2X27X

Crystal structure of the outer membrane protein oprg from pseudomonas aeruginosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
209
Chain Sequence
b'DIQGHKAGDFIIRGGFATVDPDDSSSDIKLDGAKQRGTKATVDSDTQLGLTFTYMFADKWGVELVAATPFNHQVDVKGLLDGKLADIKQLPPTLLLQYYPMGGTNSAFQPYGGLGVNYTTFFDEDLASNRKAQGFSSMKLQDSWGLAGELGFDYMLNEHALFNMAVWYMDIDTKASINGPSALGVNKTKVDVDVDPWVYMIGFGYKFHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN OPRG
publication title The Crystal Structure of Oprg from Pseudomonas Aeruginosa, a Potential Channel for Transport of Hydrophobic Molecules Across the Outer Membrane.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 55
structure length 209
sequence length 212
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2x27X00
2MNHA 2LHFA 1MM5A 3C5OA 1P4TA 2F1TA 3G7GA 1MM4A 3GP6A 2N2LA 2M07A 4RLCA 3QRAA 1QJ8A 1Q9FA 2MHLA 1ORMA 2K0LA 1Q9GA 1THQA 1BXWA 1QJ9A 2X27X 2ERVA 1QJPA 4PUXA 3QRCA 2GE4A 2M06A 2JMMA 2N2MA 1G90A 2F1VA
chains in the Genus database with same CATH superfamily
3DZMA 2LHFA 4KRAA 1MM5A 2KDYA 3BS0A 4UB8O 4AKRA 4C4VB 1GFOA 4CTDA 4N75A 1P4TA 3POXA 4G76A 4Z3TA 3UU2A 2X9KA 3PRNA 4PR7A 3T0SA 4RLCA 4E1SA 4LSFA 5IYUA 3QRAA 1MPFA 2QTKA 5H2FO 3LK2A 4O4XA 3VE1A 3UPGA 5AFUL 3A2SX 4G75A 2XTQA 4FZMA 1ORMA 4N74A 2W80C 5ADXK 2KC0A 1BXWA 2IWVA 4O3ZA 4FESA 2K4TA 5T5FA 1IZNA 1QJPA 2YNKA 3HWBA 4O49A 2KXPB 1ZHZA 4RJXA 3AA7B 5DL5A 3EMNX 3JCUO 3PGSA 3QRCA 3SYBA 3K19A 4FRTA 4O4UA 5DL8A 7PRNA 1GFPA 2R88A 2Y0HA 3A0BO 1PRNA 2KZ7A 3AA0A 3LK3B 4GCPA 5EE2A 3SZDA 4PJ0O 4AFKA 4AKRB 2WVPA 4AUIA 3SY7A 2MNHA 4LSIA 3VZTX 3UAQA 2ODJA 3LK2B 4AKMA 1BH3A 3PORA 4D65A 3BRZA 3PGRA 3PGUA 2OMFA 3WI5A 1GFMA 3POUA 2ZLDA 3AA1A 3T20A 3NSGA 4B61A 3JTYA 2R8AA 1IZNB 1Q9FA 2ZFGA 4LSHA 4U9CA 3TZGA 2XMXA 4GHBA 4AYID 2PRNA 4XNKA 3V8UA 2JQYA 3AA6A 3SYSA 1HXUA 1YS5A 2AXTO 3A0HO 4JFBA 4RL9A 4GCSA 5GTIO 3VY9X 4D64A 2KZ7B 4N59A 4C00A 3AAEA 4PUXA 4AYMC 1OSMA 2FGRA 8PRNA 4FT6A 2GE4A 3HW9A 3AAAB 2J1NA 2R4OA 2XE2A 3HOEA 4KR8A 4XNLA 3PQUA 4FRXA 2Y0KA 6PRNA 3WI4A 3DA3A 3KZIO 5GTHO 3C5OA 5DL6A 5G26A 5GV0A 3GP6A 1GFNA 2R4NA 2M07A 3FYXA 3WU2O 4C4VA 2YPVA 2R4PA 2XE5A 4E1TA 4BUMX 1GFQA 3VY8X 2R89A 3DWOX 3SZVA 2MHLA 3LK41 5E79O 5AFUK 5ADXL 1OPFA 1HXTA 1Q9GA 2XE3A 2O4VA 2PORA 1QJ9A 1ZHTA 2X27X 4FUVA 4K3BA 5KAFO 2ERVA 1ZHYA 1H6S1 4AYNA 2XE1A 3AA0B 5JDPA 2LFUA 2XTRA 4D5UA 4GF4A 5B5EO 3PF1A 3AA7A 4FQEA 4N58A 5G3AA 2M06A 2JMMA 3VE2A 1G90A 1T1LA 2F1VA 4O3WA 3VZUX 3LK3A 4FSOA 4UB6O 5G39A 3AA1B 2F1CX 2F1TA 4AYDC 5TISO 5B66O 3G7GA 1MM4A 2FGQX 2J4UP 2N2LA 4FZLA 1S5LO 2Y2XA 3LK42 5D5DA 3DWNA 3KVDD 3PQSA 1BT9A 4K3CA 1E54A 1QJ8A 1ZHWA 4RJWA 4JCHA 3AA6B 1PHOA 4QQ1A 3SY9A 2XG6A 2K0LA 2WJRA 4KR4A 1THQA 1ZHXA 2W81C 4O3XB 3BRYA 1HXXA 5DL7A 5FVNA 2Y0LA 3AAEB 3VZWX 4AZLA 4FSPA 4FZNA 4RLBA 2IWWA 4FOZA 3POQA 5G38A 4AYEC 2WJQA 4O3YA 5PRNA 4C69X 1T16A 5KAIO 3HOLA 4GCQA 4FMSA 2R4LA 3T24A 2KXPA 4LSEA 3O0EA 2Y7SA 4IL6O 2N2MA 4F4BA 3NJTA 3RBHA 3DA4A 3AAAA
chains in the Genus database with same CATH topology
2LHFA 4KRAA 1MM5A 2KDYA 4AKRA 4Z3TA 1GFOA 1P4TA 3POXA 4G76A 3UU2A 3PRNA 4E1SA 3T0SA 4RLCA 4LSFA 3QRAA 1MPFA 2QTKA 3LK2A 4O4XA 3VE1A 3UPGA 5AFUL 3A2SX 4G75A 2XTQA 4FZMA 1ORMA 2W80C 5ADXK 2KC0A 1BXWA 4O3ZA 4FESA 2K4TA 5T5FA 1IZNA 1QJPA 2YNKA 3HWBA 4O49A 2KXPB 1ZHZA 4RJXA 3AA7B 5DL5A 3EMNX 3QRCA 3SYBA 3K19A 4FRTA 4O4UA 5DL8A 7PRNA 1GFPA 2Y0HA 3SZDA 1PRNA 2KZ7A 3AA0A 3LK3B 4GCPA 5EE2A 4AFKA 4AKRB 5IYUA 4AUIA 3SY7A 2MNHA 4LSIA 3VZTX 3UAQA 2ODJA 3LK2B 4AKMA 1BH3A 3PORA 4D65A 2OMFA 3WI5A 1GFMA 3POUA 2ZLDA 3AA1A 3T20A 3NSGA 4B61A 3JTYA 1IZNB 1Q9FA 2ZFGA 4LSHA 4U9CA 3TZGA 2XMXA 4GHBA 4AYID 2PRNA 4XNKA 3V8UA 3AA6A 3SYSA 1HXUA 1YS5A 4JFBA 4RL9A 4GCSA 3VY9X 4D64A 2KZ7B 4N59A 3AAEA 4PUXA 4AYMC 1OSMA 2FGRA 8PRNA 4FT6A 2GE4A 3HW9A 3AAAB 2J1NA 2XE2A 3HOEA 4KR8A 4XNLA 3PQUA 4FRXA 2Y0KA 6PRNA 3WI4A 3DA3A 3C5OA 5DL6A 5G26A 5GV0A 3GP6A 1GFNA 3FYXA 2M07A 2YPVA 2XE5A 4E1TA 4BUMX 1GFQA 3VY8X 3SZVA 2MHLA 3LK41 5AFUK 5ADXL 1OPFA 1HXTA 2XE3A 1Q9GA 2O4VA 2PORA 1QJ9A 1ZHTA 2X27X 4FUVA 2ERVA 1ZHYA 1H6S1 4AYNA 2XE1A 3AA0B 5JDPA 2LFUA 2XTRA 4D5UA 4GF4A 3AA7A 4N58A 2M06A 2JMMA 3VE2A 1G90A 4O3WA 2F1VA 3VZUX 3LK3A 4FSOA 4AYDC 3AA1B 2F1TA 3G7GA 1MM4A 2FGQX 2J4UP 2N2LA 4FZLA 2Y2XA 3LK42 5D5DA 3KVDD 3PQSA 1BT9A 1E54A 1QJ8A 1ZHWA 4RJWA 4JCHA 3AA6B 1PHOA 4QQ1A 3SY9A 2XG6A 2K0LA 4KR4A 1THQA 1ZHXA 2W81C 4O3XB 4AZLA 1HXXA 5DL7A 5FVNA 2Y0LA 3AAEB 3VZWX 4FSPA 4FZNA 4RLBA 4FOZA 3POQA 4AYEC 4O3YA 5PRNA 4C69X 3HOLA 4GCQA 4FMSA 3T24A 2KXPA 4LSEA 3O0EA 2Y7SA 2N2MA 4F4BA 3RBHA 3DA4A 3AAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNH A;  2LHF A;  1MM5 A;  3C5O A;  1P4T A;  2F1T A;  3G7G A;  1MM4 A;  3GP6 A;  2N2L A;  2M07 A;  4RLC A;  3QRA A;  1QJ8 A;  1Q9F A;  2MHL A;  1ORM A;  2K0L A;  1Q9G A;  1THQ A;  1BXW A;  1QJ9 A;  2X27 X;  2ERV A;  1QJP A;  4PUX A;  3QRC A;  2GE4 A;  2M06 A;  2JMM A;  2N2M A;  1G90 A;  2F1V A; 
#chains in the Genus database with same CATH topology
 3DZM A;  2LHF A;  4KRA A;  1MM5 A;  2KDY A;  3BS0 A;  4UB8 O;  4AKR A;  4C4V B;  1GFO A;  4CTD A;  4N75 A;  1P4T A;  3POX A;  4G76 A;  4Z3T A;  3UU2 A;  2X9K A;  3PRN A;  4PR7 A;  3T0S A;  4RLC A;  4E1S A;  4LSF A;  5IYU A;  3QRA A;  1MPF A;  2QTK A;  5H2F O;  3LK2 A;  4O4X A;  3VE1 A;  3UPG A;  5AFU L;  3A2S X;  4G75 A;  2XTQ A;  4FZM A;  1ORM A;  4N74 A;  2W80 C;  5ADX K;  2KC0 A;  1BXW A;  2IWV A;  4O3Z A;  4FES A;  2K4T A;  5T5F A;  1IZN A;  1QJP A;  2YNK A;  3HWB A;  4O49 A;  2KXP B;  1ZHZ A;  4RJX A;  3AA7 B;  5DL5 A;  3EMN X;  3JCU O;  3PGS A;  3QRC A;  3SYB A;  3K19 A;  4FRT A;  4O4U A;  5DL8 A;  7PRN A;  1GFP A;  2R88 A;  2Y0H A;  3A0B O;  1PRN A;  2KZ7 A;  3AA0 A;  3LK3 B;  4GCP A;  5EE2 A;  3SZD A;  4PJ0 O;  4AFK A;  4AKR B;  2WVP A;  4AUI A;  3SY7 A;  2MNH A;  4LSI A;  3VZT X;  3UAQ A;  2ODJ A;  3LK2 B;  4AKM A;  1BH3 A;  3POR A;  4D65 A;  3BRZ A;  3PGR A;  3PGU A;  2OMF A;  3WI5 A;  1GFM A;  3POU A;  2ZLD A;  3AA1 A;  3T20 A;  3NSG A;  4B61 A;  3JTY A;  2R8A A;  1IZN B;  1Q9F A;  2ZFG A;  4LSH A;  4U9C A;  3TZG A;  2XMX A;  4GHB A;  4AYI D;  2PRN A;  4XNK A;  3V8U A;  2JQY A;  3AA6 A;  3SYS A;  1HXU A;  1YS5 A;  2AXT O;  3A0H O;  4JFB A;  4RL9 A;  4GCS A;  5GTI O;  3VY9 X;  4D64 A;  2KZ7 B;  4N59 A;  4C00 A;  3AAE A;  4PUX A;  4AYM C;  1OSM A;  2FGR A;  8PRN A;  4FT6 A;  2GE4 A;  3HW9 A;  3AAA B;  2J1N A;  2R4O A;  2XE2 A;  3HOE A;  4KR8 A;  4XNL A;  3PQU A;  4FRX A;  2Y0K A;  6PRN A;  3WI4 A;  3DA3 A;  3KZI O;  5GTH O;  3C5O A;  5DL6 A;  5G26 A;  5GV0 A;  3GP6 A;  1GFN A;  2R4N A;  2M07 A;  3FYX A;  3WU2 O;  4C4V A;  2YPV A;  2R4P A;  2XE5 A;  4E1T A;  4BUM X;  1GFQ A;  3VY8 X;  2R89 A;  3DWO X;  3SZV A;  2MHL A;  3LK4 1;  5E79 O;  5AFU K;  5ADX L;  1OPF A;  1HXT A;  1Q9G A;  2XE3 A;  2O4V A;  2POR A;  1QJ9 A;  1ZHT A;  2X27 X;  4FUV A;  4K3B A;  5KAF O;  2ERV A;  1ZHY A;  1H6S 1;  4AYN A;  2XE1 A;  3AA0 B;  5JDP A;  2LFU A;  2XTR A;  4D5U A;  4GF4 A;  5B5E O;  3PF1 A;  3AA7 A;  4FQE A;  4N58 A;  5G3A A;  2M06 A;  2JMM A;  3VE2 A;  1G90 A;  1T1L A;  2F1V A;  4O3W A;  3VZU X;  3LK3 A;  4FSO A;  4UB6 O;  5G39 A;  3AA1 B;  2F1C X;  2F1T A;  4AYD C;  5TIS O;  5B66 O;  3G7G A;  1MM4 A;  2FGQ X;  2J4U P;  2N2L A;  4FZL A;  1S5L O;  2Y2X A;  3LK4 2;  5D5D A;  3DWN A;  3KVD D;  3PQS A;  1BT9 A;  4K3C A;  1E54 A;  1QJ8 A;  1ZHW A;  4RJW A;  4JCH A;  3AA6 B;  1PHO A;  4QQ1 A;  3SY9 A;  2XG6 A;  2K0L A;  2WJR A;  4KR4 A;  1THQ A;  1ZHX A;  2W81 C;  4O3X B;  3BRY A;  1HXX A;  5DL7 A;  5FVN A;  2Y0L A;  3AAE B;  3VZW X;  4AZL A;  4FSP A;  4FZN A;  4RLB A;  2IWW A;  4FOZ A;  3POQ A;  5G38 A;  4AYE C;  2WJQ A;  4O3Y A;  5PRN A;  4C69 X;  1T16 A;  5KAI O;  3HOL A;  4GCQ A;  4FMS A;  2R4L A;  3T24 A;  2KXP A;  4LSE A;  3O0E A;  2Y7S A;  4IL6 O;  2N2M A;  4F4B A;  3NJT A;  3RBH A;  3DA4 A;  3AAA A; 
#chains in the Genus database with same CATH homology
 2LHF A;  4KRA A;  1MM5 A;  2KDY A;  4AKR A;  4Z3T A;  1GFO A;  1P4T A;  3POX A;  4G76 A;  3UU2 A;  3PRN A;  4E1S A;  3T0S A;  4RLC A;  4LSF A;  3QRA A;  1MPF A;  2QTK A;  3LK2 A;  4O4X A;  3VE1 A;  3UPG A;  5AFU L;  3A2S X;  4G75 A;  2XTQ A;  4FZM A;  1ORM A;  2W80 C;  5ADX K;  2KC0 A;  1BXW A;  4O3Z A;  4FES A;  2K4T A;  5T5F A;  1IZN A;  1QJP A;  2YNK A;  3HWB A;  4O49 A;  2KXP B;  1ZHZ A;  4RJX A;  3AA7 B;  5DL5 A;  3EMN X;  3QRC A;  3SYB A;  3K19 A;  4FRT A;  4O4U A;  5DL8 A;  7PRN A;  1GFP A;  2Y0H A;  3SZD A;  1PRN A;  2KZ7 A;  3AA0 A;  3LK3 B;  4GCP A;  5EE2 A;  4AFK A;  4AKR B;  5IYU A;  4AUI A;  3SY7 A;  2MNH A;  4LSI A;  3VZT X;  3UAQ A;  2ODJ A;  3LK2 B;  4AKM A;  1BH3 A;  3POR A;  4D65 A;  2OMF A;  3WI5 A;  1GFM A;  3POU A;  2ZLD A;  3AA1 A;  3T20 A;  3NSG A;  4B61 A;  3JTY A;  1IZN B;  1Q9F A;  2ZFG A;  4LSH A;  4U9C A;  3TZG A;  2XMX A;  4GHB A;  4AYI D;  2PRN A;  4XNK A;  3V8U A;  3AA6 A;  3SYS A;  1HXU A;  1YS5 A;  4JFB A;  4RL9 A;  4GCS A;  3VY9 X;  4D64 A;  2KZ7 B;  4N59 A;  3AAE A;  4PUX A;  4AYM C;  1OSM A;  2FGR A;  8PRN A;  4FT6 A;  2GE4 A;  3HW9 A;  3AAA B;  2J1N A;  2XE2 A;  3HOE A;  4KR8 A;  4XNL A;  3PQU A;  4FRX A;  2Y0K A;  6PRN A;  3WI4 A;  3DA3 A;  3C5O A;  5DL6 A;  5G26 A;  5GV0 A;  3GP6 A;  1GFN A;  3FYX A;  2M07 A;  2YPV A;  2XE5 A;  4E1T A;  4BUM X;  1GFQ A;  3VY8 X;  3SZV A;  2MHL A;  3LK4 1;  5AFU K;  5ADX L;  1OPF A;  1HXT A;  2XE3 A;  1Q9G A;  2O4V A;  2POR A;  1QJ9 A;  1ZHT A;  2X27 X;  4FUV A;  2ERV A;  1ZHY A;  1H6S 1;  4AYN A;  2XE1 A;  3AA0 B;  5JDP A;  2LFU A;  2XTR A;  4D5U A;  4GF4 A;  3AA7 A;  4N58 A;  2M06 A;  2JMM A;  3VE2 A;  1G90 A;  4O3W A;  2F1V A;  3VZU X;  3LK3 A;  4FSO A;  4AYD C;  3AA1 B;  2F1T A;  3G7G A;  1MM4 A;  2FGQ X;  2J4U P;  2N2L A;  4FZL A;  2Y2X A;  3LK4 2;  5D5D A;  3KVD D;  3PQS A;  1BT9 A;  1E54 A;  1QJ8 A;  1ZHW A;  4RJW A;  4JCH A;  3AA6 B;  1PHO A;  4QQ1 A;  3SY9 A;  2XG6 A;  2K0L A;  4KR4 A;  1THQ A;  1ZHX A;  2W81 C;  4O3X B;  4AZL A;  1HXX A;  5DL7 A;  5FVN A;  2Y0L A;  3AAE B;  3VZW X;  4FSP A;  4FZN A;  4RLB A;  4FOZ A;  3POQ A;  4AYE C;  4O3Y A;  5PRN A;  4C69 X;  3HOL A;  4GCQ A;  4FMS A;  3T24 A;  2KXP A;  4LSE A;  3O0E A;  2Y7S A;  2N2M A;  4F4B A;  3RBH A;  3DA4 A;  3AAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...