2X1OA

Gelsolin nanobody
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
120
structure length
120
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAAAGRNLRMYRMGWFRQAPGKEREFVGTMVWSSDTIYYADSVKGRFIISRDNAKNTVYLQMNSLKPEDTAVYYCAAGAGWAGTMTDYNYWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Llama-Derived Gelsolin Single-Domain Antibody Blocks Gelsolin-G-Actin Interaction.
pubmed doi rcsb
source organism Lama glama
molecule tags Contractile protein
molecule keywords GELSOLIN NANOBODY
total genus 30
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1oA00
5F70A 4YHYC 2DQUH 1KV3A 5EC1B 2ICWJ 1ZANL 4M02A 1MJUL 3E6FB 4JFZL 4Y19B 1CYGA 1EEUA 1TXKA 4WDIA 5BO1H 4XBPA 5E8OB 5FYKH 5DRXA 2F5AL 2IBZX 1AGFA 3OZ9L 2AJVH 2RFXB 2V2TB 5EOTB 4HIXL 4O02L 1IEAB 2DQUL 4JFOA 4WCYH 3QUXC 5GGVL 5E1AB 4U7SA 1YECL 5E5UB 5LWYL 4YHKL 1N4XL 2VIRB 2CXGA 3L3GB 5FM5O 3VDAA 4GG6F 4KXZH 4HUWB 4Y4FB 4S0SD 1I9RH 4PBXA 1BWMA 3WD5L 4L9LB 2OBGA 4HH9A 4QRUA 4PP1C 4F7MB 4AMKH 4YXLL 5E4IA 4I5BA 5D70H 3VXTB 3HZKB 3OPZH 1LEGA 3OB0H 2OMNA 5D5ME 3PL6C 4R4BA 5FKPA 1BECA 3WDIA 1JV5B 2HN7A 1KCVH 5EN2B 1MCHA 1DJSA 3KPNA 1MCRA 1MRFH 3TNNB 2JF1A 1CL7L 1KPVA 4L5FL 1A7OL 1RZGA 2VC2H 4JDTH 1R5WA 3UPCA 3CFCL 2VMFA 3GMOB 1BZ9B 4H0IA 3IETB 1QUNA 3SKNA 2P46B 2KKQA 4P2YA 4WO4C 3PQYD 4LCCB 3LSOA 4NM4H 1Q9KA 2D4DA 5F89B 5CJXC 4J12A 1I8IA 3ZHLA 5JORB 3K4ZA 1TZHB 3SPVB 2EYSA 2SEBA 4O2FA 3IT8D 3UJIL 3RWDA 4C56D 1T0MB 5IVNA 3W9DB 1I4FB 1P7QD 2PR4L 1FNGB 5J12B 3L7EA 4MB3A 1FIEA 4JZOA 4NPYB 1E4WL 2DQJL 3W81A 3BZEB 5J1SC 2HT2C 1JNLL 1KNOA 4U6YA 5J3HC 4AH2A 3GMNB 3EOAB 3GI9L 5D7IE 1S9VB 3T0WA 3SDDB 1X3DA 5D6DC 1CICC 1NGQL 2DI9A 3O4LA 1U92A 2VAAA 4D0BB 4HX1B 1J0IA 4N9GB 3PWLA 4IRJB 3SCMB 1W0VA 3MLWH 5C09D 1IT9L 1OY3B 1S9WB 4EOWL 3Q5OA 3Q3GB 4WGWB 1IC7H 5F9JA 5D7IA 2B7DT 3DETD 4XNZC 2XT1B 2A9NH 3QDMB 1NUGA 3RI5K 3L5JA 1CZ8H 3BQUB 3QNXA 3QDGE 1T66D 2UY7A 4ZUVB 3OBAA 3MLWL 1N7ML 1A14H 2VLKA 2JB5H 2FEDD 1NAMB 3NIFE 4X4ZA 2Z8RA 3MA9L 2RGSA 4LARH 3INUH 4HBQA 5GHWH 1T89A 3S5LG 1JUFA 2NLJB 2A9NL 2DLIA 1F3JB 1S8DB 1ORQB 3CX2A 3HNVL 2ENYA 3FB8A 4RMVA 3JBG7 1U3YA 2G5BB 4BFIA 1O7SA 3E1F1 3M8OH 1LO2H 2Y6SC 2DLGA 3BMVA 4MD5A 4FN0A 3QDAA 4LSUH 1WWBX 1JMXA 1JN6A 3SE4A 4YO0B 3QUYD 4CGTA 4EDXB 4JFED 3Q3GA 1U8MB 3TZVD 3UJIH 4OZGA 4JRYD 2LU3A 2J8UB 4X83A 3BEWB 2CGRH 1U3HB 4JFDD 3BUYB 5BO1L 1N59A 2DM2A 2HG5A 4MA8L 1O0VA 5I1HH 5IQ7L 5AYQA 3PWPB 1NGYA 3OGCA 4UILL 5CBEA 1FL6A 3CFBB 4ZNEE 5JPNB 4NNXB 4Z7OE 1AGCA 4K2UL 3TYFA 2BCKA 2NY7H 2X4UA 2J88L 2EKSB 3AS0A 3LHPL 4J6RL 4AIZB 4FA8A 2BJMH 2O26U 4U1HB 2CGRL 1ED3A 1MLCB 1IGFH 5DD3H 5DVKA 5JIKA 2DQFA 1P7QA 1IAII 2ZUUA 3V4VH 3ME0A 2G9HB 5F7UA 2NNAB 5LGJB 2ADGB 3G6JB 1SJVA 2R0WH 1BD2D 5HYJB 3C8DA 3G6AA 3OHXB 4ZUSB 4LOUC 3VFUB 4YO0A 3LN5B 4A6YH 5D1XA 1MWAH 5EU4B 1FQ9C 5SWQB 2X5PA 4JGJA 2RAMA 4LPVA 3CDGB 4MZ3A 2OMBA 3Q48A 5C0BB 3VXTA 4JFFD 4UNTA 1A4JB 5E0QA 5E70A 5IEKB 2K7QA 2HAZA 3KPMA 4OZIE 3I6KA 3MFGB 3UC0H 1KEGL 1IAMA 4N5UA 1GOHA 1WT5A 3NPZB 4WI5A 4NNXA 3SO3B 2HLFD 3MLTA 1DQLH 5JOFB 3JV0A 2OR7A 4KKAC 5I71C 4U1HA 5E94A 3LIZL 4OFPA 5IFAH 2Y7QA 5DJ0A 2X89A 4NBYB 5ID0B 5HHVH 1EFXB 3RWHA 5I1DB 5EDXA 1UWGL 5GZND 3ISWA 4U1JB 5H35B 2YK1H 2AV1A 2EICA 4PLJC 4U1SB 5C1MB 3HE7C 3NPSC 1Q0YL 1WZ1H 4PY8I 4FQXD 4JFXA 5EZJB 4RQQA 2W07A 4W4NA 3TZVC 5HHOB 5HDBF 3WL9B 1BP3B 4NRZB 5D2NB 2UWEA 1W0YT 4JKPL 5DD0L 2H6PB 1F4WH 4K7FB 4G6JH 5CJ8A 3SBWA 4O51A 1YC7A 2XOTA 2A6JA 1KIQA 2WINB 5KSVA 1TCMA 3ARFC 4FXGB 5JOPE 1KYOK 5DJ8B 3QIWA 4ZUUB 4LHUG 3CPLA 4WUUD 4KK5C 3HN3A 2XNAB 4WI3A 2ZSWB 3H42H 3N1MC 3GJFH 1UXWA 3L3JB 3VGDA 3FRUB 2VDPH 3QP3A 4R90H 4PYHA 1MNUL 4MCYA 4X9HA 1AP2A 4XXCA 1YNLL 1L7TH 5EORL 4KTDL 2D2OA 2RCSH 1R3IH 4NKMB 4BFEA 4MDIA 5IM7A 5D1QA 4L8DB 1ZVYA 2OJEA 4HSQA 2M1KA 3CXHJ 2NCMA 2MJWA 2QHRH 5CIPA 5D7LE 4JPVH 5FKAA 5FYKD 4R3SA 1LEKA 2UV3A 4I8DA 4YX2L 5GS1B 4F57H 4NO3A 4KVCH 1AGEB 5CJOH 1FL5A 5JHDA 1WIOA 2FDBP 1GOGA 4HXBL 1PQZB 2P1YA 2VXTL 1A1OB 1KBGH 3ZDXF 1IGYA 2FZ3A 3KPSB 2XN9B 2JB6B 4J8RB 4JFEE 3ARSA 4QYOB 1WBXA 1C16B 2ZNXA 3S88L 5C9JA 5L2KB 1BFTA 4Y2DC 3VGGA 4IIQB 3WIHL 3GRWA 5ALBL 3PL6B 3QIWB 4ZUUA 3QNZB 4PRIA 3U7YH 2BHUA 2FSEA 1RU9H 2NY1D 3TH4T 4KDWA 1J8HA 5T1LD 3LOWA 1QKZL 1NLDH 4FQXB 1CGYA 2Z35A 3IDUA 4JM2A 3RTQC 4EKXA 4F7EA 5JNYB 1DQML 1CI5A 5DS8A 3QIWC 2P5WB 3BH9A 3S6CA 3HC3L 1PDKA 1A6AB 3QUKA 1OB1B 1JVKA 1P6AB 4Z7WB 5INCB 4PJ8D 5I17B 3I6LE 4GW5B 1WUNT 1U8IA 3AY4C 4XP6H 4JRYA 3D85D 3BEWA 1NCAL 1RK0A 2W9EL 1OSPL 1FHGA 1U3HA 4OIBA 1H8OA 1PFCA 4FQQA 1P7KA 5TQ0L 4G6JL 4D0DA 2LVCA 4DGVL 1B4JH 4I4WB 1XGTB 4W68A 3HNSL 3EHBC 3KPSA 2LFGA 4QHLB 3MNVB 4UOJA 5E2VL 4PV9B 2AJ3B 3IJYB 2R0WL 1FNLA 1QLEL 4Y5VC 1Z5LB 3ARWA 1RIVL 4KY1H 4KAQL 1P7QB 3JTTB 1CLZL 4FZ8H 4U3XA 5LBSH 3RWIA 3TP4A 4TUJB 2XTJC 5CP7A 4NGHH 5C0DA 2NXYC 1RHHA 1N5AB 4RMQA 1XH3B 3ARED 4HWUA 2VZSA 3IJHA 3QQNA 3HA0A 3RVUC 1T3FA 3CDYA 4MXVF 4B7IA 1QTYT 3EYSL 4OFYD 1ADQL 1I1FB 3F62A 4NJ9H 3V6BR 2R29L 3H3PH 2J4WL 2B4CL 4P2OD 2R1YA 1X6NA 2PXYA 5IBLC 4NQCB 2H45A 4JQXC 1RZJH 3FHQA 5IP4A 2DLFH 2OLDA 1JBJA 5E2UL 3O2DH 3MFFB 1T2QH 1UGNA 2BMKB 3C8KB 3WCYA 4U7MA 5BS0A 3VXOA 1KJ2B 1TVBA 3FQXB 4PJIA 2BRRH 5I1IL 3MRIA 2QSTA 1NCWL 4AG4H 3OL2A 3O41B 4L1DA 3BEVA 3B9DA 4FFVC 1G84A 2NY1C 2VLJB 2X10A 3ZE2F 3JV4A 3WS6C 4FQIL 3T3MF 3VWJC 1JGDB 3BGFB 3WNKA 3SDCB 2IEPA 1OAKL 1UWEL 5I1JL 4JFXB 4XC1L 1T03L 5DC0A 3IRZA 4OD1H 2YUWA 3QUMA 5F7YC 3TM6A 5HSFA 2DWEB 5EULV 4I77L 2OR8A 1NC4B 4D0CA 2AKRB 3BZFB 4ZMAT 4M6NL 1BEYH 2EH7L 4PTTA 4XB7A 4P9HL 5KN5A 1WWWX 1D5IH 5D7SL 3DECA 3MACL 4I13B 5F1NA 4U1IB 4QRPB 4X4XA 4Z0XA 4G6FD 1V5JA 4LMQI 4ZFOB 1FAIH 1E27B 2AK1H 5CCKL 4PJHB 1W0WB 3EFDL 4K7PX 3CUPA 3L6FB 4ZFGL 4M8QB 4KV5E 4KXZI 1NFIB 1OAUH 5DJZB 1UH4A 4NJ9L 5JW4N 5EPMA 1NH6A 4AYFA 2V6HA 3PDGA 4F9LC 2F19H 1KN2L 3S35X 3RZCD 2RR3A 4Z7NF 3DVNB 3FQNB 1NL0L 4LNRB 5DMIH 3A6BH 2JJWA 3HG1D 1I7UA 3TH2T 3T08A 3ZT7A 3TT3H 2DBLH 4ODSH 3RFZC 3T0EC 3RGVB 3BIAX 4XTRC 4OZHA 3EOTH 3GIVB 5LXGL 1NGXB 2MMXA 2XI9A 3B2UC 4KH2A 1CICA 3DV6A 4Z78A 3LZFH 2I60L 1NBVH 5DUMH 4KQ3L 3MJ9H 1N6QL 5JA8B 3VXRD 1K5NA 3JWDL 2FR4A 4LVNB 5EO9A 4PJXA 4HWEH 1MREH 3FN3A 3OMZA 4XPAL 4UNUA 5SWZB 1HNFA 1DBBH 2GSGA 2LAGB 3RWJB 1DSFL 4QRRA 3CK0L 1MCPL 5HGDA 3FO0L 5IESH 2W0FA 5MEPB 3TIEB 4PRIE 1PVHA 2UUDH 3MROB 1RK1A 2X7LA 1I8KA 3UO1L 3JWDH 1BF2A 3MMEA 5GS0C 1FN4B 3GSVA 2Q6WB 4KKCC 3HG1E 4GMTL 4LVOC 3HZYA 4UT9H 5DFTA 2GJ6D 3ESVF 1OAXH 2HN7B 3MXVH 3M07A 4XAKE 3SKMA 1IBGL 4NC2B 2AEIT 4YK4B 3IJYA 1FZJA 4YFLI 5IFHH 3D87B 2HTKC 3K8MA 4LSUL 4OIIL 3RVXD 2LTQC 4U0QB 2YZ1A 1F4AA 1I1YB 4GG8A 3F58H 2A9MH 4R7NB 5E99L 5JOPD 1K2DA 3FL7A 4E9LA 2E6PA 5JMOC 5A2FA 3PWJB 1RZJL 4Z7VE 4LKCB 5E9DE 2ZUQB 3RA7L 5KSAA 5DJAB 3X3GL 4H0HB 1FJ1A 1LO0H 1VEOA 2PKDA 4X6DE 2J7LA 4MWFB 4Y19D 1UJ3B 3PHQA 2FLRT 1FIGH 1MI5E 4D2NA 3B9KC 3ZO0A 5TDPA 1VFAB 2UWEE 4LPYA 3M1BA 3DARA 3NFPB 1OM3H 3VGBA 1IQDA 4JFEB 2ZP0T 5HYFA 3LDBC 3P77A 3VJ6B 3HPJA 4BSWB 1X4YA 1B88A 3UTSA 5CJQH 3IU4L 3ULUF 5GGSB 4HX1A 2W60B 3L3OA 4HIIB 1Q8MA 5F6IC 1RVFL 5DT1L 5I8OL 1GIGH 3MV8D 5DK0B 2P5WE 1MEXL 1UXSB 4Z6AT 4MAYA 5JW5B 4XCNB 2BOCA 4GKZA 1CVRA 5D8JH 4Q6IA 3UTTD 5BS0E 4JFFE 2DLTA 1YEIH 3RWEB 1VADA 1QFWL 4S1RH 1FJ1B 3D3VB 4RWYL 4OBSA 1B90A 1MI5D 1LEGB 2NY6B 2X44D 5ACZB 3QDMD 4LLMA 2CO7B 2Y4SA 5TGBA 5D7KD 4IOIA 2YRZA 5IFJA 5DQJB 4ZFGH 3ROLB 1V05A 2CR3A 3GIZL 4NZRH 5CINH 4O2CB 4Z7UA 3RZCA 1U93A 4WRLA 2Y72A 1VGEH 4PY7A 1GVIA 2BXYA 5EBGA 5DRNB 1E4XI 3DRTA 3C5JB 2C3XA 2XTJE 3BDYH 4D9LH 4PUBL 1A7RL 4Y1AB 5CEXA 1IC4L 1BZ9A 3O2WL 4XTRD 5DRXB 4CUCA 4DKEH 5E8PB 5E5RB 3AGVA 3GJEA 5EOTA 5DJZA 1WBZA 2CDGA 2CRMA 4RFEA 2QHLA 2YBRB 4OCSH 1UKTA 2VZ1A 1TETH 3MLRH 4PRPE 4TN9A 4JO3L 2NW3B 4DOHE 2IQAB 2EYSB 2SEBB 5DRWA 3P4NB 3VWKB 1E4JA 3HZMA 5DI8B 2VZUA 3WS3B 1OWWA 6FABH 1YMMB 5CEZD 3RGVD 3L5IA 3PP3K 3MRNA 4HPYL 5FYKL 3RL1A 1H8NA 4JR9H 1BAFL 2B39A 2X1XR 4MLSA 4P2CG 3GO1L 2QQNH 2EO9A 5GGVH 2BVQA 4BUHA 4ZPVA 4Y88A 1OVZA 3I2CH 1T6VN 4ZSOE 3B43A 2G9HA 1KLGA 2VLRE 1KPVB 1R5IA 1OAZL 2ICCA 4CADB 3AMLA 3RWJA 3NCYS 3KPSE 5EZIL 5EO1A 4WVRA 4XWOC 4Y2OA 3NN8B 4BM7A 4LASL 1OAXL 4L3EE 1BFVL 1RK1B 3QEUB 4JFQB 1NCTA 3SY0B 5I15H 2XXCB 4JKKA 4QHKJ 5F3BA 3MBED 5JXEA 1A47A 3O6FC 1NAMA 3AAZB 2VB5A 5J0BA 5IQ9B 1MNUH 2F74A 1G9ML 3A6CL 3ARDC 3D3VD 4KGLA 3QIBB 4OM0L 4PJBF 5D7LA 4EN3B 1FE8L 3CVIL 4GAFB 3HB3D 3RKPA 1DBAH 3SDAB 2RFXA 1MWAA 1QSFD 3MOAH 3DX8A 4XXCC 2I9LA 5GJSL 5JIIA 1FG9C 2YD6A 1EGJA 2WBJB 3PWJA 3L5HA 3BT2H 4YHZH 4AIXA 1GCFA 4JLRA 1KJMB 3T0DA 3ZYOA 3ZE0F 4QRRE 2GCYB 2I24N 3RY5A 1LD9B 1JFQL 1E4KA 3QT2A 1SYVA 3SY0A 1D5XA 1D3CA 1G7QA 5KOVC 3U4BH 1PZUB 3FTGB 1IAOB 5C08E 3DVGB 1L0QA 4K3DH 3BMWA 4E41B 1Z9LA 1KIQB 1FL6B 1L6XA 3NAAH 3QDMA 1TFHA 15C8L 4K9EH 4X8JA 3EYOA 3RDTD 3EYVB 4YHLL 5CKGA 3KHQA 2ATPA 5IVXF 1JL8A 4IDLA 3UCRA 2VDOL 1RZGB 3TA3C 3ZHKA 4LARL 1LVEA 1QSEE 1OSZB 4I0PB 5B39A 1WV7T 3L5XL 2W60A 5DD6B 2VDML 1E6JL 5FCSH 3UTOA 4LSQH 2BVOB 5KVDL 4JFFB 1G1YA 4NM8L 1ZWIA 4HUUB 5ENWB 1P4LB 3PGDB 4TSCH 5CIPB 1Y6MR 3O2DL 4PGBA 1RMFL 4WO4B 3GMMB 1R5VA 3CDGA 3UJJL 3B5TA 5C0BA 1WIPA 4WTZG 1C1EL 1FYHB 1VSCA 2O5ZH 2NYYD 1TTUA 2IPKB 1WK0A 4G6KL 3CU1A 4JFPB 5HYJE 2GK0A 1D7FA 4LLVA 1OD7A 3ZE1F 4Y89A 3TWCH 5DC9B 5DA0B 5DQJA 1M6OB 1U8NA 3LEXB 2EDTA 1VKXB 4M7JH 4N5EC 3TPUA 5JOFA 6CGTA 3K8LA 4R0LA 4PJAF 3ARDD 1Q1JH 1D6VL 2FIKB 4S1SL 3H9HB 4R4FH 4MAYC 2OI9B 4HWBL 4JZJB 1UKQA 2JELH 2B2XL 3PWLB 1JZ7A 4NO0D 2E5EA 2G60L 5F93C 1NAKH 3SDDC 2NY4C 1XGYL 3MUZ1 1EAPB 5I17A 4WFEE 1ZTXL 1ZWIB 4HUUA 2YBRA 2J1KA 4MJID 1ULVA 4QXUH 2D7PA 3N0PB 3BP5B 2E9BA 2YRLA 7FABH 2IQAA 5IHBA 1YMME 3IDNB 1JWUA 4AM0B 4JB9H 3V8CA 4BQ8A 3U4AA 4P2OC 4OLUL 5DFWH 4J6RH 4P2QD 4QHLA 5TF0A 3VXUA 2VH5L 2R1WB 5FB8B 3F7VA 5L2KD 3MRRB 3NOIA 2E7CA 3VH8A 2VXUH 1IKFL 2IBZY 3VFMB 4U3HA 1S7RA 4OZFA 1TNNA 1G7MA 2QSVA 2YPKA 3D5OF 2EXYC 3H8NA 3MV7A 5GRYA 4CN1A 4X4YA 1IGMH 3PHSA 3K81A 4I18B 2AXGA 3VFOA 2Y7QB 3TV3L 4R96B 4H0GA 4OKVA 3VDBA 1XF3B 3QPXH 3EO0A 3U83A 3JVGC 4LK4A 1CL7I 2WWMC 4I3RL 4MA3B 4PFEA 5J06A 2QKIB 4X9FA 4M1DL 1AGEA 4XCCH 5F3BB 5L88L 2JCCF 3QZWA 1D9KC 5CD5C 5E5MA 3RX8A 5HHOA 3TYFB 2P49B 1A6TA 4Y5XA 3VRIA 4M7KL 1QYGL 1U8QB 3ZLQC 4D94A 1HHJB 1DSFH 3VA2C 3VXOB 1KJ2A 1TVBB 5SWZE 2WW8A 4NCDA 2F5BL 1MPAH 3EDDA 4XT1C 2DQDL 4F33A 4KKBD 2R56L 5I75B 5KSAC 1NPUA 3PABA 2X09A 3WMSA 1IFHL 4QF1A 3VGFA 1ZTXH 3NFNA 1NUNB 3CFDB 1KN2H 2KL6A 1F00I 1Q9LA 1ZEAL 4R96A 1JPTH 5CHNA 4KJQC 3OZ9H 5HHPB 1YNLH 1U8JA 5FYKU 4YFEA 3GJFA 4WWID 4JO1L 5DDHB 3UMTA 3H9SB 3PQYB 4Z8FL 2H41A 3WJLC 2PTVA 3ETBF 3THML 1DUZB 4NUJA 4LSSL 5ESQB 3UYOD 3KJ6L 4XPBL 1RURL 2HKHL 3BZFA 4XB8A 5GS1A 3BPCA 3X13A 3T0EA 4KTEL 2WIIB 4D9QE 1IM3B 5AZEH 5C0RL 5GS0H 4PJGF 1MJ8H 4EZMA 3JWDC 2I60H 3G04B 2XV6B 5K9QI 2JIXB 2YPVL 4HS8H 4U1IA 1ZOXA 2P47B 1LWRA 5E94B 4X9GA 3O3BA 3LV3B 3THMH 5LGKA 2IAND 3U1SL 1HZHL 1TJIL 5K9JH 4ISVB 3U7YL 2ED9A 2FSEB 1BIIB 3G6JF 4YHPB 5GS1C 4QXTB 5DO2C 1YQVL 5C0DB 1J8HE 2QQLH 3IDIB 4FQ1H 3SKOB 4YE4H 1H15B 2VLRB 5F8QC 1ZE3C 2DQEH 1Q9LB 3OAYK 1V3KA 3QQ4A 2XA3A 4QGTA 5FYJL 3DWTA 5F7NC 5INCA 1DTUA 3U1SH 5K9JL 4JY6B 3MV01 1S7QB 2ATKB 2ZSVA 5HGAA 4O58L 3I9GL 1UM4H 2D9QB 4FQHB 2L7UA 4KKLD 4QGYA 1C5DB 1CD1B 3RTQB 4D0DB 1S7VA 1UZ8B 2YK1L 3X12A 5D2LB 3KPQA 4KU1A 1B0WA 2D7MA 4G42B 2XY2A 3JWOH 4K71B 3DX7A 5HDBE 5GHWL 1FO0A 1IE5A 5IEHB 3TO2A 1YPZE 2VZOA 2HLAA 1C5BL 1NFDB 1ERNA 5HI4D 1TIUA 1ZHNA 4U1MB 4XP6L 4HAFA 4NKMA 1KCSH 1PX4A 4XZUA 3CXHK 4RMTA 3JTTA 1HHGA 5JQ6H 4GXVL 2XZCH 4GAYB 1RZKH 1YUHB 2BVPA 5ESVB 1T0NA 4R3SB 1YJDH 5C07D 5EC2B 5MI0C 1IRAY 5IT2H 4P5KA 5DD1L 2IJ0C 1I9JL 2FX9H 2DQIH 2BY3A 1X5HA 1IKFH 4KPHH 1BM3L 1KB5L 1IAIL 4NDMB 35C8H 4FQPA 5BZWB 1CDIA 3WUWB 1UYWL 4PLJD 2ED8A 2AKRA 2ILLA 2NY7L 4PJ7A 4XNMA 1FO0H 4LPXA 3KPSD 1A7RH 1AO7E 4HS8L 4RZCB 3VH8B 3RIAF 4LSPL 5E2TH 3TPKA 1KXQE 5CAYB 1CXEA 1RJZA 2HH0H 4JRXD 3TV3H 2EYRA 1T2QL 3P4OB 3QEGH 1IAKB 2UYLB 5BRZE 3DHMA 4KPHL 2HWZL 4JAMA 4N8CH 3O3AA 2VC2L 1CDUA 3HCVA 4X6FA 3TA3B 4JQIL 4IJ3C 2CMRH 1YZZA 2Z8WC 4XNUL 1T66C 3FO9A 1QSFE 3WNNA 5KSBB 5KTEH 3CFEA 5IB3B 5MHSE 2B4CC 1WCQA 5T33H 1JZ3A 1BZ7A 4O4YH 4ZTPL 1RK0B 3VXQA 4X80L 4MA3A 5D6CB 2FWOA 1LO5B 1UB5A 3P9WB 3DYOA 4YJZL 3L5WB 4GRWF 1M7IB 4ZOAA 2Q76B 4Q7DA 2P7TB 4X99A 4Y16A 5DGQA 3FOLB 2Y06L 3S5LA 1EEZA 4JQVC 5C2UB 5E2WL 1AIFA 4L4VB 4GXUN 3RNQA 5KS9B 2HJLA 1PZ5B 1MH5A 5EBWB 3BGFC 4C56B 4JCMA 2QLVB 4UAOB 2CLRB 4NQEE 4F33B 3NCMA 3QISA 2PXYC 2OR9L 3IGAA 3DUSA 4ORGA 1AD9B 4F37F 1JF1A 4X6FB 5D1QD 3IJHB 2XFXB 5F9AC 1NEZB 3P11L 2J8HA 1WSST 4YWGL 1B4RA 4MAYB 1OW0C 1ZA6B 3M17A 4TQEH 2V9TA 3GJFB 3BPOB 5M95B 2P48B 1T1WB 1E28A 4PGJA 4M5ZH 4YZFE 1KFAH 4LFHD 4UT6L 2GY5A 1QNZH 2X05A 4M9OA 1WIUA 3A6OA 2Q20A 4YGVA 1YEFH 2KDGA 1Q72H 3C08L 1N4XH 2XKNB 1H3GA 1X5YA 2Q7NA 2Q76A 1RIHH 4M5YH 5B22A 4EVNA 5L9DL 1BBJA 2HP4A 2P8MA 1AR1D 2YD9A 5EZOH 5I74C 4FFZH 4O2CA 2PYED 4Z7UB 1OCWL 2QBWA 2D4FA 5KS9A 2QSCL 4JJ5A 2EIEA 2Y6SD 1HDMB 4ODVL 1JPST 3QDGA 5EIVA 3ARGD 3BGAA 2KQNA 2O61B 1EA9C 4OFIA 4WUUB 4P4RB 1BIIA 3H42L 2VLLA 1ZAGA 4OAWB 3L3IB 2Y23A 5E8NB 3CX5K 1DL7L 1GC1L 1NC2D 1FGVH 4QHMB 3TO4D 1SMAA 3V0AC 5TQ2L 3VFGH 2ZUSA 4Z95H 4KTDH 3Q6FA 1YYLL 3TO4B 4LSVH 2D31B 4QRUB 5HI4C 1DVFA 1NDMA 1OTTD 3MRCA 1D5MA 1FL3B 3T2PA 1T80A 3BW9B 4DEPC 5I0ZA 4HCRH 3MRNB 4OIAA 4TTDC 2DLHA 5A3ID 1KCUL 4LCWD 2VXTH 3FZUD 5BJTB 2VSCA 3PE9A 3VXSB 1G7LA 4N0CC 3MRLA 2CKBL 3GM8A 4MAUH 4WFED 5E00B 4YR6A 1MHPL 1JIBA 3AB0C 4N0YH 4ELKB 2CIIA 1NFDE 4YBQC 3BO8A 3LS5H 2E6QA 4W70A 3G5ZB 4ODXB 1VDGA 3TVMD 4QNPE 1EMTL 1BPVA 4F58L 4UIKH 4P4RA 5JZ7C 2MPAL 4YNYB 3SQOL 1FFPA 3PXJA 3BZDA 1KCUH 1I7RB 1T20B 5C0CD 2DAVA 3S97C 1MVUB 2HTLC 4FMKA 4GG8B 2D7OA 4DN4L 2DBJA 3PDDA 1YYMH 1QO3A 4JVUA 3DGGA 5A43C 5D5MB 1B0RA 3S4SG 4LKCA 4YUEH 5IGXL 3WN5B 4CVZB 4JVWA 3AREA 1AFVL 4LL9A 2A1WL 3RWFB 3SGDH 1YNKL 1OW0A 2BNRA 3O3DB 4LLMB 3SE3C 3RP1A 2B5IB 1P1ZB 2PTUA 3WHE0 1G7HA 1OP5K 3RDTC 3SDAA 3EOAA 4OQ1A 5HGBB 1JHKH 4R0LC 4Z7NE 1PSKH 3O11A 4URTB 2CDEB 3BSZL 3UZEA 1OM3L 2XQYG 2R39A 4C83B 7FABL 3IRPX 1WGOA 1YNKH 5DVOA 2OYPA 4GS7B 3DMMA 3H9YA 4D9RE 5L0QB 1FNFA 5CJBA 2EDJA 5JOEA 3UTSB 4YDJB 1JTPA 1BGXL 2DIAA 1KB5A 3R1GH 4HT1H 4NQXA 1AD0B 4HXAH 2BSRB 3OKKA 3B2VL 2A0LD 3VXMD 4UI2A 5D5MA 3LSOB 4OLWH 1NBVL 5DUML 3TCLA 3TJEL 3WD5H 2MQCA 2GJ6E 1PG7L 2BNUA 3EYQD 3H2WA 3PGFH 4L8SC 3SPVA 2CUHA 3RWFA 2A83B 4YHOH 1FNSL 1EEZB 1OTUC 4LVHB 2FYYA 4EUPH 3IU4H 5T1LA 3BP6A 4Q9RH 2EYTB 3LS5L 1ONQA 2A2QT 1AJ7L 2HT4C 4NQUA 1ACYH 2X4NB 3IU3B 3O6KL 4NUGL 5LGHH 3JWNC 1ORSA 3DIFB 3CJJA 1DN0B 5D8JL 2R0ZL 1LEIB 1IEHA 4DN4H 4TOYL 1Y0LB 4PREA 4LBEB 3EHBD 1EV2E 5B4MD 4JN2A 4NNYA 5D1ZC 3KPOA 1WICA 2DL2A 2V17H 4OLUH 5DJ6A 2HA1A 1WBZB 3MYJB 4JPIA 3W0WD 1KC5H 2H1PL 4JFPA 4LLVB 3W0WB 5E95B 2NXYD 3H3PL 1VGKA 2GTWB 4UDUB 4KRPC 2EKSA 3T4AB 3RTQD 3D6GA 3N1PC 1OGAD 5J12C 3MR9B 3HPJB 4WHTB 3UBXG 1BOGB 4A6YA 4NYLB 1RU9L 3MRMA 4QOKA 4UV4H 5IF0B 4DGIL 5C0BE 1WZKA 2FCBA 5D5MF 1ORSB 4HV8B 3IETA 3QPQC 1RJCA 2CK0H 3QRGH 4GBXC 1KENH 4N0CD 4S11A 1G0YR 3FFCD 4Y8AA 1YEJL 4PRBB 4UOW0 1BF8A 3QIBD 1R5IB 3SGKA 3DX6A 2YS4A 5JORA 1UA6H 1IC7L 1JN6B 3SDXB 3KS0H 1BX2A 2CKBH 4Z77A 5BZDA 5GSRA 3DVGA 1G9NL 4HGMA 4APQA 1B4JL 1FNSH 2ITCA 1MCNA 4XNZB 1A0QH 3ROLA 2F5BH 3QUML 5HD8C 3TYGH 4HS3B 3VFMA 1INDH 4R4ND 4N8VG 2Y07H 3ILQC 3QEQE 2KUTA 5F1IB 2YPKB 2H3NA 1RUPL 3B5GA 4RGMB 4OD2B 2ZKHL 5L7XH 3MRMB 4QOKB 4UUJB 1B9ZA 4PRHA 4RWYH 3P0VH 3T4YB 3M8OL 3BIBX 3FO0H 1T20A 4GRWH 4JO1H 4Q9QL 3WNMA 5L2KE 3FQUA 4LCYA 2AV7B 5ENWA 1MREL 2X9YA 3WE6A 1XIWC 2O93L 4KUZH 4WFFD 4FTVA 3CLEL 4UQ3A 3KJ4B 4G9FE 4N0FB 2H1PH 4CMHB 3KPRE 4Z77B 1YMMD 2X9WA 3LPGA 4NRZA 2XKUA 4LSTL 3AREB 4APQC 1JHKL 4H1LH 4LLUB 1AKJA 5HPOA 4YPGB 5CGYD 3U7AA 5ICXA 5BS0D 4ZOCA 4PLOB 1NBQA 4KUZL 1DLFL 1GGCH 4HFUL 1QPXA 3FONA 3LEXA 1MQ8A 2EEBA 2ZUWA 3SGKC 1J1PH 2ZSWA 2NY3C 5I1LA 1YJDL 4HGWB 4ZTOH 1SBSL 2NY5L 5DGRA 5JLZB 1AP2B 2PO6A 3Q1SH 2IPTL 1S7TB 2A6IB 2QL1A 4UTBH 2OZ4A 5ACLA 3RA7H 5CHNB 4HFUH 3MGAA 5D72H 4L8DA 1KELL 3QWOB 1NMCC 2ESVA 5HYQA 3VG9C 1LMKA 3P9LA 2J8UA 1T04B 3H9SA 3DROA 5HJ3A 4P4KD 1L4IA 1BQHB 2BY1A 4YAQA 1DUZA 1G9NH 4U6VH 4ZSOA 4OF6A 15C8H 1LK3L 4NN7B 1CLOL 2GJZB 3AXLA 4QT5B 4QTIH 2FJFB 5CMAB 4GKNA 3WL9A 5IIEA 4KROB 4LHUB 4M93B 2X4UB 3O45B 4X8XA 2RIKA 5T1LB 3FB6A 4GAJL 3RX7A 3DSNA 3PWVB 2BNRE 4PJFF 3PL6A 4DW2H 5GJTH 2X4NA 2GHWB 1MWAB 3CCHA 3V8OA 4HUMB 1CGTA 3D39D 5F7MC 4P2QB 4HGWA 1A7BA 4QXTA 2XNAA 2GITA 4KGJA 5HHVL 2CRYA 2WWKT 1F5WA 3ARPA 4XHJC 4U49A 1P2CB 1MCWW 3QQ4B 3FMGH 4OKVB 3UJJH 2BSSA 3IDMA 3KPOB 4Z7QF 1QLFB 3QUXA 5D7JB 1SYVB 1D6EA 4MDIB 2MCG1 2H32H 2LE9A 2VLJE 1DDHB 5DQ9A 3CU7A 2GSIA 4G6AD 4FFWC 3GSWB 3KPRD 1QHPA 3BD3A 2DQGL 4Y1AD 3TNMA 4HWZB 4K3EL 3LS4H 4BH8A 4PRID 5I1CH 3MNVA 2Z0BA 3MV11 1HCVA 4U33A 4NZRL 5AWNL 2Q86A 2EEDA 4OD3L 3ARZA 5E6ZA 1FZOA 4G42A 4ZFZB 1DN2A 1K4CB 3GKWH 3N1GC 4QYOA 1CGVA 3BDYL 4PGZA 4D9LL 1C8PA 4KHXL 5JO5B 1C5CH 3SE9H 4HKXB 1KIUA 3DMMC 4HV8A 3RWIB 4LLDA 4JM4L 1JK8B 4OZIF 5HI5C 1MCOL 4OFYA 2Z35B 4L8BB 4U1GC 3F5WA 1T0NB 5C08D 4JB9L 2HVKB 2BOBA 1RI8A 4IOSD 5C6WH 4GQPH 5KVGL 4NFBA 2R1YB 3WFCH 3EO0B 2Z8SA 4QTIL 3UBXI 4YLQT 2H2PC 4JM2C 5BZWA 3WJLA 4V1DB 4NQDD 4JDTL 5ANMA 4PJ7B 4HMDA 4DFHA 2CRIA 4HWZA 2R2BA 1M6OA 1MFDL 1A8JH 5DSCB 3CPLB 4NKIH 3IXAA 3QSKB 3ZYIA 1RD6A 4N90D 3CMGA 4WEUD 4G6MH 4OCRH 4OD2A 5I19L 2EDRA 3VW3L 4MXVE 5I2IA 1NCCL 5E6ID 4EDWH 5T3ZL 3C6LD 5D2LF 1Z0MA 3DYPA 4HKXA 3TA3A 3L1OH 4W6XB 4Y2DB 5T5NF 3ARQA 4GSDL 5IM7B 3MO1B 2J12B 1BQSA 4M1DH 5SX5H 4Y19E 1G7JB 2XPGA 4P23D 3WFBH 4G6ML 1LEKB 3LKRA 2FWOB 1WITA 1ZLSH 2UZIH 1IM9A 1MHHB 4RCAA 1E4KC 2CUIA 1YEDB 1A1NA 2X89D 3GMLA 1QRNB 4V1DA 1URLA 4ZUTA 4WWKD 1X6LA 3RTQA 1TZGL 3MRHA 5BV7C 3OKLB 1QD0A 3QCTH 3RVWC 1NMBH 1KXVC 3KLDA 3BPCB 4GXUM 3X13B 4YPJA 1GRWA 5DJ2B 1C08B 1CTNA 1HHKA 2PYFA 1S7WB 4QRSA 4MJ6B 3U0TB 4ORZC 4NQTA 1Q94B 5BRZD 3Q5YA 4M8VA 5I8EA 3U4EA 1ZEAH 5BOPA 1AO7B 4RMWA 4GUPB 3QUKB 3SHSA 1JZ4A 3GBMH 2VLJA 1INEH 4YHPA 1T1ZB 3MGOB 2Z91A 3JTSA 2YN5A 4PJDF 1HYSD 2APWA 1NUFA 2GTZB 2YD4A 1FFOB 4P5KB 3NA4A 3LN4A 1KTKE 3FQNA 3SDDD 1PGRB 4O9HL 5TFSH 2R9HD 1DVFD 2R69H 4R26L 1OTTC 2Y36L 3MJ9A 4PJIF 3WUWA 3VWJA 5CEZL 1FNAA 4HEME 4HW6A 5IVOA 5FFLA 1BOYA 3GBLA 4JJ5B 5CKAA 2BSTB 1EO8H 4PJCE 3T2NL 4HXBH 3QEQD 4K07A 3ARFA 4JY4B 2AJSL 3HUJA 4N0UE 4NQSB 3VRLF 2FR4B 5GGRY 5JW4M 1G0XA 3CFDA 3TJEH 4L4VE 4HHAB 3WIIH 4GRWB 3T09A 3S88H 3O6FD 5D1XC 1FCCA 3TZVA 2W0FB 4LLAA 3VXMB 3EO9L 2D7TH 3LMJH 5AWNH 1J8KA 1I8KB 5SX5K 4OI8A 5E8DL 5EPMB 5FUOH 1O5DT 3GKWL 3MJ6A 3ARDB 3HPLB 3TT1H 1YUHA 2BVPB 5C0AA 43CAA 3BW9A 5IT2L 4G9FB 2NX5D 1F2XK 2C3HA 4CMHC 2BVYA 4P57A 4JKLA 5C8JB 2BMKA 3QYCA 5IB4B 3AREC 2VL5B 3DSFL 1P69B 2PUQT 3BD4A 1KLUB 1VERA 3EO1A 3MRDA 4QRQA 4ELKA 4L8SA 4JR9L 2HJLB 5GGQH 1HEZB 4TVPH 4G8GA 1F4XH 4BH7B 4L3CB 1OGAE 5M94B 3KNBB 2DJ4A 1J8HD 3QJFA 2EC9T 3IGAB 1KOAA 4EXPX 3DV6B 5A40E 5T1KB 4NQSA 4KI5D 2BFVH 3WIFA 3FFCB 5IBLD 4HK3N 4XVUC 4ZPTB 2IANE 2WLZA 2ED7A 3B8YA 4HUXA 5D71H 2F5AH 4NNPL 5ETUB 1KPRA 3BRDA 1D5ZB 5CP3H 1TITA 3L5XH 4N9OB 2XQBH 2WUBH 3LRHA 2H9GA 1BFSA 1T21B 4QXUL 1I9IL 2ZPKH 2OSLB 3RU8L 4D0CB 4YGVB 4Q6IC 3RDTA 1MFBH 3T3ME 5CEZH 5D6CA 1BJ1H 1KB9J 4NNPH 4EVNB 5KN5B 3V5DA 2AP2A 1JHLH 4PJ9B 3O6ML 1A9EA 5FYLL 3O6FB 1IQDB 3CZJA 3A6CH 1QPPA 4OF8A 1E27A 1FO0B 3LRSA 5CUSH 4G6FB 4TRPH 3RAJL 2ERJB 1K85A 3D3VE 4XC3H 1S78C 2DLEA 2FHBA 4WU7A 4Y2DA 1P4BL 4WEMB 3D39E 3K74B 3MUGB 3C60C 3QXVA 4NQCD 2IADB 2P5EB 4OZFH 1XF5B 1AQDA 1OGTA 3KYMB 4TUKH 4MDJA 5ECJE 5GS2H 2I5YL 4NQXB 1J1OH 2IH1B 1F3DH 4R7NA 1WFOA 1NC4D 5ETUA 4CDHA 4GAGL 3EW3B 3V0WH 3RY4A 4MMZC 3WUZA 2WSKA 3KPPA 4XP9L 4XX1G 2R0KH 4H25B 3S34H 5F88B 3S36L 1CDBA 2D31A 1CL7H 1ZA6A 12E8H 1FBIL 3M17B 2XN9D 2W59A 5KAQG 3GMLB 3HE7B 5EBMA 3K7UA 5DJXA 4QWWD 4KV5F 4E42B 4EI6B 4M7KH 3QG6A 3I50L 2I26N 1AGBB 1F58L 4QOKE 5ICYB 3D69B 3E8UH 1TETL 3MLRL 3DUHA 4PJ9A 2P43B 3MCKA 1S7WA 3HUJF 3BO8B 3RJQB 1DVFC 2VE6B 2YUVA 4JKWA 1U8HA 1ES0B 3OV6A 3LEVH 5B3NA 4U31A 3DO7A 3IAGC 3P77B 5HGDB 2PO6D 4O2EA 4X7CC 4GQ9H 4PTUB 4LIQE 1OAQL 1XR9B 3DBXB 1CDYA 3FOMA 2XXMB 3MYJA 4LU5H 4K9EC 3NCJH 4NC0B 3WO4C 3U46A 4NWTL 4H1LG 3HC0B 3TN0B 4NFDA 1MCEA 3HE7A 5EBMB 4LGRB 4Y16C 3O6LL 5D7IF 1QFUH 4R8WL 5IOPB 3CZFB 5D1XD 3WO4B 3BD5A 1JGVL 3MTRA 5FHAL 4ACPA 3QG6B 5BXFB 5MEQA 3CFJB 4QHUB 1IT9H 5ACZA 2JLLA 3WLBB 3MRJB 4L4VD 4JY4A 4P3DB 3NIDE 5C6TH 5FAAA 4AH2B 1JZ6A 5E1AA 1U8HB 5EUKA 1F4HA 4NM4L 3RZCB 2C5DC 3RX5A 4CADA 3LDBB 2CUMA 5LJYH 3BN9C 2OI9C 5CIPH 4LQFH 5HVHC 1Z9MA 1HWGB 3EFFB 4LFHG 1P9MC 1QBLL 3LZFL 3TVMB 4NZDA 5DJAA 3VD9A 2HTKD 1JZ8A 1NSNL 1KGCD 3NH7L 4POUB 1FH5H 1CXKA 3TCLB 1BIHA 1A6ZB 4TVPL 4LCUA 3HNVH 5C86A 1RY7B 4XAWL 3KS0J 1JGLH 2ITCB 4U6XA 2XY1A 4APQD 2AI0L 3DTXA 1KF9B 5BXFA 3JZ7A 3LKPB 1MCLA 3CFJA 4M7LL 1QRKA 4XPGL 3AU1A 4X98A 2VQ1A 5BV7B 2AJZB 5DA4A 4M62H 4XMLH 4WWKB 2NLJA 3MXVL 3HE7D 2WUBL 1TQCC 3FQUB 1KYOJ 5FA4A 3IFLH 3LAFA 1MAMH 4ZO6A 5C0CB 3G5YB 4K2UH 2FB4H 4TPRL 3U2SB 5ADPL 3RI5F 1NBZA 4XNXL 4JO3H 2B1AH 1FL3A 3ULVF 4WV1B 4PJBE 1AKJB 3RDTB 5TF1H 3U9UB 1ZLWH 5DYOB 4LDLB 4NKDB 1A5FH 5ICXB 2BNQD 4IOIB 5F6HI 4U6YB 4X6BA 2XICA 2EIBA 2BNQB 2ATPB 3HS0A 5ADPH 4PJ9D 2W9DL 4PRDB 1HHHB 3VFVB 5KSAD 3QDJD 4GRLB 1ZLVK 43C9A 1N64L 1MRCL 4M6ML 3TGXA 3P30H 3V9FA 1FFPB 2GEEA 5F1KC 3GJEB 5JUEL 1N0XL 4C54A 1XIWA 4RFOL 5H2BB 1E4WH 2DQJH 4YEEA 5HYQB 4Z76B 3UC0L 2ADGA 3FT2A 4IOFD 2PYEE 3ARGC 3I50H 3DGGB 1MY5A 1F58H 5HJ3B 4YAQB 2F58L 4NZTH 4G7VL 4PB9L 3ZZ1A 2H2SD 1BZQK 5DI8A 4BUGA 4JPKH 3ARGB 3O8XC 4Z5RA 2ARJB 3LIZH 1P9MA 2VLKB 1N0XH 4L29A 5IFAL 3T8XB 5IHUH 2MPAH 3QNYA 3SQOH 1MEXH 4G6AC 1QFHA 4AQ1B 3MBEB 4OTXL 3PWVA 1I1AB 2VABB 5HHQA 3I6KB 3OR7A 2DRUA 3J7HA 2KQMA 3O11B 4NO0A 5FYLD 3OX8B 4XBPB 1FO0L 3S37X 3RPKA 5GGUA 3BOVA 2NW2B 1G9NC 4NJAH 4CVXB 1BMGA 3ET9F 2X4SB 4FFVD 4A6YB 2CKBB 4I0KA 5SWZD 1I9RL 4WIQA 1EAPA 5HDQH 3OTTA 3IDMB 2JJSA 1MQKL 3LQAC 4P9MH 5DK2B 3D85A 1KC5L 5DMKA 5ITBH 1GAFL 4J3XA 2YZ8A 3QUXB 5D7JA 2NZIA 1AXSA 5D70L 3KYOB 1DDHA 5KS9E 3PGDA 3P4MA 3WDJA 1JWUB 2RCSL 3FQTB 1LP9A 4DKAA 4WO4A 5T3XL 3WSQL 3T8XA 3EYUL 2A83A 1BX2B 4AQOA 2G2RA 3ARXA 3HZKA 3L9RA 2F74B 2VO5A 3MCLH 1ND0A 4UV4L 3D1MC 1RZ7L 4WHCA 3N06B 5SV4A 3GDBA 3V52L 1TPXC 1UWGH 3ECBA 3T2OA 5EZOL 2R0LL 3MJ7A 5SWSA 5J9PA 4P3WA 3DIFA 2AGJH 2HKFH 1RUPH 1NCUA 2NW2A 4PIRF 4K7PL 1IC5H 4WUKH 4G8FB 3W2DH 2FIKA 2VERN 4GH7B 4P4KB 1RUMH 5KVDH 4GG6A 4NCC2 3D2UD 2VKXA 4S1DC 5DK2A 2WP3T 5DMGD 3WKML 5BQ7A 4KRNA 3CH8A 4K8RD 1FGVL 5ALBH 4XCYA 1CR9L 3WE6B 1M05B 2K7PA 5I16A 5HDLA 4UAOC 5I8CA 1IC5L 4WUKL 4JG1L 2R2BB 3I3BA 1L7IH 3DYMA 2WNGA 3SJVB 4X6CF 1VGKB 4Y5XC 4F8TA 4MJIE 2XTJB 3MLTB 4YDVB 1MF2L 4MNGE 5HHNA 2HFEA 1FNGA 4A6YL 5IMOA 5A16A 2C26A 4AT6A 2NPLX 3ULVH 1BOGA 3ZYZA 3MX0A 1M7XA 1NLBL 1MAJA 3AC0A 5MENB 3O2VH 5L9DH 1XT5A 4OF0A 4NWUH 1FCGA 1OTUD 5DLML 1JGUH 1F13A 3SDDA 1HXYB 1F45A 1KCRL 4I0CC 1KSRA 5CSZB 4X4YB 1WWCA 2JCCE 3BXNB 5DR5H 5FV2A 1WBYB 4ZXBB 4PGBB 4PJGB 1KEML 1IARB 2C3VA 3B4NA 3BDXA 1CK0H 5DQDH 4EOWH 3SGEH 3O2VL 4I9WE 5BQ7B 1VEMA 5F7KC 2YOCA 4GW5A 1CGSL 4JQXA 3F8UB 3MLXL 2IGFH 3BP4B 2FECI 5GGTL 5TH2B 5K9KA 3SE8H 5ADOL 2Q7YB 3DROB 2BHZA 2WIIA 3EDEA 1P7KB 4NN5C 1GGYA 4ZSOB 4HUKB 3C8HA 1U8NB 2NY0C 5T5NG 1RVFH 3SE3A 4RISH 4U4BA 3V6OC 4R2GB 1MCJA 3FFCE 4M43L 5KZCD 4B7LA 5F1IA 2OP4H 4V2BA 1K4CA 4U2YA 5E5MB 4P2OA 4HWBA 5DMYA 3X17A 4K8RL 2F8XC 1U8QA 1MHCB 1FVCA 5C0BD 4ISVA 2D7QA 3OB0K 3VCLA 1KULA 1RUML 5I1AB 5DFVC 4Y5VA 1JHTA 3OJDA 4YHLH 2FGZA 4XMPH 5DRZB 2HVJB 3AROA 4HUNB 5A3IC 3RZCC 1Z2KA 2Z91B 3JTSB 2GITB 5L2JA 4F8QA 5CWSB 1XZ0B 2V9RA 3R4DA 5E4EC 1HWHB 3MA7B 3SOBH 3R8BB 2HFGH 4JHZA 4YBQD 1S7QA 2ATKA 3NCCB 3R06A 1QSEB 2XN9A 4FTVE 4YPGA 5FO8B 5B38B 2X1OA 2R8SL 4GFTB 4OV5A 1P4BH 1IQWL 5C9JB 5L2KA 3PWPA 4FQIH 5I30L 1A21A 3I85A 4KJYB 2VL4A 3IXAB 3TNMB 1UC6A 1HI6A 2NY6C 3VXNB 2OQJB 3CSGA 3MFFA 2EDKA 3HAEG 4F57L 2BCKB 3V0WL 1FYTE 5HHMB 5JLZA 5AUMA 4OCNC 3VCLB 5F9OH 3EDFA 5F72S 2MWCA 1WISA 3LD8C 3TZVB 4CNIB 1I85A 4IHOA 4JRYB 2FX8H 3L3HB 1RPQA 4CW1A 3T77B 1OQOA 3LKRB 3F7YA 4L8BA 2FH6A 3T3PE 1YEGH 4JRXA 3ARDA 2YA1A 4RMUA 3MACH 4IDJH 5EU4A 2VN4A 1YC8A 2X1PA 3GSRB 4QT5A 4J2XA 1NAKL 3R06B 5FO8A 3VFNB 4F7TA 3IDJA 1K3ZA 1L9MA 3PIQA 4MVBC 1XIWD 1P53A 1SEBB 4PV9A 3FB6B 3E2HB 1HXMB 3UTTA 5KSBE 4IBLT 2Y1VA 3SDAD 4KROD 3S9DB 4L4TB 1RJZB 1C5DA 1CD1A 1ZANH 2D03L 3A6BL 5HPMA 4JFZH 2Q1EA 2DMKA 4PJFB 1T1YA 3GSNH 1YEKH 1IC1A 2HTLD 1UWEH 1FDLH 3VXPB 5AAWA 1GGIH 5FF6A 4OLYH 5DJDA 1YQVH 1KPRB 5KSBA 4J3UA 4HUVB 3QQ9C 1T5XA 4R7DA 1HIMH 5FHBH 1QFOA 3DHJA 5J13B 1S7UB 4P5MA 4W6WB 1EEYB 1F90H 5DDHA 3P2TA 3GHBL 2GTZA 3ULUD 5CZVL 1Q0YH 3O0RH 4Y19A 1IGML 1ZHBA 2C3GA 2GQHA 3P11H 3PQYE 1L9NA 1JPSH 4Q74A 3HI6H 1A7QH 2V2WB 1S7SB 1ZA3B 3MLYL 4JQVA 4QWWC 3ZYJA 3O6FA 3EOBB 3V95A 1MOEA 4H26B 3T0AA 1QSED 3LV3A 3O3BB 2B5IC 2KBGA 2J4WH 1MRFL 3O9WD 3STZB 3GIVA 2HFTA 5EBLB 3ARFB 2V9QA 2X4OB 2B0SH 4ORGB 4AEEA 4GT7A 3HI6L 5T3XE 1G6RA 1C08A 2PYFB 3RBSA 3IDIA 2AXJA 3C5ZD 4O5LH 4PJGE 5AYUH 1GGUA 2DQHL 2BRQA 1TDQA 1N5YL 1Q94A 5J1AB 3E3QE 3W5NA 4HUVA 4TSAH 1Z3GH 4OM1H 1RZFH 1NAML 2BOBB 2C3VB 3LHPH 1JE6A 1K6QH 1EEYA 2A9ML 4ETYA 1N3NB 3UBXA 3KYNB 1NCWH 3TNNA 4JPVL 4BZ2H 5CJXA 2X7LB 4GLRI 1LO5A 1LO3H 1UB5B 2XG5A 5C70A 5JHDB 1GC1H 5ELIA 5DSCA 4WU5B 3VGHA 4YQXH 1MIEH 1SYSA 1QKZH 1PAMA 4NHCH 5F21B 2DD8H 3EOBA 5D9SA 4Z0XB 3E6FA 2Z4QB 4MA1C 2HH0L 2P4AB 2WAHA 2F54D 4L4VA 5EBLA 5BRZA 4YZFF 4WEBL 3LQMA 4MA1B 4FXKB 4ZXBD 3CC5A 3TFKD 1NFIA 3NABL 2NZ9D 1EGJH 3UJTH 4JFOB 1II4E 4FTVD 1SJXA 5HGHA 1IQWH 2ENSA 3MA7A 3L7FB 4PRNB 3LQZB 3U46B 4G3YH 5J1TC 4JKMA 2LAAA 3O9WA 4XP1H 3QO0B 1JI1A 4PJEB 3GI8L 1HKLL 5IMLB 3INUL 4JG0L 1FLTX 3DXAB 5FGBC 3ULUE 4Y4KB 4PBVC 3S37H 5MEQB 1QFWH 2EIZB 4KJYA 4S1RL 3IJSA 1IAKA 2UYLA 3P0YH 3P4OA 5D9SB 4B41A 2J3SA 4JAMB 1E4XL 4H8WL 1Y6KR 3TA3D 4FQLH 4Y4HB 3VRJB 4O5LL 1RULH 4JG0H 4YHMH 5BRZB 3N1QC 4C57C 2YXFA 5EWIL 3OKOA 1AC0A 1PG7X 1TVHB 3U7WL 1NEZG 1ADQH 4X5XA 5EU7E 1MVUA 1OGTB 1BZ7B 3PF2A 4YWGH 4L1HA 5F71A 4ZUVA 5DK0A 4H25A 3FN0H 1RJYA 2HFFB 3RNKA 3WNOA 4MSWA 2A74B 2C1OA 1IZJA 4IMLB 5FYJU 3GSNL 5EU6D 4QNPF 5JHLL 1T0MA 1MCCA 1S8DA 4JFHE 4NQCA 1AIFB 5C08A 5CZXD 3RU8H 1N2RB 3F6IA 3FAWA 3B9KA 3W82A 1KTRL 1B0GA 4GRMA 1CFTB 4RRPA 5ERWB 4M6OL 1HIML 4WJ5A 3AS2A 1JGEA 5DT1H 2BXZA 1AC6A 2Z9TA 4KVCL 5CJOL 4HJGB 3S4SA 3SJVE 4ZS7L 3GSQB 1MAKA 1X5GA 2A6DB 4C83A 2CIIB 3G5VB 3H7BB 1C5CL 4FP8L 4PRHE 5FA4B 1I3RB 4KDVA 4OZHF 3K1DA 4JM4H 1F42A 1R3JB 4NQEB 1T1WA 4Q0XL 2EDDA 3TFKC 3GSNB 4ELMA 2EZ0C 1TCRA 4S10A 1LO4L 2VXQH 1NJ9B 4XX1E 5LCVH 1GPOL 4FG6C 4MNQD 4RGND 1CXFA 4Z7WF 3U9UA 1CFVH 3O8XD 3OAZK 1U3HC 2ZCKH 1EPFA 5I15L 3NFPA 1KLFA 2YMXL 1CN4A 1E4XH 1BEYL 1K8IB 2EH7H 1GPOH 3B9AA 3HKFA 4H8WH 5C2BH 1D9KA 3IU3A 1NANH 1Y6NR 3G6AB 4F9LA 1H3UA 5IR1B 1JYXA 3HC4H 2NXZD 2VLLB 2QQKH 4MQTB 4NBXB 3MCG1 4OAWA 3ES6A 4HBCH 2BVQB 3WXVL 3A67L 4EBQL 1FIGL 5IB2A 2VWEE 5E8NA 4HLJA 4FQJL 1Y0LA 4WUUE 4JRXE 1I3RA 4MLIA 4I2XE 2XZAL 5GS3A 5IEKA 5GS0L 1DE4B 1CFSA 1U41A 1MIEL 4FHBD 2FBJL 1NJ9A 1T21A 2MSPA 3KPLA 4JM2F 3UTTE 1XGRB 2EE9A 3CGTA 2ZCLH 1A6ZA 4BSJA 5LWYH 4JFQA 3NCJL 1FYTA 5IBUB 4DCQA 5DUPH 5IFJB 3VXSA 4LNRA 1HILB 3CD4A 4U6TA 1SYSB 4FQ1L 5IVZA 5KVGH 1EFXA 3HMWH 2GUOA 5E6YA 1ZGLP 3RY6C 3PWPE 1UM6H 2OXHA 3E6HA 3IDYC 1MCDA 2GJJA 2BNRD 5EIIA 3NGBC 2W91A 3BSZH 5E8PA 3MRJA 4OB5H 3MJ9L 2Y5TB 1N6QH 3IDYB 4XPFL 4W81A 2HLFC 4P3DA 2N7BA 3GJFK 5KVFL 3O81A 4ONGL 4PRBA 4HEPG 2FH8A 3UO1H 2E27H 3VFSA 1K8DA 1QSFA 2NW3A 4MHHG 5J3HD 3VFUA 2YEZB 3O6LH 4MMXC 5AG8A 4Z7UE 3NZHL 1MUJA 5GZNC 3P0YL 5E6IC 4HIEB 1YMMA 4MA8H 2N7AA 4HKJA 2EIDA 4TSCL 2FJGB 4KI1A 3BJLA 2VLJD 1U58A 5ISZB 3ULVL 1SQ2N 5JXED 2VTFA 2E27L 4JZJC 4UMGA 5FEBA 1NGWA 4LSVL 5IVZB 4JEGB 5HGBA 5FYLE 5KG9A 1FC1A 2FD6H 3ARTA 4M7ZB 1HH9B 4NP4L 3HC3H 3PP4H 3G6DL 2BK8A 3FQRA 3ZT5A 3DO7B 3TWCL 4U0RB 1WLHA 3MR9A 4WHTA 1WJ3A 1IEBB 3MBXH 4U6HA 5FYJE 5B8CA 4I0PA 4RA0C 1ZGLB 1X7QA 4EUPG 3F58L 2BNQE 3VE0A 1AGDB 3WDHA 1T4KB 4YDKL 5D7SH 3UTSE 2YPLE 3WIIL 2O5YL 5EU6E 1J0ZA 4EIGB 2AV1B 1WT5C 1M05A 5I16B 5I74B 4J23A 4YDIH 3LH2H 1NCAH 2W9EH 3WFEL 5T1KD 3MNWB 1R5VB 4OT1H 3QNYB 1U58B 4JM2B 1N2RA 3QIBA 5FUZH 4BFBD 4O51B 3FONB 4GRMB 5FUCE 5F7EH 5HHQB 3HI5L 2P24A 4ZAKD 3FT3A 4EQ2A 1GC1C 3CVHL 4TNVK 2EC9U 4IRSD 1DQJA 3P40A 4OGAC 4NO2B 3EBAA 1JF6A 5GRVK 5DWUH 3GB7A 4JDZB 2XZQL 4FZ8L 1RIUL 4LMQE 5EUOB 2EE3A 3B9EA 4LPCA 4NT6A 4DEPB 5TDNB 4RAVA 1J05B 1YY8A 2HT2D 1LD9A 2WUCH 4HMCA 2IQ9L 3SKNB 3QFDA 5CBAA 1MFEL 3QI9C 4RA3A 3ARRA 1E6OH 4B50A 1K4DA 1DBJH 2ZPKL 3OF6A 4ZO7A 1S9XA 5F7LB 1X5KA 3SKUD 5JXAH 3LPFA 5F89A 1CBVL 5DMJB 4GKSB 3W0WA 3ILPA 2IWGA 4XWOD 1PYWB 1LP9B 3VA6A 5I18H 3FRPA 1NEUA 4WI4A 4XPHL 2AVGA 4ODUA 2WUCL 3WKNA 1MLBA 1TZGH 3HNTH 5FO7B 1A2YB 4FQJH 2B2XH 3VXUB 4LPWA 3BZEA 3MRFA 3T2QA 3IVKB 1DLHA 1JFQH 4WFHD 2HMIC 1F6FB 3ALPA 4YIQA 1KJ2H 1KJ3H 2AEQL 1TQBB 3MBXL 3IKCA 4S1QH 5TE7H 1V3LA 3GZKA 1VFBA 4OZGF 2VAJA 1DANU 4Y5VB 5FDWB 2V2XA 4JDZA 3C5JA 5DS8B 5T1DH 2IFFH 3HMXA 2PXYB 4XP9H 5HHOE 4Y1AA 3ARYA 1UVQB 3BPNB 1CFSB 2R2HB 4NO5A 2DWDA 2AXFB 3OF6D 5JIHA 5KANI 4CN4A 4M62L 1F3DJ 2X70B 4MZ2A 2W0PA 3EYFB 4G43A 4X7TA 4X6BB 4NM8H 3S96B 3VWKC 2OTUB 2Q8BL 3BDBA 3CVHA 2HFEB 1EFQA 2QADD 5CMAA 5JR1L 1A2YA 3D39A 4JY5H 1AXTH 3ALXA 4OQTA 3TIDB 5T3XD 3RL1B 3WFZA 4UOW1 3ULVE 5B38G 4BQBA 3MUJA 2NMSA 1XGQB 2N1KA 5IVXA 5F7FA 3WEXB 1HXYA 3WNPA 3F5WB 2HKFL 3B3IA 1AXTL 5FOBB 1KG0B 2VDQH 2PTTB 4QTHB 5I1KL 5HY9A 1JTOA 4FS0A 3B9VA 1LILA 5E08H 2QQLL 4PTTB 5GRUH 4JHWL 2OZ4L 5I18L 1CZ8L 3FRPG 2GJ6A 1UZ6E 4UIKL 1GIGL 2R0KL 4OUUB 3S34L 2Z93A 4OZ4A 1HHIA 1WCBB 1A1MA 3W39B 3BKYL 5JW4Q 5CBEB 4LKXA 2B1HL 4ONOA 3ULSA 4LVNC 4X5LA 4KMLB 1JGVH 5I1LB 3UTZB 3CMOL 4LF3A 3KWWB 4WY7H 4LCCC 4ZFOL 1FVCB 3FJTA 4I18A 5EB9A 5E7FA 1A6VL 4DTGH 4HJJL 4QRPE 1ZGLA 3JXAA 5F7DB 5MENA 4ZAKB 3VFTA 3BHBA 2HVJA 2ZWLT 4OCLC 4PS4L 4PJCB 5GRJH 5AEAA 5HYJA 2ZKHH 3QFJB 4PGDB 3U4BL 2R4SH 1XZ0A 3MODH 2NXZB 5GGTA 2VDNL 3V6OE 4GLRH 1QBLH 3NIGF 1A1NB 4EIZC 4AL8L 3QIWD 4HK0A 4Q2ZA 5GIRA 1OPGL 3EAKA 4LCIH 2G2RB 5B38A 1U6AL 3WJJC 1CFBA 1INEL 2ADFL 3VXME 5ICZB 1IAOA 5DWUL 2EDOA 5GGTH 3QWRD 4AZ8A 3TH3T 2J88H 1GGBH 3K2MC 3O6MH 3S7GA 2QTEA 4HKBA 3V6FA 1ITBB 1E6JH 5D2LA 4OSUH 4KQ4H 3FN0L 3T0BA 1AO7A 3KVQA 2FX9L 4ELMF 4NOBA 3QUZA 2CO6B 1ZS8A 1H3PH 3WSQH 5JZ7D 5CFHA 1NFDA 4N8PA 2J6EL 1FLRH 4PJFE 1P84J 3D2UB 1UT9A 4YHNA 2O5XH 3SKMB 1V7MH 5BVPL 4JRXB 1R0AL 3SGJC 2D0FA 1U8KB 5INDA 2VR5A 4KZEL 4WDIB 5C0GA 3D25A 4Q2ZB 1ZMYA 1KJ3L 4GMSL 4KTYA 4ODUB 4WI6A 5E9DA 2CMRL 2ESVE 4KK8D 4Z7QE 1I7UB 5L8JB 3MPCA 1NKRA 3NA9H 2O5XL 1ZKAA 4WTZA 3KPTA 5T33L 1R0AH 3P4LA 4KVNL 1D9KD 5ALCL 3U7WH 3HFMH 4YHIA 3VW3H 2PO6C 2CQVA 1J5OH 3MV9B 2EYRB 1IGCH 3SDYH 4XPBH 4OI7A 4OCXH 1SY6L 4QXGL 4HC1H 4NQDE 1N64H 2Q8AH 3U4EB 1A6PA 4KI5F 5EO9B 2X41A 3SE4C 4ZG1A 5CD3B 3C6LB 1KB5H 3PHQB 3ZTNL 3WV0A 2DI7A 4G7VH 4XMLL 4Y2DD 1OL0A 2ZJSH 1WVZA 4HK3J 4KVNH 3VI4F 1JV5A 2EDFA 4CNIA 4YHNB 3WFHA 1T1ZA 2NTSP 3MGOA 5HI3C 1Q38A 2BVEA 3GUTB 2PNDA 2AW2A 5DUBB 3MMEB 3N9GH 1FN4A 3GSVB 1CXIA 1PQZA 1QFUL 4R8WH 5T3ZE 1R5WB 4HPOH 4CU6A 4F7PA 2EDNA 4JVPA 4N8CL 4MB5A 3QRGL 2VDKH 4LSRL 3IJSB 4FRWA 3SEPA 4PB0H 4P2OB 3EO1B 3MRDB 3L3OB 4AY0A 1A7PL 5T1MA 3MRRA 2XZAH 4PR5B 5DTFA 1FNHA 5HXMA 1LGVA 4X0KB 5DD5H 1CFNB 3WXWH 2HRLA 4M5ZL 3C87A 1SM3L 1MH5B 5EBWA 5KANG 3VFWB 4C56A 1A7NH 2CK2A 1ZT1A 5IVXB 3PV6A 3RWEA 1TVHA 1MQKH 4PJFA 4LRNH 1EHLL 4NOFA 2VXVL 1DBBL 1I1YA 3DUSB 4QCIB 1MCPH 1G6VK 3RVVC 5L2JB 1EHNA 2KPNA 3IFPB 2PTTA 3LQAH 4QTHA 1A6AA 5E1HB 1AE6H 1UACL 1CT8A 1QVOB 1T2XA 1RJLA 3H9ZA 5D2LE 2EZ0D 5D6DA 2YWZA 4G8GD 5HYSA 3OKEB 32C2A 4PRPA 3RQ3A 1KBGL 1IILE 3MCLL 4IEFB 1JPFA 4MS8C 1JRHH 5C2BL 2Z93B 1UB6B 3QDJB 1YDPB 1PD6A 1U92B 4X4ME 2L0DA 4Q9QH 1HHKB 3BGMA 5IJKC 5ALCH 4FOMA 3MLYH 1SEQL 4LF3B 1OAZH 3BN3B 4XPGH 1KCLA 4M61A 2GFBA 1TZIB 3UEZA 2VDRL 1F90L 2EXWD 3HTLX 4NC1C 1CF8H 4OGYH 5F97E 3BQUA 1UCTA 3SO5A 3QUZD 1ZK9A 1N5AA 4QF1B 4B0MM 3QFJA 1KTDA 5HGGS 3CLFH 4LHQB 4F58H 4RRPG 3BWUC 5I76B 3MNZA 4HAGA 3QEGL 1MHPH 3X3GH 1RJLB 5HHPA 1XR8A 3RWGA 4RGOH 4PRPB 1PY4A 2DQTL 5IW6B 2DI8A 4K71C 4OGYL 4JFDE 1UH2A 3VWJD 2BHYA 3FB8B 3TJHD 3U0PA 4KRMB 4QHKI 1KTLB 1WEJH 5D1ZA 5LBSL 4DKFL 4NCC1 1F11B 5FM8A 4U1GB 4XWGL 3U0WL 3E2HC 3WHXA 1W72H 1N7MH 3ULVC 1OQXA 2PCPB 4MJ5B 5EA0H 2GFBB 3ES6B 4Y4HA 2IAMD 3VRJA 1TZIA 1U93B 4PJIE 2DQEL 5TQ2H 3VFGL 3VXUE 1BFOA 4O2EB 3WFEH 1YNTA 3BFOA 5CEYB 5JUEH 2GYSA 5TE4L 3C2AL 3VI3E 4DVRH 4PJCF 1QEWA 3TBSB 1F6AB 5IB5B 2IADA 4GAJH 1AQDB 3HE6C 5JQHC 1V8HA 4F15B 4BA8A 3VRLE 3SGEI 1WAAE 4N68A 3HC0A 3TN0A 4U1KB 3L7FA 4HT1L 2GKIA 3HUJE 2YD5A 4N0UA 4PRNA 2V2WA 3CZFA 3FB5B 4PLKD 2P8MB 2HT3C 4XNQA 2W9LA 4TNWF 1SY6H 4QXGH 1JTTA 1MIML 2XWTA 3S37L 4BH7A 1B6UA 3MBEC 1X5LA 2CIKA 4JREC 4X4XB 4IS6B 1G1CA 5SWQA 3UAJD 3AY4A 3KLAA 2ZOKB 1YNTB 3HB3C 1K8DB 5CEYA 1D5ZA 5CP3A 4QOKD 1GYAA 2DQIL 2DTSA 5A2JH 1UQSA 1HSBA 4NWUL 4PTUA 3S36H 3SGDI 2DOCA 2X4PB 3S35L 2ID5A 2UY6A 1XF4A 3ZDYE 1GJIA 4N0UB 5ISZA 4R4NC 2HFFA 4MNQE 4V1DD 3RNKB 3V5DB 2GAZA 5CLWA 3NTCH 2DDQL 4S0TD 3BKCL 2ZUYA 1JWSB 2AEWA 5B39B 1QBMH 1PJ9A 1Q1JL 4HS6B 2Z4QA 5JPMB 3SE8L 3V2AR 4Z8FH 4OF7A 1AQKL 3I2CL 3PV6B 1NCBH 1W8NA 2P5EA 4RQQB 5DC4B 4L9DA 2AXHA 1T5WA 4K8RH 3TESA 1DANT 1KT2B 4PRAA 4GW4A 5SWZA 1MFAH 2NY0D 5I66B 3LPWA 2GK0B 4PPTA 4P49A 1CLYH 3TT3L 1OTSC 4HJ0D 3MUHL 1T2JA 3WKMH 5DJXB 2OX5A 3MROA 5BMFL 4WEBH 2RBLA 1FYTB 2VITA 4P46A 4NKDA 2DM3A 1GZQA 5ICYA 5DHYB 4P5TC 2EO1A 4XI5C 3HZYB 1MF2H 3BESR 4U6XB 4OKDA 4X99B 4Y16B 4Y4KC 1FORL 4E41E 2V7NB 3I02A 3LEYL 2W0LA 5C0EB 2ZOLA 5EOQH 3RNQB 4GRLA 3T4AA 2F15A 2X4TB 4LLYA 4CMMB 4NC1E 4LGPB 3QH3B 3L95B 1VPOH 3BP5A 3VGEA 1S7XA 3FO1B 3U6RA 3DMMD 4GOSA 1UEYA 2Y07L 4XNYL 3B9KD 3OKMA 2E9WA 5CINL 4BKLA 1A1OA 5DZOA 1IGYB 3R0NA 1A0QL 1F2QA 4MAYD 3RAJH 4HQQH 1ZLUH 4WFFE 2X9XA 4HUWA 2VRAA 4ZXBC 1XR8B 2DN7A 2NY4D 4A2MA 3ABZA 5LVEA 3CMOH 1U95B 4HKJB 3WBDA 5C0IB 4EJ1C 1YPZB 3FB7A 3BISA 4KKNA 4I5BB 2VUYA 3MOQA 2FYYB 3DJ9A 1I3GL 2ZCLL 5JNYA 2FO4B 2FATL 5FO7A 3PHOB 1JYNA 1R3IL 1MPAL 5GPRA 1PY9A 5TE4H 5KJRH 1R3KB 3RIAK 4LNVA 1G7IB 3LKNB 3TPUB 4ZUWB 3SBWC 1HHHA 4Q97A 1JPGA 2VLME 3ZKXC 4RFNC 1S7XB 2O61A 4NRYA 4ONFH 2UZYB 3TBTA 1TCRB 4C55A 4X9IA 1AJ7H 1T1XA 4KROC 1YY9C 1UM5L 4DVBB 3MRGB 3KYOA 3UTPE 5JW5A 1T6WA 2FJHA 4KK9C 3VFSB 5FIEA 4XNXH 4PP1D 1XF2A 4GQ9L 3DTXB 3MRCB 5HVWA 4UDUA 3KJ6H 1ND0B 2W38A 4KTEH 4WV1C 4X7SL 3MRBB 3D39B 3PP3H 1B3JA 5FGSA 1D9KB 1XH3A 3BKJL 3NFNB 4HCRA 3S3PA 1MRDL 2CR6A 1T3FB 5LCVL 5TDOA 4X6DB 3QJHA 3ULUC 2VABA 2OL3H 1VA9A 4XP4L 1A6UL 2L4OA 4LCWE 4W4OA 3BUTA 4LHUD 4ESKA 1LE9A 3QHZH 3FQRB 5ESAA 1YYML 1KB9K 5HI5D 1WQVT 4LSTH 5ESQA 4X6EA 2CKBA 1S9WA 1X7QB 5F6HJ 1Q9WA 3NPSB 3VE0B 2ESVB 4DW2L 5GGQL 5CS7A 4QRRD 1I8MB 5J7CC 2CKNA 2VR9A 5EU7C 5FYJH 4YXKL 2R2CA 2XRAH 4IDJL 5IMMB 5FECB 2MTPA 1UJTA 1ZLVH 3VXSD 2EECA 3F6LA 2I07B 2BDNL 5FCUL 5GZOC 3P0GB 3V7AG 3JSSA 1I75A 3MREA 3X14A 4PV8A 4HFWB 4DUXA 5I0DA 1G7HB 5ADOH 4X6CB 3X3FL 2XQBL 3IKCB 2P24B 2BC4A 5CSGA 1PSKL 3VFPB 3D9AL 4UU9B 1DQJB 4WW2A 5CSZA 1RULL 3I6GB 3FT2B 2Z92B 3V5KB 4PGDA 4BK4A 2XZQH 3PGCB 1WF5A 4X6EB 1NUDA 2IMNA 3R1GL 4NO5B 4YXHL 1Q9WB 1VHPA 1MUJB 5E99H 3K2UH 4JO2L 4CU7A 3KPQB 5HBBA 2KZ1B 3ZL4H 1S5HB 4J7RA 4PGEA 3HI5H 3DX7B 4ZFOA 3EUUA 5E6IB 1X5XA 2FEDC 1PEWA 1UYWH 3GHEH 4TPRH 3T0EE 1I3UA 1VEPA 3SOBL 2B20A 3AAZA 2V7NA 1WZLA 1RFDL 3I02B 1DEEA 3B2UD 2JIXA 3RVTC 3LQAL 5F9DC 4X9BA 3C5ZC 5HHNB 4J4PD 4NQDA 1QLRB 3IDXL 5A16B 1S7TA 1MJJA 4H8WC 1FSKC 3LVEA 1E6OL 2I9LB 4ZTPH 3VFPA 4JO4H 4YDLC 5HHXL 3P9LB 2AABH 4JFYA 3MLUH 5F7HA 4PD4K 3QUYC 1QG3A 1SJEA 1RZFL 1FRGH 2MHAB 4XNMB 2DYPD 4C59B 3T1WA 4OCRL 3BJ91 4E5XB 4K94L 5KJRL 2FJFA 3FO2B 3ZDZF 3GSUB 1VENA 5FCUH 2GJ6B 3BZ4A 2D3VA 4JO4L 1S9YB 4AEHL 4JPIB 5KW9L 1KPUA 3ARUA 1I8LC 3JUYA 1NCDH 1F4WL 1FE8H 3CVIH 5J9PB 2DKMA 3V4PL 1EJ6A 4BQCA 3QIUB 3KWWA 5H94A 1HZHH 3GB7B 5AUMB 1W8OA 3VXQB 1OSZA 3JV6A 5DVNA 1JYVA 3REVA 3TO2B 4MGXA 4NFCA 3EGSA 4JFDB 4OBRA 2DQTH 4RAVB 1ZHNB 4FQ2L 5DEZA 3A67H 4EBQH 4HULB 5GRVL 1EBPA 5DR5L 3K2UL 5DRZA 1BJMA 1SJEB 3MV7E 1HHGB 4LQ1A 5FYKE 4I1NB 5J6HB 4M1GH 1KACB 5I8CB 1DFBL 3HR6A 4J3OC 1JWMB 4F7TB 4JY5L 5EA0L 2F53D 3EJZC 4XPAH 4FQ2H 4G8IB 2E8ZA 2NY2C 2X4RB 5F7WC 4ODVH 3TBYB 1KPUB 4L4TA 5CZVH 5ID1B 1QOKA 5JO5A 1JNNL 4KI5C 4R9HA 5DMGC 1WC7A 2B1HH 5IW3A 5C0NC 3PUCA 1RZJC 3MXWH 3I3DA 4XMKL 3T3PF 2E8YA 5FDWA 1WZMA 2V2XB 1Z0NA 3JV6B 1TJGH 3VFRB 4U1NA 4LSQL 1PG7W 1NLDL 1WBYA 4ZXBA 2IANA 4PJGA 3MJGX 5K33A 4OGZA 1X5IA 4Q9RL 1Q9OB 4GXVH 2ICWA 5IFHL 4ENEC 1CWVA 5D96C 3WIHH 4K94H 4M93C 1MIMH 2W1NA 2DIJA 2X70A 3T2NH 4DGYH 1QQDB 3EJYD 4L3AA 5EZIH 5CZXC 1EDQA 1JPFB 4EN3C 1TNMA 2D7TL 4WI2A 3S96A 3EZ8A 2V7HB 3KDMA 8CGTA 3WS6A 1IKNA 3DXAD 3VFNA 4HK0B 4HWBH 5GIRB 4YFDB 2P7TA 2X1QA 4PG2C 1NGQH 1A64A 5LKNA 3F7VB 2GIYA 1J18A 2AAVA 4D8PB 4UV7H 1ETZA 5MP6H 5TE6H 2WQ8A 3IDGB 5FO9A 4OZFB 3LKQA 3VGAC 4DAGH 1NC2A 1VADB 2FNBA 1KIRA 2VDNH 2NY5H 4LPUA 2VZVA 3Q1SL 3OAUL 3V5KA 1RAMA 1U8LA 2HMID 2OTWB 5HY9B 3MNZB 3P73B 5FF6B 3MRKB 4R26H 1NMAH 4Z7WA 4Y1AE 3OKYA 2C4FU 1XMWA 4HGKC 4AEIH 1QBAA 1CLOH 1EFXD 3MRQA 1NQBA 3RGVC 4R7DB 3UBXB 2EDXA 1LO4H 1QSEA 2VXQL 2CLVA 5BCAA 1NBYA 5IW6A 1S5IL 1QQDA 3TO4C 4M6MH 4OZ4B 3ZT6A 3STLA 1AFVH 1KTLA 1XGTA 3QZWB 5C0GB 1QACA 4XVTH 4LAQH 1F11A 4WHDA 4YNYA 4U1LA 1M71B 4Z0BL 5I1KH 4LAJH 1PKOA 5I8EB 1EXUA 1H3XA 3BYTA 2YA0A 2ICES 2VOTA 4P59L 4D8PA 2CPCA 3SDXE 2VDLL 5SWSD 4H26A 1CFQA 3OR6A 2IFGA 3KR3L 5BOZG 1U9KA 2FEEL 2R23A 2X4OA 1IAIM 2FEEI 5ILTH 5LAXB 2JK5B 3HZMB 4IMKC 1F6AA 3F7YB 5IB5A 4BYHA 3QDGD 1ZT4A 1CCZA 3MRKA 2Q3AA 1QVOA 4JRYE 1BJ1J 2BSSB 3O9WB 5J8OA 1P1ZA 1RUKH 4E5XA 1FV1A 4ERSH 1A6WL 1EJOL 5LQBL 1W72A 4LP4A 1BWWA 4LIQH 1MCWM 4L3EB 4ZPVB 1DVFB 1NGPL 5ICZA 2J5LC 4P23C 4G9FD 3IXTA 2FHFA 3GSWA 2OSLA 3PV7A 4EN3D 2D0GA 1XGUA 4MNQA 2QQQA 5H8DA 2YD7A 5DUBA 1A3LL 5HPMB 1QYGH 1H9VA 4MX7B 2XTJD 4F2MA 2JJVA 3ARBC 1C1EH 3G04A 1T1YB 1Q0XH 5F1OB 2CIKB 5TE7L 1ITCA 3NIGE 5BV7L 5JDSA 4PJAA 1INQB 4IS6A 3LB6D 3ZKNC 3VXPA 2CSPA 3U30B 1ZS8B 1NGPH 3QEUA 4IRZL 5GGSY 3O41A 3QRFM 3F7RA 1G7PA 4MA7H 4P2QE 1U6AH 5KSBF 1CFNA 1MCIA 3TN0C 4JPWL 4WU7B 5T3XH 2C4FT 1S7UA 4P5MB 4ODTH 4YC2C 1NGYB 3UPRA 2QV2A 4NN5B 3IAPA 2WWKO 2VLRA 4OLVH 2FATH 1EVTC 3Q0HA 2JELL 3IFPA 2VSDA 4ONHA 5JXEC 1XF4B 4IRSC 4O00A 2FO1A 2VDKL 1H8SA 1J12A 2YA2A 3B5HA 5C8JA 2GAZB 5D1QC 4L3EA 2DQFB 2VNCA 1MFEH 1UJ3C 5IROA 4FQHA 4LHJB 1KLUA 1NGZB 3ZKMC 5HVFB 4HS6A 3B9KB 3QQ9D 1HEZA 4WW1B 1SM3H 4J4PA 4XCFH 5TPWH 4L4JA 1R3HA 1CFTA 5ERWA 5HVHB 1X5JA 4NHUA 1MJ7H 3VXRE 1RUQL 3KHOA 2MQ0A 1TPXB 3WFBL 1F8TH 5EH1A 1RSFA 3DV4B 4QHNA 1R3JA 4MQXC 4NQEA 5F6IB 5GXBB 4RDQF 4GSDH 5C0AD 2ESVD 4TNWK 4JHWH 3TLRA 1FFRA 4KC3B 1YEKL 3UYRH 2FGWH 1KB5B 5DHVH 3QIUD 4Z7VB 2XWJB 2QQKL 1U91A 1WFTA 1DBAL 2VDQL 4LOUD 4J1UB 4YDIL 2ZNWA 5I76A 3AM8A 3NIDF 1F8TL 4H20L 4RGMC 4XCEA 5DJ0B 5FHBL 5B21A 1LK2A 3CSYA 3FMGL 3BT2L 2DICA 5IOPA 4WW1A 3VI4E 1C7SA 1WTLA 4P0DA 5DTFB 2VJXA 5C08B 1C12A 4UQ2B 5CSBA 2EYTA 3IDGA 3SKJH 4Y4FA 5EUOF 3U0WH 4H1LA 5J11B 3IB4A 4KRPD 2IG2H 4XAKD 2A6DA 3RKDD 5BZDB 1CU4L 4X7EC 1DQDH 4HC1A 3D0LA 4RGOL 5DXWA 4K3JH 3LRGA 2B0SL 3QPQD 4FXGA 4LAQL 5HYSB 3KPLB 5MEPA 1YEHH 2CLVB 3SE9L 3KLHD 4LSPH 3IFLL 5DJ6B 4I3GA 2R4SL 1BM3H 3MODL 3PJSA 4NN6B 1YPZA 3BP7B 1N26A 3B6SB 1UB6A 3BKJH 3STLB 2EIZA 3K4DA 1OWRM 3MLSL 3TCXA 3Q5TA 5GRUL 3SN6N 3MV8E 3FOLA 5HI3D 3VXRA 2GTWA 2PW2B 3O6KH 4UQ2A 4D9RD 3FT4A 4JE4B 2CJUL 1K8IA 1UG9A 3OKOB 3QEQB 1MJ8L 1MI5B 2FL5A 2OCFD 5J89A 1TZHA 4JO2H 5IR1A 4MXQC 3RWDB 3MLSH 3LMJL 4WWKA 5JTWA 3W9DA 3FOMB 4C4KT 1BD2B 5HYJD 1KTDB 5IV2A 3QBTB 1MRCH 4BK5A 1YN7B 5IHZA 1FAIL 2CJUH 4PJEF 5MEND 2WWMD 5KVEH 3RWGB 1YN6A 4WHYH 4LGSB 5F3HB 4RGNB 3C9NA 1S9VA 4FQXA 3KPRB 4JREB 5ACMA 3ZKSD 5DURB 4QHUA 3G08A 3QXDA 2C1PA 5EG6C 4APQB 3NZ8B 1WZ1L 5DYOA 4MX7A 3BRFA 1BVZA 1CLZH 1KXTB 2A6IA 2AXGB 2AABL 3VFOB 2P8PA 3SKJL 4NQCE 3GSQA 5KVEL 3FQWA 4AJ0A 2P5EE 5C0EA 4ZD3L 2X4TA 4CMMA 1YEGL 1TJHL 3HC4L 4KJQD 4FABL 3BX7C 3VJ6A 5J4MA 3IKKA 4WCYL 4Z7UF 3T65B 1BVLB 4U6HB 5B8CB 3OXSA 5GGSA 4WNQB 5DVLA 4G80A 2APXA 5IHUL 3UPRB 3T4YA 2H8PA 4HIIA 2VZ3A 3SGJA 4GJTB 4RAUA 3HRZA 4DKFH 1V3MA 4CBPA 3RKDC 3W0WE 4OV6F 5DEFA 5CEZE 1YN7A 2AV7A 4PRPD 4R90L 2DQGH 4OF5A 5ISZE 2QSQA 4XCFL 5TPWL 1NMCB 4YXLH 1JUFB 5HHOD 4UIMA 3KLHC 1D5MB 5SV3A 4DK6A 3LKOA 3VXUD 1MFBL 5D93B 2DLFL 3PWUA 3VI3F 3QXDB 3CAFA 2XWTB 3K46A 1LP9F 4KZEH 4W4OC 3WXWL 1H5BC 6FABL 3NH7H 1JF5A 4RSVA 4Z7WE 4F37K 4NHUB 3OR7B 2QR0B 2AQ1A 4UINH 5T5FH 2FGWL 3MV8A 5IB2B 3V6ZB 4DWHA 5K9OB 2R69L 5KS9F 4GW1B 1HH9A 5DRNA 3T65A 2DS4A 2B8OT 1Z9SA 1DE4A 2M8XA 3NGBB 4BELD 3QEHB 4IRJA 4JDVA 4PYGA 3SCMA 4MXQD 12E8L 2P8LB 1I7RA 2R4RL 1AGDA 1F6LL 3RPIB 3C8KA 4RMRA 3MRPB 3UDWC 1TTFA 4NKQB 2NXZC 2VQTA 4PGEB 4I2XB 1V7NL 2R56H 4UIMB 1BD2E 3UYPA 3P4MB 2WANA 1LK2B 1WTGT 4GBXD 2BNQA 5C7XL 3BEVB 4QRPD 2GUOB 1JRHI 5SX4H 5EFIB 2DYPB 2R4RH 3EZJB 2Q3ZA 4LSSH 2VLRD 4YK4C 5IIEB 3O3DA 3BPLC 3MRFB 2NY4B 4TSAL 2Y9RT 3GI9H 2IC2A 1SY6A 3WUWG 3LN5A 3K3QA 1MVFA 3GNML 3RUGF 2H26A 2AK4A 2F54B 3S35H 3ZDYF 4HG4J 5ITBL 1TTGA 4LLWA 5SWSB 3DNKA 2EE2A 4HQQL 4TSBH 1FGN