2X1BA

Structure of rna15 rrm
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
GPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA 3'-END-PROCESSING PROTEIN RNA15
publication title Structure of the RNA15 Rrm-RNA Complex Reveals the Molecular Basis of Gu Specificity in Transcriptional 3-End Processing Factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 22
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2x1bA00
4TLQA 3CUNA 2SXLA 1NU4A 3SDEA 2DH7A 2DHGA 3PIOQ 1RK8A 2XSFA 3CPWR 1X4FA 4UQTA 2DIVA 2MJUA 2HGNA 2RQ4A 2RRAA 2I2YA 2QEXS 5LXRA 2DGTA 2LA6A 5LSLA 1PGZA 3L3CA 2XNRA 2DISA 1X5TA 4CQ1A 2K3KA 2DGQA 1JJ2R 1X5PA 5ITHA 3U1MA 3CCES 2XS7A 2KRBA 1X0FA 1H2TZ 2CPHA 2LEBA 2VODA 1QM9A 3CD6S 1WF1A 1WHWA 2OTJS 1XN9A 2MJNA 2KXNB 3MD1A 5DDOC 3BO4A 1YJWS 2J0QD 2HGMA 1KOOA 1U1OA 2MZQA 3NS5A 2DNNA 4F25A 5IM0A 2F9DA 2EK6A 2J0SD 1HL6A 1VBYA 2EK1A 2RS2A 3UD3P 2CQGA 2X1AA 4EGLA 1WWHA 2CPDA 2CJKA 1X4DA 2DNHA 2DGWA 2O3DA 2FPHX 3P3DA 3VAFA 2RRBA 3VAKA 4QPTA 1JJHA 1N52B 2DNPA 3UCUP 2U2FA 2N3LA 3G6ES 1CVJA 1HA1A 2DK2A 2M0GB 2MZJA 4RU2A 2KI2A 4IOCQ 2LCWA 5LSOA 1PO6A 3UCZP 3CMAS 3NNAA 1WF0A 2MSTA 2FY1A 2MZRA 2RVJA 1UP1A 2DIUA 4QQBA 3TO8A 2G4BA 2MPUA 1WEZA 5HL7Q 1OIAA 1X4AA 1M5OC 3CTRA 1SJFA 3UD4P 2N7CA 2JWNA 2MKHA 2NLWA 3NS6A 2D9PA 4WIIA 3H2UB 4LMZA 3RW7A 2E5HA 4C7QA 1FXLA 3MURP 1RKJA 2MKSA 2VOOA 3FEYB 1WEYA 1FJCA 3V4MA 2CQIA 2LXIA 5H1SV 2AYBA 1U1QA 3EGZA 1YITS 5LJ5Y 1JJ4A 1OPIA 3EX7B 1VQ5S 3EGNA 1U1NA 2G1DA 2KH9A 1L3KA 3CCRS 2ADCA 2CQ1A 1VQ9S 2ERRA 2MSSA 1WI8A 3MUTP 1M5VC 2NZ4A 5GAHU 2DGVA 2WBRA 3Q2TC 1K8AT 5MLCV 2DGOA 2Q79A 4CH0S 1OWXA 2GHPA 3IWNC 3HI9A 2KFYA 1U1RA 1H6KX 1N8RT 4LJMA 2MZ1A 3NMRA 2FC8A 3U1LA 5HO4A 1FO1A 3BS9A 4UY8T 3THPA 1K9MT 2J76E 4V19X 1X4GA 3BEGB 3PIPQ 1W2BR 1Q7YT 3VAIA 3CCSS 1BY9A 3RW6A 2LQ5A 1FHTA 2DHAA 1URNA 5D78A 3IRWP 2AYMA 1VQ4S 5DM7Q 3CC7S 3VALA 2MKCA 3VAJA 1WG5A 2CQHA 2MQQA 4PRFA 3THTA 2CQDA 3H2VE 2LECA 3CXCR 2HGLA 3P49B 2KRRA 2OSQA 2DNKA 4ZKAA 3G96A 3VAHA 1QVFR 2M9KA 1FT8A 2KYXA 3OW2R 4BS2A 3ZZYA 2MQOA 2MQNA 1U6FA 2LXUA 2MKJA 3VF0B 1FJEB 1P27B 1WI6A 1VQOS 4CIOA 1VQNS 5IFMA 2M8DB 1YI2S 2RU3A 3JB9k 2CQCA 2DNQA 4IO9Q 1VBZA 1WF2A 2DNLA 3P5TL 4ERDA 1VQLS 2YH1A 2MY8A 4IOAQ 1F9FA 1VQ8S 2DH8A 2KXFA 2JRSA 4YUDA 3J7ZT 4CH1A 2JVRA 3BO2A 4YOEA 2OIHA 2RS8A 3R1LA 2M8HA 2DH9A 2DITA 1SJ3P 1B7FA 2KN4A 1KQSR 1X5SA 1AUDA 3R27A 4IUFA 2CPXA 3B4DA 3D2WA 3MDFA 2KVIA 1VQMS 4W90B 2BZ2A 2M2BA 1A7GE 2DNOA 4ED5A 2FHOB 3CCLS 3Q2SC 5D77A 4F02A 2HYIB 2V94A 1WHVA 1U6BA 2DNYA 2EVZA 1U1PA 5GVQA 2MZSA 1M5PC 4F26A 1YHQS 2CQ4A 2QFJA 1KD1T 2GO9A 3CC4S 3S6EA 2DO0A 1NJIT 1S79A 5DETA 4QU6A 2VOPA 5JVGQ 2HVZA 3TYTA 2CPEA 5CXTA 1D8ZA 1Q81T 1U1LA 2LYVA 1M1KT 2OSRA 2CPIA 2X1FA 2CQ2A 5BJRA 2N3OA 5GADU 5IQQA 2ZJQQ 4TU8A 1VQ7S 1WG1A 2MHNA 1ZZFA 2K8GA 3LPYA 4WFAQ 1HD0A 3HHNB 1WHYA 3G71S 2B0GA 4LIRA 3NNHA 1N54B 1X4HA 4FXVA 4TU7A 4OZ1A 2ADBA 1D9AA 1X4EA 2CPFA 1YJNS 1VC0A 2E5IA 2YH0A 3DLLQ 2E44A 1VBXA 2J8AA 1Q82T 1NO8A 3SMZA 1VQ6S 2MGZB 3CCJS 2UP1A 1M90T 1R8HA 2LMIA 2CQBA 2CQ0A 2DNRA 2DNGA 3G8SA 2KG1A 1Q86T 2RT3A 5DDRC 1X4BA 2F3JA 3SXLA 5GMKa 3CCMS 1FJ7A 2XNQA 1WG4A 1X4CA 1ZH5A 2MQLA 3VAMA 3I56S 3UCGA 1X5OA 2CQPA 4C4WA 2YTCA 1VQPS 3ZZZA 3K0JA 4PR6A 2DGUA 1WHXA 2PE8A 2L41A 2XB2D 2I38A 3J7YU 3MI7X 5CYJA 4P6QA 3US5A 2F9JA 3SDEB 3B4MA 5GAGU 2E5JA 1QVGR 1U2FA 2G0CA 4C0OC 3S7RA 1DRZA 3BO3A 2OTLS 3N9UC 2L08A 2KHCA 3LQVA 1A9NB 4OZ0A 5DM6Q 3ULHA 1VQKS 1IQTA 4WCEQ 1DBDA 1OO0B 2CPZA 5LJ3Y 4W92B 3MXHP 5JVHQ 1O0PA 2X1GA 2M70A 2YWKA 3I55S 2KT5A 2DGXA 2RUGA 3CC2S 1U1KA 1VC6A 3G4SS 1UFWA 2A3JA 3DXBA 1YJ9S 3MOJB 5IM0B 4WKRA 3FEXB 4J5OA 1KC8T 5GAEU 3CCQS 3CULA 1S72S 3NNCA 1VC5A 2ZJPQ 2ZJRQ 2L9WA 2KXHA 1SJQA 1YIJS 2DHXA 2M88A 2MZTA 1WEXA 1YWXA 2DNZA 4Y0FA 5LXYA 3G9CA 5DDQC 2LEAA 3CMES 1H2VZ 2N82B 2KM8C 2AD9A 2DHSA 1SJ4P 2AYEA 2RNEA 4QU7A 2LKZA 2X1BA 2D9OA 2MKKA 2FC9A 2YKAA 4A8XA 2JVOA 1JMTA 1N88A 3VAGA 2DGSA 3MUMP 3R1HA 3UE2A 2MMYA 1G2EA 3S8SA 4FXWA 5DDPC 2RQCA 1WELA 1UAWA 4PKDB 3S01A 1M5KC 1K73T 2M4MA 3P6YC 1FNXH 2KM8B 2JX2A 2MYFA 3CCVS 4TU9A 3MD3A 1DHMA 4Z2XA 2XS2A 2DO4A 4YB1P 3CF5Q 5CA5A 2MQMA 3MUVP 2PEHA 2OJ3A 1HD1A 1R8PA 1ZZNA 2KU7A 2DNMA 2KG0A 1U1MA 4WFBQ 2MGZA 2E5GA 1YTYA 4U67Q 1SJRA 4M5DB 2MXYA 2U1AA 2MY7A 2M52A 2M7SA 2MKIA 2MB0B 2MQPA 3CCUS 1SXLA 4WFNQ 2CPYA 5FJ4A 1UW4A 3G8TA 1WTBA 2DB1A 2BOPA 2VONA 2XS5A 2LA4A 4WF9Q 2HZCA 2QA4S 1KOHA 1P1TA 3TP2A 4Y00A 3UWTA 2CPJA 2CQ3A 1H2UX 2D3OR 1DZ5A 5EN1A 2AYGA
chains in the Genus database with same CATH superfamily
3BGRA 2BANB 3EVOA 3UVJB 4BWMA 2X51A 5ETMA 2MJUA 4PG6A 2FHJD 1IM4A 4GO7X 4H4OA 5G4DA 2JZ5A 3KMSA 4P2FA 1VLOA 4C3LA 3FCVA 4C8LA 1FFGB 1HPZB 4CQ1A 4A48A 4C3MA 7AT1B 3CCES 2KRBA 2LEBA 1WF1A 3R2DJ 3MZIA 1KVJA 1NEEA 3H4DA 1U1OA 5DO2A 3TUZC 1XEZA 2QA1A 2JSXA 4EGLA 3I6PA 4MKYA 1X9MA 4X4QA 2AJ1A 1SC4B 1ULRA 4CLTA 2XMMA 4QPTA 1N52B 3OFHA 4KE5A 1YK9A 1SUQA 5L9NA 3I0RA 2GC8A 3JYTA 4B3TF 3I0SB 3W2VB 3TO8A 2BV3A 4X64J 3UN5A 3MEDA 1UA0A 1SL1A 3CTRA 4LMZA 2XGQA 4C7QA 3EZ5A 4OHVA 2ZH4A 3GFXA 2PFDA 2VOOA 1WEYA 2HNYB 2HW3A 3BDPA 1RU1A 5U47A 4K7QA 1LWFB 2B4OA 1RTIB 1UJ5A 3MMCB 4WP9A 3CWJA 2NZ4A 2VZ9A 4USJC 3ZFVA 3FZBA 3Q2TC 2BDPA 2OMOA 3PX0A 3N01A 4OYMA 3HI9A 1YQHA 1H6KX 1N8RT 2FC8A 1PC5A 2EEYA 5F8MA 2B4VA 5D3GB 3H25A 1ZAXA 2LEPA 5B0DA 3QRRA 1VS3A 1XMBA 4KGMA 1TELA 2HIYA 2Y0SD 4L3NA 3MECB 1NK7A 3VAJA 3THTA 4C3KA 4X62F 1J5OA 2FJEB 3KLEB 1YBTA 4QYRA 4LF6J 2C2RA 2MQOA 2MQNA 2GQQA 3JB9k 4ES1A 4O3RA 4J9UE 1U02A 4ECVA 2HG4A 2DNLA 3NAIA 1VQ8S 4ELVA 3M6XA 2DEJA 4OI6A 4PXDA 4R8UA 4YOEA 2FVSA 4TY8A 4LFCJ 3GR1A 4DL6A 5KOWA 3T3FA 1N5YB 5LT5A 4W90B 5C42B 4DR7J 1TUGB 1U8WA 3M8ZA 3CJKB 4C0BA 4WTYA 1AT1B 4RUCA 1BQNA 1WHVA 4F4YA 2EVZA 1JXVA 3D67A 1YHQS 3CC4S 2R7VA 2D7SA 4CM2A 2KJVA 4DV4F 4A8SA 2CPEA 2F40A 2C3UA 2X1FA 3I32A 3DRRA 4MH8A 5EUHA 3K8WA 2E1RA 4OYWA 2GJFA 4JI5F 5BYSA 1VC0A 1LW0B 1IKXB 1HWUA 3RZAA 1NO8A 4X84A 1VQ6S 5DLFA 3SV3A 1T02A 2GHWA 3LP2B 2ZKUA 3SIPB 2DNGA 4DFPA 1Q86T 1IN0A 1X4BA 1F60B 2VFTA 3V5RA 2F4VF 4YB7A 4RW4A 2CZVC 3QQCD 4F3OA 3C16B 2LU1A 3W2WB 5BR8J 5D6GA 2DGUA 3CCZA 2PE8A 3MAAA 3MMAA 2UV8G 3BO3A 1MW7A 2QLFB 2OMLA 2G2OA 2WB1D 1RT4B 3I55S 2KT5A 4JI3J 3BR9A 4GRSA 1LW2A 3IO1A 2HS4A 2YKNB 5GAEU 3CULA 4F0HA 5J1NA 2GIRA 4B3OA 2NXJA 3NNCA 1LWCB 4J90A 4NA3A 2ZJPQ 4OX7A 2XYGB 3DDIA 2XHCA 4JP8A 1CLFA 2HK3A 3ENVA 4DX5A 4DR6F 1HNIA 3CD7A 2JVOA 3DRPB 3QWPA 1WELA 5K5MA 4LF7J 1I1GA 4UY85 3MD3A 2NR0A 1UZDA 2IDLA 4P73A 4YB1P 5B0CA 2BJ1A 4QJVA 4EK2A 2OJ3A 2KU7A 2FJVA 2J6TA 1N32J 1E6YB 2KG0A 4WFBQ 3M9MB 3QIPB 2VQFF 2MB0B 4WFNQ 4IG0B 2CPYA 1P6TA 2ZH3A 1TFYA 2CUYA 2ZWOA 3JTNA 2B56A 4ICLB 2YKOA 3GQCA 5EWEA 3UVJA 2D3OR 2WW8A 3HCXA 4USWA 2JJ4D 4O44B 3M2RA 5CD4A 3LP1A 1HBNA 5M2RA 4UUWA 2PI5A 5HVFA 3F73A 2I2YA 4DBQA 5D8HB 4I2QB 4IR9A 2VG6B 2K3KA 2DGQA 3DMJA 2RKIA 2H51B 3T5LA 1AW0A 5H9FK 2W9AA 3BQ2A 1XN9A 3IR6B 3M2VA 1L5UA 2OFGX 2MZQA 1N36F 3CCWA 4GVLA 3D66A 4CLLA 3AFGA 1X4DA 4K4SA 1JQGA 5KFGA 1T9XA 5IOLA 1BUXA 1JLCB 3OBIA 5ETNA 1NB2A 4C8MA 5HJXA 4ES2A 1S1WB 2IRXA 1Z4UA 3H40A 2MSTA 1NXIA 3KLVA 2K06A 4O3NA 2MPUA 4A46A 3DLHA 3T6BA 1M5OC 3BKTA 2W9CA 2JWNA 4JI7J 2D9PA 2J9DA 2YKMB 1FXLA 2HVEA 3MMCA 4LREA 3SFUA 3T1AA 4KO0A 3SSRA 5KFXA 2YXLA 1VOMA 5HMZA 2EFGA 1BD6A 3QBCA 5D4LA 3RB6A 1OWXA 4KV8A 2IJRA 4MIBA 3RB4A 5D3GA 1VHIA 5HO4A 1FO1A 1HI0P 5A8WA 1PILA 3NGUA 2CNNB 4USVA 1F9EB 1F5AA 2FGCA 4DI6A 1VRTB 3NCRA 3KLHB 4JI6F 3J81Y 3TA2A 4WFZA 4EUVA 3J80Y 1F3FA 1KFSA 1NK8A 3KUEA 2WW4A 1NKCA 5KFRA 4K0KJ 2PMHA 1RHJB 2OSQA 3EWGA 3CCTA 2HZVA 1AZSA 3LGHA 3GCWP 3FDSA 6AT1B 2AWZA 2Z2MA 4C98A 2VPYB 1EX8A 2KFZA 1TKTA 1NNDA 3O3LA 4OL8A 1FKPB 1JLEA 2JLFA 2PSZA 4DG1B 2KVIA 2MKYA 4H4KC 1A7GE 3TVZA 2WCXA 4FVMA 1SH2A 2BW7A 3WIVA 1RB0A 2QC3A 4KH0B 1IM6A 2QA2A 2CQ4A 4ITSA 3WX4A 2VJUA 4DSIA 4MK8A 1BLUA 1HQUA 2N3OA 2HFNA 4ZPCA 5I3PA 3HHNB 1S9GB 3G71S 2ZNYA 5ETLA 4EI2A 1YJNS 2CPFA 3ICLA 4JI0J 4LBHA 3POTA 3LP0B 2GNKA 1J5EF 1YRTA 1LNQA 4NI2A 4OX8A 3ILLA 4CO0A 2CXEA 2RQMA 5G0RA 4EO8A 3H42A 2NSCA 3O8WA 2DXDA 2A1BA 4O23A 2B5JA 4RW8A 2ACMA 2MQLA 3DDKA 2RDJA 2OPSB 2EW9A 4NCGA 2R2RA 2BKPA 3DDNA 3PHTA 1RT7B 2VG7A 5GAGU 3J7Z5 3D6HB 2YVSA 3PW0A 2FVPA 1NMEB 1GMVA 4IG3A 1OO0B 1HR0F 2CNLB 5LJ3Y 4M5MA 3M9OB 3PDNA 2OPQB 4M63A 5DLGA 5E3CA 2DGXA 5EWFA 4O3QA 1RT2B 2EFVA 2HHSA 1LWCA 2A18A 1XMQJ 2AX1A 2XEXA 3CIZA 1UVNA 1OMSA 3B78A 1FA0A 3KLGA 3LGMA 1B99A 5DQHA 2DRAA 4F4WA 4HKQA 2ZJRQ 3IS9B 4AFFA 3D6TB 1WEXA 3RB3A 2ZC4A 1RABB 3OTCA 1RLCL 2X1BA 1NSQA 2QIFA 4FF4A 1KSPA 4ZVFA 1LWXA 2C3OA 2BYCA 4F2RA 3DLEB 1PG5B 4Y2KA 4WE1B 1FDNA 3KLIA 3OTDA 1S7IA 3AQPA 1NBEB 4URSA 3TZWA 3T1HJ 3JSYA 1DJ0A 1JXLA 1YTYA 1SJRA 2WVEA 3DYAB 1R43A 3V6DB 1QTMA 1S6QA 3DLGA 1KFDA 5I42A 4DUYJ 2C28A 3W8GA 3P96A 1TVRB 2ZBPA 2FZGB 3LTOA 2LDYA 2DCLA 1NU4A 3DNCA 1TL3B 1GMWA 2F8EX 1RT6A 3N6LA 2ZH5A 2QEXS 3AD9C 2ZE2A 1DQ9A 4YHHF 5J2PB 4FF2A 1KHWA 3DRSA 2PMZD 1FDDA 2UZAA 1NDLA 5IM0A 2J0SD 3EUNA 2IMWP 4QW8A 2OEKA 3C14B 4LF5F 1FWLA 2JOQA 3OL6A 5DG7A 4C8NA 4PZVA 1AYEA 4MKBA 2LCWA 4TVAB 2UXCF 4DN0A 2J7UA 4B3TJ 2XY6A 1NLKL 2Z2LA 3QZ7A 4CLUA 2YKMA 4DR4F 3CJQA 1RAEB 1XQIA 5AXNA 4X4RA 2FLOA 1Y00A 2WSCC 5AXKA 4QIVA 3MPVA 2CQIA 1FJGF 5H1SV 4NRUA 3LA0A 1OYDA 3O44A 4L74A 1U1NA 1UFLA 3M6UA 4IFVB 5HJYA 4HH1A 2XMTA 2ACYA 4K4UA 4DL7A 4JI8F 4OYAA 2AP6A 2GMHA 3OQ2A 1XIQA 4CH0S 4OHXA 1T8EA 1C1BB 2KFYA 1S59A 4QWEA 1QJHA 4ED4A 2C3PA 2ROEA 1V3SA 3K5OA 3A8JA 3KG0A 4HYKA 5J1PA 4LRFA 1FDBA 4ZCMA 3CCSS 1IBMF 1QE1A 3AXKA 3IRWP 3CC7S 4X62J 3HFVA 2V0NA 2HGLA 3G96A 3N0VA 3BPDA 2V34A 4ID8A 5KFKA 3W9IA 3WDOA 4ECRA 2D74B 4PG4A 3PXGa 2E9ZA 2GVDB 5C25B 3RRHA 1N0VC 3V81A 4CH1A 4Q0BB 5B0BA 3BH6B 2E5LF 1KQSR 4C8KA 5JUMA 3FNNA 3HFZB 4X4NA 2RHQB 1T9UA 3DGPB 1VJWA 3IM8A 1LK5A 3KK2B 1H73A 5J2QA 1ZAVA 1O8BA 4PG7A 1M5PC 4OHWA 2GO9A 1N5VA 4DV2F 4DV4J 3OPKA 4HTJA 4CNYA 1CJKB 2HVIA 2V2ZA 3MMBA 3QJLA 2VD3A 2GFFA 4LQ9A 4PWDA 2YWEA 4OJ3A 3MCOA 5K8NA 3QFHA 1RBLA 4JI5J 5CZVA 5F8IA 3TX8A 4NX9A 4FYWB 3TANA 3D4JA 4A47A 2HSEB 5DQIA 3PRBA 3CCJS 1X31C 4BCAA 4F4ZA 5CABA 3BPSP 3R5BA 2V8PA 3SQOP 2RT3A 3SXLA 1WG4A 2FJBB 1RHMB 4FS1A 4WTOB 2BA9A 2NXUA 4DDFA 2HHHF 2I38A 4H54A 4DOZA 5AT1B 2RSQA 2UUBF 3F56A 1C4AA 1BQMA 1NZAA 3N79A 5HQMA 3AA8A 3HPOA 2CNKB 4ENOA 2JEJA 3MFIA 2OKQA 2P9EA 1TKDA 4A8WA 1HQEA 2JEGA 3DM2B 4TY9A 3FEXB 2FVRA 4GKKF 3KJFB 2QMUB 1U2RA 1SJQA 1YRUA 4NLQA 1HNWF 1S6UA 4DR6J 4GVBA 3TARA 3M1VA 3FVYA 3W3SA 3ZTOA 3ILJA 4NLYA 1N6QB 5FDLA 3OLBA 2C2KB 5L46A 1RA6A 4ECTA 4ZHRA 4Q5VA 4U8YA 3CNQP 1O51A 2MQMA 4LSNB 4ZLJA 1IKYB 2BX6A 3HHKA 2ZHAA 1U4BA 4TN2A 2K2PA 2VQFJ 2U1AA 3GV8B 2YQ3A 4R5PA 3G8TA 1O5JA 2HWHA 1NH8A 2BVZA 3CDBA 3A12A 4Q2LA 3UWTA 4K4TA 3AQOA 4M5GA 2UUWA 4IH5A 1SQFA 5AE1A 2Q1LA 4JI1F 2DIVA 1NPPA 5E2QA 2HGNA 4B9NA 3FCWA 5GMEA 4OX6A 3ITHA 3CJ4A 3W5XA 1OQ6A 4OFZA 3TVKA 1WHWA 4LIWA 1N36J 2EK1A 1I6JA 1PYSB 3C6TB 4PWWA 2YKPA 1UMJA 3OLAA 3VAFA 4H4MB 2D3ZA 2WVDA 3A13A 3H8YA 5J2NB 1RGVA 3G6XA 3KK3A 4G1IA 4DL4A 3OR2A 1C0TA 1RA7A 3E01A 2AKWB 1WEZA 2UVRA 1JLQA 2B6AB 1HARA 2X7IA 2R8HA 1ZPWX 3QLHB 4YMEA 3D28A 2W2PP 4O3OA 2NUHA 3OSNA 1JLFA 1OPIA 3EX7B 3W64A 3M30B 1VQ9S 2ADCA 1TKXA 1M5VC 3HSGA 2W01A 3K58A 4ZLPA 2B43A 2GHPA 4ZA1A 3TZZA 1VBKA 2ZWPA 3BKFA 1WD6A 2IVMA 1K9MT 1FCAA 3VAIA 4Y2IA 5A6WA 2RUSA 2DPJA 4JI6J 2E1PA 3WZ0A 4DWIA 2BQRA 5IC6B 4ELUA 2QX0A 3BREA 5D78A 2J6SA 3VALA 3X3UA 1FWKA 3Q83A 4NWBA 2MQQA 3H2VE 1W2IA 1YLXA 3RRGA 1R0BG 3KJQB 1WDDA 1FFWB 3TW0A 3DLKA 3TA0A 4RNFA 1YI2S 2GVDA 1NCLA 3QFWA 4HDHA 3HDSA 3R7SB 4RR5A 4S0MA 2MY8A 1XNRF 2IJNA 3IG1A 1KQFB 3TA1A 2M8HA 1ZPVA 1B7FA 2W8KA 1GH8A 2NXNA 2ZFHA 2KT3A 4ED5A 2Q3PA 3G2XA 1F5BA 2Y0BB 2ILYA 4F02A 4E8UA 1HNVA 4ZN1A 4GC6A 4J37A 5AJ3J 2BACA 4PYDA 2UXBF 4X4TA 4RBTA 4UW2A 2QGFB 1P9QC 4GO5X 4BDPA 1RT5A 5BJRA 5KFIA 4PCQA 2AT1B 4WFAQ 2AHOB 4IYQA 3JS9A 4WBFA 1N54B 3R6GB 2GA7A 3I9V9 4WYLA 4P71A 4ID5B 4DV0F 1J5EJ 3M2UB 2ZOMA 2VQEF 2GX8A 2J8AA 2QZ8A 2ATCB 1M90T 4RUBA 4OQJA 5HP1B 2V69A 3PEJA 2DNRA 3MM6A 2KG1A 4K8RA 3MM5A 4ZPAA 3OVAA 1AROP 4Q44A 4X2BA 3PY8A 1NJXA 5GAEI 4HACA 4A8KA 3PVXA 3MI7X 2UVVA 1JKHA 5I4MA 3S7RA 2HWIA 3N28A 2JLGA 1HR0J 1U48A 1DLOB 1UA1A 1LXJA 2GIQA 3KK1A 1CULA 3MPDA 4L75A 3GYNA 2PC6A 4CP5A 5CYMA 1P9YA 3D1HA 5SZTA 3CC2S 3T41A 2YWWA 4N76A 2HHVA 3G4SS 2B4PA 3HD2A 4J5OA 2FHJA 1N48A 1KHVA 4Q2MA 1VC5A 2KXHA 1YWXA 1SQGA 3CSKA 1UKUA 1S9EB 1QD1A 1LEOA 1RWVB 2DPIA 1KLNA 1UEKA 3FZ2A 4EZ9A 4NE9C 2HNDB 2Q6CA 4JUZA 3B6BA 1M5KC 5C24B 3NAHA 2VG5B 3NWGA 4OI1A 2KO1A 2RIJA 3UI3A 2R7WA 5KFZA 2Y3YA 4RW9B 3FSYA 1XR5A 2WVFA 2VONA 4DR2F 4F67A 1U6ZA 3PKMA 4WF9Q 4MT1A 2WOMB 5KG6A 3OL7A 2QA4S 2OH2A 5K8MA 2VDIA 2UVUA 4J9VA 3ZTSA 1D1UA 4TLQA 1CBKA 4RLEA 3Q8VA 4I7FA 2Y9HA 4DZ6A 4DV1F 4DN9A 2HLUA 2J7KA 3QO9B 3CD0A 3PHEA 1A0OB 4PUOB 1Y9OA 2AQ4A 2E29A 1R8AA 5T41A 1GK8A 4YHHJ 1S1UA 2GGPA 2VA2A 1WKJA 3HHLD 4O4GB 3KOAA 4TNOA 4DPWA 4F4KA 5J2NA 5HROB 3C6UA 2XY7A 3K17A 1RAOA 2DR7A 2KFNA 4KBIA 4DV3F 2UXCJ 1T05B 4LQ3A 3VTIA 4IH7A 3EM1A 2MZRA 3GIRA 3Q8SB 2ZH1A 4DR4J 1VIXA 1SJFA 4K4WA 1PJ5A 4RL1A 3WIUA 2VBWA 4A8FA 1FJGJ 3SFGA 5KFQA 3W61A 4L76A 2AYBA 3CDAA 5KFVA 5LJ5Y 2VPXB 2EC2A 2YX7A 2QE5A 3BYRA 4FF1A 4JI8J 3L7UA 3MUTP 5GAHU 4JI4F 4RNOA 3IR7B 2HFUA 1GXUA 4HL9A 2CNOB 1KVKA 4QR1A 2J76E 2YNFB 1UJ4A 1SKWA 1IBMJ 1SBRA 5L8RC 1RWPB 4YDDB 2XHWA 1FHTA 1IKWB 4B3MJ 1EIYB 3OHBA 4ECUA 4I6WA 4LRCA 3UR0A 2VPWB 1CJTB 1QVFR 5F8GA 1LFWA 2QLWA 3FMBA 3TAMA 4BS2A 4ZP7A 5KFMA 1YBAA 5F9LA 1VQNS 2DNQA 2FD2A 5H9EJ 4C48A 4YS2A 4ILMA 1ZA1B 3DOLA 3R5GA 2D3UA 4I68A 1LFPA 4IOAQ 1EP4B 1N33F 4ZVGA 2E5LJ 3EZOA 1HBMB 3R27A 1S6PA 4IUFA 2V8HA 1KQGB 3C46A 3AT1B 1RAFB 2HQCA 2BJ7A 2E7XA 5D77A 1CS4A 1S5ZA 2XMVA 2VUGA 4OZ5A 2AGQA 1KD1T 4J9NA 4DV2J 1T03B 2LQ9A 3FFIA 1N34F 5CXTA 4AT1B 1GXLA 4MFBB 4A8MP 1U1LA 1SH3A 3DOMB 4ED0A 4KFBB 4HEA9 2GHVC 4W98A 4NEYA 4XTTA 1DTTB 4NRTA 4TQRA 5B7WA 2YH0A 5L1JA 3C19A 1RKIA 3HULA 1S1TB 3ADAC 2CQBA 1KBRA 3W5ZA 2IPOB 1FKOA 3HJFA 5DZ6A 2W24A 2POKA 2HHHJ 3HT0A 1VMBA 4ZDNA 4C4WA 1SKUB 4KIAA 4QIGA 3GJQB 3J7YU 3ZZOA 4DL2A 4Y2CA 1A9NB 4G65A 1VQKS 2FGOA 3AOBA 4C8YA 1FK9A 2IFXA 3FBFA 2IBOA 1CJUB 4GKKJ 2CIMA 2YNGB 4HDGA 3V6JA 2P6TA 2BE7D 1NAQA 4B3RF 2H54B 3I4PA 1HNWJ 1VR6A 2C22A 3JQKA 2WVCA 2D1CA 4MYUA 2AYEA 4MKAA 4UTGA 3KNGA 4LR8A 4UOFA 3UR3C 4EBEA 3M32B 3MOZA 4JV2A 4OJHA 3R9LA 2DO4A 2IAJB 3PCOB 3ZTPA 2PEHA 1HNXF 1LKZA 4M5DB 2WOMA 4DJBA 2M52A 3HKZD 2OFHX 2GMJA 3RJMB 2LA4A 3T1YF 3TP2A 4Y00A 2R7TA 1TKZB 3P8BB 3M8QB 1NDCA 3B54A 4JI1J 1RK8A 3SSQA 4FKXA 1X4FA 3NRBA 3QT5A 1MWZA 4M5KA 1UCNA 2K3IA 2W2MP 1X5TA 5JXSA 4RW7A 2V4QA 3LWLA 3OVBA 2AIRB 3FK4A 5KT3A 3ET6A 5HROA 3NS5A 4F25A 1XNQF 1HL6A 5HMXA 1VBYA 4B9UA 1I94F 3PO5A 3MFHA 1NUEA 2CJKA 4WZMA 1T05A 1GXTA 3ENWA 3PYGA 2VPZB 1JJHA 4DSEA 2B9XA 2HHXA 1HA1A 3K59A 1DTQB 5LSOA 3A3NB 1S4EA 4DHVA 2XLIA 4AXIA 5E41A 4KKOB 3JQJA 3ZTQA 4MMOA 3DC2A 2MQ8A 4P10A 2WK4A 3GFHA 1B4SA 4L72B 1KS2A 3KJVA 2C3YA 3RR8A 2E7WA 3LALA 2HBYB 2ZBCA 1RTDB 1TL7A 2MKSA 3FEYB 3K5MA 4OYPA 1L3KA 5KG2A 3PX6A 3AD8C 2DGVA 2DY1A 1TL4A 4ILRA 2PGCA 1D8YA 1M0SA 4LJMA 3ELHA 2HVDA 3DOKA 3ZZPA 1B0VA 4UY8T 3GFZA 1AXQA 3TAQA 3E2EA 1BMQB 2IM2A 2JEFA 5ADZA 1L3TA 4DS4A 2LECA 2P8IA 4U9RA 3BV8A 3NG8A 4NPOA 3M6VA 3MCMA 1FT8A 4WU2A 1TV6A 3VF0B 1QTNB 3TR5A 2EC0A 2PA8D 1WF2A 1RCXB 1XNRJ 2N4CA 1SL0A 4USHA 3AJDA 1QAXA 4YUDA 1F9HA 1S1VA 1JLGA 2MHEA 2XULA 3NY0A 4G1PA 4K50A 1MU2B 3ENAA 1UW9A 4LSZB 4KGXB 2FLLA 3BM7A 4ZPTR 8AT1B 5DETA 5JVGQ 2R2UA 4DFMA 1M1KT 4Z7YA 1RHKB 3KTQA 2GCFA 4TLRA 4EBCA 2K8GA 2DT9A 4NZ0A 4FS2A 2FIUA 1X4HA 5MAOA 2V4JB 2QLBB 1IKVA 3UNYA 4DV0J 2W4CA 2VQEJ 3RUBL 3DLLQ 4FDFA 4BBYA 1RXOB 3SMZA 1LQ9A 4P72A 1TFWA 4PQUB 2J0XA 4LF9F 5KFHA 1R8HA 5T7LA 3SQGA 3NGDA 1S10A 2QN6B 2QMWA 4ZN3A 5K14B 3IA0A 4RW6A 3M8PB 2HHPA 4LF4F 2VIHA 4OX9F 1CC7A 3ETOA 2QYGA 3BGRB 2BJ3A 4IDKA 1GAOA 3GV7B 2P5VA 3D1OA 3W65A 3N9UC 1ACMB 2G2YA 3MR7A 4H4OB 2XSJA 2OI2A 4CZCA 1O0PA 1P1LA 2DR6A 4RNMA 3AODA 2VBXA 4WKRA 2XGPA 3E8OA 4WXOA 4HT5A 2IIHA 3KJNB 3IM9A 3N6NA 3TJAA 1SUQB 4GKJF 1TUWA 3I0RB 1MG7A 3JYTB 3J7AN 2CJXB 1FD2A 2DKOB 1HWIA 5DDPC 4NLWA 2DXFA 5ETOA 2YPYA 3D5MA 2KHDA 3BN7A 1FRIA 1U1MA 1B0PA 1N5QA 3AB4B 4G6VB 2MY7A 4IKAA 2M7SA 4Q7AA 1AFJA 3BYPA 3JSMA 4DR2J 4E0DA 4F4AA 2VFSA 1U8SA 1HLWA 4TKTA 3D0IE 2P2CB 1HYSA 3OT9A 2PO4A 1WORA 3D0HE 2VH7A 2HRTA 1WJ9A 3MEKA 1F1BB 4DV1J 2W9BA 2F63A 2A2DA 3TAPA 2I0XA 3SSSA 1M5SA 3FGVA 1REGX 4RWXA 1RSCA 2HWTA 3L3CA 5E5NA 5D0EA 4G1QA 1NZ8A 1FX2A 1J5OB 2J0QD 3G87A 4IQMA 2XZDB 2WSFC 5DQGA 3VAKA 2ZDPA 5A8RA 3G8QA 3GG0A 4ZVPB 4ZLLA 1FX4A 1ZAWA 3K5LA 4R8UB 2DXEA 3W7BA 2XO7A 4TY8B 4QQBA 3QSYB 1KRPA 3K5PA 2A0FB 2I5JA 4OJ1A 4IFYA 1BQNB 4J9OA 3V4MA 1QSSA 3RRKA 2OP5A 4DUZF 4QR2A 2NSBA 2C42A 3T6JA 4JI4J 3FCHA 3C8YA 2NUUG 3PYEA 2C3MA 3H7HB 2HMIA 3UNGC 3DRRB 2XMWA 2WSEC 4IQXA 2MZ1A 1TL5A 2PDAA 5BYQA 1W7WA 1TAQA 1XTZA 2W8LA 1DQ8A 4LFAF 5KT4A 3M8WA 2ROPA 3JTPA 2XQCA 3FBCA 4Y3CA 4ILLA 2AYMA 2ZH8A 3H4BA 1QAJA 1TK0A 2CQDA 3DXSX 3CXCR 4ZKAA 1T9TA 1S0NA 4RW4B 2MKJA 3CB4A 1SI9A 3RAQA 2CQCA 5L38A 2UUAF 3MTJA 5FIIA 4I2PA 3MAAB 5E3PA 1Q8BA 2CJQA 1N33J 3MMAB 2DH8A 1JB0C 2KXFA 1R8BA 1S4FA 2V6AA 1FEHA 4PXCA 2DBBA 3MCSA 2KN4A 3S1TA 1L3UA 3MDFA 3JXOA 1HW9A 2BZ2A 5J2MA 4DU7A 2RF2A 4CI0B 4OI2A 2V94A 1LW2B 3H5UA 3Q23A 1EHWA 4B9VA 1QUVA 1RADB 1XBWA 1NHKL 1Q5YA 3S6EA 3ZO7A 3QAEA 4OLPA 4B3OB 1B7YB 2HVZA 3IAS9 1Q81T 1OPZA 4XO0A 4AE5A 5L1IA 2KZMA 1PBUA 1HNIB 1HBOA 4TXSA 2MHNA 2R7SA 4LF8F 2MLYA 4TU7A 3T19A 3SEOA 4OHZA 4QYZJ 2AMCB 1X4EA 1D9DA 3NGRA 1PSDA 1T95A 4E98A 5LSRA 2C2MB 3QT8A 3GLJA 3GCXP 1IR2A 3W63A 2RE1A 2GMLA 2VJVA 4MKVA 2AGOA 4PG8A 3U7JA 2RQKA 1D9FA 3BBCA 2B9WA 2AEJA 1FXDA 2YTCA 1YJUA 1FD8A 5IXUA 3Q89A 5FLXY 4CLYA 2XB2D 6FDRA 3M2RB 3H2LA 3LP1B 5EX0A 1PCAA 1HBNB 1RACB 2A10A 3IAM9 3AJ1A 1DBDA 2CPZA 3HKWA 3M7VA 3DMJB 4F3QA 2RKIB 4LUBA 1CJVA 4E2FB 3V4IA 2HFZA 4IH6A 4OYOA 3M2VB 1K1QA 4ANCA 1UFWA 1XJWB 1SV5A 4B3RJ 4X4OA 3CIMA 3CJTA 1YIJS 2M88A 3C15A 3FSIA 4B9SA 4Y0FA 4C6AA 1H2VZ 2KM8C 1PAUB 1SB6A 2LKZA 2D9OA 1EJ7L 1EQ0A 3L7PA 5E33A 3WBZA 2GVZA 5IS2A 4DV6F 3VQSA 3FUYA 2W9CB 1IWAA 1MROA 3THVA 1FNXH 4CT8A 1H74A 4ZLNA 5CA5A 5HVGA 1X9WA 2DVIA 1HNXJ 3MMJA 4TQSA 1NK9A 4KO0B 4KPYA 1E6VA 1KNZA 3ZNUA 2MXYA 3AHPA 4HLBA 5D0GA 3T1YJ 2UU9F 1P1TA 1DARA 3GR0A 4KV8B 2KT2A 5EN1A 2AYGA 1UVMA 1RDRA 5A8WB 4WZQA 3OUYA 4DFKA 2EKNA 5KT5A 4YDXA 4J91A 4UZBA 3QGPA 2ASYA 4QCLA 3BQ1A 3BGOP 1NSPA 2VA3A 2H4WB 3IWLA 5HBMA 1K0TA 1H2TZ 3EE3A 2K7JA 2FVCA 3K89A 2YWHA 3I5CA 1XNQJ 4I67A 1AZSB 4NLPA 2F9DA 2VBZA 3EZUA 3M4XA 3IGVA 4KHMA 2O3DA 4DR5F 1S0VA 2U2FA 3LW5C 3G6ES 2CWXA 4RU2A 4IOCQ 4FYVB 2BOAA 5KFFA 3QJPA 1TKTB 1YZ7A 1U45A 2G4BA 3BB5A 3GB0A 5E3RA 4FKYA 1RYSA 1TMJA 1JLEB 5ETPA 3GZ7A 5HI7A 1AA1B 4YQWA 2E66A 3CDEA 1FE4A 4CYUA 4J7CA 1U0HA 1N56A 4LR7A 2VC0A 3FRYA 3QGGA 2WRMA 3NS7B 4AL7A 2Q79A 4YFUA 5IQ6A 3BH7B 2VBYA 1HQUB 2HAIA 2ZH7A 4V19X 4JI2F 3G82A 3IP0A 2EBEA 4DSKA 5CZXA 2VHGA 3POTB 1BY9A 3GSIA 1ITPA 1RWUA 5KG0A 4NI2B 2DRBA 5DM7Q 1NH7A 1J27A 3TJ8A 3NGSA 4DR3F 2F5GA 2CQHA 5G0RB 4PRFA 1S48A 3P49B 3VAHA 4QWAA 2B5JB 4RW8B 3GIMA 5K8OA 1O6XA 1BE4A 1WI6A 2V8DA 4CIOA 4K2XA 4NCGB 3SCJE 1H38A 2PT0A 1VBZA 3P5TL 4ERDA 2VG7B 3HMJG 2J7WA 4IG3B 4M5HA 4ZCIA 1FVSA 4RU9A 4ZK7M 4NLRA 1TMMA 3BGLA 3UQSA 1Y0HA 4Q45A 2OD4A 4X64F 1KN6A 3BZQA 3PW4A 2MZSA 3HVTA 4RNNA 3KLGB 4M1KA 3PX4A 2FLNA 1Y5IB 3R5CA 3LAKA 5IT0A 2WAQD 3W66A 3RBEA 2J9CA 3H59A 2NQPA 4J9MA 1ZM3A 1ZZFA 1H7XA 5B0EA 3DCAA 3MPYA 4RZRA 3CO9A 4AQYF 4LIRA 2XCPA 3PEHA 5F41A 3KG1A 3NBPA 4OZ1A 4X4UA 4I6AA 4WWSA 3KLIB 3Q22A 1ZETA 1YBUA 4J9LA 1VBXA 2B7BB 1SH0A 3IRXA 3Q8YA 2EFNA 4USMA 3LANA 2CDRB 4AL5A 3QT7A 3OJUA 1YKWA 1S1XA 1S6QB 3DLGB 5I42B 4EYHB 1VQSA 4LF4J 4PPZA 2R8IA 2WBMA 3UDVA 4OX9J 2G9OA 2IRYA 1X5OA 2VV5A 2C2EA 1R89A 2FLPA 2H9ZA 2ZOFA 4DQQA 1WC6A 2J0WA 2RU9A 2L41A 4P6QA 4ZIVA 1U2FA 4ED8A 1NB7A 4DPXA 3LQVA 4NEZA 4QIEA 5A0YA 1RT6B 4AL6A 2JEIA 5HLFA 3DGVA 5CQGA 5I3UA 2FUG9 2ZE2B 2ZEJA 1GTHA 2X1GA 1VFJA 2WZ1A 1SQEA 2YNHA 3DRSB 1U1KA 5IM0B 2PIIA 2QFIA 1HNZF 3HHLA 4QU7A 1QLNA 2R2SA 1FRHA 4KH1B 2YPZA 3FSXA 3R1HA 2Z0GA 1V3ZA 2MMYA 4HHUA 2W7PA 2BKNA 2M4MA 3GP9A 2J6UA 2V67A 2AEFA 3ZC4A 2XS2A 1EKSA 2BE9B 1R8PA 1QSYA 3I9ZA 3GYGA 2BKOA 1FRXA 4WJBA 4R0JA 4ED7A 4IRDA 1XK8A 2M5YA 1RWKB 2O1PA 2XO6A 3A4TA 3V6HA 1WNEA 2ZH9A 4FXDA 4XK8C 1JLAA 3HM9A 5EX3A 1M1HA 1IJEB 1AFIA 2MEWA 2HHUA 4I0WA 4C11A 3PIOQ 2BJDA 1CSJA 1NK0A 1QE1B 1WUUA 2DGTA 4PABA 1FKAF 1S99A 4FNIA 2IMOA 7FD1A 3LAMA 3FRZA 3CW2C 1MWYA 1F5CA 2XMJA 4KB7A 5KG5A 4F8RA 4PQAA 3TOQA 4WFXA 2E9RX 1G4CA 3UCUP 2LLZA 4NMLA 1KWMA 3VGSA 3V81B 5A6PA 2C1EB 3BGUA 1R0AA 4DF4A 2EXUA 1SVDA 2YNIA 4U6PA 2ZUGA 2R3VA 1X4AA 3R8YA 4CLSA 2BM1A 3QRQA 4F36A 1BWEA 4K4XA 3CEDA 4ES3A 4F50A 1Y5LB 2LXIA 5K20B 4DUZJ 5J2QB 2KTQA 1J2VA 3EGNA 3CCRS 4PWUA 2MSSA 1RAIB 3QWUA 1JX4A 1B0TA 3T5HA 3MMBB 1UZHA 3O2IA 1VRUA 1KDNA 3FKBA 4PWDB 4GC7A 2IVFB 1F0XA 1VRQC 3IN5A 1F2HA 1EARA 3MR3A 3TRGA 1R31A 3HVRA 3CJSA 2DHAA 5KFDA 4ZITA 3SI8A 4YB6A 1NRKA 3B8HA 4ZVOB 2B9YA 5KG1A 1HWLA 1W25A 1Y10A 2OLWA 1Q4RA 1FJEB 1UFKA 5KG7A 1VQOS 2RAQA 1HI8A 5IV4A 2UUAJ 5HMYA 2OPRA 4V1Ak 3SV4A 4KR0B 5K9FA 2W1BA 1C1CA 4ED3A 3BO2A 1T3NA 1H3DA 2B8QA 2RS8A 1SKRA 1BQMB 1UTAA 4HHHA 4KGKA 1RT1A 2IYGA 1HQEB 2HVHA 4ZCLA 1URRA 1U6BA 1C0UA 3PFOA 4J9PA 4CO2A 2ASLA 4A8OA 3H98A 1D8ZA 2PI4A 1FNOA 3AOAA 4GVBB 3M1VB 3BF4A 2OD6A 1VI7A 3PRDA 4BHQA 4LF8J 5FDLB 4MK9A 2V9KA 3PM9A 3TQ1A 1BHNA 2L9DA 3OR1A 2KB2A 2ZZMA 4ZHRB 3OXLA 1D9AA 3LF0A 3HZGA 4O0IA 5E0OA 4OZ2A 4M94A 4EU0A 3HP6A 2O01C 4B9LA 3PTWA 4R5PB 3NL0A 2DD8S 3PW5A 2GQCA 2CQPA 1RT3A 2FJDB 3P4UB 5KFTA 4ED1A 1B64A 3LUYA 4OIXA 3JSRA 2Y1IA 3T9ZA 2IA6A 2NYIA 1ZM9A 2APOA 3AY0A 4I64A 4DPUA 3MM8A 3ITHB 1IXKA 5M2PA 2RUGA 2D69A 1KC8T 1APSA 4CCHA 3DI6A 3OL9A 4N8NA 2DHXA 1R7IA 3OD2A 2HHWA 4NA1A 4LSLA 4NL5A 3NCPA 3KXDA 2JLEA 4FP9A 2N82B 2AD9A 1FRLA 3Q24A 2FC9A 1FESA 3RGIA 4P74A 3KK3B 4ECSA 2DGSA 3OR2B 1C0TB 3E01B 5LOQA 1HHTP 3BSNA 4DV6J 1U47A 3W5YA 2V4RA 1JLQB 4URQU 4PKDB 3P6YC 2V63A 5KFPA 5JJBA 1DHMA 5L39A 4ZCKA 2KZZA 2OEMA 5E7OB 2B7CB 4N41A 2B4UA 1JLFB 1NDPA 4JI0F 4U67Q 4MJKA 2CFXA 2LDIA 2MQPA 1HBUA 1TKXB 1UW4A 2HK2A 3ONQA 2UU9J 2IY5B 2KYZA 1H2UX 4X4PA 1EETA 5KG4A 4OLOA 4MYTA 4CTAA 3SDEA 4CT9A 4HI2A 1OY6A 3R7NB 4FPIA 3PR4A 2DR9A 2RQ4A 4Q8FA 5GMDA 2LA6A 4O0NA 1RWOB 2A2CA 1WOPA 2XS7A 1WOOA 4DX7A 3TZXA 1SJ1A 4AYBD 4U7UK 3MD1A 3BO4A 4DQSA 3VCDA 4UOCA 4Q43A 2DNNA 2EK6A 2EKYA 4LBIA 3UD5A 4UOHA 3DLKB 1S57A 3UD3P 1TP7A 3MM9A 4DR5J 3GIIA 3CJ5A 2Q43A 3DLBA 5DRKA 5DGBA 3PJXA 5ETTA 2MZJA 3DKDA 3HZEA 3IG1B 3HT3A 3RB0A 1WF0A 5H9EK 3ZTRA 5M2UA 2JC1A 4HT7A 5E3AA 1JLBA 1JJCB 3R6LB 1RHRB 1C4CA 1RAHB 2R8KA 1HNVB 2BJEA 4RWWA 2HNZA 1Y7PA 3PKYA 3MEGA 2BE2A 3TWZA 1REVA 1RT5B 3VQTA 2VASA 2PEBA 3PFEA 1TU0B 4JI2J 2XG8A 4IRCA 2XBPA 3HF5A 2AW0A 5B0FA 5A8KA 4MK7A 4DR3J 3I5AA 3NXZA 2F4VJ 4RX6A 2NXCA 4J9SA 1YJTA 3MM6B 3VGUA 3R3TA 5CH7B 3MM5B 2KYXA 4ZVRB 2AJQA 2LXUA 3BSCA 2XY5A 3DU5A 1R0CB 3HSDA 3R5AA 3KUHA 4HACB 4YN3B 1VIOA 1JKHB 1ELOA 1UVLA 2OIHA 3A8KA 3VGTA 4DLGA 1FRMA 1UEUA 3WQPA 2UUCF 1KTQA 3KK1B 1CULB 1RTJA 3RG6A 3B4DA 1HFEL 4DMZA 5CYMB 1MWQA 3RBXA 3FJ2A 5J1EA 3Q2SC 2ZBIA 1AB8A 1SCJB 2CAJA 2W25A 3CMQA 2M3DA 2AJ2A 3PZPA 1XERA 4QIWD 4ECXA 1V5IB 2VKZG 5CYQA 2DO0A 1NJIT 3R7BB 1S79A 4DZDA 2WONA 4NZ6A 4K4VA 2GZOA 4CO3A 5DS7A 4ANEA 3NGKA 5IQQA 1VQ7S 4TU8A 1ZOTA 4URGA 2W4PA 3MM7A 1GMUA 4WPAA 4AQYJ 2WB4A 4Y34A 2RD5C 1FTRA 3VZHA 1KLMA 2ZD1A 3O5TB 2DRDA 1LV5A 2XZTB 3KNAA 2L9NA 1Q78A 1W26A 2XLKA 4FYYB 2PD1A 2BRLA 2F3JA 3CCMS 3C66A 3KWMA 4V19J 2Z2YB 2Y1JA 2FYXA 1UWAA 2HHTA 1RI7A 1UPPA 3B4MA 4WP3A 4I7FB 4ZJLA 1QVGR 4C0OC 2Q66A 3RBZA 4WCEQ 3BR8A 1H72C 2H48B 1TTHB 2IJFA 4MIAA 3I82A 1S1UB 2O67A 2GGPB 4P2XA 2BXJA 2V2QA 4DUTA 2Z57B 4DSJA 1NDKA 4PXBA 3EPIA 5F3ZA 4LR9A 1AUSL 2XC9A 1Q5VA 3ZZTA 2QA4G 4WP8A 2QL7B 3MAQA 3RAMA 3C6UB 1HNZJ 3IGNA 2ZKTA 2DNZA 3SBMA 5DDQC 5IT9U 3EICA 2MKKA 2FVQA 3K5NA 3MR5A 1SIZA 3GG1A 1NJZA 1Q16B 1SC6A 5C2CA 4L3KA 4DCJB 2KM8B 1GQEA 1VCTA 1RYRA 4XDCA 1HWKA 2XI2A 1HD1A 3EDQB 2DNMA 3KLFA 1X8DA 2R7XA 4XDDA 2MGZA 4LBPA 2HLTA 4CLFA 2QRRA 3PR5B 1UWBA 2BOPA 3HXMA 1WKKA 3CO0P 1HWJA 3MR2A 1IBKF 2CQ3A 4YY3F 2KL8A 2XMUA 2V50A 3TEGA 1HIYA 1FDAA 5KFJA 1LWEA 5F0WA 3QSIA 3BSAA 1D09B 1IR0A 4FYXB 2IYIA 1QM9A 4ZPVR 4CRJA 1ZM4A 3AA9A 1PKUA 1HMVA 2IC3A 5BYRA 3TAMB 4DL0C 1MMLA 2J9EA 4KAIA 2CPDA 5HN0A 2R2TA 2H5IB 1T0TV 2RRBA 1NSKL 3DOLB 2KI2A 5HK4A 4ZS6A 3MGJA 2R8JA 3BKUA 5HL7Q 1LK7A 1S6PB 1HHQA 1JWWA 1S7HA 2K1RA 3RW7A 4KY3A 1CS4B 4NLSA 4B08A 2LP4A 1RTHA 1K44A 1EQMA 2YQ1A 4U96A 3KDOA 4L6V3 4FPRA 1R3NA 2NCKL 3FFIB 4MIWA 3U1NA 1V3RA 4DX8H 3TZYA 1UPMB 3TI0A 2Z4PA 3QYYA 2HRUA 1T9VA 2HHQA 2EI5A 2BANA 3D0GE 3IR5B 3BS9A 2RDDA 4NYOA 3TQEA 3G6YA 3PIPQ 3FQLA 1ZTTA 3RW6A 2BABA 1FEEA 2ZBRA 1HPZA 4KRWA 3ILOA 5D0RA 4LRDA 1FXRA 5D15A 2J9DE 4F0MA 2M9KA 4YB5A 3BQ0A 1FKOB 2XWYA 3ZZYA 2CADA 4C8OA 3IWXA 4KC5A 2M8DB 2RU3A 1BGXT 3IC1A 4C9DA 2V68A 3W62A 2V8GA 2H3EB 1GFWB 4K5RA 1F9FA 2IDEA 2R7QA 2XCAA 2NS1B 1RAAB 2JVRA 3I0SA 3W2VA 1AUDA 2CPXA 1A6LA 5C2GA 1FK9B 2ALZA 1Y11A 4JYAF 2R42A 3GTYX 2XMAA 2HNYA 1RLDA 3HHLC 2VB6A 1LWFA 1RTIA 4CO4A 3PW7A 5DJBA 4RJVA 2RMLA 3CJ3A 4DCOB 4PEOA 5A2QU 2NYHA 2HQ3A 2RRNA 3OFGA 5EHHA 4QWBA 4U95A 2LYVA 3PNIA 2FQQB 5GADU 2VDHA 4HVZA 6FD1A 1VYAA 2DJWA 4BWJA 3PJWA 4K59A 2ADBA 1Y5NB 2E5IA 4RBVA 2E44A 3MECA 4OV1A 4NOHA 1TR0A 2QLJB 4KT0C 4AD6A 2P9CA 4I6YA 1FF2A 4WK3A 2LMIA 2UP1A 1Q8KA 4XPCA 3WC0A 2JL9A 5HQLA 3KLEA 1FTCA 2EWHA 5DDRC 3NKYA 3W1YC 2R4FA 5KG3A 2XTJP 1OY9A 1VQPS 4PR6A 4YR0A 1WHXA 5CYJA 2YY3A 4X66F 3PRVA 2UV8A 3AB2B 3BBFA 2K7KA 2IM1A 5KFSA 5IWAF 1N5YA 3MXHP 4RW7B 4M8LA 5C42A 3EDRB 2M70A 3CJKA 3EXYA 4LF5J 4A8QA 3ET6B 1YJ9S 1U24A 4NZ7A 2DCUB 2HURA 2AF6A 2MZTA 3H5SA 5AJ3F 4KHRA 4ECYA 3FC9A 4BC9A 4ED2A 2IBKA 4I4BA 1G2EA 3GE9A 1RE1B 3M6WA 2HIQA 2AV5A 1LW0A 1IKXA 1BXNA 4NCBA 3KJVB 4N56A 4WKYA 1TL7B 1D0EA 3LP2A 1Q79A 4IOBA 3CCUS 1SXLA 2XYHB 5FJ4A 4JOUA 2JH3A 2GIFA 3CGIA 2Z30B 2GJIA 5I3QA 3C16A 3W2WA 1YSJA 3KDNA 1TK5A 1X9SA 3DOKB 2SXLA 2JFKA 1NSAA 3GIJA 2DHGA 3CPWR 4UQTA 4OI4A 1IBLF 2RRAA 1Y3KA 3TUJC 5ETVA 5F9NA 3H0PA 2RB7A 2HKEA 1CC8A 4JV5F 3RYLA 5ITHA 1KKHA 2GS8A 1RT4A 7FDRA 3QATA 2FB0A 4AUKA 1QAIA 2YKNA 3A1YG 1TV6B 4M5JA 2QSFA 2X1AA 3C2PA 4DF8A 5KTQA 2DNHA 1RBAA 2FPHX 3P3DA 4RNHA 1JK9B 2HS0A 2MLZA 1Z2LA 1YDLA 3IFEA 1VK8A 3U02A 4ATNA 1JNZB 3DRPA 1V5VA 1H0HB 1S1VB 1JLGB 2AJFE 3NS6A 1PIEA 4WIIA 2E5HA 3DLJA 3H90A 1E6YA 1Q8LA 3R5JB 1U1QA 3EGZA 4KQZA 1JJ4A 1VQ5S 3QIPA 1I3OB 1SC1B 2G1DA 4A4JA 3KG4A 3OFFA 2ERRA 4IG0A 4NLUA 4LVNP 4J9RA 3A8EA 2DGOA 1Q53A 1U0SA 1U09A 3IWNC 4ICLA 4Y2MA 2GAGC 2BQUA 3BGFA 1U1RA 1N5SA 2AEMA 1UJ6A 2B3TB 3ENQA 3I4HX 4F2SA 2ZOGA 4O44A 2VF3A 5GAGI 3JAMU 3I96A 2B51A 5L1LA 1RWNB 1Q7YT 4OZ3A 2QL9B 1IKVB 5IV3A 1EB0A 4I2QA 2LQ5A 2VG6A 3OJSA 1URNA 1G1XA 2R7RA 3HLUA 1VQ4S 3WX8A 1CQMA 4QYZK 3DRXA 2MKCA 1WG5A 4OYIA 4Y65A 5T7LB 5JMNA 3SQGB 2DHHA 4ZVTB 4PPDA 3MPUB 4NLTA 4RW6B 1RWXB 5ETKA 2BUNA 4IO9Q 3L9ZA 2UUBJ 3QAUA 1CQNA 3MAHA 1VQLS 2V9WA 1JLCA 3ZNJ1 2V2VA 4IDKB 1T11A 3AAWB 3KHGA 2FJXA 1NHVA 1S1WA 1JIHA 2F7VA 2IA0A 1VGYA 4DV7F 2UUCJ 1SJ3P 2XSJB 4CLKA 1XMOF 5HATA 2YX1A 1VQMS 2Q6BA 1RAJA 3L09A 1SC3B 1MMDA 1NPRA 1L3SA 2E1CA 3NEKA 3A3OB 5CD4H 3M8SA 1EZZB 4F26A 1T9WA 3BJYA 3M8YA 4LF1A 3VVTA 2BMBA 3TYTA 2C2DA 1YG0A 1SL2A 3GJRB 1IWGA 4CWBA 2RJZA 2CPIA 2CKWA 1JXEA 2CJAA 1Y4ZB 2HFVA 1IUJA 2DY9A 4WIQA 4G3IA 2NZCA 2H5EA 4NXMF 5HQ8A 1RWWB 2W7OA 1RJJA 2BQ3A 1VRTA 3KLHA 1B3TA 1MNEA 1YGYA 3TJ9A 2BR0A 1S97A 3UDCA 1F6TA 1VQYA 1K47A 2OO4A 4M5NA 3VV2B 5CCLA 2R8GA 2R9LA 1QY7A 3OTOF 3Q0AA 4OZLA 4B3MF 3AXMA 3JSMB 2EPIA 1X4CA 2HRYA 2HBQB 1HYSB 4LVOP 4NLXA 5KFEA 5B0GA 2L48A 2W9BB 3CVKA 3UW1A 3PYDA 1DRZA 4Z37A 3ULHA 1ROFA 1IQTA 4NLDA 1FKPA 3HJVA 4DG1A 4G1QB 3G6VA 2VKRA 3NWRA 4EYIB 4DL3A 5THWA 4MAKA 4W4MA 3CCQS 2Z56B 4OZJA 2NREA 2H5JB 4I56A 4X4VA 4NXNF 5AXMA 4LRBA 5A8RB 2RH3A 2VL1A 2RNEA 2YKAA 4P2SA 4HH0A 4YEAA 3GV5B 1MN7A 1S9GA 1LXNA 2DTJA 3SCLE 2F4FA 2CJBA 1SPBP 5AXLA 4TU9A 4Z2XA 4QBUA 1FI4A 3LP0A 2PA3A 2I5JB 4IFYB 2IM3A 1ZZNA 4DSLA 2ABYA 4K2JA 4JV0A 2CVIA 2OEJA 5KOXA 3N6MA 4B3SF 1S49A 1WTBA 4ZVSB 1IQZA 2QTWA 3HHEA 1IBKJ 2OPSA 3A8IA 4LF2A 2HMIB 2EBGA 4YY3J 1EAYC 1MSWD 1RT7A 3LOUA 3MHYA 3TNVA 4ZOSA 4KPCA 2QL5B 3HO1A 1H7WA 3QPIA 3D6MB 5FLXU 1QDUB 4KSEB 1ZA2B 2FZKB 1CEZA 2XNRA 3W9JA 2DISA 4RKUC 3VVUA 4ECZA 2CPHA 2OPQA 2KXNB 3EJMA 1RT2A 4DFJA 3Q86A 2LVWA 2CQGA 1WWHA 4ZIWA 2UVWA 2B8PA 3IS9A 1KEKA 1YJ7A 2FTRA 2DNPA 2UXDF 3Q8QB 1WC3A 4I2PB 1CVJA 5D4PA 4HHJA 3MPWA 3BN4A 3NNAA 5LMNF 3KMQA 1TL1B 3JSBA 3DLEA 2Y8WA 4WE1A 4RO0A 3W60A 5J2MB 4NYZA 2RF2B 2UXBJ 3Q8RB 1RKJA 4P7TA 1YITS 4USTA 2V5HG 4UT4A 4OYZA 3DYAA 3V6DA 3TUPA 3KKFA 1IBCB 4XIUA 2RILA 1TVRA 4OYBA 1HBOB 4NMXA 3EGVA 2EG1A 1U49A 3NMRA 3NCQA 1WTFA 4QIFA 3BEGB 1TL3A 1UEVA 4ZVHA 4AXJA 5H9FJ 3OFEA 3O6QA 3I5BA 1OSCA 3BDEA 1VLYA 5J2PA 3IBFB 2BW2A 5F8JA 4DXLA 1WC0A 3LWMA 2KRRA 2ASDA 1FWPA 4CO1A 5IT4A 3OW2R 1HW8A 5KFOA 1WSVA 1PJ6A 2YWGA 3C14A 2EFOA 1G6BA 1Z1ZA 4TYBA 3JQMA 3KUGA 3TVYA 2JRSA 3TEHB 4GMKA 1QUPA 2HPUA 2DH9A 3R5DA 2OHDA 2AX0A 1BC6A 4BLGA 4DCPB 4DPOA 1CJVB 2ZZNA 2FHOB 4JYAJ 2XM3A 4USKA 1IR1A 3V4IB 1GNKA 3QJJA 3DHXA 1K1SA 1U1PA 2O5DA 1S77D 4TYAA 1IJFB 1RISA 1SV5B 4IFVA 1R6YA 4QU6A 2YWFA 4ZPBA 1XC9A 1YVFA 5KFBA 3C15B 4ANDA 4B9MA 3GYXB 1C1BA 3EYZA 2KKHA 1S6OA 3D3CJ 3OVSA 3LPYA 2GVZB 3PG9A 3NNHA 3MTKA 1MROB 3VR1A 2D41A 3I87A 4P9SA 5HANA 4N77A 1TUVA 3X1LB 1E6VB 3RBDA 1ZYQA 4RUAA 3G8SA 4JBCA 5GMKa 4WU3A 1FJ7A 1FRKA 1ZH5A 3V2UC 4X4SA 2HBRB 3I56S 2DYAA 2COLA 2PMWA 3CT9A 4P7VA 3MCNA 5LMUF 4X66J 4WYWA 4OMFG 3BBBA 3US5A 2E5JA 5C25A 3OUYB 1WACA 2FZCB 3T5KA 4Q0BA 4CLWA 5IWAJ 3GSDA 4W92B 4DR1F 3HX9A 1RHUB 3DGPA 5HBMB 1ZS6A 3D68A 3UN2A 1D3WA 3KK2A 1K0VA 3DXBA 2EFPA 5C7PA 3NOGA 1SKSA 4DV3J 4ECWA 5E3QA 1S72S 4PXEA 4ETZA 1CJKA 1U26A 2DHSA 2CJ9A 2HS3A 1WSRA 2YBVA 4ZP6A 3EXCX 3UE2A 1T7PA 3MEEB 4YP3A 4QWDA 3U27A 2JX2A 1FFSB 1NPKA 1GEHA 3CJ8A 2ZITA 4YR2A 3F44A 2Z58B 3UN3A 4KGVB 4CYUB 5KFLA 3PO4A 1U0HB 3OHAA 4A8YA 1RHQB 4Y28C 2Z8QA 4B02A 1WDTA 3BSOA 2B9EA 2A6OA 4XPEA 3CUNA 2LFVA 2XSFA 1IBLJ 4DS5A 3G82B 1NJYA 3QRPA 4JV5J 1X60A 4OYXA 1JJ2R 3U1MA 1X0FA 2A6MA 1Q7LB 3UFCX 3W8PA 2MJNA 5DDOC 1X7VA 3DM2A 2HGMA 4ETXA 2AZ3A 1Q0NA 3WHIA 4LFBF 3FEZA 3W9HA 4RPFA 3CDUA 3HD1A 1ICEB 2DGWA 2CRLA 4ZMMA 2X3DA 3QGHA 2CA9A 2HZAA 1F3VA 2ZC3A 2M0GB 1HHSA 1TL1A 1PO6A 3GILA 3WC2A 1TQLA 4M5LA 2FY1A 2QT7A 3M05A 2DIUA 1N6QA 2F8MA 3GJSB 2XMKA 2NLWA 3H2UB 4OHYA 3E3XA 4LSNA 1IKYA 2GJ2A 1FJCA 1N34J 4UQGA 4NCAA 2HQGA 3HVTB 2KH9A 2C2ZB 3AH6A 2UUTA 2WBRA 1K8AT 2ZUAA 2VFUA 4DSFA 4ZJQA 3THPA 2H4YB 4MTPA 3GIKA 4P52A 1BWVA 4JV1A 3OTEA 3P45B 2ZH6A 3NBPB 3UPFA 4CO5A 2R7OA 5KFNA 4F3MA 2E7VA 5HSPA 3J81U 3FBBA 3IRXB 2O66A 3J80U 2C2OB 1RCOB 4QOTA 3QT6A 2Y1RI 5IC4B 1MLAA 3OL8A 1S1XB 1WC1A 3C6TA 2Y1LB 1VJQA 5D4NA 5IFMA 4H4MA 8RUCA 2I8EA 3PJ9A 2YH1A 2PN6A 4FBUA 4DV7J 2RDIA 3QNWB 1S0OA 2FJAB 2XZWA 1S12A 5A0YB 5KFYA 1XMOJ 5HLFB 5I3UB 5GADI 2I1RA 5KT6A 3D2WA 2B6AA 4C8ZA 2M2BA 1OYEA 3QLHA 3D3BJ 2YNHB 2XWXA 5KT2A 3T5JA 1DY3A 2DNYA 3MWBA 3NGTA 3M30A 2QFJA 4I69A 2MDAA 1GX5A 4J9QA 2NPFA 2OGUA 1G7CB 3HHLB 3HFKA 2CQ2A 2AGPA 2ZZTA 1PC4A 2F8HA 4NXMJ 1I5OB 2N4DA 4X65F 3V6KA 2ZM6F 4IRKA 2RHSB 3SZ2A 2EFQA 1M5HA 2E1AA 4WXWA 1Q82T 2ZVIA 1NK4A 2ATLA 1U2CA 3OTOJ 2CQ0A 3PW2A 4LRAA 5IZHA 3OV7A 3LH2S 2HFOA 4ALZA 1RBOB 2WTFA 1NK5A 1Z2ZA 1JLAB 3ZZZA 2QMXA 1RP5A 2F65A 1QSLA 3AJ2A 4DQRA 1U7LA 2G2ZA 4ZVUB 5F0UA 4C11B 1FE0A 4NLVA 2KDOA 4RUHA 2FDNA 2QO3A 2ZNZA 3SCKE 2LQBA 4HI1A 2KJWA 4Z7CA 3LGNA 4EMDA 3Q8PB 2BJ8A 1I94J 1WC4A 1VC6A 4KGZB 1DFDA 3RR7A 4Y2AA 3OTBA 4N47A 4Q8EA 2VFVA 4NXNJ 4ZVEA 2BBEA 3F41A 5GAHI 3EVWA 2L9WA 2G13A 5LXYA 3G9CA 2QG9B 5IT9Y 2ALYB 4FBTA 1RWMB 3MEEA 8ATCB 1R0AB 4DEZA 4KHPF 4OJGA 2YNIB 3S8SA 5B0AA 1UAWA 3PYFA 2W7AA 3M9NB 2MYFA 3IBCB 4ID5A 3M2UA 3CF5Q 4DV5F 1N4LA 4CDIA 4DQIA 3K7RA 3RU0A 4C97A 2HEKA 2MTLA 3N5FA 4B3SJ 5HP1A 4EFAC 4U8VA 4DPYA 2MKIA 4FZVA 4KYZA 2AU0A 2DB1A 2H65B 2JHEA 2HZCA 4OI3A 1KOHA 1PYOB 1VRUB 1PYTA 1HI1A 3KYLA 3J81j 3IBWA 1HQ2A 1DLOA 1CG2A 5CHCB 2NPIA 5LSLA 1PGZA 4FN5A 5ETRA 4J9KA 2VODA 4EWTA 3ISZA 1YJWS 3H20A 2P6SA 2RS2A 4EEYA 1UL3A 3M8RA 5DG8A 3L95X 2UXDJ 1Y3JA 1GTEA 4QW9A 2OPRB 1SIWB 1KONA 3QZ8A 1S9EA 5HAOA 3UCZP 3CMAS 1C1CB 4WFYA 5LMNJ 3VGVA 1DURA 2W2QP 2RVJA 3D7SB 3QMQA 3NMAA 2HNDA 1OIAA 2ZVSA 5C24A 3UD4P 2MKHA 2VG5A 5AE2A 1RT1B 2J5AA 3UDLA 3OXGA 5A76A 2F1FA 3ZXWA 1C0UB 1OSDA 1HKAA 2QSWA 4RW9A 5HVHA 1GMWD 5KT7A 5KFUA 2HFSA 2IM0A 5F8HA 3FBEA 2DR5A 2JDJA 1Q95G 3ISNC 1X0PA 4LT6A 3J7YI 5KFCA 4I1TA 1KQKA 4NYPA 2BEFA 4DU8A 3OR1B 2OPPB 5HMWA 1W2BR 3R2CJ 4FVCA 4LF9J 3QO9A 4EZ6A 4PUOA 5L1KA 1NKEA 4ZP8A 1H98A 4PYAA 4O4GA 1PBAA 4IR1A 1MN9A 4FF3A 2CDQA 4K4YA 1T9YA 2HBZB 2W2NP 4CNZA 4LF6F 1U6FA 1P27B 3ZZ0A 1JNRB 2NXEA 3E51A 1LOUA 1GX6A 1RT3B 2VFRA 2IRUA 4ZPDA 1WOSA 3HK2A 3NP5A 1DQAA 3R1LA 5K8PA 2DITA 4LFCF 2BJ9A 4QWCA 2XYPB 1X5SA 5DG9A 3K57A 3MM8B 3N4WA 1RTZA 5F8LA 3CCLS 2PFFB 4DR7F 2HYIB 3GMGA 5B08A 5GVQA 3ISND 4Y6IA 1YZ6A 3DI6B 2ZHOA 4DQPA 1T3OA 4GKJJ 3ZZRA 4ELTA 2VICA 1UETA 2VOPA 2JFDA 5A2QY 4LSLB 4CLZA 4F0KA 2CVEA 2ZJQQ 1WG1A 4C0HA 4F4XA 2WVBA 1HD0A 2I6WA 5BXIA 1F2GA 4FXVA 1VDHA 2YNFA 2CG4A 3GONA 5C5JA 3UO0A 2GAHC 1IKWA 2GQ2A 1FERA 5KAKA 3T9NA 4B9TA 1CJTA 1HBUB 3QGIA 1KTVA 4PG5A 3EPGA 4EO6A 2XNQA 3J7A1 3GFYA 4EBDA 2FY8A 5ETSA 3UCGA 4ZP9A 1WC5A 2BRKA 5LMUJ 5BR8F 3K0JA 1EETB 2OELA 4CTAB 2F9JA 4P2MA 3SDEB 1EP4A 2BM0A 4M95A 5EGYA 2OTLS 2L08A 3CJ2A 5CCMA 1EKRA 1T94A 4OZ0A 1N0UA 1HBMA 2JC0A 4M5IA 4DR1J 1YRXA 2XI3A 4O3SA 4KJIA 2GO8A 1N5TA 4WK1A 1YJVA 2HQDA 3DN9A 4FYDA 4JI3F 2W4DA 4DL5A 4H4KA 3MM9B 3ZZUA 1T03A 3DRYA 1U25A 1Q1KA 4UOGA 3K2YA 4IO1A 2LEAA 4MFBA 3DOMA 3EMTA 4KFBA 4N8OA 4B17A 3D9BA 2Y8YA 1JMTA 5T14A 3MUMP 2CWKA 4FXWA 1TAUA 1DTTA 1JLBB 2QJ3A 2RQCA 3S01A 1K73T 1PAEX 5LL6d 5L9XA 3CCVS 4LF7F 2DEIA 4ZJOA 3C3LA 3D1QA 2LXFA 2ZDOA 4D3GA 5FD1A 3VZIA 1S1TA 1N32F 4K4ZA 3DU6A 2E5GA 1UVIA 4USIA 3G86A 2AZ1A 9RUBA 1V6HA 2HNZB 3CD5A 1V9OA 1VISA 3MEGB 2XS5A 4L73A 3H5YA 2BE2B 3SCIE 1REVB 3OSPA 2KVQE 1DZ5A 3CE8A 4LFAJ 2OAUA 4C2MA 1FNMA 3FMWA 1UVJA 1KR4A 2DH7A 4ED6A 3EVMA 3O1LA 2L3MA 3GPAA 2QV6A 5LXRA 5A8KB 1X5PA 1OY8A 3IXQA 1R27B 3CD6S 2OTJS 1KP6A 5D4OA 5F3TA 1CJUA 1KOOA 2G0JA 4LFBJ 2J8SA 2CZ9A 4UF4A 1ZM2A 2YNGA 1YJRA 4OI0A 2GW8A 5AE3A 2LQJA 1OQ3A 2YKQA 3D6FB 2HQFA 2N3LA 2D3O1 3HSJA 2DK2A 2LU2A 2WHOA 1R8CA 3L7OA 4UUXA 2VC1A 3ILIA 1BQXA 1UP1A 2V8VA 5F8NA 1TZ0A 4OZNA 3PV8A 2N7YA 3CDWA 1NK6A 3D54A 1RTJB 4ZVQB 4DLEA 3M32A 3P5BP 2N7CA 4QR0A 2XLJA 3Q8UA 5RUBA 2IAJA 4JI7F 5J1EB 1XR6A 3MURP 3MEDB 4NLOA 3VHQA 4F7VA 2FJWA 1ZBTA 2IHR1 4YR3A 2ASJA 2YX4A 4CLPA 3RTVA 4QZVB 1KVIA 2C2NA 4M5DA 1QAYA 2CQ1A 5CYQB 1OJ4A 1WI8A 2WONB 2VU5A 4OV6A 5SUHA 5MLCV 2CG8A 2R7UA 3JTOA 4KTQA 1OS5A 2AJ4A 3HSZA 1TKZA 3DFEA 2OPPA 1DAXA 3MM7B 3U1LA 3M8QA 3JAMY 4U7CA 3DHWC 3ETMA 4NA2A 5D0HA 3QIDA 1RQ0A 1X4GA 1KLMB 2ZD1B 4QPXA 4RBUA 1S9FA 2IVYA 3A3PB 3R97A 2CJYB 2CYYA 2DNKA 4K0KF 2H1YA 1TK8A 2LQ8A 1NJWA 2E9TA 1C2PA 3AD7C 5EWGA 1B70B 4F04B 1DTQA 5EDWA 3J7ZT 3HVWA 3KHLA 3B82A 4KKOA 4R25A 4ZPWR 2MLXA 4ECQA 2P9GA 4HR2A 3GJTB 2CZ4A 2DNOA 9ATCB 1RU2A 2ILZA 4R0EA 3K8VA 1RTDA 4JB8B 4DPTA 4N7TA 1I51B 3LPEA 4CM0A 3N5BA 3SYZA 1UVKA 5CAAA 5KFAA 3MR6A 3VWSA 1RUSA 4DX6A 2OSRA 1M1GA 2G1HA 4XAKA 2QLXA 4HTIA 1R6VA 3GWCA 1VHFA 3CJRA 1WHYA 5LM7E 2B0GA 2DR8A 4X65J 3RAXA 2ZM6J 2GV1A 2X3GA 3L4BC 4O3PA 2Z2ZA 4ER8A 3AOCA 3KLFB 5ETQA 1NM2A 2MGZB 1L3VA 1CPZA 3I31A 1MMNA 3KHHA 5DGAA 3NLCA 1UWBB 1RAGB 3GU0A 3VAMA 2JNJA 2EG2A 5B09A 3UDEA 1IVZA 2OUGA 1YX2A 2G0CA 4P75A 2ROGA 3NOCA 2FHKA 2KHCA 5DM6Q 1LWEB 2I9SA 3HHDA 2QYCA 1XWLA 1NHUA 4NLGA 2E1MC 2HQIA 4NASA 4UZCA 5JVHQ 4N5SA 2YWKA 2ZHBA 2YQ0A 1MU2A 3F0NA 2HAFA 3CJ0A 4CH7A 1HMVB 4U7UD 2A3JA 2IC3B 3MOJB 1PJ7A 3TUIC 3MF5A 3IMQJ 2ZBQA 1XMQF 1FVQA 3EGWB 2FHMA 1ZTWA 1XR7A 4BC7A 2G0IA 3CMES 1WKLA 1NKBA 1SJ4P 4FNHA 4O4RA 4A8XA 1GT8A 1G3OA 4KHPJ 1N88A 3VAGA 1P8GA 4PAAA 2V4JA 2ZH2A 3H5XA 2V2KA 3HVAA 1Q8IA 2K1RB 4DV5J 4D3HA 3MUVP 2AJ0A 4K5SA 3PACA 1RTHB 5KFWA 4PQUA 3T1HF 3FQKA 3LO3A 1RZMA 2W2OP 4USUA 3OXFA 5K14A 1S0MA 3KFWX 3M8PA 1S76D 1VK3A 1FRJA 3KHRA 3TX0A 4DUYF 2CPJA 5DZ7A
chains in the Genus database with same CATH topology
3BGRA 2BANB 1D1UA 1MSWD 4TLQA 1RT7A 3LOUA 3MHYA 4RLEA 4ZOSA 3TNVA 4C11A 3HO1A 3PIOQ 4I7FA 1H7WA 3QPIA 2X51A 4BWMA 4DV1F 4DN9A 2HLUA 2BJDA 2MJUA 2J7KA 4PG6A 3QO9B 3CD0A 2FHJD 1IM4A 3PHEA 1CSJA 1NK0A 1Y9OA 4GO7X 4H4OA 5G4DA 4PUOB 2JZ5A 1QE1B 4KSEB 2AQ4A 3KMSA 2DGTA 2E29A 1R8AA 1CEZA 5T41A 4C3LA 4C8LA 1FKAF 2XNRA 1HPZB 1S1UA 1S99A 2DISA 4CQ1A 4RKUC 4A48A 4FNIA 2GGPA 2IMOA 4C3MA 7FD1A 3CCES 4ECZA 2KRBA 2CPHA 2LEBA 2VA2A 3LAMA 3HHLD 1WF1A 3FRZA 4O4GB 2OPQA 3MZIA 1KVJA 1NEEA 3H4DA 2KXNB 3KOAA 1MWYA 1F5CA 2XMJA 1RT2A 4KB7A 1U1OA 5KG5A 5DO2A 4DFJA 4TNOA 3TUZC 1XEZA 2QA1A 2JSXA 4F8RA 4PQAA 4F4KA 2LVWA 1IQTA 3TOQA 2CQGA 4EGLA 3I6PA 4WFXA 1WWHA 1X9MA 4MKYA 4X4QA 2AJ1A 5J2NA 2E9RX 5HROB 2UVWA 3C6UA 3IS9A 1KEKA 1ULRA 2XMMA 4QPTA 1N52B 2FTRA 2DNPA 2XY7A 3UCUP 3Q8QB 2UXDF 3OFHA 2DR7A 4KE5A 4I2PB 2KFNA 2LLZA 1CVJA 4KBIA 5D4PA 4HHJA 4NMLA 4DV3F 1SUQA 3MPWA 1T05B 3BN4A 4LQ3A 5L9NA 3VTIA 3I0RA 4IH7A 5A6PA 2GC8A 3V81B 3NNAA 3JYTA 3BGUA 1R0AA 4B3TF 3I0SB 4DF4A 5LMNF 2MZRA 3W2VB 3KMQA 3TO8A 2YNIA 4U6PA 1TL1B 2ZUGA 2BV3A 3JSBA 1X4AA 3Q8SB 2ZH1A 3MEDA 1UA0A 1VIXA 1SL1A 3CTRA 1SJFA 3DLEA 2BM1A 4K4WA 4WE1A 5J2MB 4NYZA 1BWEA 4LMZA 4K4XA 2VBWA 2XGQA 2RF2B 4C7QA 3EZ5A 4A8FA 3CEDA 3Q8RB 1RKJA 4OHVA 2ZH4A 3GFXA 4ES3A 2VOOA 1WEYA 2HNYB 3SFGA 5KFQA 2HW3A 4F50A 1Y5LB 3BDPA 2LXIA 4P7TA 5U47A 5J2QB 2AYBA 3CDAA 5KFVA 1YITS 5LJ5Y 2VPXB 1LWFB 2B4OA 1RTIB 2KTQA 1J2VA 1UJ5A 2V5HG 3EGNA 2YX7A 3CCRS 4PWUA 2QE5A 3MMCB 3DYAA 2MSSA 4FF1A 3V6DA 3CWJA 3MUTP 2NZ4A 2VZ9A 4USJC 5GAHU 4JI4F 3ZFVA 3FZBA 3Q2TC 3QWUA 3KKFA 2BDPA 1JX4A 1B0TA 3T5HA 2OMOA 4RNOA 3MMBB 3IR7B 3PX0A 3N01A 3O2IA 1VRUA 3HI9A 4XIUA 2RILA 1GXUA 1YQHA 1H6KX 1TVRA 4HL9A 1HBOB 1N8RT 4PWDB 4QR1A 2EG1A 1U49A 3NMRA 2FC8A 3NCQA 1WTFA 4GC7A 4QIFA 1PC5A 5F8MA 2J76E 2IVFB 3BEGB 1TL3A 1UEVA 1F0XA 2B4VA 5D3GB 3H25A 1ZAXA 2YNFB 1UJ4A 4ZVHA 4AXJA 1SKWA 2LEPA 3IN5A 1SBRA 5H9FJ 5B0DA 3OFEA 5L8RC 4YDDB 3MR3A 1VS3A 1XMBA 4KGMA 1R31A 2XHWA 3O6QA 3TRGA 1FHTA 3HVRA 2Y0SD 1IKWB 2DHAA 3I5BA 4L3NA 5KFDA 3SI8A 3MECB 1OSCA 1NK7A 3BDEA 3OHBA 4ECUA 4YB6A 1VLYA 4I6WA 5J2PA 3VAJA 3UR0A 1NRKA 2BW2A 2VPWB 3THTA 5F8JA 4C3KA 4X62F 3LWMA 3B8HA 1J5OA 2KRRA 2B9YA 5KG1A 1HWLA 2FJEB 2ASDA 3KLEB 1QVFR 5F8GA 4CO1A 1W25A 1LFWA 4QYRA 2QLWA 3FMBA 5IT4A 2C2RA 3OW2R 3TAMA 4BS2A 2MQOA 2OLWA 2MQNA 1HW8A 4ZP7A 5KFMA 1YBAA 5KFOA 1Q4RA 2GQQA 1FJEB 5KG7A 5F9LA 1VQOS 1VQNS 1HI8A 2YWGA 3JB9k 2DNQA 2FD2A 4ES1A 4O3RA 2EFOA 4ECVA 5HMYA 5H9EJ 2HG4A 2DNLA 1G6BA 1Z1ZA 2OPRA 3DOLA 4TYBA 4ILMA 2D3UA 3SV4A 4I68A 1LFPA 3NAIA 4KR0B 5K9FA 4IOAQ 1VQ8S 4ELVA 1EP4B 1C1CA 3TVYA 2JRSA 1N33F 4ED3A 3M6XA 4OI6A 4R8UA 4PXDA 4ZVGA 3BO2A 1T3NA 2FVSA 4YOEA 1H3DA 2RS8A 4GMKA 4TY8A 1QUPA 2HPUA 1BQMB 3GR1A 1SKRA 2DH9A 3R5DA 2AX0A 1HBMB 4DL6A 3R27A 5KOWA 1S6PA 3T3FA 1N5YB 2V8HA 4IUFA 1BC6A 1KQGB 3C46A 4DPOA 5LT5A 4W90B 4KGKA 5C42B 2E7XA 2ZZNA 1RT1A 2FHOB 4C0BA 3CJKB 5D77A 4WTYA 2IYGA 3V4IB 1GNKA 1HQEB 4RUCA 3QJJA 1BQNA 2HVHA 4ZCLA 1URRA 3DHXA 1WHVA 4F4YA 1U6BA 1C0UA 1K1SA 2EVZA 1U1PA 2XMVA 2VUGA 3PFOA 2O5DA 1S77D 4TYAA 4J9PA 1IJFB 4OZ5A 2AGQA 4CO2A 1YHQS 1KD1T 4J9NA 1RISA 1SV5B 2D7SA 4IFVA 3CC4S 2R7VA 1R6YA 1T03B 2ASLA 4QU6A 4A8OA 2LQ9A 2YWFA 2KJVA 4ZPBA 3FFIA 1XC9A 1YVFA 3H98A 4DV4F 2CPEA 4A8SA 1D8ZA 1N34F 5KFBA 1FNOA 2F40A 5CXTA 2PI4A 1GXLA 2C3UA 3GYXB 4B9MA 4MFBB 4A8MP 1U1LA 1SH3A 4ED0A 1C1BA 4KFBB 4HEA9 3EYZA 2KKHA 2X1FA 1S6OA 3M1VB 3I32A 3BF4A 3DRRA 2OD6A 3OVSA 1VI7A 3LPYA 3PRDA 4BHQA 4MH8A 5FDLB 2GHVC 4MK9A 5EUHA 3K8WA 3NNHA 2V9KA 3PM9A 2E1RA 1DTTB 3TQ1A 2L9DA 3MTKA 3OR1A 2KB2A 2ZZMA 4ZHRB 3OXLA 1MROB 4JI5F 5BYSA 4NRTA 3VR1A 1D9AA 4TQRA 1VC0A 2D41A 1LW0B 3I87A 3LF0A 1IKXB 1HWUA 5B7WA 3HZGA 2YH0A 4O0IA 5L1JA 3RZAA 1NO8A 4X84A 5E0OA 1RKIA 1VQ6S 5DLFA 1S1TB 3SV3A 4M94A 4N77A 1T02A 2GHWA 3LP2B 4EU0A 1TUVA 3HP6A 2CQBA 1E6VB 3RBDA 1ZYQA 3X1LB 2O01C 2ZKUA 2DNGA 4RUAA 3G8SA 4DFPA 1Q86T 4JBCA 4B9LA 1IN0A 1X4BA 4R5PB 5GMKa 3NL0A 4WU3A 1F60B 2VFTA 3V5RA 1FJ7A 2F4VF 1FKOA 3HJFA 1FRKA 2W24A 2DD8S 4RW4A 2POKA 4YB7A 3V2UC 1ZH5A 2CZVC 3PW5A 4X4SA 2GQCA 3I56S 4F3OA 2COLA 2CQPA 1VMBA 2LU1A 1RT3A 4ZDNA 3W2WB 4C4WA 3CT9A 4KIAA 4QIGA 5D6GA 2DGUA 2FJDB 4P7VA 5LMUF 3CCZA 2PE8A 3J7YU 5KFTA 4WYWA 4ED1A 4OMFG 3ZZOA 3US5A 2E5JA 3MMAA 5C25A 3OUYB 4DL2A 1B64A 1WACA 3T5KA 4Y2CA 2UV8G 3BO3A 3LUYA 4Q0BA 4OIXA 3JSRA 1MW7A 1A9NB 2Y1IA 3T9ZA 1VQKS 2NYIA 2IA6A 2FGOA 3GSDA 1ZM9A 2APOA 2OMLA 3AY0A 4I64A 3MM8A 4DR1F 4W92B 3ITHB 3HX9A 4C8YA 1FK9A 3DGPA 5HBMB 2WB1D 1IXKA 2IFXA 5M2PA 1RT4B 3I55S 1D3WA 2IBOA 2KT5A 3BR9A 2RUGA 1LW2A 3KK2A 1K0VA 3DXBA 2EFPA 3IO1A 2HS4A 2YKNB 1KC8T 5GAEU 2CIMA 4CCHA 3CULA 3DI6A 1APSA 1SKSA 5J1NA 2YNGB 2GIRA 4HDGA 3V6JA 2P6TA 4ECWA 5E3QA