA 2XGQA 4TY8B 3AJ1A 2AQ4A 5K8PA 2VUGA 4ZP9A 2AGOA 4E8UA 1IKXB 3TOQA 2HHXA 5KG4A 1N88A 4RZRA 3CJ3A 1I94F 2IVYA 3KTQA 3G86A 5T14A 3GB0A 1HBNA 1TKTA 3DRSB 4QCLA 1HWJA 4Y28C 1QSLA 1S1UB 4HDHA 5B0EA 1VQPS 4FF3A 2WCXA 3CCES 1IKYB 2QA1A 3H4BA 3VR1A 1K9MT 3NCPA 3RAMA 3QO9B 4H54A 3HVAA 3CJ4A 5BJRA 4HH1A 1P9QC 3DXBA 2CQ0A 5EUHA 3OVSA 1VFJA 2FHKA 1FA0A 3FEYB 3TVKA 1IUJA 1M0SA 4PQUA 2VG6A 4ES3A 5K8OA 1RJJA 2QO3A 2FC9A 2ZH3A 3UR3C 2VQEF 2C2EA 4FP9A 2J76E 1JXEA 1UAWA 1AW0A 1MMLA 3PRDA 2FIUA 3ITHB 3MR5A 4F3MA 4RU9A 3B4DA 3CT9A 3GMGA 4JV2A 1Y5NB 3H5UA 1RT2A 1BQXA 2B4UA 1H2TZ 2RB7A 2RS8A 2W25A 4Y00A 3W2VB 4QBUA 2QSFA 3KHRA 4QWBA 5GAGU 4GMKA 4O3QA 1PGZA 4GO7X 2RU9A 3LP0B 1RT5A 1Y3KA 2HS4A 4MIWA 1N5SA 1SC6A 2DNPA 2W4DA 2UV8G 2P5VA 2XI2A 2WOMA 5CCMA 3DOLB 4I0WA 5H9FJ 1RTIA 1ZBTA 4X4QA 2M2BA 4JI8F 2GFFA 2VA2A 2XWXA 2DNNA 1SJQA 3VAHA 3SI8A 1KTQA 2HFNA 2XCAA 5DDOC 3PW4A 2EFQA 4Z37A 4J9SA 2UVRA 4C8OA 2XNRA 5KFJA 4ECQA 3NG8A 1JNRB 2RT3A 3F73A 4OI0A 2VB6A 2DPIA 1SQEA 1Z4UA 3C46A 4LSLA 3NP5A 5LSOA 5H1SV 1OO0B 4DFMA 4ZP8A 2JEJA 5CZVA 3ISZA 4NLGA 1RAJA 2EK1A 3CMES 2VONA 2ZBIA 1X4HA 3BR8A 4C7QA 2KT5A 5B09A 3PX4A 1TK5A 1A9NB 4M1KA 1UKUA 2BJDA 1D9FA 1IBMF 3HF5A 1TP7A 2CQ1A 1OPIA 3CCRS 4A4JA 4XPCA 1WG1A 2RDJA 3DMJA 5HI7A 1FRLA 2DNHA 3Q8QB 1QM9A 2OFGX 3EPGA 3SXLA 3GILA 3HZEA 4WZMA 5A0YA 5B08A 1ZYQA 2YKOA 2HHSA 5C42B 1IJFB 1RTJA 2NUHA 2WB4A 4WK3A 3CXCR 4CIOA 2I5JA 4QOTA 1Q8BA 4ID5B 3I4HX 2C3YA 4OX7A 4QJVA 3DLGA 3FJ2A 2EW9A 3G8TA 2XY6A 3VAMA 1WHYA 3KK1B 1P27B 2NPIA 2OPSB 2HVIA 2GGPA 4DV5F 4KIAA 3G6YA 2E9TA 1TL5A 4CTAA 2DK2A 4OZNA 5D77A 3K5NA 4N8NA 2R4FA 4DJBA 3U1NA 1HQUA 3IRXA 2R2UA 3MFIA 2B4VA 4QIGA 4F3QA 3KHGA 3PZPA 4QU7A 3LW5C 4PKDB 4RUHA 1HBMA 3V6DB 2CJAA 4DSFA 5HMXA 3BN4A 2GHWA 2R7VA 4W92B 1NU4A 1ZAVA 4JOUA 3W2WA 1VQ7S 4HL9A 1M1KT 1X4BA 4PXCA 4R0JA 1JX4A 3PO4A 4EO8A 2ROGA 4ZMMA 1H2VZ 4QR1A 3EYZA 4K4VA 4DL7A 3FMBA 2CJBA 1YRXA 4A47A 3AA9A 2OJ3A 3LUYA 5M2PA 2LXFA 4R0EA 5KT4A 2MGZB 2VG6B 4DQRA 1QAXA 4ES1A 3DOKA 3DDNA 4F26A 2C3MA 7FDRA 4OHWA 5JXSA 3ETOA 5F3ZA 2ZJQQ 2M4MA 2LQJA 3OXLA 2OIHA 4QPTA 3IFEA 1S6PB 4X4OA 3OLBA 4F4WA 1RT2B 4KB7A 1NRKA 4DN0A 2IYIA 1ZAXA 3JSMA 1LWEB 1S9EA 3DXSX 1QAIA 4JI5F 5B0CA 1TK8A 4KJIA 2RH3A 3DLBA 3UW1A 2CQIA 4K4TA 1VQSA 4J9QA 5KT2A 2OH2A 3I5CA 4PXBA 4QR0A 1T8EA 4X2BA 4UQGA 1HWIA 1VGYA 2WOMB 2B0GA 4C8ZA 1NB7A 4B9LA 4KHRA 1UVMA 4DV4F 3M32A 3M1VA 2V8GA 4LSNA 3LO3A 2OD4A 1T3OA 3G96A 2VOOA 2VBZA 2XMJA 1R7IA 3HO1A 1QUPA 1S9GA 4RUAA 2BV3A 5FD1A 3PV8A 2ZDPA 2G9OA 4PG4A 3GR0A 2NQPA 1P1LA 1JLEB 3MM6A 4IOCQ 1N34F 4RBTA 5E3QA 1FEEA 3QAEA 4IO1A 4A8QA 4B3MF 4B9VA 3N0VA 1HR0F 4F4ZA 3IG1A 1LXNA 1S99A 1X4AA 1VQ9S 2EBGA 5J1EB 5BYRA 1T95A 2HNDA 3UWTA 3HK2A 1VS3A 3K8VA 4DSJA 2YKMB 1SJ1A 1KOHA 2DGQA 1V3RA 3OJUA 2VODA 4QWEA 3DMJB 4Q5VA 4Q7AA 4F67A 2AYMA 2J0QD 1KVIA 2JRSA 3KK3B 2W24A 3DRPB 1ZTTA 2HRYA 4HLBA 4CO3A 4K4WA 1BQNB 3RB0A 1FDAA 3GFYA 3PJWA 2JX2A 4WFXA 4PG7A 2GQCA 5GVQA 2GIRA 1R27B 2M9KA 4NLXA 2Z2LA 1UETA 3CD5A 5D8HB 5L1LA 5I4MA 1YRUA 4TQRA 1FKPB 2I8EA 2PE8A 4OI2A 1JKHB 4DFKA 1ELOA 3GFHA 1N5YA 1LV5A 2RKIA 4WF9Q 1OQ6A 3UI3A 2LA4A 3QZ7A 4IRCA 3H2UB 1VQKS 4CTAB 2KG1A 3LWLA 2X1FA 2LYVA 1QTMA 3RRGA 1SH0A 5CYQA 4KGMA 4Q2MA 2B5JB 2DGOA 3MM7A 1NKCA 4K0KF 3C66A 4X4RA 3BS9A 2HW3A 3MPVA 1Q7YT 4YEAA 1WHVA 1JJ4A 2R7UA 1TKXA 4PQAA 2HHWA 3N28A 1YJRA 3KLFA 1HBMB 3MMAA 4NRTA 2HWHA 2R8JA 3Q2TC 3NAHA 3QMQA 3N5FA 1VOMA 4EEYA 2KXHA 3BGFA 4MKYA 2OO4A 1YBAA 2ZNZA 1NNDA 4M5DA 3GFXA 2C3OA 2J9DE 3VQTA 4A8FA 1U6BA 2XBPA