2X27X

Crystal structure of the outer membrane protein oprg from pseudomonas aeruginosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
209
Chain Sequence
DIQGHKAGDFIIRGGFATVDPDDSSSDIKLDGAKQRGTKATVDSDTQLGLTFTYMFADKWGVELVAATPFNHQVDVKGLLDGKLADIKQLPPTLLLQYYPMGGTNSAFQPYGGLGVNYTTFFDEDLASNRKAQGFSSMKLQDSWGLAGELGFDYMLNEHALFNMAVWYMDIDTKASINGPSALGVNKTKVDVDVDPWVYMIGFGYKFHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN OPRG
publication title The Crystal Structure of Oprg from Pseudomonas Aeruginosa, a Potential Channel for Transport of Hydrophobic Molecules Across the Outer Membrane.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 55
structure length 209
sequence length 212
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03922 OmpW OmpW family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2x27X00
1G90A 2N2LA 1MM4A 1QJPA 4PUXA 2ERVA 1MM5A 2F1VA 3QRAA 2M06A 2GE4A 2K0LA 4RLCA 2F1TA 1Q9FA 1THQA 2JMMA 2M07A 1ORMA 2MNHA 1QJ9A 3C5OA 3G7GA 1QJ8A 3GP6A 2MHLA 2LHFA 2N2MA 3QRCA 2X27X 1P4TA 1BXWA 1Q9GA
chains in the Genus database with same CATH superfamily
3PQUA 2XTQA 3DWNA 3DWOX 4JCHA 2KXPB 4AYID 4C4VB 2R4PA 2YPVA 2XE3A 2R88A 1MM4A 5B5EO 1QJPA 3A0BO 3LK2A 3WI5A 5ADXL 2ERVA 4IL6O 4QQ1A 4FZMA 2M06A 3PGRA 2GE4A 4GCPA 5PRNA 2O4VA 4O3ZA 2K0LA 4FESA 1T1LA 2F1TA 1Q9FA 3LK42 1PHOA 1THQA 1ZHYA 2M07A 3AA6B 3BRZA 4LSEA 2MNHA 3SZDA 2XE5A 3VY9X 5AFUK 3HWBA 2R4LA 2Y0HA 4GCQA 3UPGA 1ZHWA 3KZIO 4AYDC 4LSFA 4GF4A 4RJXA 4D65A 5B66O 3JCUO 3AAAB 4O4UA 4AZLA 4Z3TA 4GHBA 4N58A 5TISO 2XE1A 2XMXA 5G3AA 2WVPA 5GV0A 5GTHO 1GFQA 1T16A 3T20A 2KC0A 3SY9A 4GCSA 5ADXK 2WJQA 4RL9A 2AXTO 4AYMC 1G90A 1IZNB 5DL7A 5DL6A 3PQSA 2N2LA 4FSOA 3SYSA 4C4VA 3SYBA 3VZWX 4B61A 4C00A 2KXPA 2KDYA 2OMFA 4K3BA 3VY8X 3PF1A 4AYNA 2R8AA 2Y7SA 4AYEC 4LSHA 5DL8A 2R89A 3SY7A 3NJTA 4XNKA 3C5OA 3AA6A 2Y0LA 4FUVA 3RBHA 3V8UA 1H6S1 3BS0A 3DA4A 4PJ0O 5G26A 3LK3B 1GFOA 2J1NA 2XG6A 2MHLA 3GP6A 3POUA 4UB8O 1HXXA 1BT9A 3T24A 4CTDA 4XNLA 3DZMA 3QRCA 2ODJA 4PR7A 2X27X 3FYXA 3POQA 1P4TA 3AAAA 4O49A 3UU2A 4D5UA 4AKMA 2X9KA 3K19A 4G76A 2JQYA 2KZ7B 3VE2A 1OPFA 1ZHTA 4FZNA 2QTKA 4N75A 4F4BA 4K3CA 2WJRA 1ZHXA 4KRAA 3AA7B 4AFKA 1BH3A 2PRNA 2J4UP 1IZNA 5E79O 1YS5A 1MM5A 5KAFO 3DA3A 2XTRA 4FRTA 4RLCA 4FSPA 2JMMA 5FVNA 1ORMA 1GFMA 4BUMX 5G38A 3BRYA 3JTYA 3T0SA 4FZLA 1QJ8A 3WU2O 8PRNA 5T5FA 4O3WA 4FRXA 4O3XB 2K4TA 3PORA 3HW9A 3LK3A 5GTIO 3UAQA 4AKRB 4D64A 1S5LO 1OSMA 5JDPA 3POXA 1MPFA 1ZHZA 3AAEB 2YNKA 4RLBA 1GFNA 3WI4A 5EE2A 3HOEA 1BXWA 4KR8A 4JFBA 1Q9GA 4U9CA 4RJWA 1E54A 2W81C 2IWVA 3SZVA 2W80C 3PGSA 3HOLA 2ZLDA 3LK2B 4O4XA 1PRNA 4O3YA 5IYUA 3EMNX 3LK41 2KZ7A 3A0HO 3KVDD 3PGUA 5DL5A 4PUXA 2Y2XA 4N74A 2F1VA 3QRAA 2R4NA 3AA7A 4LSIA 3AA0B 3PRNA 4FT6A 4FOZA 3AA0A 2IWWA 2XE2A 3VZTX 1QJ9A 3O0EA 2FGQX 1GFPA 3G7GA 3VZUX 5AFUL 2FGRA 2PORA 2LHFA 2LFUA 4AUIA 4FMSA 4C69X 2N2MA 2ZFGA 3TZGA 1HXUA 4E1TA 4KR4A 2Y0KA 3NSGA 2F1CX 4N59A 3VE1A 3AA1B 4G75A 4AKRA 3AA1A 5KAIO 3A2SX 5D5DA 7PRNA 3AAEA 5G39A 4FQEA 6PRNA 5H2FO 2R4OA 1HXTA 4E1SA 4UB6O
chains in the Genus database with same CATH topology
3PQUA 2XTQA 4JCHA 4AYID 2KXPB 2YPVA 2XE3A 5ADXL 1MM4A 1QJPA 3LK2A 3WI5A 2ERVA 4QQ1A 4FZMA 2M06A 4GCPA 2GE4A 3SY7A 2O4VA 4O3ZA 2K0LA 4FESA 2F1TA 1Q9FA 3LK42 1PHOA 1THQA 1ZHYA 2M07A 3AA6B 4LSEA 3SZDA 2MNHA 5AFUK 2XE5A 3VY9X 3HWBA 2Y0HA 4GCQA 3UPGA 1ZHWA 4AYDC 4LSFA 4GF4A 4RJXA 4D65A 3AAAB 4O4UA 4AZLA 4Z3TA 4GHBA 4N58A 2XE1A 2XMXA 5GV0A 1GFQA 3T20A 2KC0A 3SY9A 4GCSA 5ADXK 4RL9A 4AYMC 1G90A 1IZNB 5DL7A 5DL6A 3PQSA 2N2LA 4FSOA 3SYSA 3SYBA 3VZWX 4B61A 2KXPA 2KDYA 2OMFA 3VY8X 4AYNA 2Y7SA 4AYEC 4LSHA 5DL8A 4XNKA 3C5OA 3AA6A 2Y0LA 4FUVA 3RBHA 3V8UA 1H6S1 5G26A 3LK3B 1GFOA 2J1NA 2XG6A 2MHLA 3GP6A 3POUA 1HXXA 1BT9A 3T24A 4XNLA 3QRCA 2ODJA 2X27X 3FYXA 3POQA 1P4TA 3AAAA 4O49A 3UU2A 4D5UA 4AKMA 3K19A 4G76A 2KZ7B 3VE2A 1OPFA 1ZHTA 4FZNA 2QTKA 4F4BA 4AFKA 4KRAA 1ZHXA 3AA7B 2J4UP 1BH3A 2PRNA 1IZNA 1YS5A 1MM5A 3DA3A 2XTRA 4FRTA 4RLCA 4FSPA 2JMMA 5FVNA 1ORMA 1GFMA 4BUMX 3JTYA 3T0SA 4FZLA 1QJ8A 8PRNA 5T5FA 4O3WA 4FRXA 4O3XB 2K4TA 3PORA 3HW9A 3LK3A 3UAQA 4AKRB 4D64A 1OSMA 5JDPA 3POXA 1MPFA 1ZHZA 3AAEB 2YNKA 4RLBA 1GFNA 3WI4A 5EE2A 3HOEA 1BXWA 4KR8A 4JFBA 1Q9GA 4U9CA 4RJWA 2W81C 1E54A 3SZVA 2W80C 3HOLA 2ZLDA 3LK2B 4O4XA 1PRNA 4O3YA 5IYUA 3EMNX 3LK41 2KZ7A 3KVDD 5DL5A 4PUXA 2Y2XA 2F1VA 3QRAA 3AA7A 4LSIA 3AA0B 3PRNA 4FT6A 4FOZA 3AA0A 2XE2A 3VZTX 1QJ9A 3O0EA 2FGQX 1GFPA 3G7GA 3VZUX 5AFUL 2FGRA 2PORA 2LHFA 2LFUA 4AUIA 4FMSA 4C69X 2N2MA 2ZFGA 3TZGA 1HXUA 4E1TA 4KR4A 2Y0KA 3NSGA 4N59A 3VE1A 3AA1B 4G75A 4AKRA 3AA1A 3A2SX 5D5DA 7PRNA 3AAEA 6PRNA 3DA4A 1HXTA 4E1SA 5PRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G90 A;  2N2L A;  1MM4 A;  1QJP A;  4PUX A;  2ERV A;  1MM5 A;  2F1V A;  3QRA A;  2M06 A;  2GE4 A;  2K0L A;  4RLC A;  2F1T A;  1Q9F A;  1THQ A;  2JMM A;  2M07 A;  1ORM A;  2MNH A;  1QJ9 A;  3C5O A;  3G7G A;  1QJ8 A;  3GP6 A;  2MHL A;  2LHF A;  2N2M A;  3QRC A;  2X27 X;  1P4T A;  1BXW A;  1Q9G A; 
#chains in the Genus database with same CATH topology
 3PQU A;  2XTQ A;  3DWN A;  3DWO X;  4JCH A;  2KXP B;  4AYI D;  4C4V B;  2R4P A;  2YPV A;  2XE3 A;  2R88 A;  1MM4 A;  5B5E O;  1QJP A;  3A0B O;  3LK2 A;  3WI5 A;  5ADX L;  2ERV A;  4IL6 O;  4QQ1 A;  4FZM A;  2M06 A;  3PGR A;  2GE4 A;  4GCP A;  5PRN A;  2O4V A;  4O3Z A;  2K0L A;  4FES A;  1T1L A;  2F1T A;  1Q9F A;  3LK4 2;  1PHO A;  1THQ A;  1ZHY A;  2M07 A;  3AA6 B;  3BRZ A;  4LSE A;  2MNH A;  3SZD A;  2XE5 A;  3VY9 X;  5AFU K;  3HWB A;  2R4L A;  2Y0H A;  4GCQ A;  3UPG A;  1ZHW A;  3KZI O;  4AYD C;  4LSF A;  4GF4 A;  4RJX A;  4D65 A;  5B66 O;  3JCU O;  3AAA B;  4O4U A;  4AZL A;  4Z3T A;  4GHB A;  4N58 A;  5TIS O;  2XE1 A;  2XMX A;  5G3A A;  2WVP A;  5GV0 A;  5GTH O;  1GFQ A;  1T16 A;  3T20 A;  2KC0 A;  3SY9 A;  4GCS A;  5ADX K;  2WJQ A;  4RL9 A;  2AXT O;  4AYM C;  1G90 A;  1IZN B;  5DL7 A;  5DL6 A;  3PQS A;  2N2L A;  4FSO A;  3SYS A;  4C4V A;  3SYB A;  3VZW X;  4B61 A;  4C00 A;  2KXP A;  2KDY A;  2OMF A;  4K3B A;  3VY8 X;  3PF1 A;  4AYN A;  2R8A A;  2Y7S A;  4AYE C;  4LSH A;  5DL8 A;  2R89 A;  3SY7 A;  3NJT A;  4XNK A;  3C5O A;  3AA6 A;  2Y0L A;  4FUV A;  3RBH A;  3V8U A;  1H6S 1;  3BS0 A;  3DA4 A;  4PJ0 O;  5G26 A;  3LK3 B;  1GFO A;  2J1N A;  2XG6 A;  2MHL A;  3GP6 A;  3POU A;  4UB8 O;  1HXX A;  1BT9 A;  3T24 A;  4CTD A;  4XNL A;  3DZM A;  3QRC A;  2ODJ A;  4PR7 A;  2X27 X;  3FYX A;  3POQ A;  1P4T A;  3AAA A;  4O49 A;  3UU2 A;  4D5U A;  4AKM A;  2X9K A;  3K19 A;  4G76 A;  2JQY A;  2KZ7 B;  3VE2 A;  1OPF A;  1ZHT A;  4FZN A;  2QTK A;  4N75 A;  4F4B A;  4K3C A;  2WJR A;  1ZHX A;  4KRA A;  3AA7 B;  4AFK A;  1BH3 A;  2PRN A;  2J4U P;  1IZN A;  5E79 O;  1YS5 A;  1MM5 A;  5KAF O;  3DA3 A;  2XTR A;  4FRT A;  4RLC A;  4FSP A;  2JMM A;  5FVN A;  1ORM A;  1GFM A;  4BUM X;  5G38 A;  3BRY A;  3JTY A;  3T0S A;  4FZL A;  1QJ8 A;  3WU2 O;  8PRN A;  5T5F A;  4O3W A;  4FRX A;  4O3X B;  2K4T A;  3POR A;  3HW9 A;  3LK3 A;  5GTI O;  3UAQ A;  4AKR B;  4D64 A;  1S5L O;  1OSM A;  5JDP A;  3POX A;  1MPF A;  1ZHZ A;  3AAE B;  2YNK A;  4RLB A;  1GFN A;  3WI4 A;  5EE2 A;  3HOE A;  1BXW A;  4KR8 A;  4JFB A;  1Q9G A;  4U9C A;  4RJW A;  1E54 A;  2W81 C;  2IWV A;  3SZV A;  2W80 C;  3PGS A;  3HOL A;  2ZLD A;  3LK2 B;  4O4X A;  1PRN A;  4O3Y A;  5IYU A;  3EMN X;  3LK4 1;  2KZ7 A;  3A0H O;  3KVD D;  3PGU A;  5DL5 A;  4PUX A;  2Y2X A;  4N74 A;  2F1V A;  3QRA A;  2R4N A;  3AA7 A;  4LSI A;  3AA0 B;  3PRN A;  4FT6 A;  4FOZ A;  3AA0 A;  2IWW A;  2XE2 A;  3VZT X;  1QJ9 A;  3O0E A;  2FGQ X;  1GFP A;  3G7G A;  3VZU X;  5AFU L;  2FGR A;  2POR A;  2LHF A;  2LFU A;  4AUI A;  4FMS A;  4C69 X;  2N2M A;  2ZFG A;  3TZG A;  1HXU A;  4E1T A;  4KR4 A;  2Y0K A;  3NSG A;  2F1C X;  4N59 A;  3VE1 A;  3AA1 B;  4G75 A;  4AKR A;  3AA1 A;  5KAI O;  3A2S X;  5D5D A;  7PRN A;  3AAE A;  5G39 A;  4FQE A;  6PRN A;  5H2F O;  2R4O A;  1HXT A;  4E1S A;  4UB6 O; 
#chains in the Genus database with same CATH homology
 3PQU A;  2XTQ A;  4JCH A;  4AYI D;  2KXP B;  2YPV A;  2XE3 A;  5ADX L;  1MM4 A;  1QJP A;  3LK2 A;  3WI5 A;  2ERV A;  4QQ1 A;  4FZM A;  2M06 A;  4GCP A;  2GE4 A;  3SY7 A;  2O4V A;  4O3Z A;  2K0L A;  4FES A;  2F1T A;  1Q9F A;  3LK4 2;  1PHO A;  1THQ A;  1ZHY A;  2M07 A;  3AA6 B;  4LSE A;  3SZD A;  2MNH A;  5AFU K;  2XE5 A;  3VY9 X;  3HWB A;  2Y0H A;  4GCQ A;  3UPG A;  1ZHW A;  4AYD C;  4LSF A;  4GF4 A;  4RJX A;  4D65 A;  3AAA B;  4O4U A;  4AZL A;  4Z3T A;  4GHB A;  4N58 A;  2XE1 A;  2XMX A;  5GV0 A;  1GFQ A;  3T20 A;  2KC0 A;  3SY9 A;  4GCS A;  5ADX K;  4RL9 A;  4AYM C;  1G90 A;  1IZN B;  5DL7 A;  5DL6 A;  3PQS A;  2N2L A;  4FSO A;  3SYS A;  3SYB A;  3VZW X;  4B61 A;  2KXP A;  2KDY A;  2OMF A;  3VY8 X;  4AYN A;  2Y7S A;  4AYE C;  4LSH A;  5DL8 A;  4XNK A;  3C5O A;  3AA6 A;  2Y0L A;  4FUV A;  3RBH A;  3V8U A;  1H6S 1;  5G26 A;  3LK3 B;  1GFO A;  2J1N A;  2XG6 A;  2MHL A;  3GP6 A;  3POU A;  1HXX A;  1BT9 A;  3T24 A;  4XNL A;  3QRC A;  2ODJ A;  2X27 X;  3FYX A;  3POQ A;  1P4T A;  3AAA A;  4O49 A;  3UU2 A;  4D5U A;  4AKM A;  3K19 A;  4G76 A;  2KZ7 B;  3VE2 A;  1OPF A;  1ZHT A;  4FZN A;  2QTK A;  4F4B A;  4AFK A;  4KRA A;  1ZHX A;  3AA7 B;  2J4U P;  1BH3 A;  2PRN A;  1IZN A;  1YS5 A;  1MM5 A;  3DA3 A;  2XTR A;  4FRT A;  4RLC A;  4FSP A;  2JMM A;  5FVN A;  1ORM A;  1GFM A;  4BUM X;  3JTY A;  3T0S A;  4FZL A;  1QJ8 A;  8PRN A;  5T5F A;  4O3W A;  4FRX A;  4O3X B;  2K4T A;  3POR A;  3HW9 A;  3LK3 A;  3UAQ A;  4AKR B;  4D64 A;  1OSM A;  5JDP A;  3POX A;  1MPF A;  1ZHZ A;  3AAE B;  2YNK A;  4RLB A;  1GFN A;  3WI4 A;  5EE2 A;  3HOE A;  1BXW A;  4KR8 A;  4JFB A;  1Q9G A;  4U9C A;  4RJW A;  2W81 C;  1E54 A;  3SZV A;  2W80 C;  3HOL A;  2ZLD A;  3LK2 B;  4O4X A;  1PRN A;  4O3Y A;  5IYU A;  3EMN X;  3LK4 1;  2KZ7 A;  3KVD D;  5DL5 A;  4PUX A;  2Y2X A;  2F1V A;  3QRA A;  3AA7 A;  4LSI A;  3AA0 B;  3PRN A;  4FT6 A;  4FOZ A;  3AA0 A;  2XE2 A;  3VZT X;  1QJ9 A;  3O0E A;  2FGQ X;  1GFP A;  3G7G A;  3VZU X;  5AFU L;  2FGR A;  2POR A;  2LHF A;  2LFU A;  4AUI A;  4FMS A;  4C69 X;  2N2M A;  2ZFG A;  3TZG A;  1HXU A;  4E1T A;  4KR4 A;  2Y0K A;  3NSG A;  4N59 A;  3VE1 A;  3AA1 B;  4G75 A;  4AKR A;  3AA1 A;  3A2S X;  5D5D A;  7PRN A;  3AAE A;  6PRN A;  3DA4 A;  1HXT A;  4E1S A;  5PRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...