2X1VA

Crystal structure of the activating h-ras i163f mutant in costello syndrome, bound to mg-gdp
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
139
Chain Sequence
TEYKLVVVGAGGVGKSALTIQLIQNHFVDSYRKQVVIDGETCLLDILDTAEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Activating H-Ras I163F Mutant in Costello Syndrome, Bound to Mg-Gdp
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPASE HRAS
total genus 44
structure length 139
sequence length 163
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x1vA00
2XSZD 2HYIC 1OFUX 3WNDA 1KI6B 1S2MA 3H0KA 4QJ4A 2QN6A 2JLVA 1NVWQ 1QRAA 2A9KA 2OFWA 4FIDA 3TW8B 1W5TA 2PH1A 3BIFA 1G3MA 4S2EA 3RLFA 1SVLA 4YQFA 2F1IA 1NG9A 2FGJA 1CULC 1OIXA 4JL6A 3SFVA 3I5XA 3U44A 1ZJ6A 3AUXA 1P5ZB 2VP0A 1Q22A 2QSYA 1VCOA 1ZM9A 2ZRPA 4Y0VA 2BIFA 3IEUA 2LCFA 4CW7A 1ESMA 3UMSA 2CJWB 4IXNA 1UADA 4TL6A 4HUQB 4X8HA 4BEBA 3C8UA 4Q1BA 2PZGA 3VKHA 1G8HA 1U2RA 3W5IA 1RRCA 5CK4A 4W5JA 2HXYA 1GIAA 1R0ZA 4PO8A 4MA4A 1AQYA 1RYHA 4KSBA 3IGFA 2NO1A 5KPJA 1NMZA 4BFZA 3EWSA 5JRZA 2O5VA 1NVUQ 4CDGA 2DFNA 4XSGA 3TVDA 1Z28A 1TX4B 4XTCS 5FTJA 1I2DA 3VR1A 1HYQA 1D2EA 1EFCA 5K8TA 4QBIA 1E2NA 1BYIA 4WW0A 4IEEA 5TB5A 2O0JA 1TEXA 4A82A 2VSOA 1T4GA 2ZI4A 1E9RA 2BBOA 1GKIA 2QPAA 1AN0A 1W5SA 2YKGA 1NSTA 4KAXA 2FZ4A 4ZI2A 2XTMA 5KUTA 3PEWA 1MT0A 4EKDA 3U7GA 2WAXA 3SZRA 1E2HA 2ZU0C 1XTRA 2EFGA 3C5HA 1AK2A 4DLYA 3A6PC 5DNYB 2QP4A 3IUYA 5LD2C 1KMHB 1P9RA 2RGAA 3C14C 4OHWA 2G6BA 4PXAA 5A0FA 5DI3B 1J99A 2FZLA 4UNNA 4DDTA 1ZNXA 2YVUA 2ZI7A 4HZUB 2ASEA 4TYQA 2OBNA 4BLPA 4BEJA 1AS2A 4DIDA 2YYZA 1QHNA 1EESA 5EUQB 1DAKA 4TL7A 1Z29A 1OLOA 4G3XA 5BN5A 3SS8A 3A36A 1C1YA 2AFIE 1XZQA 2O8CB 1IOZA 4E03A 1KI1A 4IDHA 3RS2A 3X2SA 1MKYA 3CONA 4C7OA 1D9ZA 1NN3A 2VF7A 3ND9A 2IYUA 2XTZA 4TMTA 2DYKA 4PFSA 1YQTA 4TMKA 3DM9B 4BFXA 1FP7A 3L8ZA 1P75A 4IJMA 5GVRA 2IWHA 2JLWA 2FNAA 5L3RA 3B82A 3EZ2A 4QFMA 2GTPA 4TYPA 5E7JA 3CZQA 2D7DA 2W6JD 3RDPA 1ZNZA 2ERXA 4IOJA 3KKQA 1VCMA 4QHSA 1SZPA 2J5XA 5FPHA 4RFVA 2VH5R 4US1R 4Z54A 3TRFA 4BWYA 1SXJB 4QGHA 2XTNA 3HPQA 2BHRA 2DY1A 4LY6A 4OHXA 2MSCB 4Q7JB 4D4JA 4WZAE 2V7QA 2J7PA 4AIIA 1QF9A 1VHLA 3W3ZB 1XMJA 2EYUA 2JLSA 3BAFA 5EP1A 2IX3A 2RHDA 4A6PA 4A0FA 1N2CE 1XPUA 1KAOA 1ZVQA 1SULA 3AGQA 3HR7A 4HYYA 3GCGA 4KFTA 4NMMA 3SFZA 2R8RA 2WJVA 3LW8A 5HKKD 2IYSA 1R5BA 1G20E 2V54A 4N3NA 2RGEA 2QQEA 5FPTA 4MDEA 1P3JA 5JZVA 1FX0B 2JJ2A 2BM1A 2AWOA 4M53A 5LBIA 4B2PA 4GRAA 3ZH9B 4IOKA 1G18A 3CZPA 2XX3A 3QEJA 1M1YE 4BE7B 4R9UC 4HB0A 4OHVA 3CO5A 1GRRA 1ZNYA 2G0NA 1NIJA 3HPRA 2AD1A 2PZEA 2QMHA 1Z5ZA 2GJKA 2ZETA 3OEHD 4HDQB 5TXGA 4AKIA 1N6PA 1OXSC 2GRJA 4WA7A 4L8GA 4D0LB 2OXCA 2ZE6A 2AFHE 4GSYA 5BN3A 1ZM4A 2JASA 2J7PD 4KVAA 1E79D 3SC3A 1CS4C 2IF2A 4P0TA 2V6JA 2EWVA 3AF4A 4FXPA 3HJNA 4K8OA 1T5LA 1PUJA 3C5CA 4C7OB 4KU4A 1G17A 1XD2B 1SXJA 3AB3A 3CLVA 3NHAA 4GMDA 3THWB 2Q3HA 1XZPA 3T5DA 4MQBA 4FCTA 4CEIB 1E4YA 1Z83A 3NWJA 4PHGA 4NYJR 5B57C 4PQRA 3BRWD 1Z08A 2X2EA 5IK2D 3FE2A 1TMKA 2VYFA 2PCLA 4R2IA 5AUPB 1ZINA 2OG2A 1EFUA 3CNLA 4DSUA 2I1QA 3H4MA 4IOLA 3QKRB 4Q18A 2VSFA 4OQMA 5F9FA 2QPOA 1FFHA 2BMJA 5DHAA 4FI3C 2HF9A 4TL8A 3IIKA 1CR0A 3TE6A 2ZXUA 4JLKA 1W44A 4XH9B 3TLXA 4JLJA 2AKAB 1OXUA 3UWOA 4OK5A 4OYHA 3AF3A 3S1AB 4ERNA 1BH2A 3CRRA 3VU9A 2B92A 4P32A 3AVQA 5BXQC 1TF5A 2ZS8A 3PUZA 1NMXA 3LWNA 5JJKA 2HJVA 2OSBA 3GJ5A 1YU9A 3Q5EA 4JVMA 5P21A 4BASA 1UBGA 4M21A 4P3YA 5FBWB 3O8DA 2OXRA 1DG3A 2Q3FA 4MYTA 1E2JA 2WKRA 3FB4A 4I1SA 4GOKA 1TTTA 1N3BA 4P4SB 1FX0A 1I4LD 2HYDA 3C7KA 4BFYA 1V43A 3EIEA 3PQCA 1VG0B 3QQ5A 4X8OA 2DFLA 2J87A 1Z2AA 3EW9A 4MYCA 2TMKA 3RC8A 1R8QA 1KDOA 2PBRA 4DLXA 2A5GA 3AEZA 3AKEA 3VKWA 4JBYA 4UXJA 1P6XA 3EG5A 3RHFA 1T3LA 3QKRA 5TVKA 3SHWA 4A8JA 1IAQA 2CNWD 4O2RA 4HLCA 4QBHA 4R7ZA 3RWMB 3CPHA 3SBDA 4HUTA 3P4YA 2OFOA 1Z3IX 2IUSA 2CJWA 1H8HD 1XXHA 1ZW6A 1KSGA 3OZXA 2R62A 5DN6A 4LBYA 3AVUA 2CVFA 2V7QD 4DLUA 4AY2A 5UKDA 1VECA 1DVRA 1OYYA 1KDTA 1LFDB 2A2ZA 1ZM3A 3LBNA 1A2BA 2J41A 2W6IA 1S0UA 4I1VA 3ZZ0A 4C0QC 4B3FX 1J7KA 3U3MA 2F9MA 2ZIAA 1II8A 2C9OA 1XB2A 1FTNA 2WHXA 1CJTC 1G19A 2B6HA 2F1RA 3FKSA 4Q9LA 4DCNA 4YMUA 3ZZTA 1KY3A 3A4MA 1US8A 4N0EA 3T06B 3CH5A 2XZPA 3IBGA 4BRUA 3IO5A 1IJFA 2V55B 4B76A 3I61A 3O47A 2ZRGA 4K81B 3R7WB 1ZM7A 3IQXA 1ZC3A 1W4RA 5J4LA 1W36C 4RD1A 2WMNB 3I5YA 1YZUA 2ZRAA 3ADBA 1RFLA 1E2PA 4AKHA 3LVQE 2FOLA 3E1SA 3VNUA 2AHOA 2G0TA 3AQ4A 1F48A 1IN4A 4L9WA 1U0LA 2ZREA 3R8FA 3AVPA 4NYIQ 4F4JA 2VQSA 4LJ5A 5J5CA 5JBQA 2C5LA 1B23P 4QNRA 4N0DA 4BZQA 2FEOA 3VR5A 4UQOA 5KU1A 2QQ0A 3LH5A 4RD6A 2GBLA 1JPJA 3X1WA 2YWFA 1VYVA 1E69A 4PPGA 2OLJA 3CF2A 4TWZA 1OHHA 4Z1MA 3CNNA 1M7GA 2GVDC 4P4SA 5E3HA 1E1RA 4B2IA 1JECA 2ZS9A 5JECA 4BPBA 3I72A 2VHCA 4M0LA 1E2QA 1F6BA 1FQJA 4GMXA 2REOA 3ICQB 1F2UB 1Z6YA 1R0XA 2L0XA 2YINC 3MRSA 3QXXA 4MITA 4DHEA 2ZJ8A 3ZJYA 5BYKA 1KZ7B 1CJVC 1ZBDA 1OPXA 2BBSA 3D3QA 2GEVA 1OXTA 1GG2A 3PXGA 2QAJA 2N1BA 1OXVA 3X1DA 4KITB 1KSFX 4A0GA 4B73A 4MKGA 5AK0A 2QMOA 2H17A 1KO8A 5DO9A 1LF5A 1QVRA 2IYWA 3L0IB 4TMZA 1QG4A 3I8XA 4GP6A 4KFRA 4CVNA 4CEHB 1X8JA 3EPLA 4A2PA 4DDVA 3G5UA 3DMDA 4BFTA 1DTSA 1GITA 3B9PA 1GUAA 5CIQA 1E98A 1SKYE 5CM9C 4EAQA 3LA6A 2W0MA 3B60A 5HZKA 3TGPA 5DE3A 4KYUA 1Q21A 4TLEA 3AM1A 1TF2A 2ORVA 4HLDA 4F38A 4D4LA 2W2XA 1E9AA 4FMDB 3SEAA 3TQFA 5G53C 4AYTA 4B74A 3L0SA 4WXRA 4B35A 2HT1A 4E07A 2ZRFA 1YHNA 2QNRA 2VP2A 2ZSDA 4PPQA 4URYR 4LJ4A 2LWIA 4U5XA 3EASA 3R9WA 2ANBA 3K09C 2HCBA 4Z8XA 4Q47A 3GLFB 3EPHA 3DL0A 5EXPA 2PX3A 1QDEA 2QMEA 1ETUA 5JLJA 2GJ8A 4MRPA 2SHKA 4URWR 2H1LA 3U7HB 3QKTA 3VAAA 3NDBB 3KQUA 3THYB 4TMWA 1R5NA 3EX7C 1PV4A 5EP4A 3V9PA 3OFNA 2OE2A 3IHLA 3W6OA 2BMFA 4FCWA 3QF4B 3GLGB 1S3SA 2DB3A 5KDLA 5FTLA 2WWGA 1IY2A 5EE0A 5DN6D 3C15C 1JNYA 4AKEA 1JXMA 2A3RA 2XSZA 4IDNA 1XDBA 2GDJA 4B3DA 2MMGA 1GM5A 5EXSA 4NHOA 4FMCF 4BLRA 1M7HA 1G3RA 1II0A 3LXXA 1M6NA 4AYWA 2CBZA 3NC1C 5KDOA 1OHHD 2CK3A 5D3MB 4DUGD 1NKSA 5TV2A 1U81A 2AL7A 4JMPA 1D2MA 4V0MA 4DIEA 2B7CA 2G88A 4CT5A 4JT2A 4F92B 1KK2A 2CL0X 3B5JA 5FR2A 1UFQA 4G5SA 4E5UA 3V00A 2C99A 2QA5A 2VHUA 1U9IC 5CLLA 1I4DD 3FTQA 3B1YA 4M1OA 5JEDA 4LBVA 4GP7A 2IYYA 3U3JA 3N5CA 3WYGA 2O8FA 1KNXA 2EWWA 1XTSA 5CLQA 4DB4A 3PEVA 3MWJA 2ECKA 4JSYA 5TARA 3ZYCA 3BBPA 4NP6A 2WJJA 5FOVA 1TNDA 1P2VA 1EFTA 4XWOA 2YC2C 2PT7A 4Q1AA 4A2WA 3BC1A 2DWQA 2XGJA 1W48A 2PX0A 3K0AB 2XB4A 4E22A 1E9DA 1N6LA 4MRRA 1RW4A 4M2LA 1VTKA 4B34A 5GVSA 2IL1A 4Q7KA 1YE8A 4CIDA 2RGDA 2ZYVX 4Q03A 5L8VA 3Q7QA 1VHTA 2JATA 3KKPA 1OF1A 1O87A 4LOAA 4B2LA 1VPLA 1ZMXA 3EXAA 5IT5A 2XITA 2A7QA 3EC2A 3RWOA 2WSSD 3THOA 2WTUA 3WMEA 2QTHA 3EZ9A 3QE0A 2QP9X 2FFHA 4JVSB 1H8EA 4NONA 4Q4JA 4LJ8A 2R44A 2R65A 3NC0C 4LYAA 1G41A 4LJ7A 3FKSD 2HT6A 4P31A 1SHZA 4DJTA 2O8CA 3R9XA 4MUBA 1SXJD 1A2KC 2JJ8A 2GZHA 3C16C 2IK8A 2Q6TA 4OI0A 1A7JA 3QVUA 3K8YA 4CEIA 3Q85A 4PHFA 3BH6A 4DDUA 5IRCD 3GEHA 2IYRA 2FN4A 3Q7PA 3UWKA 5DISB 5TMPA 2D4HA 3PUVA 5HR5A 4E09A 2B8TA 1T5IA 4IVPA 1AS3A 1KI2A 1U0JA 2JLRA 3T34A 1LTQA 4QJ5A 1BO6A 2IHBA 4U02A 2IW3A 2I4IA 4KSCA 1Z22A 1YZKA 3ZLJA 4LPKA 1YZQA 1XPRA 3TAHA 2G83A 4RKFA 3ETLA 5KNBA 2C98A 4ITRC 1KY2A 1Q1ZA 3KXKA 4M9SA 1E79A 1C4OA 4XOIA 1W4CA 4OL0A 3SJBA 1YKSA 2QORA 5EE3A 2FU5C 1SQ5A 3WXMA 4M9ZA 1R5OA 2QAGA 3TW4A 3O8RA 2VHQA 1MV5A 3OAAD 4UXHA 3H1TA 1AS0A 2ZRHA 3B85A 3J81k 1E3MA 2ORIA 4NCJA 2CEAA 2ZRKA 2AK2A 4NH0A 5DGXA 4ZPXA 3TBKA 2WWWA 1SHKA 1YR8A 2FGKA 1IN7A 1G5PA 2GJAA 1XXHB 2PMDA 3IO3A 2YOFA 2B7BA 1ZU4A 4QM7A 3KQLA 2YNMA 4LZZA 4NYMR 4KO8A 4C0HA 3H86A 2EYQA 2RHMA 1GKYA 1KHTA 2D2FA 3KJGA 4OI2A 3RANA 4RFSB 2LKDA 5TDHA 2D62A 2GK7A 1RIFA 3AP1A 1KZGB 4GOJA 1G3IA 3UKDA 5KNDA 1GVNB 4HSEA 2ZJ2A 3CRMA 3TKLA 4XTRA 1WA5A 1JAIA 4F91B 1YR6A 2ZAMA 3MJRA 1QHHB 3ONWA 4DB2A 3QVVA 5F98A 1KTVA 1W46A 4R71A 1W4AA 4LI0A 4IVQA 4J0QA 4RD3A 3K70D 1VMAA 2J0UA 1MO3A 5DYIA 4ZDIA 2JDID 1NF3A 4HAXA 4QL3A 5G3YA 1DAFA 4DCVA 4MYHA 2WJIA 4Q9KA 1XD8A 1T3SA 1AGRA 1Z0JA 3LQRA 1FL9A 1KAGA 1R7RA 1MABA 5KSPA 1QHGA 4DWJA 3AVXA 2ZE5A 5FUVA 2QAGC 2WM9B 3HR8A 2J3EA 4B75A 5L3SA 3V4FA 2EFEB 1YZGA 2GEDA 3FHOA 3PR1A 4MGKR 1XF9A 4NTZA 1CJMA 2VEDA 1PVOA 2EW1A 2VRWA 4DT1B 3U7EB 1IM2A 1YVDA 3VHXA 3EWAA 4ESVA 1J2JA 1NN5A 1Q1BA 2JLUA 2GVZC 4W9MC 5AR1A 2J9RA 3WHKA 4IW3B 3CBQA 4LUCA 1F2TA 3K0FB 4OQXA 4Q9JA 2ZYTX 4G01B 3A58B 4TLBA 4ZKDA 1Z6XA 4JLMA 5CK5A 4BZXA 4EPXA 3K9LA 4NYJQ 3UMFA 1DPFA 1VYTA 4A2QA 3IIJA 4C9BA 2AR7A 4WIAA 2RGGA 1VYUA 3EARA 4UNRA 2ZROA 1NBMD 2GCPA 1G8GA 2W2TA 2ZR9A 2AKYA 4H1UA 2CVHA 1P2SA 4LHYA 4M1YA 4M1KA 1R0WA 1QBKC 1W0JD 3AF0A 3DVLA 4UNPA 3DZDA 2CHVA 4Q4AA 4US2R 4V0KA 3I32A 2W58A 3PUWA 3NHBA 2FA9A 1DAHA 2E9SA 4MH0R 2W2VA 3QXJA 3VX4A 3JVUA 2J1LA 1WRBA 5FOXA 3X1ZA 1WQ1R 1W0KA 2EQBA 4JSTA 4BGDA 3IILA 1RE0A 1Z8FA 3VTKA 5CDFE 1OSNA 2QP3A 2HLDD 4A1FA 2ZITA 4GDFA 2G9NA 4HUQA 4NPHA 2HEIA 2IXGA 2OAP1 4HZIA 2BCGY 3AKCA 4FD2A 1N0VC 4QBGB 4HI0E 3T1OA 1COWA 4D2IA 2YWEA 4QXAA 3FMIA 2VP9A 4OQNA 5EZ5A 1P60A 3MWKA 3T5GA 3OIVA 5J4KA 3U7FB 4BLTA 3Q9LA 4OQFA 4EPRA 1GL9B 4PQFA 1I4TD 2IUUA 3MSXA 3RAPR 2W6ID 1N6IA 4EJSB 2WPDD 4WBSA 2AN9A 3K0SA 4PZYA 5H8WA 1NG1A 4A15A 4LV8B 4D81A 2GCOB 2QT1A 2J0UB 1P4SA 2IYZA 4US0R 2FFBA 2HDNB 2OO7A 3BFXA 3CX6A 1US8B 4M1TA 4BFWA 1HH4A 3TSWA 3DKPA 3L43A 2F1HA 4O2LA 4YONB 2FFQA 1LB1B 5FOWA 3R7WA 1GWNA 1Q0UA 2XXAB 3ADDA 2QM7A 3FWYA 4ZCIA 3W8RA 4EDHA 1L7VC 1X8KA 4JBWA 2ZJYA 2N46A 3DEFA 2MMCA 4PR0A 2GKSA 1FUKA 3BE4A 4TQAA 1XJCA 2DR3A 1QG2A 1FPMA 2REXB 3W90A 4DKXA 1P9NA 4RCYA 1NVXQ 2W0SA 1B0UA 1GKUB 5JEEA 2VP6A 3ZS9A 4Z1MD 2DFTA 4JVLA 2ODEA 4RJLA 4ZCMA 1JB1A 3M6AA 3QKUA 1OIVA 1TAGA 1CJUC 3DHWC 4JLAA 3TR5A 1NN0A 3X1XA 3AVYA 5AJZA 1BIFA 4B47A 1ODFA 1D9XA 3AVOA 4BUJA 1UKZA 1XD9A 4EPYA 4ESHA 4FWTA 3AKYA 3GJ8A 3L0OA 5L3QB 4TLCA 3CR8A 1XMIA 4ARZA 1HE8B 4Q02A 4LYHA 3KZ1E 2HLDA 2WMOB 4BECA 5FI1B 3SE0A 1LY1A 3HU2A 2NPFA 5FTKA 3K1JA 4PSKA 1BOFA 1KSHA 1SVOA 4AC9A 1KMHA 5L3QA 1EFRD 5BWMA 2EVWX 4PC1A 4GI7A 1T0HB 4CRWB 5C18A 2NG1A 2ZSBA 3PUYA 2C77A 4LJYA 2KBEA 2QAGB 2FSFA 1TF7A 1CKEA 3KXLA 4IVRA 4ZKEA 1QVAA 2P2LA 4BFUA 1CTQA 1XXHE 4WZBE 4ZIRB 5FI0B 2GA8A 4YMTA 1Q1EA 1BS1A 2WJYA 3CIOA 1E2GA 3Q72A 4A92A 1J8MF 4POAA 3CRW1 4MGZR 2ZR0A 1HT2E 3A1WA 1GL7A 5FH9A 2RCNA 3N70A 3LAWA 1H8HA 3SYNA 1NY5A 1NKTA 3S1AA 4I81A 2FEMA 2FX3A 3PUXA 1Z2CA 4DLTA 2VPPA 4PC3A 5DIFA 2XAUA 4MRSA 3FMPB 4PSAA 3K0CA 5EE9A 4QBFA 5FOSA 2GJ9A 2F43B 3BH0A 4WAUA 2HF8A 4C0KA 2ORWA 2GAAA 1X3SA 1II8B 3TVTA 4TTRA 1GNQA 3QEOA 3WMFA 5CIWA 3GJ3A 2GCOA 1LF0A 3VQTA 5JSZA 3K09A 4IDQA 2GF9A 2IT1A 3WYAA 3QPVA 4DCUA 3THXA 2IA5A 3AF1A 3Q5DA 2AXPA 2IYLD 1WXQA 2DHRA 4TT3D 4NDZA 4L9SA 3C41J 4XVUA 2JA1A 1EGAA 3P32A 521PA 1X1RA 2CE2X 2JGNA 1ZCAA 3KB1A 4Q1EA 1GAJA 2IS4A 1JQLB 3FMFA 5JWOA 2D74A 3OF5A 4FW9A 2F55A 1E99A 1KO7A 2CMKA 4PSVA 2OM2A 2Z6VA 4CT4B 4YMSA 3SYLA 2G3YA 5B58C 3CRVA 3EZ6A 1LS6A 4WVFA 2F7SA 5CM8B 4F7WA 2VF8A 4PO1A 4B32A 4V02A 1Z6TA 4DZZA 4PHHA 1Z06A 5CDFA 3QF7A 4L15A 1E9EA 1YZTA 3W5JA 4DCTA 3TNFA 2OCYC 1AGPA 1FQKA 1T8UA 4IDOA 2CLDX 1JR3A 2ZI3A 2QUZA 3W9YA 2GF0A 3H84A 4P4TA 4TMXA 3KQKA 4CEJA 2IYVA 3PCRB 2WJGA 4DVGA 4CGZA 5FUWA 1G5RA 4AI6A 1N6KA 3FKQA 2IHYA 2QG6A 4Q1CA 3GEEA 1Y3AA 2X1VA 4B33A 1E2LA 1EWRA 1A4RA 2BJVA 2RMKA 4OBEA 4JL8A 2WICA 3U3KA 2P6RA 1D5CA 4HAWA 2BBTA 1WP9A 3GEIA 1JPNA 1LW7A 3K9NA 1U8ZA 3U60B 1X86B 2VLIA 5C1BA 2R6AA 2C04A 2MSEB 4DLVA 1E2EA 1VDZA 1L2TA 4Q7MB 2PL3A 1N6OA 1P72A 2FPKA 2KWIA 4C0JA 4W7SA 2ZRIA 4EPWA 1HY3A 3F8TA 3KJEA 1YRAA 4IFEA 5AJWA 5SZIA 1EK0A 4EUNA 1FOEB 2ZAOA 2P3SA 2RGBA 3UK6A 2CHGA 2DBYA 2ZJBA 1CRPA 5HKKA 3BORA 3FMOB 4OHYA 3QENA 2AD5A 3GFTA 2WKPA 2X8AA 4II7A 1P61B 4XJXA 2W00A 5BYJA 5CYOA 1NL3A 2JLXA 1FNNA 3A8TA 5C2JB 3M4YA 4XD7A 5AUQA 4A4DA 1JR3D 2IXFA 4IEIA 1UKYA 2QROA 1X6VA 4RD4A 2ODNA 3OEED 4JVNA 3OE7A 2OBLA 3QBTA 2ONJA 5FUYA 3TJZA 5FPYA 5H70A 4Q1FA 1UPTA 1NLYA 2YWGA 1GSIA 4KODA 3O8BA 5EJEA 4YLGA 5FBLB 3SYKA 5KTYA 3KQHA 2VHJA 2A5DA 2CXXA 1S9DA 4B71A 1NBME 4NCNA 4TZ0A 1N6HA 5HTKA 5BQ5A 1OW3B 3AKDA 4N1AA 3RNLA 4QHTA 1TUIA 1DAMA 3OEHA 2P5TB 5JI2E 2WWXA 3A37A 4ZI3A 5IF9A 1NN1A 3H2YA 1PUIA 3UG6A 3FOZA 1FUUA 4BZPA 1IQPA 3C4JA 1VCIA 4Q01A 2HCJB 4WOPA 3X1YA 4NKRA 3VR4A 4QGAA 3N2IA 2NGRA 4BLSA 3LFUA 1OYWA 2BMDA 1E96A 3NBXX 2V4ZA 4V0NA 3ZGXA 4AK9A 4F4CA 3WNCA 4WXPA 1TU3A 1DAGA 3I8SA 2I3BA 1GTVA 2V6IA 3GLHE 2D7CA 4LV5B 5KOYA 4JLBA 2YV5A 1N25A 1L4YA 3EC1A 5FL3A 2IS6A 3B1WA 3WRYC 2I1VB 2XNSA 4Y0AA 5D3QA 2CCJA 1R4AA 1ZD9A 2ZRBA 5HCNA 4F93B 2K5UA 3MWLA 5B2ZA 1W47A 5BW8A 3B8HA 3REFA 1HEIA 1ZD8A 2ZRNA 3U4QB 4LBWA 4NBSA 3HWSA 3EPJA 4OHZA 2QBYA 4DBLC 2QPTA 4NL4H 2JLZA 2HUPA 1KJZA 1K8RA 1F2TB 4EPTA 3OIUA 4PAMA 3DO6A 3T35A 3PEUA 2BBWA 1KK3A 3RRMA 2WWYA 4I1OA 1HT1E 2W6JA 5HE8A 1Z6AA 5F2EA 5FBQB 3OE7D 1EFRA 3ICEA 2O8FB 4KYIB 2IC5A 4D4KA 2H5EA 2PEZA 3EA0A 2ZUCA 4Q48A 4DT1A 1XJQA 1UF9A 1XMSA 2RGNC 4CZ2A 4ILEA 3VU9B 2OAQ1 1GRQA 3B1XA 4TL9A 3GJ7A 2WAYA 2WWIA 4H9GA 2JJ1A 2WZQA 1ZIPA 1RC8A 2C78A 2AXNA 4U00A 3QXHA 2J0QA 3ZVNA 1WCV1 5JCPA 2ZPTX 1AKEA 3D7MA 4BFSA 1CJKC 1SXJE 3TSOA 3IEVA 1ANKA 5EE1A 3ZD7A 2R6DA 1D6JA 3EA5A 3GJXC 2A78A 4EQ6A 1MRNA 1JR6A 2FSGA 2XZOA 2FWRA 2J59A 4DLRA 2FMXA 1OB2A 3M0EA 1GNPA 4OI1A 4LHXA 1JQJC 1JR3E 2ZRLA 4UNSA 4LJ6A 1RJ9B 1JALA 3GLHB 3KDSE 3NIBA 4EFLA 5BN4A 1YJ5A 1KI9A 1W4BA 4ZDWA 2KI5A 4JLOA 4A0RA 2XOKD 3KUCA 3DMNA 4LRWA 3ND8A 2IF0A 4MDFA 2VTKA 2CCGA 1E0SA 1NP6A 1DBSA 2D3WA 1T6NA 1MRSA 2EU8A 2QE7A 1NJGA 1GL6A 4QOSA 2Q0HA 3NDPA 4URXR 4NCKA 3U61B 2RB4A 1GFIA 3Q3JB 2XZLA 4ABYA 3BJIC 4V0ME 4FWIB 3RS4A 4AKGA 3Q8XB 1DAEA 1G3UA 4PO9A 1G8FA 2N42A 4OJKA 5SZHB 4ZDKA 2ZI9A 3LXRA 3QJYA 3CX8A 1ZUIA 3KFVA 1MABB 1II9A 4B3CA 1U9IA 2IBMA 5EXTA 3GPLA 2X77A 1QHXA 2CL7X 3PENA 2FF7A 3T61A 4KLNA 1H8ED 1KYIA 2ZM5A 4PC7A 4OJQA 721PA 5H68A 4JT4A 4B3XA 2YOHA 5SZKB 3E2IA 4DLZA 1COWD 1N0UA 4IRUB 2GBLC 4HDOB 1TQ4A 5JI3E 1Q12A 3GLHA 3GJ0A 4LHWA 3WP0A 3WNBA 2JJ1D 3VR6A 5DHFA 1OH7A 4MGYR 3VR2A 1GILA 4LPSA 4JLNA 2ODBA 2O8BB 2REBA 1E2DA 2BEKA 4YMWA 5EP2A 3AV0B 1P62B 4LGMA 2F3RA 4D0NA 3GLGE 2NO7A 1XWIA 1XTIA 2QT0A 2FFAA 3U5ZB 3D6TB 2BM0A 3WMGA 4MYUA 1OT3A 4HAZA 3CWQA 3QI2A 1QHHA 3QXSA 2QGNA 2JAQA 1RRPA 2RGCA 1RJ9A 3MUFA 2GXQA 2X2FA 4OQLA 4MKHA 2YZ2A 4Q1DA 3ASYA 1NBMA 1E1QD 2F3TA 1XCPA 3NVAA 4H1VA 4RZ2A 4UNQA 4JJKA 5ANRB 5FBRB 1VIYA 1G7SA 4EJSC 1SGWA 1E1RD 3QUSA 5HPYB 3ECCA 1A5TA 1KSJA 4Z8YA 2IS2A 1G4UR 2KSQA 5FL7A 3MFYA 3NXSA 1E2IA 3DPUA 4JIMA 1E9FA 1Z0DA 5AWFC 3LQQA 4TSFD 3VHLB 4UXIA 4XVRA 2QM8A 3CF0A 3BH7A 3LLMA 2IYXA 4PAQA 2QRNA 4OK3A 1KO4A 1IY1A 3TSZA 421PA 1F3OA 4ASUA 4EFNA 1Z47A 1CIPA 4LHVA 1MH1A 2R2AA 2QTVB 2PLRA 5HZHA 4BFVA 4DCSA 5F9HA 2J46A 3I62A 1R10A 4HAYA 1Q1QA 2J7KA 5H1YA 5J4YA 3DZ8A 4A8JB 2ODWA 1W2GA 4AYXA 2ZVPX 1NIPA 3BS4A 2NZJA 3K9HA 4M1WA 1W0KD 1G291 3GLIA 3L2OB 3DDCA 2R6CA 3HP1A 2O8EA 3QG5A 2WSMA 4M4SA 3ADCA 2FE4A 3ZVMA 3D8BA 1XX6A 3MD0A 1NY6A 3LNCA 1F2UA 121PA 2PMKA 2VBCA 3BB3A 2Q21A 1G7RA 1WBDA 4QGGA 3WY9A 1UDWA 1L8QA 5KSZA 2WOJA 4URVR 4CF7A 4LDJA 1M2OB 2JIZA 3E70C 2RAPA 3BWDD 4I1UA 2PT5A 1BMFD 1FP6A 1N6NA 1RYFA 1EG7A 4YXWA 4EQ6B 1KIMA 1O3YA 1Q20A 3T1QA 2ANCA 3B78A 2XJ9A 4JKYA 3NH6A 2FPLA 3CB4A 4Q4LA 2OLKA 1R0YA 3CX7A 4URUR 2CNWA 4KVGA 5E95A 1WBBA 3RS0A 1KI4A 3IHWA 3DOFA 1OKKA 1XBTA 2QEQA 1KGDA 3SJCA 3LDAA 2UZ3A 1CF4A 1KO5A 2A5FA 3GQBA 1E6CA 2VSXA 3AH8A 2JLYA 3U4QA 1UBFA 1ZAKA 5KO2A 1QHYA 1ZD1A 4BRWA 4DSNA 1XD2A 1QZXA 3AUYA 2WIBA 3D31A 2GXAA 2ZR7A 2GJSA 5CYPA 1XCMA 3W6NA 1N6RA 1ZCBA 2BVNA 2HJGA 5FTNA 3KL4A 2GILA 3B2EA 5SZJA 1P7CA 3NH9A 3ZZUA 2ATVA 4BLQA 4KV9A 3IIMA 4FMCB 4HLUC 4P33A 3UPUA 2V8OA 1N5KA 2GNOA 4RZUA 1C9KA 3T15A 2NIPA 4LC1A 3OIYA 3QBVA 1ZRHA 2AWNA 2R6FA 1N5IA 4B6EA 3QSYA 3WBKA 1U8YA 4QRHA 5JHGB 4RKEA 1NSFA 3W6PA 5KYKA 1OXXK 3RC3A 3CF6R 4ACAA 2EFCB 5CJ2A 2FSHA 5FOTA 1SVWA 2F43A 2PEYA 4PPNA 5CITA 3P27A 1KI3A 3EZFA 3QY0A 3IQWA 4LYFA 4CEJB 2YHSA 3K0AA 1G21E 3UATA 5L3VA 1T3HA 3SOPA 2ZANA 5IK2A 4UKDA 4EIWA 3THYA 2FDCA 2C95A 5LD2B 5JCZA 2OHFA 4B6FA 1YRBA 2EFHB 1KKMA 2ONKA 3PIRA 4QC2A 4TMVA 1AZSC 4C0SA 3ZS8A 1OKKD 5AUOB 4M22A 3BOSA 2JCSA 4TTPA 4Z51A 2WJHA 3LX8A 1U99A 5EXXA 3A1SA 5JFGA 1TL7C 1P2TA 1YZLA 4F4IA 3F3YA 4DSTA 3GMTA 3TK1A 2Z4SA 4V03A 4AD8A 3BD9A 3SDZA 1E0JA 4DDWA 3KKOA 2W83A 3MG9A 1XPOA 4TN1A 3P20A 1ZP6A 1SVMA 3KTAB 2A30A 1DG1G 3MAAC 4L5BA 2VHTA 3I3SR 2CL6X 4PAOA 2O8DB 3RVBA 3K0EA 5A4JA 4DLWA 3EZ7A 5JSZB 1XNJA 4PHTA 3NBZC 2BMEA 4AG6A 1OFIA 4ARZB 1DELA 4C0AC 2JLQA 2RH5A 3TUJC 1G6HA 1N5JA 4X8MA 1E2KA 1RZ3A 3UANA 3CH4B 2Z5FA 5G3ZA 2GZDA 1T0JB 2BV3A 4OK6A 1Y63A 3DM5A 4Q21A 1CP2A 3WHLA 1D2NA 4G5RA 4L4UA 3NKVA 3TAUA 3BGWA 3RRYA 2ZE7A 1WE2A 1XEWY 3B6EA 3L82B 821PA 1GZSA 2BDTA 4A6XA 1A82A 4AWXA 2XB2A 5LPNA 4RCZA 1Z63A 1ESNA 1YR9A 3EIQA 4V0OA 4BQSA 4HEJA 4ACBA 3K70B 3EAQA 1RKBA 3B13B 1E0AA 5K8UA 1TQ2A 1QHIA 2ZRDA 1E9BA 1G6OA 4HZUA 2CE7A 3SN6A 3ZQJA 1AKYA 3B7GA 5G41A 1XTQA 3LX5A 3FHCB 3LRPA 5AUNB 1W36B 1KK0A 1TQ6A 1U94A 3QPWA 5GADl 3V4RA 4LJ9A 1OJLA 5HE9A 4DSOA 3GJ6A 5DLQC 1FMJA 1Z0FA 3T1TA 1FZQA 4PZLA 3SHFA 3GP8A 4S35A 4TQUS 1VG1A 3HYTA 1W1WA 1M7BA 4XD7D 2G1KA 2FJUA 2IEYA 2R9VA 2ZEJA 2CDNA 1DADA 3NBYC 3UXMA 3VFDA 4HDCA 2OT3B 3QPUA 4LBZA 4DXAA 1WF3A 3RYTC 4KHZA 2BEJA 4XSHA 3T12A 4X8LA 1CRQA 3KX2A 2VP5A 3RS5A 5K8LA 2O8BA 1S1MA 4DLSA 1U90A 2OV2A 4ZO4A 4IHQA 4B3BA 2IYTA 1ZUHA 2BOVA 2E1RA 3JZMA 2LKCA 1U98A 1JAHA 2NZ8A 4HAUA 2A5JA 2H92A 3OFND 3OAAA 4KFSA 3GLIB 5JJIA 1RPZA 3WBJA 1UKVY 4YDSA 3ZD6A 1KNQA 1R8SA 1TADA 1CEEA 2Z83A 1SXJC 1TQDA 1ZC4A 1OH8A 1CR4A 3QF4A 3GLGA 4KFUA 2ERYA 2H16A 4GFDA 4PX9A 5C46F 3B1ZA 3KFXA 4JYCA 5FPKA 1S1CA 2BKUA 4MGIR 1E4VA 2GXUA 1XCGB 3KTAA 4WZ6A 3SJAA 2HXSA 4PANA 1Z07A 2V1XA 3I73A 3NEYA 2WV9A 4GL2A 3WRXC 4DC9A 1JJVA 1UEJA 1Q44A 3CPJB 1Z0IA 2BJWA 4C2UA 5FBVB 2P6NA 1XEXB 1LS1A 3MJHA 1IN6A 3K70C 3RRZA 3KKMA 2J45A 3MWYW 4NZYA 3UMRA 4Q9HA 3G82C 4QG7A 1P2UA 2UKDA 4EPVA 4LYJA 1G3QA 1AZTA 4HAVA 3MCAA 4K46A 3E5HA 2GK6A 1M34E 3MMPA 4Q4JB 3RSLA 1T9HA 1IN8A 1XEXA 2QY9A 3IKJA 4KI0A 4HB2A 3EPKA 1K5GA 5JS8A 1IBRA 1T8TA 3LVRE 2Z43A 3IBYA 2VP4A 3U3OA 5ELXA 4KBGA 1SVKA 4LJAA 4Q4HB 5FFMA 1E2MA 2QMUA 3OHMA 4LK2A 5J40A 2GEUA 2F9LA 2IEZA 2GXSA 1AA9A 2WOOA 2OFXA 4PTLA 3CW2A 1CR2A 4M9QA 4D26A 2D2EA 3NG1A 4P4UA 3BFKA 1OB5A 1BKDR 2CCKA 3KJHA 5C4MA 2KBFA 1G8PA 1FNMA 2NO9A 2ZI5A 2ZUDA 3A1TA 5M04A 3AVVA 4M8NE 4MKIA 2MSDB 2OESA 4NYIR 4LV6A 4KJZA 3CR7A 3FVQA 5GJBA 1SVIA 3LBIA 2O0HA 1S3GA 3FDIA 1Z0AA 2FV8A 2WIAA 2EFDB 1FW6A 2ZSEA 1HUQA 2BWJA 5GJVC 2Q9CA 5EP3A 5JWRA 3FGNA 2FSIA 2RGNA 1IY0A 3CUEF 3P26A 5JS7A 4GZMA 3AGPA 4KBFA 1E32A 3F0TA 4XWAA 5KSYA 1T91A 1MR3F 2D06A 2WWHA 2ZJAA 1PLLA 4G5GA 2PJRA 1VIAA 3SI7A 3U3RA 4TQ9A 4R2HA 4C0BA 2E87A 1XTKA 3FPAA 4GOXA 2YWHA 3OESA 1E9SA 3JZAA 3LW7A 1VG9B 1LV7A 4G0NA 1P73A 1SKQA 2XEXA 2WWFA 2OCBA 1E9CA 2FG5A 3UG7A 4ZIRA 1CU1A 5DSZA 4MUAA 1CR1A 2GETA 1GNRA 2QE7D 3QIAA 1VKJA 3CKLA 3SU8A 3LV8A 4B48A 2Q9BA 3P4XA 3I1FA 3R8CA 1OH6A 1W2HA 1XEWX 1UKEA 4TTQA 2KB0A 3QG1A 4HB3A 4YDHB 3AVTA 1F5NA 4TZ6A 2G1JA 2WBLC 4QJ3A 4ZCLA 1EFHA 2PZFA 3LLUA 2ZRMA 2QENA 1ZYUA 4Q4HA 2NO6A 2F1JA 4NCHA 3FHTA 5KDDA 2GZAA 1S96A 1XMVA 2KE5A 3PITA 4JKIA 3TUIC 3OIWA 4QNMA 3HYRA 1H65A 1I2MA 1FMLA 1TPZA 3QOFA 3U2QA 2QBYB 3THXB 1XEFA 1NLFA 2OZEA 5A5GA 2P65A 1N5LA 3LO5A 1PLKA 4JBXA 1UEIA 1GDDA 1AQUA 1WB9A 2NOAA 1MOZA 1HA3A 5E4FA 2VA8A 4TLDA 5DH9A 1IHUA 1NRJB 3IDQA 2IWRA 4A9AA 1KMQA 2WKQA 3KXIA 5FTMA 1EWQA 2XOKA 2Z4RA 3RS3A 3BFVA 1EX7A 3MGCA 4M9XA 4C3ZA 1IXSB 1OV4A 5DI3A 5JMTA 5B30A 1R2QA 2P0EA 2Q9AA 4B44A 1XP8A 1P9WA 3TIFA 3IPXA 4D80A 3O8CA 1EX6A 3QKSA 3CPEA 4Q00A 3KKNA 2ZJOA 1UDXA 4PC2A 1Q3HA 2ZYUX 5EZ6B 2Q3MA 3RS7A 1N0WA 4DEYA 3PFIA 3AP2A 2C9YA 1JEDA 3PV0A 1E94E 2YOGA 1PZNA 2JJ2D 2DWOA 4O25A 4XVQA 3U6KA 2NTYC 3NBFA 1IJEA 2BCJQ 4NCIA 4C2TA 3GLFE 1YR7A 2NMVA 2O8DA 2H7VA 4FINA 3KB2A 3TH5A 2OCAA 3KJIA 4NU0A 4HATA 3LD9A 5KNCA 1ZU5A 2ZRJA 2G77B 5F3WB 3G0HA 1KKLA 1MO6A 3VNVA 5FPSA 3RRNA 2YC4C 2PJZA 3K9GA 2GHIA 5L3SB 4D25A 3TUZC 4FMBB 4G1UC 2H57A 2DWPA 4GBMA 4QGFA 3SR0A 5TY0A 3TR0A 5LB4A 5D3MA 4RFSA 4JLVA 3RSOA 1MO4A 2O52A 2JDIA 4URZR 3PG5A 4PZZA 2DPXA 1NI3A 3BXZA 3ZIAA 2ZTSA 3BK7A 5FUXA 5AJXA 3R20A 1KOFA 1S4QA 5J4VA 1TEVA 1G16A 2OEPA 5IHPA 2H8KA 2HV8A 2RKOA 2ZJZA 3A4NA 5AJVB 2ZYWX 3VMFA 4M1SA 4LSGA 3B9QA 1NVVQ 1AJEA 2P6UA 3W8NA 2NPIA 2P5SA 2XJ4A 2FH5B 2JIZD 1KJYA 3A1VA 4TYWA 1HV8A 1DOAA 1R6BX 1UBEA 3ADKA 3WYFA 2C96A 1OIWA 1KK1A 3EIHA 2PLFA 3GD7A 3ASZA 2OILA 1J8YF 2QTFA 2V3CC 5IDVA 2A5YB 2BC9A 2ZS7A 2Z0MA 4RVCA 3NTUA 4JJZA 2VO1A 4KCGA 4LCBA 2ZSFA 2GCNA 1HE1C 5EE5B 3AVWA 1UM8A 1W0JA 4MRVA 4Q9IA 1NNEA 1G64A 1JXOA 1ZIOA 2OBMA 1MO5A 3B1VA 3FYHA 5HCIA 5GJWC 3LBHA 3DKVA 1ZUNB 2CLCX 5KHOC 1HURA 2ZUBA 4DEXA 4I99A 4U7DA 1W7AA 2XXAA 4OKSA 1S8FA 1U0HC 3LY5A 3R9IA 2F6RA 3UIEA 4QM6A 1L4UA 3ZVRA 1M8PA 3FFBA 1XU4A 3FFAA 3QXCA 2CHQA 4XIGS 3VX3A 5FOUA 4HB4A 4A0HA 4JL5A 4RY2A 5DYGA 5C4GB 3BB4A 4ZV4A 2Y8EA 4TSFA 1DE0A 5EQTA 1JI0A 1XRJA 4GZLA 4B43A 3T1VA 4JLDA 1ELOA 5JHHB 2QL6A 4RD0A 1E2FA 2IXEA 3K0CC 3P1JA 4JYBA 2QGZA 2ZU6A 1J90A 2QZ4A 4TLAA 3QKSB 3U6BA 2DCUA 4CYMA 5E7IA 3RABA 4D4MA 1BYUA 1DEKA 4FMDF 2O0KA 1M74A 3WP1B 5CJPA 3GFPA 2AK3A 1DO2A 1X8LA 4LWZA 2AX4A 4LHZA 3ZIAD 3BERA 1AIPA 5LB2A 4RZXA 3BB1A 2C03A 1DS6A 1AM4D 4M1MA 3F5FA 1A1VA 1NMYA 4QKQA 3MLEA 3OEEA 5LDDC 1CXZA 4Q5IA 1UAAA 2GAOA 2CLSA 1W36D 1GRNA 2WVJA 3ZDQA 1BMFA 4OI4A 5EUMA 6Q21A 3GLIE 4TT3A 2ZJ5A 3N2EA 4LX0A 4YXWD 1TUEA 4YC7A 5E7MA 4O3MA 2RGXA 2IUTA 1F60A 3TMKA 3ZQ6A 1KI8A 3PVSA 1DARA 3CM0A 4ASUD 1J70A 1G9XA 2ZI6A 2UZIR 3HDTA 4TYYA 4Q7LA 1K6MA 1S9HA 1V5WA 4GNKA 1PJRA 3CWZA 2OUKA 4I4LA 2ATXA 4GT1A 1RRGA 4EJSA 1QHSA 5J47A 2IYQA 1WDTA 2QU8A 4JS0A 5JJLA 1KJWA 1IXRC 2C9CA 2QSZA 2ZE8A 2ZVQX 3NEJA 4UJ3A 1K5DA 4V0LA 3W34A 1HQCA 1Z0KA 3L8YA 1GP2A 1KI7A 3HU3A 2NO0A 3I92A 1G7CA 4KLZA 4D6PA 3GLFA 2VL7A 4Q66C 5K8IA 5G40A 1KI6A 2NQ2C 3I4LA 4PPFA 4PC6A 221PA 1SKYB 1D8TA 2ZRCA 3HU1A 4A36A 4C0LA 3SQWA 5GJCA 4BLOA 2V9PA 1JEEA 1NJFA 1OFTA 4RSGA 1DAIA 1OH5A 4W5WA 2R6GA 3KUDA 1LVGA 4KXFB 2XNDD 1IN5A 4UJ5A 3AP3A 4HLQB 5FL7D 1KDPA 1KO1A 3AF2A 5KPDA 3VR3A 1G8YA 2DFKB 4AURA 2FPMA 4EFMA 1X1SA 1TU4A 5CB6A 2GWHA 2QRZA 3PEYA 4FN5A 1CLUA 4W5HA 4QHYA 1RVDA 1E1QA 4GPTA 1XTJA 1G1MA 4MRNA 621PA 2KJQA 3W3AA 4B3GA 3SNHA 1RRFA 1KDRA 2QI9C 1YZNA 2O8EB 4JZKA 3PJRA 3CNOA 4C4PA 4ON9A 4NYMQ 2WSSA 4RD2A 5JWHA 2J0SA 4C30A 4IKEA 1XJ0A 2JEOA 4DRZA 2V1UA 4AG5A 4IOMA 2P67A 4XWKA 1SVSA 3VKGA 4CEHA 1ONBA 1JBKA 4LC0A 1FTSA 3REGA 4D0GA 1XFAA 2OCPA 1G4AE 1DO0A 2C8VA 2VIIA 1UJ2A 1G7TA 3SBEA 4TYNA 4Q19A 3QNUA 4HLUA 2BKEA 1ZM2A 1HTWA 4G5QA 3THWA 4Q4AB 5AJYA 1JJ7A 3IPYA 1WMSA 2YJTD 4G5OA 3GFOA 4O0MA 5J4HA 3K53A 5FR1A 1ZNWA 4IXMA 1OFHA 1PLJA 1VG8A 2ZSAA 3KQNA 2J0VA 2X19A 1OE0A 3U44B 5JRJA 5B64A 5KSOA 1Q57A 4YMVA 1HQYE 4D82A 4DUGA 4PQYA 2CK3D 2C2HA 2XNDA 2PCJA 2H18A 4JLPA 1VCNA 8OHMA 1G5TA 3SJZA 3L0PA 4L16A 1NLZA 1Z6GA 3K0FA 5DI9A 3ZVLA 1LNZA 3JVVA 3DOEA 2GESA 1GOTA 4RZ3A 4IDPA 2WPDA 5CB8A 4A8JC 1Q3TA 2UVQA 4R98A 3GJ4A 2ZQ5A 4MKFA 2IS1A 2B8WA 3A4LA 3M1IA 4NE2A 3TQCA 1IXZA 1W49A 3CRQA 1IONA 3A1UA 4FCVA 4ZDJA 1E0KA 1EXMA 1U8AA 1CBUA 2B21A 4IFBA 3SQXA 1NVVR 1UBCA
chains in the Genus database with same CATH superfamily
3WS7A 4FM9A 3FCSB 1WPXA 3WLPA 1X7DA 3WNDA 2GM5A 1KI6B 1S2MA 3OQIA 3EH2A 4CLRB 1LJLA 1T2EA 1L4BA 2QD4A 1PT6A 4FFBB 4FU0A 4RPGA 2JLVA 1MJNA 2MU1A 3LQ2A 2OFWA 3I9V6 4FIDA 4BVJA 3RLFA 3HZZA 4EGQA 1OVMA 4YQFA 1IXYA 3JQ8A 3QWHA 1DWQA 2QTZA 3DDZX 4GX2A 2FGJA 4OJTA 4JL6A 1NNI1 4Q05A 5DHTA 3I5XA 4JT8A 1ZUNA 3AUXA 2Z8YM 3LDUA 3PIDA 1P5ZB 4HX5A 4UM7A 2PKQO 4EL0A 2ZRPA 4ND1A 4WV3A 1HTBA 2IXTA 1PJCA 3RYFB 1FFEA 1UADA 2O2HA 1SD1A 4HUQB 2PL9A 3CEHA 4DUPA 2WDPA 1T5DX 3HP7A 3C8UA 1E59A 4QARA 2V7WA 1CZLA 1G8HA 3W5IA 2GBIA 4NOMA 5EIAA 4G9GA 1DU4A 1FDRA 2HXYA 1R0ZA 1UZUA 3BMOB 4PO8A 4MA4A 3S28A 1XVUA 2FHSA 2LZ0A 4GLFA 5JY1A 3H97A 1ZCJA 1HSOA 1RYHA 1W34A 1O97D 2R3SA 1QAMA 1RCUA 3DMGA 4KSBA 1U3UA 1C1XB 2NO1A 1NMZA 4X20A 2ST1A 4CDGA 4XSGA 4G37A 5KX5A 1AMNA 1Z28A 2P9HA 5ELLA 3DFIA 1I2DA 1C1HA 3I9NA 3ESAA 2WILA 1CCWA 2J5RA 3C85A 2WIFA 1GZ4A 2QTAA 3OZIA 4K9SA 4NULA 5HA5A 1GZHB 4R1PA 2QM3A 1SC1A 5FD8A 5B58T 5TPWA 4IO1A 3G2PA 3N2ZB 3W5VA 2OK8A 1R8JA 3E53A 3D1VA 1S2GA 4ZI2A 2GO7A 3PEWA 1MT0A 1V25A 3O94A 1EGMB 1WP4A 3KOOA 1XTRA 2C2XA 2HRQA 1AK2A 4R4JA 3A6PC 3CZ4A 5DNYB 4KQ2A 2I4RA 2EZ4A 5LD2C 1Q2UA 3NHFA 4FGLA 5EUBA 2QRGA 1BVRA 3I2FA 3JQFA 4MS3B 3RIHA 1XG5A 5LP6C 3T3GA 2FZLA 3U0VA 3WTBA 3PDHA 2BEWA 2X0IA 2YVUA 2ZI7A 4TYQA 4BLPA 5F2OA 2UVPB 3KKEA 4BEJA 4D6XA 5LLDA 1RBYA 3VC1A 4KNWA 3V8QA 5IUJC 1Z29A 3PNKA 4Q24A 5HQTA 4XDGA 2P6MA 2FPPA 3PPXA 3G9QA 4B17A 1NM5C 3HUEA 4X95A 2QT9A 1YFZA 1C1YA 3DV2A 1U80A 2CVZA 1IJBA 1Z4IA 3MPUA 4WE3A 5ALYA 4E03A 4LOLA 2OV8A 4HTAA 3CLSC 3L7JA 5CCXA 1SCBA 5IXJA 4ZVVA 2IU4A 3DJYA 3P0RA 5DM70 3WGVA 3AR5A 2VF7A 1JRLA 2IYUA 3CUKA 3PIIA 3CVJA 4TMTA 2DYKA 4HQLA 4PFSA 3FD8A 3CSDA 5DBGA 2VDOB 5AK6A 2VK4A 4HNVA 3OU7A 4W7HA 3K6KA 5A9SA 1Z4NA 2F3QA 4HEA6 5ITZB 2P75A 2FNAA 3MTEA 3B3AA 1OLUA 3B82A 4UQLA 1QQ5A 3HI6A 4CKYA 5AFSA 4DR1B 5E7JA 1P0PA 3M82A 1YRHA 2W6JD 2XYQA 4O2AF 3E7FA 3Q41A 3FW1A 1JEAA 1SZPA 2JFUA 3RSQA 1H5UA 3GGJA 1MX9A 5JSKA 2RBEA 2HQ1A 2O7RA 4X41A 3FYUB 1GTG1 1CE8B 2V3VA 3GROA 1M2FA 3HZRA 4OG2A 2AFVA 4K9QA 5ERGB 1GAXA 1QTRA 1PGQA 3R74A 2Q1WA 4OGFA 1KEZA 2DULA 2MSCB 4IXTA 1WMBA 2EW8A 4DARA 2EFJA 1Y48E 3IRUA 2MIIA 4CMJA 1FE8A 1Z82A 1QF9A 4I46A 2UXDB 4BNFA 3W3ZB 5A04A 5A2GA 5JSQA 1G38A 4BDSA 1J56A 5JJCA 1N2CE 4C05A 1KAOA 3VJRA 3HR7A 2AOTB 3SFZA 2Y6VA 4WH0A 2R8RA 4NZNA 3LW8A 3P9IA 4OIFA 5U1PA 1R5BA 3SC2A 1T4CB 2YJNA 5K8VA 1DKNA 2J3MA 2FP4B 1EP1B 2RGEA 5FPTA 5JZVA 2E89A 4J3JA 1I24A 2HIAA 2HIGA 2FEWB 3DAOA 3PXXA 4M53A 5ARDA 1JFVA 5TT1A 3JD3A 4UCFA 4OKNA 1ORIA 3QEJA 2A9JA 1MOSA 1NJSA 4HB0A 3VV3A 2NZVG 3MEQA 1NUPA 2DP4E 5CNIA 3D2AA 4BO0A 4EHKA 1E8MA 2G0NA 3C0KA 3HPRA 2AD1A 1YBAA 2ZETA 3OEHD 4XPIB 1QE5A 4UNRA 1FPQA 4R3NA 5ALKA 1N6PA 2HHLA 2VDNB 4WA7A 2ZE6A 1FS6A 2JASA 1RNLA 2OORA 2J7PD 2Q3BA 4QU5A 1DXYA 4UUMA 4OFZA 4QPZA 5IJ0A 4P0TA 1BEEA 3TTWA 2Q3DA 2EWVA 5KQSA 5LDGA 1XZAA 1PUJA 1WJGA 4KU4A 3LM8A 4F4HA 5CAEB 3KHSA 4YUWA 1ZGBA 4O33A 5HIMA 2Q3HA 2H0RA 1YQEA 4PHGA 5A05A 2JJQA 1NVBA 5IKEA 1RRKA 5B57C 3HO1A 1OGJA 5EMNA 4BN0A 3BRWD 4UVDA 5IK2D 1CHNA 3E3AA 2HBYA 2VYFA 3ZY5A 1OZAA 1ZINA 2OG2A 3CNLA 1DQPA 4FDUA 4FUQA 2Q49A 3ONDA 4DSUA 4HFMA 3UMYA 3P2KA 2I1QA 4XR4A 2R8EA 4D3ZA 2C07A 2EERA 3W2IA 3SXUB 2BGIA 1I7QB 2Y77A 2D59A 3RUEA 3UY4A 1FFHA 3QYFA 4CR6A 2JFOA 2Y1FA 3V6MA 3HJTA 1OZGA 1A88A 3WGOA 1W44A 2DJIA 3T0GA 1BDBA 4NQZA 1AU9A 2XAAA 4EGAA 3U6BA 1RRMA 1ZSVA 1QLWA 1D6SA 4OYHA 2MWMA 1BH2A 3PPYA 5HW0A 5K03A 1UPXA 3KELA 3WSWA 2B92A 4IGFA 4HRVA 2AVDA 2QN9A 4ZTUB 4B6OA 1YONA 1C81A 2O0MA 2UYGA 2PDAA 3A4VA 5EAIA 1NMXA 3BMCB 3LWNA 4BV3A 4D3YA 4J7XA 1CYDA 2HJVA 5JJKA 4AICA 2DU8A 3W6ZA 2G80A 3OEWA 2FSPA 1T5HX 1UBGA 2GK4A 5EGSA 1Y5MA 2PTGA 2J9GA 3O74A 2H29A 1E2JA 3FOWA 4I1SA 4MYTA 2XF2A 2OVBA 1T1EA 1A97A 3WIEA 1N3BA 1BX3A 2QN3A 5IABA 3SVLA 1AZLA 4MYSA 4MUMA 1FX0A 2HYDA 4R0NA 3LY9A 1V43A 3EIEA 3ET5A 3C3AA 4UTNA 4X8OA 2H3HA 4BC0A 3JYQA 4AUKA 1AXEA 3C3WA 4G36A 2PBRA 4DLXA 2VS1A 3AEZA 3MRXA 4ZD6A 1GT6A 2XRYA 3E23A 3RHFA 1Y4SA 3AJEA 5KYXB 3H18A 1HRKA 3ZDXB 3QKRA 4BQFA 1JIQA 2WFLA 3SHWA 1IAQA 4A8JA 4QBHA 2D5IA 4OQEA 3EZNA 2PO5A 2JAWA 3H5TA 4R7ZA 3TQOA 3AL2A 4I4NA 3RVQA 5AYVA 2CJWA 4N6NA 4XB6B 1XXHA 5LJIA 4TZTA 3AVUA 1OZ0A 4M8SA 1G9TA 3HO6A 4MVJP 1VECA 4Y6GB 5UKDA 1OYYA 2VDWA 4FC6A 1XR3A 2A2ZA 2D5AA 3BCUA 4M0UA 1ODKA 2VHWA 5IAJA 2K2WA 4ZMSA 2D6FA 1A2BA 3AX6A 5GGXA 1RDFA 1S0UA 1KDZA 5AMXA 3ZUGA 4G07A 3U3MA 2XCTB 5L7YA 3IAS6 2F9MA 1MC1A 2I7CA 1II8A 1GYQA 4LDAA 2TRSB 4RSHA 1PR4A 1XB2A 2WHXA 1MV8A 2B6HA 4ER3A 3S2YA 3HN7A 4B31A 3DD5A 2WHYA 1B0PA 1US8A 3A4MA 4RV5A 3T06B 3WLOA 2CUZA 1XN1A 1UIRA 2JGJA 1GGVA 4ME6A 5EMLA 5K0LA 5LDHA 4QDJA 2ZRGA 4K81B 2I6QA 4L8VA 2XI4A 5K3DA 2WIDA 4INOA 2FG6C 3BJZA 1DJQA 3IQXA 4ZV7A 3SYTA 1PHRA 1W36C 3I5YA 3DUFB 2X86A 1RFLA 1E2PA 2NSJA 2ZT7A 3NKFA 4DDKA 4AKHA 2FOLA 2X6RA 3S2EA 2NSYA 1F48A 2IPMA 4L9WA 3C4VA 4I1RA 4LDRA 1U0LA 3V4PB 3R8FA 3EXHB 5JMOA 1MPTA 1C3EA 4TLMB 2B1JA 1VLQA 2C31A 2YW2A 4JV5B 4BIMA 2ZB8A 1HG0A 5JBQA 1B23P 3PGMA 5IAAA 4X1KB 1BW9B 2DR0A 3VZRA 1WPGA 2QQ0A 1SA0B 1UEXC 1WW8A 4RD6A 2GBLA 3NRBA 2RCYA 1XGKA 4R51A 2UUPA 3G5MA 3E15A 4YJHB 4OHMA 1PKEA 4CKEA 1FFBA 1R9GA 2Z5VA 3CNNA 2GVDC 4ZQEA 4UNIA 1RYNA 2EZTA 2Y1KA 4FIZA 4MW4A 3ZBQA 2X5JO 4B2IA 1JHZA 1ID1A 3I72A 4M0LA 4YCJA 5EPEA 3IQDB 4EJ6A 2C0PA 1JDTA 4K6MA 5HRUA 4ARIA 1SK9A 3QHAA 2OHXA 2CHEA 1QIEA 1F2UB 1R0XA 1Y80A 2WAAA 1SNYA 3HCCA 4Y6SA 5BYKA 1OPXA 1TKAA 3D3QA 2GEVA 1OXTA 4PINA 4B1FA 3JWIA 2CFOA 2DETA 1AUOA 1DEXA 2WU3A 2UZ4A 2WUVA 3FJOA 3G0DA 5DO9A 1KO8A 5IS2A 3I8XA 5E2AA 2WG0A 2NQTA 3EPLA 4FFLA 3CRNA 2CLIB 4YV2A 3B9PA 1O5TA 4P3PA 1B2LA 2LNDA 3IMFA 3L7NA 4BMOB 1O58A 2D1SA 1SQ0A 1KEEA 1P7ZA 3ZHTA 1RWPA 1WUKS 5EKDA 5K2OA 4W99A 1UC9A 1WHSB 3FYSA 3G2HA 3OF3A 2ORVA 1KVTA 2EF0A 2A0FA 2QHXA 4D4LA 4TKVA 4DPLA 3AM1A 4B5KA 3FZQA 3RGGA 5G53C 5HQ3A 3L0SA 3AHEA 3ETGA 3BFPA 3KZCA 4RS4A 1QOQB 4OXKA 4DCJA 3ZVKA 3DOCA 4LJ4A 2JGDA 4Q37A 4OYYA 4G0YA 2PQ2A 2TS1A 8ATCA 3SE7A 4B3IA 4DL9A 2ANBA 4I2VA 5ALGA 1SBTA 3E58A 2H63A 4AJHA 3WNVA 1QDEA 3UUEA 1ETUA 4MUEA 4B7XA 1V7QA 3FOBA 4ENPA 5KWJA 1HDCA 2GJ8A 2JD2A 3ILSA 4CHTA 3M34A 5A5VA 3T3MB 2H1LA 3QKTA 5B53A 2F00A 3NDBB 4DYDA 2GO1A 1EX1A 2F2TA 1R5NA 1I7SB 2C84A 2SCUB 3DFZA 3V9PA 3PI7A 1WO8A 1VKRA 2AUNA 2RC6A 3LHDA 2JB9A 2C57A 3FWPA 4TN5A 3Q1KA 1WD5A 4M37A 2L19A 1V6CA 4I8XA 2FPXA 3PL5A 3DOHA 2XA2A 3QF4B 4E2FA 4QO8A 5J2UB 4PFQA 2IX9A 5KDLA 3CJTA 3RTAA 5FTLA 1EG2A 5EE0A 1PJZA 3C15C 1ONNA 4XLTA 2XSZA 2Y0EA 3C3EA 1YCGA 2KLBA 2EKPA 3NNDA 4IDNA 5F7JA 3TDKA 1YU6A 4EB6A 2MMGA 5KVCA 4BWGA 5KYTA 4NHOA 1MJFA 4TLLB 3ZD9A 4FMCF 2PZJA 1E9VA 1G3RA 4AYWA 4S1NA 5LA6B 2CBZA 4JEIA 3M9XA 1UZLA 5LMUB 4DUGD 2J4FA 2M9MA 2PVSA 1A96A 4CM9D 2O7QA 1D2MA 1UOOA 3PFKA 2EJVA 4OOFA 4NCBA 2B7CA 2G88A 1H1LA 3ZZMA 4CT5A 4JT2A 1BQEA 4Z3OA 4KRXA 4K6OA 5FR2A 4F6RA 4G5SA 4I4TB 3E9EA 3GVCA 4M0FA 4CPDA 1XTZA 4RVFA 3KZMA 3ZBPA 1RTKA 2P1ZA 5CLLA 3FTQA 3B1YA 4MV4A 1PYGA 2WG1A 3TZHA 3W9UA 2F64A 3CCBA 1GCUA 3KAPA 5KTSA 4C89A 1RQNA 4RTOA 3R9XB 3EQ7A 1ZK3A 4ALKA 1P2BA 4O5AA 4CN8A 2EWWA 4MWTA 5CLQA 4DW8A 3PEVA 1GUFA 2Q9UA 2Q6LA 4JSYA 5TARA 2PRIA 1HX7A 3SGLA 4YJFB 2WU8A 4IAOA 3UB2A 3L4SO 1TNDA 2HA2A 4ADSG 1O5IA 2PT7A 1RPNA 1MH9A 2EKZA 2GN4A 1WDKA 3ONVA 1BROA 4DHWA 2DWQA 3KPVA 1ZN8A 5D5HA 2XGJA 4JGGA 2M6RA 1NUAA 1E9DA 1MFPA 3L3BA 1UZMA 4GO1A 4BNHA 3PS9A 4KNYA 1YB7A 4Z2AA 3Q9SA 4WOKA 1XNQB 4MVJG 2RGDA 4WLUA 1OU4A 3SP1A 1VSQA 3BHMA 3RIGA 1CJBA 5AOVA 3TIGA 3FOEC 1K7SN 3EY9A 3Q7QA 4DRXB 1PYDA 3FUUA 4LOAA 4JP5A 1AXGA 1ZMXA 4ZN6A 1LLFA 5JXGA 5IT5A 2XCOA 3RBZA 3O8QA 2A7QA 3EIFA 4O4LA 1U8UA 3RWOA 3U4CA 5HYVA 2ATEA 2WSSD 4Y2JA 5AKIA 5JZBA 3WMEA 2JGMA 2QTHA 4LCJA 3EZ9A 3M6WA 3QE0A 1DKLA 2WD7B 4JVSB 5LBTA 4D9MA 3PEEA 4NONA 1D1SA 1FBNA 2R65A 1VIMA 2C1XA 1G41A 1LRKA 2DTXA 2OCDA 3L7MA 4NBKA 2G7MC 6NULA 3TEFA 5JVDF 5JXWA 1L4MA 5FNVB 4KXVA 3DJFA 5JLAA 4DM7A 1HETA 3C16C 3MS7A 1GLVA 3QLTA 4LRXA 4XEUA 1O0SA 1WXGA 1G4HA 5LYYA 2ZUFA 2WYWA 3ODPA 3Q85A 2CDBA 2PSJA 1EPUA 5DHQA 5DM60 4X65B 4XGNA 2P1DA 2H5LA 4L76A 4P82A 4LWOA 2FN4A 3BKWA 1LBHA 3DT9A 3QA9A 1XKTA 2RAUA 3PUVA 1I3MA 5DISB 3ZCPA 1ZHOA 4KQIA 4IIJF 1IH8A 5EZQA 3HGQA 1U0JA 2J6IA 3DWFA 5ED0A 3PHGA 4BMSA 1EZZA 5DEIA 2QIOA 3DXZA 3EVGA 3RO7A 1M3SA 3VDQA 3ZLJA 1YZQA 2QL5A 4HH3C 4QUDA 5KNBA 2FN9A 2H4FA 2V4UA 1OAOA 3KXKA 1CVRA 4M9SA 4P80A 4ZJUA 4L27A 3P9QA 1DC5A 1T15A 2HWUA 4HDMB 1F8UA 3L7BA 3IIEA 4WZZA 5HMLA 4FOOA 1YKSA 1L7PA 2QORA 3OQMA 4J4HA 4LTMA 8GPBA 4HAOA 3NO4A 4LXTA 5A3RA 3TW4A 1CQIA 2CMHA 1NBWB 3BD6A 3O8RA 1MG5A 3OAAD 2ACVA 2Q5FA 2ON6A 3NV9A 4G97A 3H1TA 4MVJD 4PS1A 1HMYA 1FCJA 4TOIA 4WN9A 3T3EA 3NIWA 1Z5VA 4R84A 2ORIA 1NPTO 2CEAA 3FN4A 3O8LA 4FSXA 2AOTA 1Z4OA 5D1HA 1YR8A 2E5LB 1DJMA 1TC1A 2PMDA 4RELA 1VLLA 4C4RA 3QI7A 2Y1LA 1P77A 1ZU4A 2ZUSA 4V1CB 1LSOA 1GKYA 2ZIXB 3FNEA 3HYNA 4RFSB 1CY2A 2LKDA 2I6SA 4LKOA 2D62A 2BTEA 4R0VA 3AP1A 1D04A 1VJ1A 4TTVA 4GOJA 1G3IA 1TVMA 2JS7A 3ICOA 4AP6A 1Z4QA 2JCBA 3M6UA 5TJHA 3M83A 4QTYA 2DMRA 3TKLA 1EVZA 1QB7A 2E6KA 3UT0A 3AU9A 1YR6A 2P7HA 5EWLB 2DBQA 4DB2A 2XPCA 1D6MA 1AUQA 1K06A 1W4AA 2YVQA 1PFKA 3DBHA 3NCHA 4ZEOA 5IN5A 5JNVA 4LS3A 1DUIA 4MO2A 4OAOA 5IH3A 4H0FA 1OI2A 2JDID 1QIIA 3WLJA 2HI0A 5IF3A 1ZEMA 3S6JA 4Q9KA 1VJDA 5CA1A 1N1EA 4MVJH 4I1IA 2J4DA 4LOKA 4D8YA 3ORSA 4D43A 1R7RA 2PX8A 3KJNA 1QHGA 2H1WA 2PV7A 4DWJA 5JAMA 3QXGA 4FYXA 2YXNA 3PZBA 3LBFA 2EFEB 1YZGA 3PR1A 2FWIA 1GNLA 2G4VA 1XF9A 2H11A 1PJLA 4FLEA 4J03A 4MEJA 1CJMA 3AUAA 2P2CA 5THXA 1B4DA 2VEDA 3BIJA 1PVOA 1NMQA 1R4MB 5KTNA 1GR0A 4W1SA 3JRWA 1ZKDA 2QJRA 1NN5A 4EG0A 3HBJA 2GVZC 1N2OA 4PVDA 4RZQA 5KQLA 1YZFA 3FFWA 1HTTA 3DEJA 4YWJA 1NX9A 3FUTA 2FWMX 4ZU3A 4AF7A 1EHYA 1JMKC 5T4HA 1DKUA 2FLVA 2P91A 3HCPA 3K0FB 3PD0A 4WFIA 1JIUA 2DKNA 2HK6A 4IZIA 2IZ5A 4X00A 1Z6XA 1JJAA 1NI5A 1Z4PX 2C94A 2CSUA 3PE3A 3IXMA 1Y8QA 1V41E 3QU4A 1DPFA 4A2QA 1R0SA 1BMQA 4JVOA 3IIJA 2Z09A 5EEHA 1C80A 1UT5A 3MJVA 1W19A 1O95A 1SMKA 4WJLA 3FWKA 3RH0A 1ZJZA 4I5DA 1P1FA 2ZROA 4O4JF 2GCPA 2W2TA 2ZR9A 3N53A 4JZYA 5CHYA 5DV9A 5TPWB 4FPXA 1P3DA 4BTLA 3H83A 2RG1A 5AW2A 1QRSA 2JGIA 2X1HA 4E08A 5BRAA 4UNPA 3DZDA 2CHVA 2WW8A 1G5FA 4V0KA 3G8AA 1ES9A 2W58A 3VJMA 5DGIA 3V4VB 1O89A 2RAVA 3T1HB 3JAMA 1DAHA 1AHNA 4CV3A 3ANTA 3A0UA 4FKZA 4Y9TA 4AJIA 3M4XA 5ALMA 2W2VA 3LVFO 4M8KA 4OH1A 4K2AA 4WEQA 3FYTA 4HT3B 2J1LA 1MJHA 1GTRA 5HUHA 1NQVA 1V0JA 3IILA 4JU8A 1V4VA 3OM0A 1RE0A 5DBFA 3WWZA 4HWTA 1JR6A 2B20A 1OSNA 1WLSA 1VL5A 4NBWA 1TZBA 2QP3A 3LIIA 3DZHA 2ONYA 3DL2A 1LDNA 3AUJB 2HLDD 4MWZA 3QUQA 1UT6A 5EJ8A 3L93A 4HUQA 3IAS1 4PLHA 4KE7A 2IXGA 2OAP1 1ADYA 3F49S 3PNQA 4G25A 3IV7A 4MVXA 4X63A 4WERA 1DXQA 2BCGY 4FP9A 5ALEA 4MQLA 3TOXA 2B0CA 4FD2A 3Q0IA 5EVCA 3LGAA 1I0LA 1KHHA 2NXNA 4HEA1 3I6MA 4IIDA 4GLBA 3T3DA 2YWEA 4QXAA 3ZWPA 3FMIA 1FNBA 3UQZA 3KJQA 4ZEVA 1D07A 1WU7A 3SPXA 1PYOA 1IZ7A 5J4KA 5EIBC 4Z2YA 4NPCA 4OQFA 2C5EA 1UZAA 1I4TD 3RAPR 1E7RA 3G85A 2W6ID 1GA4A 3GA5A 1L4KA 4NK5A 1ZESA 2WPDD 3D8NA 5TS2A 3L8FA 4EJSB 4F6CA 5BQ3A 1U28C 5H8WA 3QRWA 3A1NA 3JQDA 2P77A 2A86A 2AYZA 1A04A 1GXSB 2VPIA 4B3HA 4PCUA 1P4SA 4B7UA 2OPBA 1TVKA 1H6BA 1UK8A 2Q0XA 3K4PA 1P1BA 3FCCA 3HRHA 1FSPA 1FUIA 2HWWA 2B5VA 4PYMA 4CF4A 4ERNA 3X1JA 2H52A 3DKPA 4IZHA 1FXUA 4O4HF 4WBNF 3AY3A 4YONB 2FFQA 5BNTA 5K0GA 3G1TA 4LK3A 4AJ9A 1GWNA 4GD3Q 4CKXA 4WK0B 1YOVA 4IDGA 1HNWB 3DHEA 1XTTA 2VAWA 2QM7A 3NTQA 5FIUA 1BN6A 2BGLA 3L4JA 2B4TO 4JBWA 2ZJYA 1P0QA 3SYMA 1ZJ5A 3O7MA 4CKBA 5LN1A 2WEKA 3SSOA 1FUKA 4LWQA 1XJCA 4P83A 1QG2A 5EOVA 3T7EA 1CZKA 1EQ2A 1P9NA 3AJAA 3VI3B 5AXDA 3E3OA 5JQWA 1GKUB 1U8FO 2CVPA 3ZS9A 2I71A 2O2GA 4FHDA 2FG7C 3GV0A 1LXCA 2P3QA 1V4NA 1WPQA 2CLLB 1CK4A 1DWOA 1JB1A 1JIJA 1OIVA 3HWRA 1CJUC 3IQFA 4ISCA 2XMZA 4ZOEA 3E82A 5I9SA 3TR5A 2GZSA 1NN0A 4K6CA 3EFOB 2HJRA 3X1XA 3WB2A 5AJZA 4RF3A 3L18A 2D5BA 5IVKA 3AVOA 4P3XA 3VR5D 4ESHA 2C3PA 5EJ6A 1NM5A 3GJ8A 5FULA 5H80A 3G13A 4EY6A 3J80A 5LZ8A 1ZH0A 4U0JA 2WUFA 3RYHB 4MV8A 3AG6A 5DASA 1HE8B 4NJOA 4LYHA 3WX0A 3KZ1E 4H15A 2HLDA 4DJDC 3NOVA 4BECA 1NWHA 2BSXA 1DKQA 1UC4B 1QTIA 2FR8C 2FN8A 4GWKA 4J2TA 5FTKA 3K1JA 2GM4A 4W8OA 2ZXEA 1SVOA 4LXUA 5L3QA 2M1XA 4N18A 4Z4HA 2E1PA 1GSAA 2QM0A 4DXHA 3UGQA 4AWAA 3UJ7A 1PG0A 4NMHA 4YYEA 2AE2A 3CX4A 3PYLA 4LJYA 4MINA 1EM8A 2NNLD 1QB8A 1TF7A 3F3SA 3KXLA 3U4AA 1LNQA 2CXQA 1DC8A 1T5SA 3Q7RA 2EATA 3UAWA 4DNXA 5A5EA 5JAPA 4BMXA 4ZZ1A 1RHJA 3A27A 4ZIRB 2GA8A 4YMTA 1JKMA 1Z5GA 1X9HA 4A92A 5A6SB 4POAA 1GCAA 4MGZR 3GY0A 4PLPA 1L4NA 3W6UA 3UFXA 1QE0A 1C0IA 5DVZA 1HT2E 5K3OA 1NRWA 3A1WA 3MBOA 1ORWA 1H2YA 1UBOS 2RCNA 2Z9BA 1ZD5A 4BP1A 2O7NA 4F1JA 3LAWA 3DLIA 3TBFA 2E4ZA 1MXHA 4GMHA 3RK1A 4I81A 3E7PA 3IT2A 3HV2A 2HO5A 3UUWA 4QUHA 2YWBA 1QRDA 4AZVA 2AMJA 3IUQA 4OLJA 2QN2A 4MRSA 2ROQA 3C6XA 3OLXA 3T9CA 4DUZB 1N9GB 5FOSA 4P84A 1XHEA 2PGJA 2JEYA 4LFAB 2G8LA 4DLPA 1G21A 3ZE1B 3FDFA 1U2DA 2C1ZA 2FZGA 1NUQA 1PZMA 4AKTA 4QPPA 4H7JA 2QOEA 5K6TA 5KNCH 4BO8A 1GPKA 1KA9H 3IUPA 5GPBA 5JSZA 1ODTC 4NMWA 4RW0A 3WYAA 4DCUA 2BE7A 2IA5A 3Q5DA 1OFUA 1OU0A 1RPJA 3L0DA 2DHRA 4TT3D 4OLFA 3S5JA 4JN6B 3RUAA 3GAFA 2H2WA 3GRAA 3QTLA 4JB3A 4R2KA 5EKSA 2JA1A 5FWDA 5TPZD 3P32A 2BR4A 1X1RA 3V4SA 2CLKB 4HRAA 3KB1A 3L4BA 4Q1EA 5DNUA 4FK8A 1DFGA 1U0FA 3JARB 2XTJA 2PT6A 3EPRA 5G0TA 1BQ4A 1U4NA 3M4NA 4FGSA 2WZDA 4S05A 3O2SB 3IEMA 3GNTA 5JR3A 3H5WA 4WGGA 4YMSA 5G1PA 1Q77A 2C4MA 4M9RA 5CM8B 4WVFA 2VTBB 4C01A 2VF8A 2PZ8A 3I6QA 1ISIA 3KIPA 4Q39A 3Q4GA 4NU6A 1Z06A 1J5PA 3G89A 2X9GA 3D8SA 1BU8A 4X54A 4B6QA 1OBHA 1E9EA 4OFBA 2I3ZA 3FPGA 3KLPX 4U7TB 5CGQB 5B2EA 3P97A 1YBHA 2YN2A 5C8XA 3OCXA 2W37A 4DXDA 2TYSB 4ZCQA 4PSDA 1GGFA 1HORA 1XWWA 4RH0A 4G4JA 3W9YA 4OMDA 2GZ2A 2YIDA 3UOGA 1JSRA 4TMXA 2WJ3A 4YCSA 5CDYA 4CEJA 3T3OA 2IYVA 3MJCA 4QO7A 1D03A 4DVGA 4CGZA 4HFNA 3M8KA 4NENA 3FKQA 2QG6A 2JFHA 4Q1CA 5J2UA 3GEEA 4DR7B 1Y3AA 1KPGA 3PD7A 1UFOA 4J9UE 2YNMD 4ZOQI 1QR6A 1CQJB 3WGMA 3N2YA 3OBBA 4J0CA 2W6MA 4YRJA 3OMXA 4Q7QA 4M76B 4KIJA 3ENKA 3COSA 3GGDA 4HAWA 3A9WA 2CBGA 2JAUA 1P3Y1 1I1QB 4U2EA 1EINA 2R6ZA 4IHKA 3OQVA 4NATA 4BNIA 2XCQA 4KQ1A 4J1NA 4OGLA 3OOYA 2PT9A 1T0IA 4N5IX 1L2TA 1N6OA 1P72A 3B36A 4HUJA 1HT3A 1VFNA 2KWIA 4C0JA 3IXQA 3AETA 1W96A 5SYMA 5LUAA 2ZT5A 2FSUA 4YV1A 4F8JA 8ABPA 1R6VA 4XCVA 3KJEA 2PUGA 4CM3A 1YRAA 3HA3A 2WFMA 5SZIA 2BISA 2QJTA 4R3WA 2ZAOA 2P3SA 2EGHA 3OJ0A 3MM4A 2ZTLA 1ZGGA 3QE2A 3UK6A 2GEFA 3NMUF 5IDXA 2DBYA 5I7SA 3NJ8A 3MBIA 2TSYB 2AUMA 4RWZA 1PJ3A 4UHCA 4Z7NB 3PCXA 3GRVA 4UBJA 4XZ3A 3IHKA 3VNBA 3HS3A 4MAFA 2GARA 3SLRA 4BKPA 4D9HA 1KY5A 3IEIA 4GLOA 1U8TA 5LP6B 2OC4A 1CT9A 2NX2A 5HIJA 1YRLA 5LKAA 1MA0A 4MV1A 1UKBA 2IHJA 4YJGA 5B4VA 3HU5A 2XKBA 4NMLA 4A4DA 2IXFA 3KPJA 4H6XA 1X6VA 3ZY2A 4JVNA 4WN3A 1M8KA 2Y27A 2W2PA 3IEXA 5FUYA 4P7FA 1GTMA 3ILYA 3P9PA 2FLWA 3TFQA 1QQBA 4RTMA 3GN2A 5FPYA 4LZNA 4RAQA 4Q1FA 3J7TA 3HLTA 3TW0A 3UXHA 3WDLA 1NLYA 5A1TA 5FBLB 3KQHA 3IAXA 3LWZA 4RDIA 3E7XA 2J5BA 4YN3A 3RUFA 4Z9YA 1WQ4A 5FXMA 3PR3A 3K92A 1Y5NA 1XZFA 5I9BA 1N6HA 2C3OA 3QQPA 4G1FA 3VH1A 1SY7A 1WTCA 2A0KA 1AQLA 4Q3CA 5F7XA 3DV0B 3PDUA 2B4KA 3DOJA 4IXDA 1SFRA 1ZOPA 3IE2A 4KZKA 5CGZA 3VKFA 5CBPB 5IWAB 3ETDA 2WWXA 4YRTA 4ZI3A 5L7TA 1XRSB 1BW9A 2CGEA 4GOLD 1QOPB 1NXTA 1N8SA 4L3VA 3VUEA 1FUUA 2A9FA 3OIDA 4G09A 5JD3A 1U0RA 1VCIA 4NBRA 1ZIDA 2EC5A 3D6AA 3O03A 4GL4A 4WOPA 2JPDA 5CH3A 1JIKA 3VR4A 3WR5A 1DIGA 4N7RA 4XYMA 1E96A 3NBXX 1AC5A 2V4ZA 4V0NA 4R8RA 1DBWA 2FW9A 1RI1A 3AEYA 3FUXA 4I2NA 4N7JA 5CT9A 4ZARA 4F2PA 2MT9A 3MB5A 3F71A 1BXGA 3C3MA 2A9RA 2J5KA 1Z8NA 2V6IA 2Z3ZA 3GLHE 3GRCA 3P0FA 2D7CA 3QUSA 4MIOA 4NE7A 5E6RB 4LV5B 5KOYA 1ISPA 1X7WA 4LEIA 3U09A 1L4YA 4QYIB 4MIYA 2IS6A 4CM4A 3H2SA 3B1WA 3IQHX 2PLWA 1EWVA 3VZDA 3FPKA 3JWEA 4KK3A 5HCNA 2VUSA 3OZ7A 1JG6A 3PFHA 1CYEA 1QKIA 1ZITA 3HB7A 4PZ9A 5D86A 1W47A 1HR0B 3A32A 4CMEC 1DQRA 5BW8A 1CE8A 4R16A 1N3YA 1ZD8A 3REFA 3Q0TA 3U26A 3ON5A 4RH3A 2WJAA 4J7AA 2QPTA 4NL4H 2JLZA 4NFSA 2HB6A 3PC2A 1PR5A 3AHCA 4RVNA 1T1IA 2HOQA 4JYZA 2XY4A 2C20A 4D8UA 3HO8A 3SX2A 1KK3A 1T2AA 3FMVA 5AI0A 1IQUA 4P4NA 1Z6AA 3TS1A 3SLKA 3WL4A 3ICEA 1EFRA 2IC5A 3ESYA 3UJ9A 4JP2A 1V16B 4Q48A 3EA0A 3RVDA 4P53A 1N1GA 1XJQA 3ME5A 2WSYB 2WA2A 4LGCA 2OAQ1 1N2CB 2JGKA 2EQAA 1TCBA 1UMCA 3GJ7A 3V32A 2E7ZA 4ZVLA 3TLJA 4D0SA 4IPTA 2X8JB 2JJ1A 5CNKA 1J2UA 4KRGA 2D0DA 3RHTA 4BX3A 1G1AA 1MG0A 3DMYA 2Q2NA 2NWQA 2QLNA 2XE8A 3U7JA 3B12A 4FD3A 4II2A 4UE2A 4A03A 4B3TB 2W2QA 1CJKC 3TSOA 5D3KA 1Z75A 2QL7A 3IEVA 2X9NA 5GWXA 1ANKA 2FE1A 4QWMA 4XJSA 3D7KA 3AOEC 5EE1A 3ZI7A 1D6JA 1K4YA 4IIJB 1J8DA 4M7WA 4WTOA 1QVWA 3EA5A 4GOND 2Z1NA 2Z3VA 3E9ZA 1QG6A 2V7BA 3CUVA 2XUIA 1DRJA 3EBPA 3CNHA 1PWZA 5ERYA 3LDHA 4EUKA 3KT6A 3NYWA 1RM3A 1WV1A 2IZ0A 1JDZA 1S2OA 2A0UA 1IPEA 3FYUC 3OJLA 5J2TF 3D4LA 4NC9A 2AUTA 4MV3A 4TV9A 4GX0A 4LJ6A 1QCDA 3GLHB 3KDSE 1N5MA 2JK1A 1PL0A 1P45A 1BJTA 1X94A 4GM0A 4EAAA 1V47A 4EFLA 4Z4CA 3O2NA 1KI9A 4ZDWA 2RIPA 2KI5A 2DLCX 1FU7A 3KUCA 4G1CA 3TEMA 4A0RA 5A2QA 2IH2A 1IYZA 3ND8A 4LRWA 5BPHA 1NP6A 1Q1NA 1DBSA 2IQIA 3EHDA 1D09A 3IDAA 2QTNA 3T9DA 1EQUA 4URXR 1U31A 5I3ZA 1L7XA 2JANA 2RB4A 3A9VA 2JFNA 1YS7A 5LQAA 7ADHA 2JI9A 4PLGA 3BJIC 3EEQA 2X0NA 3H0EA 3DT6A 2OUIA 3N0WA 3Q8XB 1DAEA 5ILQA 1G3UA 1G8FA 1Y1LA 2WYHA 1LPAB 1C9YA 4GQIA 4UARA 1K98A 2BFBB 4N3BA 3QJYA 1Q14A 1FK8A 3CX8A 4CIBA 1MABB 1PJ8A 4EG6A 4B3CA 1P39A 4H7FA 4ZHQB 3GPLA 4WXEA 3IA2A 3I28A 4EG4A 2H1RA 1W6RA 4ZO7A 2Y05A 5G4KA 4QOHA 1J22A 3L1JA 3LPLA 1C3VA 4NAHA 3QVSA 4GYWA 5ER6A 1WHTA 4OJQA 5H68A 1KAHA 2PX4A 1DRUA 4JT4A 1A9ZA 3E2IA 4NJMA 2CLOB 2GHRA 4IRUB 3ZV5A 1QPZA 3DZBA 2CZCA 5HK8A 1KJ8A 2PD4A 5JI3E 5JY6A 1TYDE 1SC6A 5A71A 4LHWA 4XWTA 4PNEA 3AFGA 1OH7A 2VT2A 3KWLA 1G5HA 4HQ6A 3VR2A 1GILA 3ROEA 3LPAA 4JLNA 4LC9A 1FLVA 2ODBA 1PIWA 3UH0A 2O8BB 1QGYA 1UMBB 4M89A 3Q7EA 3AV0B 3Q3VA 3NZEA 4C04A 5E7QA 1UBTS 3RQIA 5B7GA 2NO7A 4NICA 1HNXB 4A6EA 3CWCA 1UP6A 2FFAA 4RANA 4EHLA 4QDZA 4M88A 2A0XA 4WZBB 4A91A 1YJAA 4MYUA 4D8WA 3I4CA 4KWTA 3QI2A 1FRQA 1Y7PA 1Y3FE 2P79A 2ZSUA 1CD5A 5HILA 3RASA 3QXSA 4DFDA 5CFQA