2X1OA

Gelsolin nanobody
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
120
structure length
120
Chain Sequence
b'VQLQESGGGLVQAGGSLRLSCAAAGRNLRMYRMGWFRQAPGKEREFVGTMVWSSDTIYYADSVKGRFIISRDNAKNTVYLQMNSLKPEDTAVYYCAAGAGWAGTMTDYNYWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GELSOLIN NANOBODY
molecule tags Contractile protein
source organism Lama glama
publication title A Llama-Derived Gelsolin Single-Domain Antibody Blocks Gelsolin-G-Actin Interaction.
pubmed doi rcsb
total genus 30
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1oA00
1F6AA 4ZD3H 4OFYA 3R8BB 5I8CA 4Y4HB 1A64A 3WXVL 3WL9B 1OPGH 1WCBA 4WU7A 5GGRY 3SKOB 1FIGL 5AZEL 4J8RB 1MPAL 5HGGS 3RY6A 4XT1C 4XB8A 3D0LB 3TO2A 4OUOA 1U8PA 1BQHG 3QEQE 2WAHA 3ARYA 4PJDF 4JDVA 5DHYB 5DEGA 2FYYB 1FQ9C 1GH7A 1RIUH 2H1PL 4MS8D 4ODHH 3BJLA 4F7PA 4EDWH 4Y5YC 1MVFA 5KZCD 5C0GB 3OR6A 4WHTA 2CXGA 4H25B 5CS7A 5IW3A 4JKPL 1U93B 3ULVC 4PJAA 1OP5H 2YHGA 5IM7A 5CJXC 4JDZA 3KPMB 3S37H 2YEZB 3RWIB 2VZ3A 1F6AB 3PWUA 1AJ7L 1JZ6A 1RZKC 4M3KB 3W81A 3U9PL 4OZGB 4KK9D 2EIBA 1JWUB 2RCSL 3GJEA 3GMQB 3VRJA 5HBBA 5GISH 3QIWB 4L3EA 3AY4C 3L95B 1NEZA 4NCDA 4E0RB 2LU3A 4R4FH 3VH8A 1IAKB 4ODUA 5GIRB 1K4CA 4YHPB 4XVSH 4PRAA 4KV5E 4G6KH 2NY4C 3MRKA 5IT2L 5JUEH 2ZWLT 3OPZL 4POZD 5L7XL 4GBXB 3KXFA 2IEPA 4ONHB 4IHOB 1HXMA 4MNGA 1CK0L 3ARQA 3T1FA 4KY1L 1QRKA 1GGTA 3FCTA 5MP6H 5I17A 3QUXA 2BJMH 1KCVH 1V3KA 1EUUA 4ONFH 2Y23A 5DSCA 3MUHL 4M7LT 5INDB 3RX7A 3UYOD 1B0GA 5B4MC 4GAJH 3VRLE 3RGHA 4JN2B 4DKEH 3HZVA 5MP6L 2BY0A 4PJEF 2HRPH 4XMLL 4PJIE 4GLRH 3RZCB 4PJAF 4WTZA 1LD9A 4JRXE 2HJKA 4UT7L 3SDDB 3D3VB 2NX5A 3J8F7 2NTSP 3FQRB 1DR9A 4NKDB 2HRPL 1KJ3L 4NNXB 2ICEA 3BIAX 3HS0B 5DRNB 2E3VA 1A22B 5E6YA 3VXRA 4QNPF 2H2SD 1EFXA 1SY6L 3S36X 4XBEL 3RUGE 2IPKB 4PRIB 4UNTA 5D2NA 3IKCB 1VB9A 5FHAL 2VXUL 1DCLA 5F21B 1DQML 1SQ2N 5HI5D 3TO4B 1MCBA 3BD5A 1IVLA 4P5MA 3AREB 5HI3D 2BDNL 3VFSA 5SWQB 3D85B 1B6DA 4LHUB 35C8H 1BREA 3REVA 3KR3L 1JJUA 1MWAH 3NTCL 1A6VL 3QFJE 5IJKC 1KENL 3OG4B 4QRQB 5JXAH 1JZ5A 4V1DD 4ZNCD 4Z7QE 3VMOA 4PJGB 4K9EL 1NEUA 1DANU 3MLSL 5LGKA 5T3XH 3UJIH 4XAWL 1GZPA 3HG1D 3O41B 3B83A 3L5JA 4MVBD 1I7RB 3IU4H 3QNZA 3VCLB 3O41A 1A3LH 4Y1AD 1GC1C 1KCSH 2VRAA 5JW4N 1KLFA 4JFZL 1A1MA 3CFDB 2C3VA 4OCYL 2GCYA 4FQ2H 1TZGL 1Y6MR 1CFQA 5D7SH 2A6IB 2NR6D 4G6MH 3O9WC 4IDLA 5TE4H 2AABH 4OCYH 3AREA 1CYGA 3LD8B 5BV7L 3WIFB 2H45A 1OTSD 5I19L 1L0XA 2WK2A 5ESQB 3N1FC 3ZDYE 4P4RA 5B39A 3WSQH 5KVGL 1MCRA 4OGAC 5SWZA 4POZC 2YA0A 2BC4B 3GI8L 4MNQE 3HUJA 3RZWA 2H32H 3BQUA 3N1GC 2D7PA 1AIFA 2DS4A 1CGYA 5CGYD 3LAFA 4MQXC 1FG9C 1CCZA 4ELKB 4ZNEA 1CBVL 1YEIL 4JGUA 5SV4A 3ARTA 5J3HC 4JFED 5IW1B 4PRPD 2IBBA 4LCIL 1JPST 5LWYH 2CDFB 2F53D 3BP4B 4P23D 3VGGA 5I0DA 3UTTB 4YQXH 4LIQH 1NGPH 3ECBB 1DVFB 4RDQF 3MRPA 1FG2A 2AEQL 5C0IB 5CZXC 1X5FA 5D7JC 3VDCA 3ZE1F 5TDOB 1U3YA 3EYVA 2G2RB 3IDGB 2NXZC 3V6BR 3H0TA 3PXHA 4WI4A 5DFVD 4LVOC 2A6DB 2XXMB 5T1MB 4W6YB 4QHLA 3ZDZE 1AY1H 1U8IB 4X4YA 3K8KA 1L7TL 3KWWB 3MOBL 4GBXA 4ZAKC 4NP4L 3WS6C 3GSOB 3SO3C 2CXKA 5B3NA 4OLWL 3D5OF 4P3CH 3C9NB 3TN0B 1WBZB 4K7PY 5DK0B 1UB6A 2P5WD 4OD1H 5JIPA 3L3KB 3UTSA 3QCTL 4EIGB 4XNQA 1KPUB 5C86A 2GSIA 5JXEA 2P49B 2P5WB 3IFOA 1F13A 3SE9H 3IS1X 4MLIA 4U1HB 1K8DA 3ZYJA 3QAZC 1XGYH 4WO4D 5DS8A 2CRMA 2Z31C 4XNUH 1UB5A 2YPVL 4ODSH 4GKSB 1QD0A 1Z5LA 3PWUB 3L3IA 5BQ7B 4QOKD 4WWKD 1T80A 1OW0A 4OLUL 1VGEH 2B20A 4IOFC 1RIHL 1CZ8L 1V7MH 5IMLB 2CIKB 4QXGH 4DAGL 2J8UF 1D5BB 4YIQB 3U7YL 4GRLC 3MV7A 4AH2B 1NKOA 4LGPB 3U0TA 3SE4A 2QSTA 4PYGA 1OAXH 3W9EB 4J3WA 3V4VH 2X9WA 4MCYB 3KS0J 4JVUA 1T6VN 5D2NE 3V6OE 3MLTB 1QO3B 2IANA 4X0KA 5DD0H 5CAYB 2BX5A 5F9JB 3SJVB 3DX7A 2O5XL 5JIIA 4I0PC 4KKAC 3GI9L 2YD4A 4X6EB 1J5OH 2VAJA 3C5ZC 1L0YA 1MCPL 4XCEB 3X3GH 1P6FA 1P7QB 5HHOB 1QP1A 3G04A 5KTEL 1S8DB 5FDYA 3DO3A 5SWZD 4PBXA 3IDIB 4I77H 1Z6JT 1ZTXL 5L2JB 3U48A 3WL9A 3RWFA 1YNTB 3S37X 4JB9H 5FYJD 1CFSA 4AM0B 1Q0YH 4YBHA 4HFWA 3HB3D 3O45A 4F7TB 1W72L 4H88H 3RRQA 1IGIH 3HPLA 4Y5YA 5TQ0H 3WKMH 1QA9B 1KPRB 5CMAA 3MLPA 3IDMA 1FYTB 4JO2L 3EJZC 3EYSH 4NDMA 2UUDK 4O2FB 1YMMB 2P5ED 5C08E 2EDQA 4GLRI 1F11A 3L5WA 4JFFE 1T3FA 1IGJB 1EERB 3T3PE 2B2XH 4LLAA 1FIEA 3N1QC 1TCRB 2FD6L 4U1MB 2I9TB 3CXHJ 4CRPA 3VD7A 4QXTB 4HZAA 2XFXA 2XZCL 2FHBA 2JCCB 5AZ2H 1V05A 4I4WB 4ZS6D 5A2FA 1AGEA 3T77B 3HMXA 4RQQA 5KVDL 5BJTA 3UTTD 1MFAL 2XN9A 3VFMA 1HHIA 3MRCA 4G6AD 4MAYB 1B88A 2WW8A 5D93B 1S5IH 4O02H 3MC0A 2YR3A 1OF2B 4IRZL 3FQNB 4XP4H 3FMGH 3RWDA 2DMKA 2Y36L 3SGKC 2ID5A 3QDGD 2YD5A 2PW1B 2LU7A 1LGVA 3UAJC 5KANG 1HHHA 4U31A 5ISZB 3TCLB 2CLRA 4TSCH 4KMTH 4QGTA 5E9DD 1IL1A 2D7MA 4C56D 4JKWA 4OCWH 4OFDA 3JV6B 2JB6B 3MV01 3PABB 2YPLA 4PRHE 3ILPA 2NY2C 2V5TA 5TE7H 4WFHE 5E6ID 3AFLA 5GS2H 1G1CA 2R8SL 3BYYA 1CXKA 3QUMA 1GPOL 2X1QA 4HJGA 4IS6A 5CIPB 4BQ9A 1NGZA 3TA3A 5CWSA 3ROLA 1LK3H 4FQ1H 4K8RD 4DFIA 3GUTB 5C0DB 5DMGD 1YJDL 3AMLA 4Q0XH 1M71A 3IF1B 2HT2D 2C26A 1S7UA 2A0LD 5T3ZH 4KRPC 3BIKA 1K2DB 1BFSA 1NL0H 1I1YB 3VXMD 4Z0BH 5C0RL 5I1JL 4EUPH 4F33B 3OJDB 1CDHA 2AVGA 3QFJB 1R0AL 5D6DA 5DTFB 5C07A 4UQ3A 4YO0B 2YC1A 2ATPA 5FUOL 5GRVL 5FO8B 4TULL 1ZT1B 2YPKB 5CEXA 1TVHB 4RAUB 3EYOB 1H5BB 4I3GA 3WFBH 3U9PH 5JDSA 3HAEG 2P24A 4LCUB 1J10A 3CMOH 4LVEA 3ZKMC 1C08A 2W65A 1CLYH 2R0ZL 4OAWA 5ADOL 3V95A 1AGBB 4ODVL 4LSQH 3KS0H 2YK1L 4OTXL 4X8XA 4WEBL 4U1JA 3TZVB 4FQQA 1BJ1H 1KCRH 4DK6A 2EEDA 2O93L 4R0LA 2VLKB 1RK0B 1U8MA 4X6EA 4IBLT 4ZYKA 3H9ZA 1MFBH 3F6IA 4NPYA 5JW5B 4HV8B 3O4OC 2HKHH 5J6HB 4Z7UF 2NZIA 2OJEA 1HQ4A 5C0CA 2V9QA 2OXHA 4K8RH 1Z9LA 4YK4B 3LKNB 2J8UB 3FQXB 1P5UA 1GGCH 4WFGE 1GVIA 5HHPB 4ZTPH 4JFPB 4YEEA 3ARPA 3HE7B 4ENEC 2PCPA 2J2ZA 3GM8A 4Q6IC 4YXKL 4QRRB 5IMLA 3MPCA 2X1XR 3BUTA 4H0GA 2C3GA 4PRHD 4LVNB 4P48A 4NM8L 4F7CA 2EXWC 3QRGL 1OPGL 4JGMA 5HPMA 4ORZC 4X5XB 4MSWA 3BO8B 5D7JA 5LXGL 4V2CB 4PG2A 5CP3A 4N90E 2J8UE 1X7QA 4WO4A 3LKRB 1JFQH 4M1CD 2BFVL 3EOTH 1RUPH 2BSTB 3D9AL 3NIGE 2CDGA 3MLYL 3HAEH 3VI4E 3QO1A 1IEBB 2FLBT 1DQMH 3R0NA 2H1PH 5TPWL 2AGJH 5CD3B 1WQVT 3UZQA 4MCYA 1CVSC 4G8GE 5DUBB 1NMAH 3UC0H 3NFNA 1FRGH 1SJHB 1NAML 1T7YA 1AP2A 4QRUB 1U92B 5EU5B 3OR7B 5KBNC 4PJGF 1NGXA 2DWDA 3ARSA 4ZAKA 4X99B 5E8NA 3MACH 3NGBB 3M07A 4DKEL 3DUUB 4APQB 5KSVA 1IKNA 2R2BA 4Y1AB 3VRIA 1A0QH 3GM0A 3WEXB 1EO5A 2MPAH 1AR2A 4N0UB 3SGJC 4Z78B 2GJJA 1JL8A 1JTPA 3ZL4L 4LCWA 2CDEA 1UKTA 2PYED 1ZHKA 3HHRB 3RKPA 5FCUL 4H5SB 4E5XA 4LLWB 3QEHA 4RX4A 1ZGLB 3KYKH 3UTSB 1ZT4A 1P4BL 1KIQA 2Q6WA 5E4EC 4CADA 4EQ2A 3P77B 2FL5B 3H9SE 3I6GA 4PD4K 3QYCA 1QNZH 2C3WA 4C83B 1JZ7A 4I3SL 3RU8H 1RUMH 3QFDB 4UTBH 1FNSH 4UB0L 2WBJB 3FTGB 1HH6A 1WSST 3SDXF 4LIQE 4U6XA 4ISVB 4BKLB 3IRZA 3T2QA 4LFHG 5D1QB 4MQ7B 3IXTA 5HD8D 4I0PA 4POYA 4NHUB 3R4DA 4JFDD 4NQDE 4PJ7B 1U58B 4OKDA 3P4MA 3IU4L 2JJWA 3CZJA 4NN5B 5EO1B 3ECBA 4P4KC 2G9HB 5LCVL 1DSFL 5GS0L 3L5IA 5B38G 3SY0B 2AAVA 1BD2D 2NCMA 2EYTA 2LTQC 4OTXH 3D39D 3G9VA 5E8OB 5I74C 1MQ8A 1J05B 4HGMA 4K2UL 3HR5A 1KCRL 4ETQA 2MWCA 3PWPA 4MXWL 1T20A 4NKIL 1I3RA 5D7LB 2J8HA 4ORGB 1V3JA 3WSQL 4PP1C 3C6SA 4NT6B 1J8KA 2OTUB 5GZOD 3W2DH 1MWAL 2VLJB 3HR5B 3QDGE 5JR1H 3TBVA 4ETQB 3T2NH 2IPKA 4C57C 4N9OB 3CVHA 4R9HA 4XP9H 3HTLX 4P2QB 1EA9C 3CSGA 3ZSSA 2E27H 1LO3L 4G6AC 4TTDD 3WBDA 1R24A 3X13B 4BZYA 4JO1L 3A6OA 1GCFA 2VDOH 3IVKA 3AUVA 3MRJA 2LFGA 1IGYA 2LVCA 1G7JA 4L3AA 1NGQH 3EDFA 4PJ5B 5KG9B 3OB8A 1U58A 2BRRL 3SDDD 4WY7L 4X4ZA 3DMMB 1TXKA 4R7DB 5DEFA 2EH7H 4UUJB 3L5HA 1PLGL 1BQLL 2W0KA 1Y0LA 4HUXB 5FUCE 2Z8VC 1RK1A 3IXAB 2NW2B 4LEXH 5IMOA 3EO1B 5L8KB 3ESUF 3K1KC 4JPWH 3WJJC 3FCTB 3ZKXC 5ISZE 3T1FB 3WMSA 1A6WL 2Q8AL 2CMRL 2DQJL 3MV9B 1WWCA 3DX8B 5GGVH 5EIIA 1N8ZA 4CADB 2WBKA 5C6PB 2ADGB 3GBLA 5TH2B 1BD2E 1CFTB 3CFIC 4PB9H 4L4TA 4NZJA 5KTEH 32C2B 5E8DH 2EEAA 3JV0A 5IHZB 2XKSA 4L9LB 3Q3GB 2NX5B 4Y2DC 3W9DB 2HH0H 1VGEL 2Q7YA 3CK0L 1B4RA 1JV5A 3FAXA 4HIXL 3MLXH 1OSZB 4LMQI 3CVHH 4Y16A 3KYNA 4BELD 3JSSA 5FB8A 5CCKL 5AYUL 4LASL 2ZSVA 1WZLA 4XGZA 2D7OA 2X4TA 1V3LA 3V0VB 1ZEAL 4UQ2A 3QDMB 3DX6A 4WWKA 5E4EB 5FM5O 4CMMB 3CLEL 5GS1B 4RA3A 2C4FT 3OJVC 2F15A 3T0ED 3PGCA 1QBMH 3V4UL 3TV3H 1RD6A 1W72B 3MOBH 1E6JL 4TUKL 3QEUA 1CFBA 4MD0A 4WW2A 4OLWH 3X11A 4D3CL 3HC4H 5FO7B 1HKLH 4PJ5E 1FO0A 5CHNA 5C92A 4EI5B 2AJ3A 1OAKL 5D7KD 3QDME 5E5RB 1U2CA 5I6XB 5AWNL 3S35H 3ULUF 1QBBA 4UMGA 1JF6A 2R1WA 3FKUS 3LY6A 3GGWB 1KGCE 3QG6A 4PJ8D 5ID1B 5A2KH 1C8PA 2B1HH 4YPGA 4N8CH 2PTUA 4LVHC 3S35L 3OMZA 3I6KB 2Z8RA 1H3XA 3HE7A 3S34H 4AEHL 5MEND 4UIKH 2BNRD 3SPVB 3SKMB 4NNPH 3EYSL 1QG3A 2KPNA 3LDBC 5KS9E 4KAQH 2NMSA 2Z91A 2OJEB 4UZGA 3VXMA 4S1DC 2VIRB 1IKFL 5D71L 2G60H 3VW3H 3ARFB 3C8DA 1S9WB 1CICB 1H8SA 2OL3B 1M7DA 4WW2F 1E4WH 3DGCR 3S36H 2I60H 4QHKJ 4LAQL 1BFOA 4Q9QH 2Y07L 4PJFF 4JM2A 4QO1A 3I6LD 1RZJL 2ZG1A 1WF5A 1VGKA 2NY5C 3ZO0A 2AKRA 2VO5A 1BGXH 3QXVA 5E2TL 4IIQB 3TBTA 3BVNB 4D0CB 3OF6D 5I1DB 1ZAGA 4PRPE 5IHZA 3IDXH 3S88L 4OF3A 1S7XB 4NQXA 2WWKO 2A74A 1I1YA 2E6JA 4Y2DA 1AO7B 4YDLC 1IAMA 1UFUA 2AXJA 4FXLA 3JWNC 4R2GB 1U91B 1BZ7A 2VL5A 1L9NA 1UM5L 3G6JB 3ZTNH 1NC4B 3EYQD 3IF1A 4A6YH 1P4IL 2DJ4A 1MI5D 4R3SA 4PJDA 2OR9L 5IMKB 2MQCA 2UZIL 4RMSA 1MI5A 5T5FL 4FQJL 1OARH 3WFHA 4K7PX 5FGSA 1EV2E 1I85C 3B5GA 2MQ0A 5HHNA 5D7IF 1QPXA 2OI9B 3I85A 2ZNXA 4KJWD 2GJ6E 1U91A 4HXAL 4AEIL 2HLAB 3P0GB 4CU7A 3IDJB 3U4BL 3VFPA 4WW1A 4LHQB 1AC6A 1PYWA 3IVKB 4U2ZA 3FN0L 4WV1A 1S78C 1KB9J 3QPXL 3RWJB 2FR4A 1MRFL 2EXYC 4I48B 2X89D 5MEOB 1FZOB 3CMGA 3DHMA 1T83C 2PW1A 4Y2DD 5BO1H 3BPCA 3I75B 2AV7A 1JN6B 1DBKL 5IB2B 5LXGH 1A7NL 1KGCD 4WI8A 2PXYA 5IFHH 3O4OB 4U1SB 1M6OB 2DM7A 1T1XA 2XNAA 1INEH 2OTUA 3NCJH 4Y2OA 3ARGC 5E1AB 1Q9LA 1MFEH 2ORBL 2VAAA 1RY7B 1I4FB 2FECI 2YKLL 1T5WB 4LMQE 4OI9A 5HHOD 4Z7OF 3T77A 3KPLB 1T20B 2ICWA 1NANI 1DLHA 4KKNA 4QCIB 5BS0A 4Y16C 3LS4H 5HD8C 1YEHL 5IHUL 4RZCA 3TYGL 3L5WB 1CD1B 2A77H 3SDAA 1KCKA 4RGNB 1LP9E 2FB4H 3SY0A 4CMHC 3U36A 4M3JA 4R96B 5I1IH 3IYLW 3BZEB 1S9YA 4PS4H 1AGDB 1KELL 2PYFA 2NW3A 4KHTL 5E00A 4PJ9A 5EBMB 1UT9A 4N0YL 1G9MH 1IC4L 4Z7VB 4PS4L 4PRNA 1U8NA 2BERA 5MERA 3I9GH 2NY7H 2OBGA 4NQEB 2UWEB 3P30L 3WD5H 3QQ3B 3O9WA 4R8WL 5IOPA 4L8SB 3MRHA 3RTQB 2RCSH 2XZAH 5EIQA 1UWGL 4F37F 3BKJL 3K4DA 3PIQB 1JPFB 4ZFOL 3AGVA 3MV9E 5JOPD 3L1OH 4F7MB 3KYMB 3DXAD 1MH5B 4W81A 4WHDA 2XQYK 1DQQA 1FRGL 5DDHA 5JUEL 3GO1L 4UTBL 3QEHB 5F9JA 1FNSL 4S1DD 4UB0H 4E5XB 2J4WH 3QXDB 4JCLA 2B5IC 2MCPH 1W72A 1JWSB 3FAWA 3AU1A 2M2DA 3NA9L 3T0XA 1RUKH 4YIQA 3GMRB 3KYOB 2ESVA 4XXDB 4S1SH 4BQBA 3SKNA 5CJQH 3UDWA 3PNWB 1YNLH 1NMBH 5EO0B 2EO1A 3I6KA 3L3IB 5F3BB 1VA9A 3PNWA 1OGAE 1HHKB 5E5UB 3WIHA 1AHWC 3BSZH 4GFTB 1RFDL 1RIVH 2BRQA 2J5LB 5EOCH 4CL7A 1SYVB 3H9HA 2MPAL 4OGXH 1XIWB 1UCTA 4ZUUB 5CUSH 3C5ZA 5K9OA 3EOTL 5CEZE 3LSOB 4YE4L 3JTSA 1MRDH 4YUEH 3WUWG 1LP9A 2Z0BA 2EXWD 2AJ3B 1ZGLP 5TH2A 4N1CA 5I8KL 1D7FA 1G7IA 4MJIA 5BZDB 1QLFA 2VXVL 1CI5A 1TJGH 1PY9A 4JG1H 5FECA 4QTHB 5FDWA 1TENA 2X4QA 4K7PL 4L8SA 4UV4H 1G7LA 1NJ9A 4MDJB 3K2UL 4NCC1 1VFMA 2FH6A 4Z7VF 4WWID 2A6KA 4OQ1A 5C3LD 2E7CA 1U3JA 1YC7A 2FGWL 1NCBL 2C7UA 4FXGB 2OL3L 2JIXA 3UEZA 1ZGLM 1NMCC 5CJOH 4JKPH 3WCYA 2UZXB 3O3BA 4FZEH 5E5MB 4HSQA 1A0QL 3KPQB 3IDGA 3LZFH 5AG9A 2ADIB 4XVTH 1A4KA 3BDYL 4GSDH 5EN2B 4HQQH 2E8ZA 2W92A 4HH8A 2V5SA 2XN9E 3MSPA 1JZ3A 1HIML 2EH8H 4FQXC 2R56L 4OZFA 1DVFA 1KPVA 1A9BA 5LCVH 3NACL 4FP8H 1FFPB 4M6OL 5E1HB 1D9KC 2WWMD 3IJSA 3BDYH 4LHUG 5J89A 3SE4C 1W2KT 3L7EB 3HE6C 2BP3A 1OY3B 3CVHB 3WUWA 2C3XA 3ARZA 4WI9A 1UQSA 4JFFB 3V6OA 5KSAA 1I3UA 3I3DA 5E9DE 1ZKAA 1KV3A 2GSGB 3WIIL 3EGSA 2YRPA 1RK0A 2DLHA 1NBYA 3NABH 1PVHA 1ZV5A 4JRYB 5KVEL 1MFDL 3JVGC 4OLVL 3MROA 4PG9B 2A38A 2NZ9D 1KG0A 1QSEB 4UAOC 1ETZB 4P9HC 2CLVA 1AGBA 1EO8H 5KVFH 4UTAL 3QDAA 2IFFL 1R3LB 5JHDA 2UYLB 5K59F 1RJCA 4OB5H 2HT2C 1MFCL 5JDSB 3LS5H 1ZK9A 5FEBA 5IFAH 4CVXB 2W0FA 5EH1A 2YRZA 4DWHA 3BEVB 5JLZA 1BMGA 2YXMA 1OAZH 3TBWA 4JM2F 1A6PA 4K3DH 3S96B 3CFDA 2B1AL 1AGFA 3V6FB 5GS0H 4ZQKA 4PRDA 3S96A 2X4UA 5C09A 4C54A 1FH5L 2VXSL 5FYKL 2BY1A 2NYYC 1UEYA 3C5SB 2EDJA 1F58L 3LIZH 4CVZA 1A21A 4MQXD 4OCLC 4KWUA 4MXWH 3NPZB 3SDYL 5D1QA 3CD4A 3HPJA 4FFYH 3D85A 5TGBB 1FVEA 1ETZA 2CMRH 4RFEB 1QSEA 5E08L 1KCVL 4JHZA 4KTEL 1R3KB 4ORGA 2B5IB 4YWGH 3EO0A 4JPKH 1I3RB 4PGEB 2ZJSH 4J3UA 1JPSH 2GSGA 2IQ9L 4I0CC 4UT9H 3AXLA 2ZCLH 4HZLA 4LP4A 2DKMA 3V52H 1G9NH 4HS3B 1FV1A 3O9WD 1NBYB 4PP2B 3ARBB 3P4NA 4OZIF 2YD6A 5JZ7D 1OTTD 1JGVL 3OXRB 1JMZA 2YZ1A 3VXRD 3QDJB 1EFXD 1JPSL 2IQ9H 2QHLA 5ISZA 3NAAH 1I1FB 4OFYD 5ESVB 1RU9H 1AHWB 3I3EA 3O3EB 1KJ3H 2E5EA 3PP4H 2J88L 2ED8A 5DJ2B 3I02A 1LD9B 3LQAC 4I0PD 5EN2A 5I2IA 1FVCA 1MJJB 3VFVA 3GZKA 5HYIA 2VUOA 3B8SA 5HHOE 4MDJA 43C9B 1NJ9B 4OLXH 3B9AA 4P4KB 4TVPL 3VGBA 3NFNB 1QFHA 2OL3A 2QR0B 3V4PH 2BSSA 4OV5A 5CJBA 4ONHA 4YHYC 4MJIE 3PXJA 4RAVA 5D72L 2X4PA 1H3TA 2DQEH 2VQUA 3B9EA 5H35A 5ICZA 4ODUB 5E2JA 3VH8B 4JQVA 3PWPD 1NFDB 5DD6A 4OI7A 5D6DC 3FT3A 4WUUE 3UPRB 3MRRA 1WAAE 1QR1A 1DQLL 5HVFB 1I1RA 3FB7B 3OKLB 5L88H 4P46D 2XG5A 3JTSB 4LLUB 4OD1L 3CPLB 1KNOA 1BF2A 3QIWA 4L3EB 3BWUC 4OZGA 2LU4A 3WFZA 3ROOB 2AK4A 5IQ7H 2JK5B 5DO2C 1BQSA 2DB8A 5L88L 4JPIB 3U82B 4IRJB 1ZHLB 4PJ8A 5CSZA 3LPWA 1UYWL 3GMRA 3KYOA 4GS7B 4JDZB 3MYJB 5IM7B 2F19L 2XZZA 3MLWL 4YFEA 1M4KA 3U79A 4MD4B 1EZVY 2HN7B 4JM4H 4HG4J 5A16B 4TUOB 4X7TB 2HN7A 3AS1A 2R4RL 5E03A 3LN4B 3L3OB 4FNLH 1IZKA 4YDVA 5J06A 3CXDH 1IMHC 2RR3A 3QCTH 1YECL 5F3HA 3CFEA 3MV8B 3MLSH 4W4NA 1E4XH 4L4VA 3SE9L 5DFTA 5FK9A 1XR9A 4KUCF 4XPAL 4QRPA 4XNUL 5L2KD 3NPSC 1Q1JH 4QHMB 1DL7L 2BXZA 4Q6IA 1VFBA 3RVWC 4BK5A 2GK2A 3FB8B 2NW3B 3UDWC 3IDXL 4RGMC 2GKIA 2J6EL 4LLUA 1S9XA 5DHXB 1A7OL 4LK4A 3GBML 5BVPH 2HJLA 1Q94A 1RSFA 1CFTA 5GGSA 3B6SB 3L7FA 1T1WA 3WHE0 4XNQB 1BJMA 3L3KA 4TVPD 3U36B 3KPPB 2CKBA 5EBLB 4HIHA 3B3IB 3PWNA 2NY3B 3HRZA 4I5BB 2ZJSL 4QWWD 2VE6A 4PJ9C 3T0VA 3GSQA 1HDMA 4MNHB 1U3ZA 1UJ3B 2XQYG 5F7FA 3S36L 1AXTL 1ADQA 4LPXA 3JWOH 1C7TA 3VG9B 4O5LL 1GGBL 3BD3A 4OV6F 4TOYH 4PD4J 3Q0HA 1EAPB 5ECJE 3PL6C 3OHXB 3H0TB 2DBLL 5LGHL 5I2IB 3GSUB 1BVKB 4HDIB 1T04B 1DQDH 4UDUB 1ORSB 2MNUA 4J6RL 4OLUH 4WJ5B 3STZA 4MA7L 2NY5L 3L3GB 2P5EB 5IIEB 2OK0L 3BW9A 5IW6A 4U1LA 2V17L 1QTYT 2H9GA 3FRUB 4GKZB 1O0VA 3X13A 5FO9A 4WW1B 5IW1A 3MBEC 3BKYH 2Z31D 2V5RA 3RWDB 5HI5C 1G7PA 2AJXH 4JFEA 4JAMB 3R0MA 2VWEC 3PWJB 3O8XD 4JO3L 4OF5A 1EFQA 1ZMYA 3IETB 5I1EL 3IFLL 1NDGA 4LVHB 5HHMD 3BQUD 3VXSB 2W38A 1WK0A 1QLEH 5IGXL 4HHAA 3T65B 3E2HB 2ARJA 2F58L 3DXAB 4QEGA 3MJ9L 3ALWA 3G6JA 2YK1H 3V5KB 4D9QE 4PRIE 2ZSWA 4R3SB 4KU1A 2I9TA 1HDMB 3FN3A 3NZ8B 2VE6B 3JV5A 2BNQE 4J4PA 2CK0L 1WAAA 1KJ2H 2C3VB 3FFCD 2P7TB 5D5ME 1Y6NR 4XPFH 4CKVX 2HKHL 4M61B 5JQ6H 5C0BE 3RIAF 5FOJA 3B6SA 4CU8A 4L8BB 4WUUD 4D0BA 3BVNA 5CIPH 5IEKA 4KI1A 4B5EA 4DAGH 4L8SC 1G9ML 5DD1L 2C9AA 4XPHH 4ONOA 1XF2A 3HPLB 4Y5YB 3VXOB 1MJUL 3FQNA 4IJ3B 3IXTB 4JO4L 4YNYB 1I7UB 3ES6A 3IB4A 1N5YL 4HWNA 3O6FB 5DT1L 3TBYB 3RL2A 5IB5A 2W60B 3VFMB 1T0MA 3BZ4B 2WBJA 3ZE2F 4MWFA 4IIQC 1KB5A 3H7LA 3INUH 3WYRA 5BXFB 3UJJH 1U8HB 1F3DJ 3PV7A 3TO4A 4RFOH 2X1WL 1EGJA 4JRYA 4HMEA 2EICA 1FZMA 3L3OA 3ZKND 2P48B 2VZVA 1VEMA 4KK9C 4HWEH 3DJ9A 4JFHE 2XWJB 4Y7MA 3HI1A 4JFOB 3UO1L 2R4SH 3LEXA 3L7EA 4Y5XC 5IF0B 4JB9L 4HJJH 1ZLVK 4O2FA 2ICES 1T7ZA 4LP5A 1ACYH 3E6HA 1N3NB 1NMBL 4WUUA 5I8OL 1JGDA 5JW4M 3OX8A 4S1SL 3IKKA 4AIOA 4YPGB 1MUJB 3KJ6L 4NO0A 4AIXA 3VFNA 1YNLL 5JXEC 3KPSD 4NHCL 4LL9A 4YUEL 2IFGA 4G8FA 4D8PA 3QDJE 4GAGL 4UIMA 2R1YA 5IT2H 4I0KA 2ZOKA 2VLKD 2P5WA 4G7YH 5DVMA 3UPRA 2NNAA 5EC2B 2OTWB 2YN3A 3L1OL 1D6VH 2P8PA 3HC3L 4KKAD 1EMTH 4YDKL 1I7TB 2MSPA 3OKDA 3F7YA 2H41A 4WFFD 4L4TD 1XF4B 4LSPL 3C08H 2VDNH 4GW4B 4HUWB 3B9KD 4I3RH 4IOIA 4QRSB 2DJUA 5I1CH 5ID0B 1IJ9A 3NA9H 1RJZA 5FKAB 2IFFH 4QTIH 3IDYB 3QIUA 3N85H 3S5LA 1FGVH 3DOSA 2ERJC 2DI8A 4XNYL 3RWEB 2IH1A 4BZ1H 4X80H 4JHWL 3IJYA 4ZFGH 3QUMH 4Y16B 4G5ZH 3SKNB 3WN5B 2W9LA 5E24E 5DJ2A 3MNZB 5HDLA 5ADOH 4WHCA 1P84K 1A3LL 1TVBB 5EDXA 8CGTA 1H3PL 2BOBA 3KLHC 2VYRE 3WS3B 1MHHA 1QSVA 4KPHL 1BIIB 3FO9B 2B7DT 3W0WE 3ZHDA 1P7KA 2Y5TB 3V7MA 5KS9B 1FAIH 2D4DA 4WGVB 3RBSA 3LEXB 5DJ0B 3SDCA 4BA8A 5F44A 1CD0A 1G6RH 1MNUH 4NYLB 4LCYA 4U1JB 4WDIA 5F7WC 1QRNA 2XZQH 1V5JA 4RMTA 3ARED 2L0DA 1U8HA 3OQ3B 3O9WB 2H32B 2ZKHH 2FCBA 3WIFA 2KH2B 5JQ6L 5T1MA 4JHBA 2E7BA 5KSBF 3O11A 2Y06H 3S5LG 1C5BH 1VERA 3DGGA 4O51B 2NXZD 5HJ3B 4XWGL 5E56A 5IEKB 2BVQA 3OJ2C 4Y5XA 5DVKA 3WLWD 1A7PL 2PR4L 3MOQA 1L0QA 2AERT 3BT2H 3MGTB 1IAOB 3QH3A 5J3HD 1IC7H 5DYOB 4AG4L 4RFOL 5HYEA 1E27B 3HUJB 3QXWA 2YWYA 3GUTA 3FB6B 5ENWB 5D1XC 2ARJB 1F4WH 3UBXI 2DQTL 3QZWA 1L7TH 3VFSB 1GIGH 3U4EA 3L3HA 1QSFE 3HNSL 3IT8D 3L3HB 2YA2A 3PWPB 3PQYE 4GMTH 2OP4H 1UCBL 2B8OT 4JJ5B 3QP3A 1YEDA 4R0LC 3VFTA 2APVA 2UV3A 4PRIA 1S3KH 4GH7B 3C2AL 5I1KH 3CH1B 3H7BA 4YGAB 2DLIA 4L5FL 4FQIL 1C5CH 4WV1B 5DA4A 1ROWA 4QGYA 5DVOA 1YQVH 3B2UC 1LEIA 2G5RA 3ULVH 4HDIA 3P4MB 4RMRA 2HH0L 1GHFH 5GRWA 1A7QH 4OUUA 1HHIB 4JO2H 3C6LC 1BWMA 1BLNA 1DE4A 4R4BA 1I3GL 2HWZL 2JIXB 4HUMB 4BKLA 3A6CH 4HH9B 1ND0B 3FQTB 5HTSA 5GRJH 3SQOH 4PREB 4XPGH 4HT1L 2OLDA 5I1GL 4TVPE 1T89A 3VWKB 1IGCH 1SMOA 4KC3B 2EEBA 2UVEA 1S7TA 3KPNA 3MLRL 3PV6B 1KACB 3P77A 4PY8I 1NAMH 3QCUL 2WLYA 4M7KL 5IBTL 5D70H 1X6NA 1CS6A 5BZDA 1OAQL 4ODXB 1T1WB 3X3GL 1FFQA 1IEAB 4WIQA 1G1YA 4YLQT 4S11A 2IAMC 1FL3A 5HVHB 2NY2D 4NWTL 4G8GB 4GS7C 1NBVH 1INQB 3U9UA 4ZUUA 4MMXC 4NO0D 1OAQH 3MNWB 3IAGC 1H0DA 2X7LA 2PTTA 1CG9A 1FLTX 3WEXA 1OAUL 1K85A 3QULA 1VGKB 3UAJD 5JNYA 4X9IA 5IQ7L 4GOSA 3WN5A 2JB5H 4Y5VA 4K23L 5D7LE 1EIBA 1CGSL 4M6ML 1OT1A 3QWOA 5DUPL 5I30L 5JOFA 4OIIL 3B8YA 3KJ4C 3RJDA 4KV5F 1YPZA 1NUGA 4NRYB 1EEYA 5DSCB 4QHNB 4PJHA 2F19H 3MRMB 3VFGH 3S5LB 1P2CB 5KSBE 3RX8A 4ZXBB 1EJ6A 3DWTA 4U4BA 3RY6C 2X4SB 5DUBA 3KLDA 1BZ9B 3W5NA 4MD5B 3MJ8A 3Q6GH 3UMTA 1XF4A 1OM3H 4F7MA 2CLZB 1ITBB 3VGDA 1KTKE 1E6JH 3RVXC 1AKJB 4HGWA 4O5LH 3CUPA 4N0CD 3NTCH 3EIFA 2KKQA 1PSKH 1RHHB 1NEZB 4PJHB 4TVSa 5FHBL 1EEYB 1QKZH 1MCCA 2XY1A 5F9WB 3MNVA 5C71A 2GJ6A 1XEDA 4IRJA 1MLCB 2AJVL 2DQIH 2ZUYA 1S7VB 3DROB 3O3AA 1A7PH 2GJ6D 3CFKA 3MRDB 4Y5VB 3VXTA 1Z3GH 2ILLA 3CFKB 5MI0B 2ZCHL 3W11C 1KCSL 4Q9CA 1JPTH 1CLCA 2J8OA 1FL6A 4PJDE 5F97E 2JK5A 1AI1H 2JJTC 1RZIB 4HBQA 3BAEH 5CFHA 3WNLA 3MRRB 3AY4A 5DD6B 1KT2A 2VZOA 2D03H 3BZFB 1DN0B 3NFSH 4DGYH 3M45A 3VXUE 2IPUG 3UTZA 2Q8AH 4LSTL 3ZDYF 1HK6A 3U7AA 1GPOH 4MNQA 5EUOA 5EUKA 5CD5C 1CDGA 3G5XB 1HINH 3DO7B 1TNMA 3D0LA 2ZUXA 3VWKA 3QDJD 1E4XL 5LG1A 3DVGB 5DUML 5IVZA 4BQ6A 3KPSE 5LGJA 5HI3C 5D2LB 1H5BA 2IAND 2QQKL 2YMXH 4PGJA 1IAIM 1G9EA 1YN7B 2ZCKH 2R29L 5EU7E 5HSFA 5DMYA 4M1DL 1WBXB 1LEIB 3LN5B 5AD0A 1GOHA 5JHLL 4RWYL 1FNEB 3LEYL 3OJDA 3N0PB 1YYLL 4ZTOH 5T1KD 3EO9H 2BVUA 1NCWL 3HMWH 1G7MA 2HLAA 4TNVK 1CLYL 2R0ZH 5GGUB 1FV1B 4PP2A 3WNOA 3RNKB 3DTXA 2Z35B 4EOWL 1S7UB 3GBNL 4U7SA 4UINH 2FSEB 4K3GA 2ICWJ 4QWWC 2A1WH 2EDBA 3D2UD 1Y0LB 4H20L 4Q9BA 4HHAB 4LARL 2Y6SD 3DRQB 1N7ML 4H20H 5GSRB 2GITA 3QHFH 4PJ5A 2BOCA 2AXFA 4AQ1B 3NCEB 3PP3H 4XAKE 1S7XA 4JHAL 5D6CB 4HD9A 2CLRB 4PRDB 2YD1A 4MJ4A 5C0EA 1EPFA 1AO7D 5F7EH 3O0RH 4JZNA 3BPNB 4QRQA 2H9GB 4H8WL 4IMKC 1YN7A 1TETH 3PDGA 4P2RA 3TF7C 4DUXA 4TUKH 4YAQB 4LPYA 5KSAC 3MA7B 2NY6D 3GSUA 4FMKA 1ZS8B 4G80B 2CUMA 3SQBA 1FORH 5EORL 7FABH 3D2UB 4QY8B 3QQ4A 1F90H 4F8TA 2UZIH 3UJJL 3GMPA 2SEBA 4NYLA 1KBGH 4G8IA 4P9HL 1E27A 1ZOXA 1CICA 1UQSB 4JFFA 5MEQA 4N1HB 3H3PL 5EUKB 5GHWL 1DUYB 5EUOB 1FJ1A 1KB5H 1UXSA 2WUBL 4U1MA 3ZE0E 4L1HA 4L4TE 3IFNL 4I5BA 2YPLE 4PRHA 3QR2A 4YBLB 1PZ5A 5F70A 3C60B 1Z3GL 4X6BA 4AL8L 3KLSA 1EJOH 1KT2B 4KZDL 4WU5A 5C9JA 3IJSB 3KLHD 4ZDHB 2B0SH 2R2HA 3BPOC 4KQ4H 3WO4C 4BFBD 5CJ8A 1JTOA 1S9XB 3WE6B 1NSNL 3HNTL 5BZWA 3OSKA 5JOPE 4RMVA 3LKSB 5EZLB 3RWFB 4XMLH 1KFAH 4GRLA 5KZCB 4JG0L 4R4ND 1IKNC 3RUGA 4N5ED 1BHGA 2OCFD 1WIUA 1H3PH 2FX7L 3F7RA 4X6CE 4G3YL 3MUZ1 3BP6B 2A6KB 1UKQA 3G04B 4LDEB 3KPSB 5JPNA 5IROA 1E4WL 2CIIB 3DETC 3CVIH 5AZ2L 4HWEL 1G7IB 3VMPA 4R4FL 3JWDL 2ZOLA 3CCHA 4NFBA 4F58L 5BMFH 4WCYH 4YHYB 3E6FA 3EDEA 4JVPA 3MLUH 4HKJA 4XVSL 5EC2A 5I1AB 1A5FL 1XF5B 2Y5TA 3C5ZB 2A0LC 3TBSA 5F9OL 1WISA 4ZXBA 3S8WA 1LP9B 4OI8A 4LKXB 3C6LD 4HX1A 3HA0A 4G8FB 5DMGC 2KQNA 4EZMA 1XZ0B 3MNZA 4DKFL 4UQ2B 2EDYA 4NQED 1KC5H 1R5WA 2R0WL 4ZSOB 3B2UD 4Q2ZA 1AJ7H 5E99H 4C4KO 3Q6FB 4PLJD 1ERNA 1VKXA 1U93A 1JP5A 2D0GA 4JPIA 4M1GL 2R0LL 1KEGL 1T2QL 1HHGB 1N64L 1PG7X 3DBXA 2IMNA 3AU1B 4Q6YA 1CDBA 4FS0A 1MFEL 2ORBH 1MAKA 1SJHA 1YEJL 4YPJA 1RZGB 4HBCH 4JQIH 3O6FD 4IOIB 2OTPA 1LMKA 4HUUA 1YMME 3RZCD 3Q1SH 2HYMA 5FUZH 1MH5A 3U0WL 3WN5C 3KYMA 3F12B 3GRWH 3KPTA 2ZOLB 4YHMH 3UPCA 2GSIB 2NY1D 2W07A 1KPUA 5ERWB 1DQQB 1JIBA 4HKJB 4OFVA 3LQAH 1VESA 5D2LF 3WXWH 3DX8A 3MV9A 5I76A 3RTQA 3PV6A 4I3RL 3KPSA 8FABB 3D18A 5FA3B 4JN1L 4LOUC 2QR0A 1TJGL 3IXAA 5B8CC 4PRNB 3TH3T 4M7JH 5BVJB 1F8TH 3NFPA 3EYVB 4G9FE 2ZUQC 4LEOA 3BIBX 2X6MA 2I27N 1S3KL 2JJUA 1SVZA 2VZTA 4GW5A 3LKOB 1JHKL 5F88B 5HGBB 1YQ2A 5JXAL 2VL4A 2W91A 3OKYA 5JDJA 1KTDB 4YHKH 4HIXH 2Y5EA 5HHPA 4J3TA 5D1ZB 5IB3A 4NQCD 2V2TA 2FO1A 2F54D 4XAKD 5IF0A 4AZ8A 4ZO8A 1II4E 1EXUA 3E0GA 2F74A 5DC0A 3UYPA 1MCIA 5F7HA 3A6CL 3C8HA 5TF1L 1I9JL 3TN0C 2QQQA 3LQMA 2VLJA 3QQ4B 3D2UA 1EEZA 1TVDA 4M48L 1JGUH 5I66A 4ZFOA 4DKDC 1ZLVH 1RUKL 2XNAB 1UJ3C 1EJOL 5E1AA 1EH9A 3BDXA 4F9LA 3G6DL 4M48H 1EK3A 2P24B 4LCUA 1J88A 5MEOA 1DVFD 4F37K 3ZTJH 5HYJD 4NZUL 1NEZG 3CC5B 2FR4B 3I75A 4LSUL 3T3MF 1FZOA 4UQ3B 4YO0A 4JLRA 1G7QA 4ZG1A 3GJFH 3IDJA 5JPMB 3WD5L 1H15A 5TDPA 3MUGA 1GZPB 4CGTA 4BQ8A 5LVEA 3TBWB 1IE5A 3E3QC 4G6KL 2QQLL 3BH9B 1RJYA 4NHUA 2IANE 3RY4A 1GGUA 5GS0D 3C87A 3REVB 3J7HA 4GAYB 1P4LA 4LSRL 4PGDA 1R3LA 3T65A 4YHNA 4N9GA 5GGQL 2QBWA 5DR5L 4AJ0A 1JGEA 2BZDA 2LTQB 4K3JL 3WLWC 3HRPA 4OZHB 1EO8L 5KVFL 1D5MA 1BD2A 4M00A 2FL5A 4K9EH 4CN4A 3H8NA 5DURD 3B3IA 3PWNB 5DR5H 5DJ0A 1EFXB 1NBVL 1YY8A 4NQXB 1OLLA 3MV9D 3MV8D 1X4XA 5ALBH 4J12A 1AO7A 2RJMA 5E2VH 5DRZA 1A6TA 1X5IA 4LOUD 2XYCA 4HWZB 2CO7B 2AQ1A 2QKIA 2VXTL 2WV3A 4K23H 4WEUD 3W11D 4IIQA 4N8CL 3P0YH 1YEJH 3O6MH 4Q6IB 3LRHA 3R8QA 3Q1SL 1BVKA 4KMQA 3RWEA 1G0YR 2XQBH 1J0KA 4PRID 1FZKA 4CNIA 3HZVB 1P6AB 1DQJA 4U0RC 3O6FC 1U92A 3KVQA 5F3HB 5D7IE 5TF0A 1F4XL 4I3SH 5HHME 4M7KH 4HXBL 5EFIA 2QSCL 2WQ8A 4LLDA 4K7FB 4I2XA 4ZXBD 1MIEH 4ESKA 4OF6A 1GC1L 5F7DA 5FYLH 5K93A 3SCMB 5INCA 2WM0A 4OZFH 2VIRA 5D5MA 4XHQA 3LZFL 3GIVA 3B2VH 5A1AA 5C8JA 3P9WB 2OX5A 4HIJB 5CZVL 2R1YB 2WP3T 1FL6B 3O2DA 4FQLL 4Q58C 4DKAA 1RZIA 3SKJH 3O3UN 4ZO6A 4PJ8B 1JPTL 2I25N 2FIRT 1FL5B 3D87B 2CD0A 3QG6B 3SE8H 5HY9B 1YMMD 1VPOL 4ZS7H 4BH8A 3VFNB 1T03L 4O4YH 12E8L 4NO5A 2P47B 2CPCA 5T3XE 2YEZA 3QT2A 3CPLA 5DK3A 5DVLA 4KVCH 4DGYL 2COQA 4OZIA 2VB5A 4JFPA 1H3GA 1OAXL 4WUUB 3KXFD 1NFIB 4PGBB 3CUPB 1B2WH 4MB3A 1T89C 2C3HA 4JY5L 1I8KA 4G9DA 2VERN 5IQ9B 5J9PB 1L6ZA 2C1OA 5BRZB 4MA3A 5F1IA 1LEKA 3WO3B 1HILB 4MJ2A 1EVUA 3BWAA 4HKZB 3P11H 5CLWA 1P9MA 4G6JL 5ICZB 4K7FA 4X4ME 1U8PB 1S7WB 4IOSD 1SBSL 3TZVC 1SJXA 4N0FA 1R5IB 4DVBB 2Y07H 1PG7W 1MAMH 5GJSH 3QDMA 4EQ3A 3O8XC 1D5BA 1NBZA 1NCCH 4YDIL 4NRYA 2CJUH 1ZLUH 3MMEB 1LDPL 3CXDL 4TQEH 1Z2KA 2CIKA 4YC2B 3SOBH 2F5BL 1OD9A 5H2BB 4JO1H 4H8WC 2BMKA 1CIDA 5C0AD 4X4XA 3UTTE 1TTUA 4RGOL 5IMMA 3DMMD 4KHTH 2WIIA 1LO0H 5C0AB 2YD7A 4M6NL 4MNGE 1AGCA 1QFWH 2V17H 4IMLB 1INQA 3TJEL 3TM6A 3GHEL 5JW4Q 1IM9D 4IDJL 3SGDH 1NFDA 4J3SA 4R96A 3EHBD 2GFBB 3TVMB 5DGRA 1LDSA 1UACL 3PL6D 1TTFA 4DEPC 1B0WA 1MAJA 5EIIB 4R8WH 4FFVC 5KW9L 4KKCC 4M8QA 1C16B 4N8PA 3SEPA 4PGEA 5DJDA 1R3KA 4X7EC 2BSSB 1JGEB 3R06A 1M05A 4KGLA 2NX5E 5HGDA 1I4FA 2GY5A 2FJFA 3KNBA 3NCFB 3VFVB 4ODHL 1KJ2B 4Y4FC 3BH9A 5SV3A 1ZTXH 3JV4B 5E0QA 5IJVA 3F7QA 5CBEB 1QSFA 5C0IA 1MVUB 1J1XL 1HSBB 2AV7B 2ICCA 4K8RL 3QSKB 1WC7B 2NY4D 3TFKC 3QEQB 3WFDL 5FFLA 1G7JB 3MXWH 5F6HJ 3IFPB 2X05A 3OGOE 3OXRA 5J56B 3TH4T 4F15B 4KK8D 1JNJA 5DQDL 5E8PA 3FJTA 3LPFA 3NOIA 4OGXL 3ZDXF 4LQFH 5DJAB 3BQUB 2RGSA 1MIMH 3WLBB 2V2XB 2I24N 2BSED 4ODWA 5JHDD 1EAPA 3OAUH 4NZRL 3FQUB 1KBGL 5J13C 4WNQA 3MBED 4MXVF 1UM4L 4BH7B 3WKNA 3WFHB 1X5XA 3U4EB 3MROB 4UBDC 4OZGE 4JG1L 1N26A 4MNHA 3SDCD 4KROC 5IB1A 2BVTA 3GK8H 1DLFL 3AMKA 4X83A 3QA3A 4DUWA 4Y4KD 3CXHK 4N5EC 4NO2B 2ITCB 3O4LE 2EYTB 4Y4KB 5TJWK 4S1QL 3ZT7A 5D8JL 5ESAB 1LK2B 3GK8L 1MHCA 2XPGB 2ATKA 1KFAL 5CMAB 1CL7L 4Y16D 1FYTD 4OCXH 5HGBA 4TSCL 5EO1A 4KMTL 4LF3A 1O7VA 5FV2A 2NY7L 5T1KB 1DN2A 4FXGA 3NFPB 5C6WH 3TJHC 5JHDB 3T04D 2X4NB 4PJFA 4OCXL 1EUTA 3FTGA 4HBCL 3UTSD 3MUY1 1D5ZA 1BQHA 2XRAH 1GGYA 4G8EB 4YHML 5FYJL 4ZFZB 3V0WL 4X6DF 4KMLB 5KVEH 1JF1A 1YYML 4O2EB 3VU2A 3MRBB 5B38B 2OQJB 4MJIB 4H0IA 2FJHB 2P44B 2IANB 4WI7A 1YEGH 5IKCA 4KJQC 4MD4A 1ZGLA 4J3XA 3K3QA 4MNQD 2BOBB 2GTWA 1YEKL 4NNXA 2WMPA 4NKDA 2MQ3A 4OZFB 1CR9H 3U0TB 5CD5D 1J87A 4M6NH 1WT5C 4GW5B 3FT4B 1JGLH 3IJYB 3D39E 4P5TB 2W59A 3MX0A 4F57H 5F3BA 5BS0E 3F62A 1R5WB 5D2LE 3SGJA 1NMCB 3OR7A 1AP2B 1IGTA 1RJZB 1Q9OA 4UU9A 5E8NB 2LE9A 1EDQA 2IC2A 1SVCP 2AXGA 1CXIA 5I17B 2X1OA 2X4QB 1KIRA 4FQXB 1CXLA 3OKDB 1VSCA 2EE3A 4F58H 3V6OC 2DLGA 5I73B 4OKVA 3U46B 1OLZA 3DYOA 4OFIA 5CKAA 3U46A 1S7QB 1LILA 2E9WA 4G7YL 3WXWL 4PBWD 5M7QA 4MA1C 3BKCL 2VR4A 3GSWA 3L95A 2NY5H 2FBOJ 1XIWA 1KTLB 4OFKA 2P1YA 2UWEA 4XPBH 1JUFA 5FGCE 1IBGH 4JFQA 4JQXA 4IRSB 1HI6B 3OKNA 2VDNL 2EDRA 4MSWB 3V0VA 1UADC 3QI9C 4IRSD 4OLEA 3EW3B 4HFUL 4KUZH 3DMMC 5F7MC 1T0NA 4JCMA 4M7ZB 3C09C 2DDQL 4X8JA 2DKSA 3OX8B 4XP1L 3D25B 4LSQL 3N9GH 3MZTA 1XGRA 3W9DA 5FCUH 4HWUA 3WFEH 1FIGH 5I71B 3PQYA 1HQ4B 5D7LD 2APFA 2X42A 3C60A 1V8HA 4DZBA 4U33A 4QXUH 4HIIB 2ZUSA 1I3VA 3QXAB 4Z7UA 4GG6A 4OZGF 1XF1A 1JHTA 4HZLB 1IC5H 1I9JH 4JKMA 4LSRH 3VD5A 4UTAH 5BXFA 1FZMB 6CGTA 1PQZB 1QFUL 3D39B 1SHMA 4FRWA 5CEZD 3QHZL 4G8EA 1BQHB 5JQHC 2VDLH 4OGZA 3UC0L 5TGBA 3KPRB 3O6FA 4FTVE 3VFUB 4Y4HA 4JREC 4XVJL 3HNSH 5EZJB 2ZUTA 5IB5B 2AQ3A 5TQ2H 4NM4L 1TTGA 1OCWH 3P9MB 1F4HA 3SJVE 3EYOA 1ZLWH 1MHCB 4QYOB 3U30B 5ABDE 1MJ8H 5IG7B 4XXCC 3C2AH 1JWMA 3ZT5A 4PLKD 1AGFB 2XI9A 4RRPA 3TIDA 3RHWF 1JF5A 5A2IH 2EO9A 4P2QA 1CD1A 2B39A 1SJVA 5FYKD 4A6YB 5MEQB 2MKLC 3V5KA 1GHFL 5CBAB 4WFHD 1KTRL 3VGFA 1HYRC 4ODBD 4UV7L 3GJFB 2OJZL 3ROLB 2HG5A 3G6JE 3MJGX 4PG2C 4C56E 1A2YA 5GGQH 3D85D 4XP6L 1NKRA 1I85A 5I1GH 2DBJA 4RAHA 2PXYB 3JUZA 3L9RB 1LWRA 3LVEA 4XNYH 5CEZH 4X9HA 4KTYA 2F54E 5GZND 1BWWA 4LCWD 4U7MA 1H3WM 1OGAA 3HG1A 3ILPB 1MCSA 4PY8J 3KR3H 3IFPA 3TESA 4JAMA 4JFEB 2VXTH 1X5KA 1TZHB 4S10A 1KF9B 3ZL4H 3T8XB 5T1DL 1I8MA 4ZMAT 1Q0YL 2E7LA 2E9BA 3RI5F 3WDJA 4Z0XB 2XQBL 2PYEB 1MVUA 2ADIA 1OHQA 1PEWA 1XGPA 2F54B 1MREH 1CICC 3HC3H 4MQ7A 5CCKH 3BI9X 2R23B 4I4WA 1MQKH 4DTGH 1JYNA 2H26A 4QXTA 4RQQB 2WWMC 3CX5J 4M9OA 4WFGD 1X5HA 2OZ4A 5A43C 5ILTH 4QTIL 4X6CA 4A6YA 3G5ZA 4P2RE 5IK3B 3VFOA 1FGVL 1ULVA 3KPPA 1IGCL 3ULUD 4HWBL 4PV9A 1Q0XL 1EHLH 2Q8BL 4GAJL 4FQLH 5FYJE 3FL7A 2XWTA 3G08A 1ZT4B 5E8DL 4DVRL 4JFDB 4KUZL 4XNZC 3IDMB 4B50A 1MHEB 5J0BA 4NQVB 4KXZI 4M7ZC 2AJYH 3QUYD 1GXEA 4K55A 5EA0H 2XTJC 5J11B 1DL7H 2CRIA 2NY3C 5SWSE 1OP3K 2Q86B 1CFSB 1BPVA 2Z9TA 1MCWW 4MB5A 1TQCB 5LAXA 1T4KB 4CVUA 4XBGB 4B7LA 4PJIB 2DKUA 3ARRA 4M9PA 4OCWL 5EA0L 1D9KD 2CUIA 1IGML 1CU4L 1P7QA 1S8DA 1FNHA 2GI7A 1XIWC 3F7PC 1GIGL 3NCCB 2DQDL 4U3XA 5IB4B 3BE1H 5A2JH 5DUPH 2MKWA 4G42A 5GGTA 4GMTL 3FOLA 2CGRH 5KN5B 2GK0A 4FABH 4K94C 3WJLA 3TN0D 5D71H 5A16A 4JREB 4RDQG 4MD0B 3BWAB 2LABA 4HKZA 4L4VE 3OXSB 1D6EA 1JTTA 2UWEF 2VLMD 4Y89A 1O5DT 2DLFH 1IFHH 3G5VB 3DX6B 3LMJH 4WWKB 1B4JH 1E6OH 4WO4B 2OZ4L 2PTVA 4XGZB 3NIGF 2DM3A 2VH5H 2EXYD 4QHUA 4S1RH 2VLKE 2E8YA 1FH5H 1RPQA 1YN6B 1K8DB 2Q7YB 1MLCA 1FYHB 5E00B 1I9RL 4PB0L 1JBJA 1S9YB 2X44D 4HT1H 3HUJF 1I8IB 5CKGA 5GRUL 1QFWL 5I1LA 4KJWC 1N5YH 2A2QT 1D5XA 3C9NA 1I9RH 2WBWB 3S6CA 5DC4B 1JK8A 3PF2A 3MBEB 3KPOA 3VXPA 5H35B 2AK4E 1VEPA 1AXIB 3NCYP 3PHQA 5C0ND 5TDNA 5EFIB 3VXQA 5KW9H 4HV8A 3QEUB 3GIZL 4HEPG 3M17B 1GAFL 1QHPA 3K4ZA 4N8VB 1FDLL 4PB9L 4P4KA 4HJ0D 4FN0A 1MFBL 2DBLH 4XAWH 4XXCA 1NH6A 5D1XA 4U0RB 2ARWA 1RK1B 5FYJU 2JE8A 5J1AB 2A73A 2A9NH 3FFDB 3SCMD 1C1EH 5E7BA 5TDOA 1HCFX 1VFUA 1DE4B 3E2HC 1K3IA 3LOWA 5B8CB 5L2KB 1GGCL 4RFNC 4Q7DA 2JLLA 2AW2A 4PLJC 5I30H 3DXAE 2ZNWA 1FG2B 1ZEAH 4I48A 3RGVB 3SBWA 1DJSA 3LRSB 1V3MA 1SJEB 4AIZB 5F93C 1A6TB 5IKCB 3SKUD 4L4VD 4X9FA 4HEME 4C58B 1MCOH 4HS3A 4JDTH 4UILL 1NAKH 4TVPH 5DT1H 4ELKA 3ARBA 3P4NB 1Q72L 3OAUL 4NZRH 1K2DA 1F4YH 4HIEA 2AQ2A 2ARJQ 1AC0A 3RIAK 3DVFA 1CXHA 1TZIB 4RA0C 2NZ9C 4P4RB 5SWZE 1NAKL 4HS6A 5C1MB 4NO3A 2A83B 3UTQA 5ADPL 4N0UE 1DZBA 4HUXA 3TO4C 4HH9A 4GAYA 1P4LB 4L3CA 4Y1AE 3T3PF 3VE0B 4XVUC 5I16A 3RWCB 1F90L 3PHOA 2PN5A 2BNRA 3MUGB 2EYRB 5E8OA 1SBBA 5C0NC 3GSNL 1RZJH 3MLVL 4HKXA 3QNYA 4HF5L 3MRGB 3P0VL 4PJBE 4ZQKB 1J0ZA 1MJUH 1IL1B 2ITCA 4JLRB 4Y5XB 3A67H 4OD2A 5F7NC 1WEJL 4PJCE 2QHRH 3EYQC 3PHOB 4LQFL 2DQDH 1VACA 2IADB 3VGAB 4QRTA 4X5WA 5IFJB 1P4IH 1XIWD 3INUL 2F53E 5DHVB 4JM2B 5DQJB 3Q6GL 4HS6B 4GXUM 3MRIB 2FDBP 4OM1H 5CILL 4ODWB 5JW3L 2VKWA 4TTGA 2QV2A 4Q9QL 1J0IA 4YHOH 3LS4L 4XH2B 3CX5K 2V7NA 3WHXB 1ZSDA 2EDXA 4O2CB 2XA8H 3BKJH 4P5TC 2NY6C 1KIQB 3MOAL 5JORA 2BSRB 1U6AL 2E9JA 3VXMB 2FECL 2R1XA 4PJIF 1A9BB 1LO5A 3FO0L 2P8LB 3DIFA 3VFWA 2XT1B 3MCKB 5IVNA 5F6IB 2CDEB 1E4XI 2V2TB 4UDTB 2ADJB 1YYLH 4NZDA 4AK1A 1CE1H 4ONGH 3RVVD 1QSZA 4I8DA 2XWBA 4TYUA 3KPQA 4D9LL 3VD4A 2OL3H 3CDGA 1U3HA 4W70A 4PJBF 1KIUA 5GRUH 3VRIB 1JZ8A 1KJ2A 4HFWB 1INEL 5I73C 2IH1B 4LNRA 1KC5L 2R0WH 5HYSB 2AJZA 5INDA 1MCEA 5DJXB 4JFQB 2D2OA 2C7UB 3HG1E 2BCKA 4DOHB 4BFIA 1E4KA 4XMPH 2B2XL 4UAOB 4HPYL 1D6VL 4P2OD 3QUXB 3RVWD 3W5MA 3KPOB 3TYGH 4XBEH 1UM6H 3BEWA 2AABL 1DBBL 1T5XA 2P8PB 1QHOA 3QI9B 3BQUC 2J4WL 2LVEA 1GYAA 1RVFL 2VJXA 3LQAL 2Z92A 3N85L 2WINB 1QO3A 4X0KB 4X6CF 3MLTA 1FO0L 2ZCKL 3BP7A 4BZ2L 4Q74A 4UIMB 1FFNB 2QQNH 5JO5A 1TVBA 4LSVH 3RDTB 3GSXA 3GJEB 1N4XL 3MV7B 4KQ3L 3O6LL 3GDBA 1D3CA 4P57A 1FGNH 3HNTH 3BMVA 4OIBA 5CJOL 5C07D 3I9GL 3MBXH 3FT4A 3QDGA 2VKXA 4ENED 2GY7B 1QBLL 4FTVD 4YR6A 2HT4D 3GRWA 4OQTH 3VRLF 4G3YH 1A7RL 4DVBA 4MXQC 3HAEB 3FO1A 3AS2A 3EFFA 4DZ8B 4RIRA 4DGIL 1R3IL 1BQLH 3E6FB 3Q48A 4J4PC 2X4RA 1I7TA 3IDUA 4OQTL 5E95B 1PBYA 3MRBA 2HLFC 1ZWIB 1U8JB 5I18H 5H8DA 2I07B 5GXBB 1ES0B 1F3JB 1CLOH 3GRWL 4FQQB 1NFIA 1I1CA 2WBJD 1CE6B 1OP9A 3VA2C 3QISA 5I19H 1PZUB 4Z5RB 4RNRA 4ZUSB 5KOVC 5IMOB 1NL0L 4NUGL 3BHBA 4J3OC 3EDJA 3O81A 5LAXB 4XPFL 2CKBH 5EU6D 4UT6L 5D7KE 1ZLSH 4F7CB 5DJXA 1F45A 3WUZA 4R7DA 1MUJA 4YNYA 2WBJC 1FNGB 1YEEL 3HZKB 5E99L 1NAMB 4HPOH 5IVXF 2DQHH 1KN2L 3QWQB 4NKMA 4ZDHA 3TEUA 1OAUH 3V5DB 5J6GB 1B9ZA 2ENYA 3GIVB 3MRJB 2EZ0D 3MRQB 1BM3H 4J23A 2ADJA 4YJZL 2W0LA 4OT1L 5I15H 5FKPA 1H5BC 4QXUL 1UXSB 4NQEE 4I2XB 2XWJA 1ADQH 2FGZA 3BN3B 5JORB 3KPRE 4L9DA 2ICWB 5C6TL 4EN3B 3VWJA 4Y4FA 4Z7NF 2YOCA 5DD3H 1QQDA 2BDNH 3E1F1 2NTFA 2D31B 2FGWH 3C6SB 2HVKB 2P8MA 4NT6A 1RZFH 3DNKA 5DZLA 2M8XA 2XOTA 4TTDC 1ZS8A 4G80A 5D72H 3DV4B 4OB5L 3TJHD 1C08B 3IETA 4LRNH 1BP3B 5JMOC 3GMMA 4NQCB 1J0JA 3EKCA 4LCIH 3DYPA 5LWYL 1WWWX 5IB2A 4NWTH 3S3PA 4GG6F 1T2QH 1WUNT 2D4FA 5L0QC 4JZNB 1UEMA 1TZGH 4D0DA 2P5EE 5C08D 1DEDA 2IAMB 1PYWB 1I7RA 2RAMA 2G75B 2VUYA 2EDWA 4NWUH 4RGMB 1EGJL 5D4QA 4PJ7A 2F53B 2VXVH 3AAZA 1X5LA 1WICA 3JWDH 1U8OA 5TF1H 4TPRH 3C09B 3VE0A 2VQTA 3DXAA 5F9WC 5IR1A 2BNUA 4U6XB 4PJDB 5AYQA 4LNVA 4A2MA 2YPLD 3R06B 3QO0A 1GRWA 3QUMB 4HJGB 1B90A 4YHLH 4BZ2H 2AS5M 4X7FC 5ITFA 2P43B 1DEEB 4DKFH 4LAJH 3EZ8A 2DTML 1JHKH 3MACL 4PTUA 2UVFA 1FYTE 5FHBH 1ZLUK 1KEMH 4NZUH 1G7QB 4LLWA 4D0DB 4IMLA 2R56H 5C0JA 1B4JL 1E6OL 5FYKH 1UVQA 3CU7A 4G5ZL 5CGMA 1J1OH 3NGBC 2ICEB 4WVRA 3TNMB 3RL1B 1TFHA 5AD0B 2MCG1 1B3JA 4F7EB 3VDAA 4UDUA 1NGQL 4MYWB 5DZOA 1Z0NA 3M8OL 4P59L 3SE8L 5HHXL 3X3FL 3UYRH 5DJ8A 4WY7H 1OQOA 5EIVA 1ZVSB 2DIAA 5BVPL 5J11C 3TVMD 5KVGH 1NCDH 5T33L 5AEAA 4U05A 4XCEA 4NKOB 1J7VR 1B2WL 1J8HB 3GFUA 3GSQB 3M17A 5E8EB 4YWGL 3W2DL 3BRGC 1S9WA 2NY0B 2APBA 1IAIL 4X98B 1BAFL 1BFTA 1G6VK 1J0YA 1XGYL 5CLTA 4GAFB 3GMLA 5H94B 5JR1L 4LARH 4JZJA 3MRQA 3VWKC 3UJTL 2AJSH 4G8GD 1RV6X 4PYHA 2C5DC 4OQTA 4XB7A 1QUNA 4GRLD 1RZ7L 4O9HH 2EDLA 4NNYA 5F88A 5CSZB 3HZKA 4BQCA 1FNGA 2EKJA 5HPMB 4GRWE 1JRHH 5ID1A 2V9TA 4M62L 2YSSB 5DF0A 4IRZH 3HUJE 1FC2D 4KGJA 1IZJA 3VXTB 1OGAD 1JNLL 5HYQA 3U7YH 4WO4C 3BKMH 2G5BB 2R15A 1MRCL 5C08A 4JY4B 4EN3C 2FBJH 4ZUVB 3U4AA 4BSWA 4YDVB 2ESVE 5IBUG 1D6EB 1BEYL 1MRCH 1HINL 4EI5A 1FO0B 5CHNB 3GBNH 4EXPX 5DHYA 4MD5A 4UOW1 1XGTB 4UU9B 2J1KA 3U1SL 4XVUD 1IFHL 5IWLA 3PDDA 4QHLB 4KVNL 3QDGB 2PKDA 1GGBH 1K5NA 3VWJD 1NC2D 2APTA 3L3JA 3CK0H 1U36A 1OP3H 1WCBB 5JNYB 4RGND 5CZXD 3CVHL 4F9LC 4GKSA 1JHLL 2BVEA 3SOBL 2GTZB 4M1CC 3V4VL 3OGCB 1MCOL 4JDTL 4JG0H 1R3JA 2VN7A 4TPRL 5EOQL 3CLEH 2EIZA 3FT3B 1YZZA 2Q7NA 4YXLH 2R8SH 1YY8B 4P5TD 5F89B 3WFBL 3B9KC 25C8L 5I71C 2BVOA 4JPWL 4JFHD 5I8EA 4D3CH 2CIIA 4J7RA 3V2AR 3CFBA 3EO1A 3OKEA 4NQUA 4C4KT 4O58H 5DMIH 2MHAB 1C1EL 1KEML 5I1HH 1C12A 3DMMA 5I9QC 1KB5L 4LF3B 4YDIH 1TCMA 2DI9A 3O6KH 4P2RD 5JW4R 4C56A 3NIDE 3FMGL 4AL8H 5D1QC 3O6ML 1IGYB 1KYOK 4Z77B 4XTRC 5JPMA 4KKLC 5M95B 4L9LC 4HF5H 3P9LB 3ARGD 6FABL 4Z7WE 3VD9A 4MVBC 3T8XA 5F8QC 4M03A 1PZ5B 4LDLB 3QDJA 2JJSC 2BSRA 4NNPL 3VFTB 5C0BD 1BQUA 4UILH 5FA4B 2UZYB 1WTGT 3E8UL 2P5WE 4NQSA 5C0BB 4XMKH 4QOKA 1P53A 4JRXD 3AXLB 3T2OA 3TC9A 1EHAA 2NY6B 2DOCA 4OCSH 3JWOL 3LV3B 2AEPL 1RZ8B 4LRIA 4XMPL 4BH7A 1OTUC 3CX2A 2OSLB 2EYSA 3VI3E 3RJQB 3U7WL 4Y4HC 4P2CG 3ZTNL 2DQCL 2HG5B 5EC1A 3ZT6A 3FRPA 1PKOA 4JM2C 2VMFA 1MI5E 3X12A 2D7QA 3IKCA 1Q9KA 5EUOF 4QOKB 4OSUL 3G6JF 1ZE3C 4R97C 2EIDA 3TZVD 2H2SC 1IM9A 2F74B 2W1NA 4HLZG 5TFSL 2HFTA 4M62H 1HZHH 3D3VE 1J9CT 3MGTA 4UOW0 1HOCB 1PG7L 5CGTA 4FZEL 1WFOA 3V6FA 4J2XA 2YBRA 5LBSL 3CMOL 1FYTA 2HKFH 5CBEA 3V4UH 4RGNC 1NAMA 4WFFE 3QRFM 1ZVHA 3LPGA 3RGVD 4LLQB 4ODVH 3W0WA 3F5WB 3VA6A 1MRFH 4M1GH 4QNPE 2RIKA 2VZSA 1SEQL 1U3HD 4Q9RH 3T08A 5GPRA 5HGDB 4JQVC 5IGXH 1HQRA 2Q3ZA 1ZXQA 1FBIH 4P3DB 3OKEB 3QB7C 4E41D 3NZHH 4PJ7F 2XICA 3DUSA 3D18B 1TZIA 1QLEL 4PG9A 1TPXC 4L29A 4NRXA 1E28B 2AJUL 4NBYB 3MLUL 3QIWC 4PJEE 1NLBL 4C83A 1U8JA 1O7SA 5F89A 3SDAD 3EOAB 4ZPVA 2BVOB 5KSAB 5ERWA 3MOAH 1IM3A 2EKSB 1G6RL 1P7KB 5KS9A 1XMWA 1NPUA 2X09A 3JWDC 4M5YL 1XT5A 2J7LA 4EBQH 5GZNC 4GBXC 1KPVB 2QQKH 2YMXL 4AEFA 3LKPB 2CKBL 1LO0L 3BGAA 5D7JD 1CN4A 4LSUH 4M4PA 4RMQA 5F9DC 2WIMA 1BIHA 1RULL 2E7HA 3AS0A 1MOEA 5E5MA 3QIBD 1CICD 4I18C 3S88H 1LO2H 1NBZB 4QRRD 5MENA 4APQA 5KSVB 4U1NB 2P46B 4ZOBA 5E2WH 5MHSE 2XTLA 4H25A 3ARGA 3EJZD 3MCLH 5DS8B 3MA9L 4HLJA 3WO4B 4X7DC 2QQLH 1P4BH 4MZ2A 4E41A 1MF2H 2H6PB 3UBXG 5TPWH 4OGAD 2EH7L 3BGFC 5DEGB 5E6ZA 4MNQB 3WJJA 3UTOA 2XZAL 3MA9H 3GSNA 2AV1A 4HW6A 1OARL 2VTFA 3MTRA 4LSPH 1IEBA 2Y1VA 2KL6A 1PKQA 5F9AC 4BFGA 3MRFB 4E0RA 5HDBF 3ELAT 4KDVA 3V8CA 1KB9K 1UC6A 3ILQD 2BJML 3LKRA 4NO5B 2FATH 2OI9C 2MCPL 5KS9F 4D8PB 3AM8A 4XCFH 3U0PB 5I6XC 5I8CB 2DF3A 2XKUA 3MRDA 1B0RA 4RX4D 1QBLH 4JVWA 4PJAB 3S37L 1WFUA 4Z18A 4QRRA 1A6ZA 1L9MA 4XXDA 1FNFA 2E9IA 3WXVH 3ZSTA 2MJWA 1IT9H 2AEPH 3QEGL 5F7DB 3QUYB 2R1XB 4X98A 2ITDA 4NSKA 2CLZA 3D48R 1VCAA 4ZYKB 2VSCA 3OKMB 1U8MB 5L7XH 5J12C 3AVEA 1EMTL 2HFFA 5C6TH 2AK1H 3KPLA 5I75C 1BOGA 1K4DB 4HWBA 3H42H 3H3BC 1AFVH 4CNIB 4P2QE 4NUGH 4LVNC 4EDWL 5T3ZE 2FB4L 2RQ8A 4MZ3A 3BZ4A 4UV4L 4OBSA 4BJLA 4X6DE 2Q86A 4LRNL 1VADA 2FEEI 1U95A 3GSRA 2R2EB 3RL1A 2DQFB 1XF2B 3SE3A 4KJYB 3QUML 5AWNH 3QNXA 1H0DB 2X7LB 3PQYD 4KKLD 2JCCE 4Y19A 3RPKA 4KDWA 3BZEA 5HHQA 3CIQA 1IC4H 1CFNA 3CH8A 4LLVB 4EDXA 5DTFA 5C07B 3TH2T 3MRGA 1OTSC 2B1HL 5CUSL 4Y4KA 4JFZH 4JJHA 3MLXL 3SDAB 3I2CL 2V6HA 4WFED 1M71B 3G5ZB 5HYFA 1KCLA 3MODH 4OZHA 2ZSWB 2W9DL 4KI5F 1QYGL 1MCNA 2VN4A 1S7RB 4QT5A 1BX2A 4OLYH 3CVIL 3QI9D 3L6FA 5KOMC 5GRXG 4Z8FH 2DLEA 2NXZB 3KHOA 5C0DA 4YHIB 2A83A 4LU5L 1QBML 3NABL 4GUPA 4LVOB 5HDQL 3PGDA 3G6AB 2CUHA 2WZPD 3TGXA 1BLNB 3HMXL 1SYSA 1J1PL 1XH3B 2DTMH 4ZOCA 3RNKA 3MGAA 5E7FA 1AO7E 3PG2A 4FHBD 2HFEA 4DN4H 1U8KB 5HHVH 2IAMA 2FRGP 4NN7B 2QSVA 2D9CA 4PLKC 5E8PB 2G75A 1VHPA 2F5BH 3HS0A 4HUVB 4ODTH 4XP1H 3FRUA 5GGTL 3V7AE 4CDGC 4P2QD 4HUVA 1G9MC 3CFJB 3SN6N 3O3DA 3BSZL 1FN4B 1LE9A 4X5LA 4M7LH 1CD9B 4OFPA 4W6WB 3TBTB 3QEQA 3ARBC 3GB7B 2X9XA 1OGAB 2IQAA 3EDDA 2BRRH 4P59H 5HHXH 2AEQH 5EU6E 3MV7E 1T2XA 5D9SA 5JZ7C 1ORSA 1N5AB 1CGWA 1I7ZA 2ZPKH 5HHNB 4JN2A 1BFOB 2DQJH 1B0GB 4X7SH 1AGEB 1A2YB 3T09A 4B7IA 2K1MA 5F1OB 1FLRH 4NFCA 2XN9B 4P4KD 1FZJA 5IBLD 5FM8A 1LNUB 2HT3D 3RP1A 1NC4A 1M7DB 1IEHA 1TCRA 5GGVL 3UZEA 3GHBH 4R26H 4XP6H 4NP4H 1AXTH 4JN1H 1RJLA 4HG4K 1DBMH 1KJVB 1RUAH 3V6ZA 4PRAB 2P45B 3H3KA 2A74B 2RFXA 3I50L 2DD8H 1G7HA 3OTTA 5HHQB 2I60L 4OLZH 1Q94B 3PDOB 4K3DL 2BVQB 2CK2A 4LAQH 2PUQT 5J6GA 2JIXD 2AKRB 3LCYA 4U1KB 4MJ6A 2R2EA 3O45B 1IQWL 4F7TA 3BKML 4AG4H 3HI6L 1VFBB 4LIQL 1NGPL 4E41E 3OBAA 1FPTL 4GT7A 1BGXL 2R1WB 5H2BA 1MCDA 5J4MA 5FA3A 3ZKSD 3CFEB 3MV8A 2GJ6B 4F2MA 3LEVL 3IDIA 3R1GH 1ES0A 1F3JA 3TJEH 4L4VB 4Z5RA 1R6VA 15C8H 1TITA 1OL0A 3FONB 4H26A 4LCYB 1MJ7H 5C0FA 4HGWB 1QRND 2XXCB 3I6LE 5D70L 2VDRL 3LEVH 3R1GL 2AV1B 3CAFA 4UOJA 1BEYH 3RTQC 2FX9H 4M4RA 5IBLC 4M8VA 3H9SB 3TVMC 3OWEA 4DZBB 2Z91B 5L8JB 5E70A 4OZHF 2DQEL 4UNUA 5I1KL 1M7IB 5C7XL 3MYZA 4YDJB 3QIUC 4Y4FD 4PGBA 1MELA 4X8JB 4YFLF 1N59B 1OB1A 3HZYB 3K2MC 4GQ9H 2YUXA 4FQ2L 1JRHL 1WTLA 1A4JA 3MJ7A 2YD3A 4QKXB 3FFCB 2ZCHH 5EG6C 3RBGA 3GGWA 3F8UB 2YPVH 4ODSL 3F65A 4LKXA 1DBJH 2AI0L 5ANME 5FGBA 1LP9F 1QEWB 1KNOB 1NGYB 2APXA 1FFNA 1HN1A 1T21A 1A3RL 1KYOJ 4GW4A 2F8OA 4HUWA 3SDYH 3O2VH 3PWLB 5C8JB 1RUQL 3TN0A 3IFOB 5T3XD 3UP1A 1D5IL 3MFFA 3C8KA 2NNAB 3SE3C 1NCAH 3DVNB 3CSYB 5JPNB 5T5FH 3ULVD 4JPKL 5DURB 4KHXL 1CTNA 1WT5A 2ZCLL 1WZKA 2BCKB 4RBPH 5E2UL 4XI5D 2AJVH 3GMOB 4DFHA 4U6HA 1Q9OB 4X7CC 4ELMA 1I9IH 1A7BA 1IRAY 2BK8A 2ZP0T 2AJYL 1PSKL 4NQCE 5GGTH 2P42B 4GKNB 4YEFA 5HYSA 3FRPG 2J5LC 4LNRB 2JB5L 1CFVL 3MRPB 4P46A 2FIKB 2O26U 4POUB 4G43B 5D8JH 1AHWA 3O3EA 3LH2H 3T0EE 1IC1A 2N1KA 1JPGB 4PGCA 5GJTL 1P69B 2VDQH 2AP2A 2PO6C 4K8RC 4KDTA 4HWZA 1ZANH 3H7BB 5T5NG 3T0AA 5IP4A 4Y4KC 1IM9B 1CQYA 3V5HB 5AZEH 5KVMC 1OGTB 1PAMA 5K59E 3NFSL 3WHXA 5DA0B 4WTXA 3MFGB 1NCNA 1JF1B 1A9EA 1L7IL 3GHBL 4R26L 4Z7WA 4NRXB 3HR6A 4R7NB 2A9MH 3GIZH 4GG8B 1MIEL 1KLGA 1NLBH 4NN6C 2X4NA 4PJFB 3TPUB 5CSBA 4DEPB 3BPLB 5L6YL 4MX7A 2I9LB 3CFCH 5JHDE 3W82A 2FHFA 3LKQB 1RJYB 2J3SA 2EZ0C 1N0XL 4ALAH 5I1IL 1WWBX 5ISZD 1YMHB 4XPTH 4GRWB 1SEBA 1YEKH 5T1LA 4MB4A 4XCYA 3PJSB 3RVXD 1DQDL 4L8BA 1H9VA 3QXTA 2N7AA 3HMWL 3VCLA 1IGFH 4Z77A 4R97B 4XPTL 1GZQA 4CVXA 3UTPE 1PDKA 4Q9RL 4XVTL 3EO9L 2D0FA 3TT1H 4XMKL 1MJ7L 3VXRE 5B4MD 1U8QA 3GI9H 2GAZB 2V5YA 1CDCA 3DX9B 4QRPE 1M7XA 5CEYB 4QLRA 4U1GC 4XBPA 4ZFFB 3NCJL 5HVWA 4AT6B 4TSAH 4NO3B 5FYJH 3V0WH 1FDLH 3EAKA 2MMXA 4WNQB 1F97A 3LB6D 2CQVA 3DTXB 2YZ8A 4OZ4A 1RZ8A 5GGUA 5DWUL 4I2XE 5C0CD 5DUMH 4BSJA 4Q0XL 3ARDA 4OCNC 4HIEB 1MAML 1A9EB 1QR4A 5F1NA 5BS0D 4X4MA 3NIFF 2H8PA 5FA4A 3EHBC 4P5KB 4Z7UB 4FQCH 2VC2L 3FN0H 2BNRE 4YHOL 5ACLA 4YH6A 4GRMB 3RNQB 5DJYB 4MA8H 1MHHB 4RWYH 3B9VA 3B43A 3D25A 4XCFL 3P0VH 4PJBA 3QPQC 3HZMA 1A4KB 2DTSA 1S7SA 3X14B 3C5ZD 1T04A 1YDPA 1A3RH 5IJVB 3QJHA 5I9QB 2FD6H 1DP0A 2AJXL 5GISL 1IILE 2FX8H 3OAYH 3GNMH 4LLMB 1UWGH 4EUPA 1FGNL 3BOVA 3N50A 4FNLL 4ZAKB 5BVJA 3BESR 4PRBA 4MS8C 5FGRA 1XF3A 3G5XA 5FDWB 3PHQB 1DBAH 1MF2L 3IDNB 3GO1H 3H3PH 5GHWH 1AD9A 3I6GB 3HRZB 3MRKB 3CSYA 5A3IC 2XY2A 3MLYH 4K7PH 4OKVB 3WIIH 2GEEA 1MCQA 3BXNB 1AXSA 1A1OB 3THMH 1BZQK 2HJLB 5DI8A 1KUMA 4A2LA 1NMAL 3ALPA 2GJZB 4MCZA 4AENB 1F02I 2GIYA 3FFCA 4X5XA 5HYJB 1MFNA 4H8WH 4Y1AA 5HGAB 1FSKC 1KXVC 4HMDA 4HAFA 1RFDH 2FWOB 4Y19E 1R3HB 4YXHL 4ZAKD 2PCPB 1NGXB 4H1LH 2DWDB 1OB1B 2FHCA 5DFWH 4QRUA 5EU5A 1G9NC 2H2PC 4JQIL 1XGTA 1UKSA 3ZE0F 2R9HC 1IT9L 4U49A 1BECA 4EJ1C 5TE6H 2F5AL 4ACPA 4ZS6C 3ALXA 1FE8H 2Y4SA 4JDVB 1M1SA 3UXFA 1YC8A 2ZG2A 1AFVL 3TYFB 2AGJL 5CZKA 4NQDD 5DJZB 1WFTA 2HTKC 1J86A 4F8QA 1D5ZB 3MQIA 3PP3K 1FE8L 3K2UH 2FATL 3GSNH 5ETUA 3SDXB 1NGWB 3RDTD 4JKKA 1ZHLA 3F6LA 3BP6A 4YGVB 4OAWB 5I1CL 1TNNA 3RVUC 3TBYA 1CVRA 5T1KA 1F3DH 5FYLD 4ELME 1RIVL 5EBMA 3NACH 4RCAA 1V7NL 3EYUH 4GSDL 1DQLH 3A0OA 2O61A 4FOMA 3KJ6H 4JEGB 3LKSA 5EZLA 3HB3C 1ZT1A 5BZWB 4I9WD 3NPSB 2Q76A 4OGYL 4HIJA 1UVQB 4PJ8C 4WEBH 3FZUC 1MRDL 2AEWA 2VABA 1PKQE 3QUZB 3FT2B 3PHSA 4KH2A 1FHGA 5D7SL 5FHAH 2RFXB 4Z76B 5C0CB 4X6BB 2HRLA 5K9QG 5EOTA 4DGIH 3TA3C 1ORQA 2BHZA 1P7HL 1DFBL 1GL4B 2DWEB 3PE9A 1EEUA 4OT1H 5IK3A 2DLTA 3VI3F 4RZCB 4AEEA 4P3CL 4PREA 4N0RA 4PRBB 1A6VH 2R23A 1KENH 4Z8FL 3D69B 3PL6A 1EZVX 4LHUD 3BUYB 3V52L 5GS0C 1N5AA 1MSPA 3OAZH 5K9KB 5HHVL 3VXSA 3AM8C 4OUUB 5H37H 3GEWB 4HJJL 3WLBA 1JE6A 1JN6A 1T6WA 3ZKXB 2JF1A 1A6UL 3NAAL 4KRPB 4JO4H 1H3VA 3QG7L 4JRXA 4PJBB 5FO8A 4M7LL 4NRZB 4XP9L 4WTZG 5DMJB 3CH1A 1U0QA 3RKDC 2FX8L 4ODTL 1MY7A 3RY5A 3U6RA 5LKNA 5KSBB 5D6CA 2VDOL 1FFOA 3QG7H 2D7TH 4P5KA 5DRWB 2B4CH 3MJ9A 4X9BA 3VJ6B 3L3GA 3L9RA 2PR4H 1GJIA 3SDXE 1T03H 3ULSB 1JNHA 4WV1C 5SX4I 3MRCB 3EO0B 4MAYA 1AY1L 4FFYL 1UM6L 3UTPD 3OHXA 2N7BA 1JGUL 3U30C 3T3ME 4XHJC 4P3WA 4G6FB 3GI8H 1S9VB 1WVZA 3P4LA 1IQDA 1P1ZB 4R4NC 3O8XA 5EZOH 1S7RA 5JXED 4RMWA 3DHJA 1JYVA 3L6FB 4F9PC 1U8QB 2XN9D 4AMKH 1RHFA 3BMWA 2HVJB 4HK3J 4JM4L 2X5PA 4KJPD 5GQBA 3C5SA 2VL5B 4QOKE 2VR5A 1NCTA 2JB6A 4I77L 5J12B 2QSCH 3HLAA 2E27L 4CW1A 4PFEA 3HE6B 3OKOB 4NC2B 5E2VL 5M94B 4LCCA 3IDYC 3U6RB 4RRPG 4Y19B 3KYAA