2X2EA

Dynamin gtpase dimer, long axis form
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
341
Chain Sequence
b'MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDKHGTDSRVDEMLRMYHALKEALSIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN-1
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 107
structure length 341
sequence length 341
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2eA00
2O8BB 1R6BX 1NY6A 4Q66C 3TH5A 5SZHB 1P72A 3VKGA 1X8KA 4S2EA 2FEMA 1JQLB 2VO1A 1XJQA 3FE2A 1P3JA 3KJIA 3QI2A 4GI7A 2NTYC 1QF9A 1FMJA 5FR2A 4ZCLA 4CEHB 2FN4A 2OFXA 2ZS8A 2J5XA 3R8CA 3A8TA 4C0SA 2QTVB 3V9PA 5GVSA 5JFGA 1T0JB 5EP4A 3NKVA 2WJVA 3FPAA 2P0EA 4EPVA 5JRZA 1F2UA 2Z43A 3FHTA 1Z6TA 3N2EA 1KI6A 5FUYA 1XU4A 3NBYC 3KTAB 2NGRA 2VHQA 3VR1A 1T3SA 4QGHA 4E03A 1Z6AA 4JSYA 3OZXA 2P6UA 3C8UA 1XTQA 3TRFA 1DE0A 3CRVA 4LHXA 3X1YA 1GITA 1KKLA 4FMDF 5FTNA 4FCWA 3WHKA 1JAIA 5JI3E 2ZR0A 2JDIA 3ND9A 1P73A 4IW3B 3VX4A 2JIZA 3U44B 1NY5A 2REBA 3CO5A 3QVUA 2O0JA 3EC2A 3QXSA 4HLUA 4PX9A 3LWNA 5CJ2A 2PLFA 4F93B 5FPSA 2PX0A 1XDBA 1RRCA 1JXOA 4ZDWA 2CNWD 5FBVB 2G77B 2ZR9A 5CK5A 1YKSA 2VA8A 4ARZA 2B8WA 2CLCX 3MJRA 1XXHE 1XTIA 4QBGB 1Z07A 1YQTA 2N1BA 2V9PA 2GXAA 4HEJA 3CWZA 5GJWC 1RVDA 2F3TA 2KJQA 4YLGA 1Q21A 4BEBA 2IYUA 3I8XA 5JEDA 2OFOA 2AFIE 1VYVA 1W4BA 4JVLA 4LUCA 3OE7A 2Z83A 2C2HA 4EPYA 4EPWA 1QRAA 2VQSA 3R8FA 4DLXA 4DEYA 3G82C 1GIAA 4DLUA 4UNNA 2JAQA 1JXMA 1NKTA 3FKQA 3IUYA 4P33A 3K0SA 1H8HD 4BWYA 1Q0UA 2ZTSA 2ZU0C 1ZMXA 3WBKA 1S1MA 4LK2A 4Q1FA 3P4YA 5DN6D 3BB1A 2YNMA 1FL9A 2BV3A 2C9OA 4FWTA 4Q1DA 1UKEA 5CYPA 4V0MA 4CZ2A 3IGFA 1RRPA 1KSFX 4RZUA 4HZIA 5CB6A 2JLXA 1BMFD 3A1WA 3FVQA 3QPUA 2WAYA 3IIJA 1HA3A 2QAGC 2ZU6A 3E1SA 2OT3B 4KI0A 1NMZA 4V02A 4R98A 4A9AA 2PCJA 2VPPA 1AKEA 4OHXA 5KPDA 1US8B 1E2JA 3SBDA 2YOFA 3HYTA 3U3JA 4IFEA 4R7ZA 1ZNZA 3AF2A 1JBKA 1M34E 3GLHA 2ZYWX 2QBYA 4Q4AA 4LC1A 2WHXA 2QMHA 4DWJA 4KLZA 1FQKA 4M2LA 1KSHA 4NYIQ 4URUR 3HPQA 2XJ9A 1M8PA 3PUYA 5FTKA 2X19A 1UBFA 3T1VA 1JPJA 1R8QA 2R6CA 3MWJA 4LCBA 4NCKA 2G0TA 4AG5A 5F9HA 4F92B 1FP6A 1MRNA 1M1YE 3NHBA 1JB1A 4B2IA 5JI2E 2Q9BA 5KYKA 3EZFA 1GOTA 4XJXA 3B1YA 2IK8A 4TMZA 5EE9A 3K0FA 1L8QA 1VDZA 3SJBA 3QBVA 1GKYA 1Z08A 5IK2D 1XXHB 1ZM3A 3MAAC 2DBYA 4JSTA 3FMOB 2VHJA 2VBCA 1G5RA 3FDIA 3MWLA 4HB4A 1YZNA 2WWWA 4V0KA 2IWHA 3GLIA 3D8BA 2J0QA 4ACAA 4C7OB 1IY0A 1WE2A 4UNSA 3O8BA 3WRXC 4ZIRA 1UBCA 2Q3HA 4FI3C 3CKLA 1ZNXA 2CL7X 2ASEA 1ZYUA 3U7HB 3LBNA 4HUQA 1R10A 4Q4JA 5H1YA 3R7WB 1D2MA 2JJ2D 4Q02A 1E79D 3TVTA 1P5ZB 3NG1A 1I4DD 1CR1A 4PC3A 3K8YA 2KWIA 3GLFE 1LS6A 4LZZA 4Q9IA 1KOFA 2VTKA 3EX7C 4CEIB 1EFRD 2QORA 5LBIA 5JMTA 1NBME 4DRZA 4KO8A 3X2SA 1GVNB 5JECA 1SVIA 2JLYA 3OIVA 3TSZA 1CS4C 2R9VA 3GJ7A 3AUXA 1NL3A 4G3XA 4FN5A 1KO1A 2BEKA 4BZPA 1ZD9A 2JA1A 2O8CB 2FMXA 1N3BA 2WAXA 2XSZA 4NP6A 4QBFA 4RY2A 3KKOA 5EE5B 4LPKA 4A0RA 2F1JA 1GKUB 1FX0A 2XITA 2O8BA 3I5YA 4QM6A 1T9HA 1TQ2A 1SXJC 4LOAA 5EUMA 4TN1A 3FKSD 4KSCA 1SVWA 1CP2A 2HXYA 1OIXA 2AKAB 4Z1MA 4N3NA 1LNZA 1FTSA 4OQXA 4YDSA 5DISB 1KO8A 5JZVA 1S0UA 1U0HC 3I92A 3HPRA 3WRYC 2BVNA 3CZPA 2ZUCA 4DLTA 4DSNA 4BRWA 1BKDR 3QKSB 3KB2A 5DSZA 5B57C 2A5JA 4NONA 5HE8A 5CDFE 2GZHA 3A36A 2GTPA 5K8UA 2D3WA 1DOAA 3LLMA 1IJFA 1KI2A 4PANA 1MR3F 2BM1A 2WZQA 1T6NA 1G18A 3U44A 1YVDA 2X2FA 1GWNA 2A30A 1ONBA 3WNDA 4L15A 4I1VA 4HB3A 4BEJA 2O8FA 1GKIA 4Q4HB 3O8DA 5FI1B 3LVRE 3KFXA 4NYIR 4MGIR 5CB8A 1Q3HA 3BOSA 3SQWA 5DE3A 3O47A 2YOGA 2Q0HA 1P2VA 1Z6GA 4HI0E 5KSOA 1Z63A 2ZR7A 3OEED 1OFHA 1W36D 1G7SA 1SQ5A 4ZI3A 3TLXA 4XVUA 1Q1QA 2LCFA 4FCTA 3CLVA 1U2RA 2ZRHA 3IBYA 4EPXA 4CEJB 4BLRA 5G53C 2QN6A 2AL7A 1SVMA 2J41A 5FPKA 5CM8B 1YR9A 4DVGA 2C8VA 5EZ5A 2VHUA 1Q57A 2HLDA 3PFIA 3EPLA 4RKFA 3TVDA 3HYRA 1RW4A 3LBIA 1JEEA 2J46A 3A37A 4DT1A 3X1WA 4GNKA 4YC7A 2E87A 1QZXA 2A2ZA 2UKDA 2PMDA 1G8PA 2W6ID 4QNMA 3GLFB 4HUTA 2ZE7A 1KMHB 4DLRA 1KI3A 4PXAA 5J4KA 1HTWA 2OEPA 2GEVA 1W44A 5J4YA 3T61A 4TL9A 2JLSA 2CK3A 1MOZA 3A4LA 2CL0X 4XH9B 3FB4A 1DG3A 1IXSB 1WBBA 2DHRA 1CJMA 1XMIA 1KK1A 3MLEA 4BLSA 1PLKA 5EE1A 1F2TB 2FSIA 3T5GA 2QZ4A 4ESVA 2QPAA 2WKQA 4EPRA 2JIZD 2CJWA 3IQXA 1ZM2A 1V5WA 4WOPA 3R20A 1UKVY 2NOAA 3QVVA 1NIPA 2GA8A 4KYUA 3L43A 2DCUA 2WSSA 3CX7A 2WJHA 3K9GA 3CRW1 2QU8A 3THWB 1DARA 2A9KA 2I1QA 4NCNA 1AM4D 5E3HA 5JWRA 4C2UA 1NNEA 1S8FA 2WKRA 3BRWD 1P9NA 1G64A 5FBWB 3CIOA 1BIFA 3UMRA 3OIUA 1JALA 1T4GA 1XD2A 1S4QA 2J7PD 4CVNA 1KK2A 2GJKA 1IJEA 2ODEA 2WJGA 3OE7D 4TMVA 2W83A 2A5DA 2AK3A 2DFNA 4BECA 1CF4A 2ATVA 2JJ8A 2WJYA 3TQFA 1Z28A 3QF4B 5F3WB 1OYYA 3K53A 4DC9A 3Q72A 1XEWX 1EFUA 2QP9X 2GJ8A 2OAP1 3CNLA 3KDSE 4IVQA 3SFVA 4A4DA 4ZI2A 3PJRA 4OBEA 4QJ5A 3T06B 4U00A 2WWYA 3ZLJA 1TEVA 4A15A 1C4OA 2AK2A 2AFHE 4PQRA 4MDFA 3LH5A 2FU5C 4P32A 5FUXA 3KKPA 4XTRA 3X1XA 5JHHB 4FMCB 4JJKA 3QBTA 2NO0A 3LFUA 1JAHA 4X8OA 3CF2A 3K09C 4B6FA 4ABYA 3AVPA 4LY6A 3Q9LA 1TX4B 1HE1C 5DYIA 5D3QA 4E22A 4H9GA 2B6HA 3I62A 4Q7MB 2FFHA 5FPTA 1GRQA 4FD2A 1E96A 2UZ3A 4DIDA 1YZGA 5LD2B 4EPTA 2BMFA 3JZAA 3N70A 3CX6A 2JGNA 1VG1A 3AVTA 4J0QA 1NKSA 1RPZA 4ZCIA 1DADA 1Z3IX 3BXZA 2GEUA 4YMTA 3KJGA 1KI7A 4BFXA 1E69A 4Q9JA 3E2IA 4RD4A 1T5IA 2ZSAA 2QG6A 2PCLA 3EASA 2IEZA 2QE7A 821PA 2GK6A 1A5TA 1KI4A 1LB1B 2BKUA 2C04A 5J47A 2O0KA 4V0ME 2A5GA 1TUEA 421PA 5AJXA 5TY0A 4B3GA 2CXXA 1N6KA 2ZJYA 4DJTA 5TARA 4PPFA 4HSEA 2PZGA 3NBZC 3RAPR 3IBGA 1N6OA 1ZUNB 4GOKA 4PTLA 3DM9B 4JBWA 1Z0AA 4O0MA 1DAMA 3C7KA 2W6JA 1D9XA 5F9FA 2PH1A 1TEXA 4LHYA 4WA7A 4XVQA 4IDNA 4A0FA 2IWRA 1QBKC 4ESHA 1AA9A 1YR6A 4KBFA 4OK5A 4B34A 2ZI4A 5BYKA 4HAYA 4OQLA 2IUUA 2B7BA 1IY2A 1S3GA 1E4VA 3AM1A 3GLHE 2Q3FA 4OQNA 2GWHA 5HCIA 1F2UB 4RJLA 3RS4A 5CIQA 3AF3A 1S1CA 3KQUA 4TYPA 4FMBB 1E2FA 1OB2A 2P2LA 1SXJD 1XCGB 1R5NA 4EIWA 5B64A 2YYZA 3LY5A 3U61B 1P6XA 1GNPA 1GL7A 3CW2A 1W5SA 4WAUA 1OF1A 2RGBA 3RSOA 2O8EB 2HV8A 5J4HA 2IYRA 4QJ3A 4WVFA 4A82A 5JWOA 3NHAA 2XAUA 3SJZA 5EJEA 4C0QC 2ZYTX 1TAGA 4WW0A 1E1QA 4ARZB 2OCBA 3I8SA 4U02A 2R8RA 5FBLB 5L3QA 3TUZC 4OI0A 1R8SA 1VTKA 4BUJA 3GLIE 3SHFA 2QPOA 3AB3A 3RABA 2I1VB 2P5SA 3MMPA 1LF5A 4JBXA 1XCPA 3H84A 1R0XA 2RHMA 4BFYA 4DBLC 1E2GA 1ZCBA 1J70A 2CLSA 2KB0A 3AVOA 4C0HA 4PO9A 2ATXA 2BBSA 1OXUA 2VHTA 3SQXA 1ESMA 1ODFA 2CVFA 2IF2A 4DCNA 4Z1MD 3F0TA 4UNRA 1GZSA 4LJAA 3LX5A 5EXTA 4NL4H 3REGA 1X1SA 3PG5A 5K8TA 1KMQA 1TL7C 4LSGA 5FUVA 1XFAA 2PL3A 2Y8EA 2ZRDA 4B71A 2IUSA 2HXSA 3QKTA 3VR2A 2BCJQ 1MH1A 1D6JA 1KGDA 1XD9A 3G5UA 4UKDA 4XVRA 2XJ4A 5KHOC 3QENA 1SVKA 2GAAA 1OFIA 1TNDA 1Z0JA 2GRJA 2YC4C 3BAFA 3ZVRA 4TL8A 4W5WA 5SZJA 1MO3A 2EQBA 2FX3A 3K0AA 3ASZA 1AS2A 1W0KA 1EFTA 1SZPA 1YU9A 4MUAA 2O8DA 4Q21A 2IEYA 3TIFA 2IS2A 2PEZA 2HF9A 5EUQB 3AUYA 1YHNA 4M0LA 2GHIA 2ZETA 3QXXA 2MSCB 4TYQA 4LX0A 2P65A 1OSNA 2ZYUX 1XB2A 3BH7A 2NPFA 1AZTA 2ZVQX 3IDQA 3T1QA 5KDLA 1AGPA 1XCMA 3GLHB 1T3HA 2QBYB 1N5KA 5GJCA 4Q4AB 4KXFB 3QG5A 2ZJBA 3EIQA 2XZLA 2IX3A 3AVQA 4S35A 2AD5A 3OFND 2Z6VA 3PUXA 4LBVA 4C0LA 1CBUA 1KO7A 2QENA 4M9QA 2YV5A 2VRWA 1KKMA 4I1UA 2W0MA 3AVYA 3S1AB 5BN4A 2GCNA 2XB4A 3QF4A 2HLDD 4A92A 1N5LA 2QL6A 1W48A 3KJHA 4PC1A 1JPNA 5FBRB 5HE9A 3W3AA 2BHRA 4EFLA 1D9ZA 1P2UA 3TMKA 1U0JA 3LVQE 1W47A 4ON9A 1G16A 1EWRA 2VP6A 4F38A 3K0FB 4QFMA 3UIEA 2QAJA 5P21A 4YQFA 2P5TB 4YONB 1OYWA 4LI0A 3NBFA 4C2TA 1GL9B 1OXVA 2QT0A 4HAWA 1SULA 1V43A 1YR7A 4DCTA 4GRAA 1K5DA 5JCPA 4AURA 1SKQA 1A1VA 4Q9LA 1JJVA 1BYIA 1XPRA 4DLYA 2MMGA 5B30A 2O0HA 1GP2A 1ZCAA 4E07A 2QEQA 1VMAA 1XTSA 4HUQB 3BE4A 4Q4JB 4IXNA 2BC9A 3CF0A 2ZXUA 1OIVA 3ZIAA 2F9MA 5TV2A 4TLBA 2ZJ5A 1E2DA 2WICA 3OEHD 1LFDB 1UJ2A 1KIMA 1XD8A 1NLFA 4YXWA 2VHCA 3BGWA 3RS0A 3D3QA 4RCYA 3A58B 3SYKA 4D0GA 1II8A 3A1SA 3DMNA 2WWGA 4ZDIA 2X1VA 4D80A 4JL8A 3M6AA 3BIFA 5IDVA 1NLZA 1XZQA 4MGKR 5DI3A 4RD3A 3KX2A 4B32A 3K70B 1Q22A 1S9HA 4BQSA 1R2QA 2FGKA 4EFNA 3AGPA 3C16C 2ZRBA 3FWYA 4JLOA 2JLUA 2H1LA 5FR1A 1SVOA 2N42A 4M9SA 2H92A 4XSGA 1DO2A 1FX0B 1ZINA 5LD2C 2OHFA 1HV8A 3F5FA 4PFSA 5EXSA 1SVLA 3EW9A 3BFVA 1G41A 4A6PA 4NYMQ 4V0NA 1HT1E 1NVXQ 2V8OA 4BFSA 3WNCA 1ZM4A 2GNOA 3ASYA 3HU3A 4Q1EA 1KJZA 1R5BA 3RRMA 5FH9A 3QEOA 2E9SA 2H7VA 3VX3A 2D7DA 1PVOA 2G3YA 2Z0MA 1HYQA 5DYGA 1E9EA 3JVVA 4RFSA 3TR0A 1E2PA 4O2RA 2IYYA 4TLCA 3PQCA 2CCJA 1UPTA 3ZQJA 3O8CA 1XMJA 1W36C 1IN4A 1JEDA 1Z0DA 2ZE5A 3DM5A 4A8JC 4GZLA 1R0WA 3KKNA 2WTUA 2ANCA 5E7MA 1CXZA 1U8ZA 3B1XA 2C9CA 4DCVA 1XX6A 4TLAA 1COWA 4WZ6A 3SOPA 5G41A 4FXPA 5LDDC 2GILA 3MCAA 1ZM9A 5AJVB 621PA 5HCNA 4UXIA 5EP2A 4D26A 1UDXA 4JL6A 5JJIA 1W1WA 2O8FB 1E9CA 4R9UC 4PPGA 5FOXA 1CJVC 4NE2A 4A0GA 3AP3A 2JLZA 3OIYA 3DKPA 2FJUA 1UDWA 1ZNWA 4GPTA 4LJ5A 1E9AA 3BB3A 1DPFA 2WMOB 5HKKD 2OXRA 1KHTA 1XTRA 2H57A 4E09A 2J1LA 5DLQC 4M1TA 2IYZA 2IBMA 1A2KC 2AKYA 1NN5A 2GVDC 1X6VA 4OHVA 1VHTA 1FFHA 4FMCF 1JI0A 4P3YA 5E95A 2CBZA 4AIIA 3UMFA 2YWFA 1R4AA 2WWXA 1KDTA 2F1IA 4HLUC 4RVCA 1OH5A 3PUZA 3NTUA 4MRVA 3RVBA 1X86B 4DT1B 4LDJA 1AJEA 3QKUA 5SZKB 4B3XA 2JLWA 1G17A 1O3YA 2GCOA 4KU4A 3PEUA 3T12A 1HH4A 2H5EA 2NPIA 3KL4A 3ZH9B 1G19A 1EGAA 4EJSC 4BLPA 2YWGA 5FL3A 2CE2X 4AYWA 1W7AA 2GXSA 4HLDA 2OUKA 3ZD6A 2E1RA 5DIFA 3FHOA 4AKHA 2HT1A 1P2SA 4G5QA 5C18A 4G0NA 5KNDA 1XP8A 4UQOA 721PA 1H65A 3Q8XB 3THOA 3KB1A 2D74A 2CJWB 2XNDD 4Q7KA 4D81A 2TMKA 4WIAA 3ZVMA 4DEXA 1G8YA 2EFEB 4L5BA 3KXLA 3B85A 1N6HA 4CT5A 1F3OA 1E2KA 2IF0A 1II9A 2R6GA 1TF7A 1E1RA 3W6OA 1G5PA 1UEJA 2NO1A 4BZQA 4P0TA 4P31A 5LB4A 1J8MF 4AG6A 5CM9C 5L8VA 3LLUA 4NMMA 2BIFA 2Q3MA 3K0EA 4GBMA 1D2NA 4FCVA 1XD2B 1HT2E 1XEXA 1W49A 3GEIA 4L4UA 4MRSA 4NYMR 1KZGB 4MYCA 5D3MA 1OKKA 3S1AA 2Z5FA 3B9PA 3EXAA 1DELA 2CVHA 3GD7A 2QT1A 1EG7A 3BFKA 2HDNB 2MMCA 3VMFA 5KO2A 2BJVA 5FI0B 1N6LA 3NDBB 3NIBA 1Z0FA 3MRSA 1FNNA 2NQ2C 1NBMD 2AWNA 4CDGA 5JCZA 4DXAA 1A7JA 2ZUBA 3GJ0A 3Q3JB 3H1TA 1WF3A 2FSFA 5BYJA 3WYGA 1OV4A 2WBLC 1JNYA 4JLBA 2HYIC 2OXCA 4Q7LA 1ZP6A 1H8ED 3AF1A 3I32A 4TLDA 5A0FA 1VKJA 1IN5A 5AUOB 1OH7A 3EA0A 4KAXA 2VP2A 2YHSA 2R65A 3B82A 1YRBA 1U8YA 4BFTA 3HWSA 1G291 4H1UA 3V4RA 5AK0A 1K5GA 2ZRLA 1OLOA 3DVLA 4D4LA 4F91B 1NRJB 2IL1A 2XOKD 1G7RA 2W00A 2ZE6A 2PEYA 4FIDA 1G5TA 4KJZA 1OT3A 2F1HA 5FFMA 2GF0A 1UKYA 4M9XA 1VG8A 4JS0A 2WSMA 1M6NA 3C14C 3LW8A 1W4CA 3FHCB 3W5JA 1G7TA 1BYUA 2HF8A 2IYQA 4EUNA 4Q4LA 4URXR 3E70C 2RAPA 1G3QA 1FNMA 4IDHA 3CB4A 1UKZA 1KK0A 4IDOA 2J45A 2LWIA 3PXGA 1T91A 4GDFA 3EZ7A 4B48A 3L82B 2ZJAA 4G01B 4QC2A 3GFPA 3AVXA 5K8IA 2NO7A 3DO6A 4US0R 2X8AA 4RZ3A 1GFIA 3MJHA 4QG7A 2QQ0A 3U2QA 2Q21A 5JS8A 3NDPA 4DLZA 3NH6A 2V4ZA 4LBYA 2EYUA 4XD7A 3L0PA 3CNNA 1X1RA 4AKIA 2BKEA 3K70C 1FOEB 1HURA 2EWWA 3BWDD 3SDZA 1CR2A 3ZVNA 1M2OB 1ZU5A 1WDTA 1IM2A 3E5HA 3VR5A 5FL7A 1C1YA 1K6MA 2ERYA 3ZIAD 4LJ7A 4HB2A 2BDTA 4YMVA 2FV8A 5TB5A 5CLQA 2BMDA 3QPWA 4CRWB 4F7WA 1LV7A 2Q9CA 3GEHA 3GJXC 1FZQA 3OAAD 4PZLA 1VIYA 4M1KA 3F3YA 4HB0A 4PQFA 2A7QA 4W5HA 1NJFA 1U94A 4QGAA 2VF7A 3FFAA 4IEEA 3QJYA 5E7JA 1PUIA 2QQEA 3GP8A 1F6BA 2C5LA 2QTHA 1NVUQ 4BFZA 4XTCS 5AJYA 5L3QB 2FFBA 4U7DA 5FPHA 3FTQA 3PCRB 3NVAA 1M7BA 1NG1A 1G21E 2GJ9A 1EX7A 4NCJA 1TADA 3WXMA 3DHWC 3P26A 4Q1AA 3UKDA 3ADCA 1PLJA 2ZI5A 121PA 3KXKA 4OJQA 4ZDJA 3FMIA 2MSDB 3DOEA 4BZXA 4B43A 1ZC3A 4RCZA 4GMDA 4QBIA 5CYOA 1OXTA 3PENA 4LJYA 4FW9A 2NIPA 5DI9A 4TTPA 1P60A 3T35A 5KTYA 1DTSA 2GF9A 4EDHA 4M22A 2B8TA 1DS6A 4PO8A 1YZQA 2SHKA 4HYYA 4QHTA 3SJAA 4CGZA 3KUCA 3AP2A 4HLCA 3ZYCA 4KVAA 5L3SA 1KDRA 4DDTA 2FOLA 3KJEA 2ORIA 3IIKA 2ZSFA 1COWD 1E4YA 1QDEA 5EQTA 2JDID 4JBYA 1Y3AA 1OHHA 3PITA 4AK9A 1CTQA 1E9RA 2F43A 2ZSEA 2GBLC 2WIBA 3K0AB 5HR5A 2O8DB 3CZQA 4GT1A 1JJ7A 3FGNA 2QUZA 4RZXA 3KZ1E 2J0UA 4TSFA 4UJ3A 1JR3A 2QMUA 1E0JA 3NXSA 1G4UR 5JWHA 3K0CC 3GJ4A 2HUPA 3EIHA 1ZUIA 4PSVA 5HPYB 2J9RA 2CHGA 2IXEA 2O8EA 4FWIB 3LO5A 2EWVA 2RGCA 1TQ6A 3B6EA 3NC0C 2BMJA 4PC2A 3TUIC 1XMVA 1G8FA 4EQ6B 2FA9A 2OG2A 3SBEA 4IOKA 4KV9A 2C77A 1MRSA 1G1MA 3IKJA 2XEXA 1HE8B 1OE0A 1UBGA 3BJIC 3WYFA 5C2JB 1E2IA 4A2WA 4IXMA 4XWKA 1PZNA 2G88A 1KAGA 2BWJA 2JCSA 4F4JA 1DAFA 2QMOA 3OESA 4GSYA 5EE0A 2QGZA 1QHHB 2IT1A 1GG2A 4NBSA 3UWOA 4B3FX 3GQBA 2HT6A 2BMEA 1XMSA 3M4YA 4JLDA 2C95A 4XSHA 4R2IA 1Z5ZA 4URZR 1ZJ6A 1PV4A 4PC7A 1A4RA 1NN0A 3ZQ6A 4B44A 1OFTA 1QHXA 2ZANA 4TWZA 5A5GA 1BOFA 1VYTA 3ZVLA 2QA5A 3LDAA 1NIJA 3B60A 3BORA 4DLWA 1QHSA 3KFVA 4NYJQ 3SS8A 3W8RA 3AVWA 1N25A 4TL6A 3TJZA 3L0IB 2J3EA 4IVPA 1NSTA 1CR4A 1U9IC 3LAWA 4D82A 1EXMA 3L8ZA 4OI4A 1IY1A 8OHMA 3HR8A 5IT5A 1ETUA 2C03A 1E9DA 2OILA 2WM9B 5FTMA 4ASUA 4JYCA 2D4HA 3VHXA 2PT7A 5UKDA 3RS3A 3SU8A 2FH5B 5EXXA 3FMFA 1II8B 2WV9A 4OI2A 4HDOB 1F5NA 1QHYA 1KYIA 5DHAA 1T8UA 5DI3B 1T0HB 5FOUA 4JLPA 5DHFA 1PUJA 2BBWA 3PV0A 3LD9A 3TSWA 3U3KA 3RYTC 2XB2A 1ZUHA 4A1FA 2G0NA 4PSKA 1G9XA 3GLGA 1MKYA 4KFUA 2IXGA 1HQCA 4JT2A 2ANBA 5JHGB 4Z8XA 2C78A 1SHZA 2GZAA 5C4MA 3CRRA 3UWKA 5KUTA 2YKGA 221PA 1XJ0A 3AEZA 3B9QA 3PIRA 4MYHA 2RGXA 4W9MC 3PEWA 1R0ZA 2UZIR 3VFDA 3W8NA 5H68A 4TYYA 4OYHA 2BJWA 3PEYA 2X77A 3VQTA 3T15A 4PC6A 1HY3A 4KYIB 3B8HA 3AVUA 5HZKA 5CITA 4RFSB 3C15C 3QPVA 4AYXA 1YE8A 3D7MA 3U4QA 2CCGA 1N6NA 2RB4A 3LXXA 1CKEA 3IHLA 4I99A 4N0DA 1WXQA 4C4PA 1Z29A 2ERXA 1TU4A 5FBQB 3X1DA 4YDHB 1DAHA 4B6EA 4GOJA 4XOIA 1OH8A 4II7A 1N2CE 1CU1A 1TPZA 5H8WA 1VG9B 3UPUA 3SR0A 2QRZA 5KNBA 2F7SA 4P4SA 3THYA 1P62B 1B23P 2C98A 3D31A 3ETLA 4NTZA 2FG5A 1P2TA 3WHLA 4PR0A 4D4KA 2CEAA 1ZIOA 3C41J 4XIGS 2CCKA 4TMKA 4KVGA 3RS5A 3ADKA 3K70D 2OBNA 2VF8A 3DL0A 4TZ0A 1BMFA 2OSBA 2XSZD 5FOVA 3THXB 3QQ5A 5BWMA 5DGXA 2EFDB 4JLMA 2XTMA 2VP0A 2FF7A 2ZRGA 3Q5DA 1FPMA 1DAIA 1TMKA 5E4FA 3L0OA 3NEJA 1W2GA 4B47A 5KDOA 3VTKA 1ELOA 3ADDA 1E2NA 3K9NA 2J87A 4PSAA 2WWHA 3J81k 2FFQA 3TAUA 2P6NA 1RZ3A 2R44A 1HUQA 1KJYA 2DWPA 2GCOB 3GJ5A 5AWFC 3GFOA 4UNPA 1KSGA 2GXUA 5FPYA 4I4LA 4Q18A 4WBSA 2YWHA 4DDWA 1NSFA 3LV8A 4UXHA 4TZ6A 3WNBA 4PZZA 1VCNA 3I1FA 2EVWX 1YZKA 3KQKA 4MKFA 2YVUA 3SN6A 1RYHA 2F6RA 2GZDA 3MWKA 3TNFA 1UAAA 4Z54A 1TUIA 2ZRPA 1J90A 1X8JA 3CPJB 4Y0VA 4IKEA 3TBKA 5SZIA 1J99A 2EW1A 1G8GA 4BRUA 2IYTA 1DBSA 4US2R 5JBQA 2W2VA 1Q1EA 4GMXA 4HZUB 3RLFA 2XXAA 2WVJA 1GRNA 1E0KA 4Z8YA 1GM5A 1VECA 4I1OA 5C4GB 3RRZA 3CPHA 2PBRA 4IFBA 4TTRA 5CIWA 4JT4A 1CRPA 3QNUA 5J4LA 4PPNA 3I3SR 1Z6YA 2NO9A 4X8HA 3RANA 3SYLA 3EWSA 1GSIA 1Z8FA 5EP1A 1E9FA 2J7KA 3VU9A 5EP3A 2JATA 1U98A 1DO0A 1AIPA 1M7HA 4BE7B 4EQ6A 4B3CA 1GTVA 4PZYA 4JIMA 4M53A 1XEXB 4LPSA 4L9WA 4B75A 3AH8A 4LYAA 5J4VA 3R9WA 1AGRA 2JJ2A 3B1WA 1E79A 5D3MB 3DOFA 3W6PA 2BM0A 2ZRMA 4MKHA 2QMEA 1II0A 2MSEB 2IW3A 4L8GA 1G3IA 1EFRA 4GP6A 3KQNA 1J2JA 3FYHA 1AZSC 3TSOA 1XPOA 3BERA 2GK7A 2ZQ5A 1OH6A 4D25A 1QHHA 2XZOA 3IO5A 1RKBA 3B1ZA 2CK3D 1IN6A 4HATA 4G5OA 5DO9A 4LYJA 4M1WA 4RSGA 4HLQB 1KDOA 3N2IA 1CIPA 3ZZTA 3SNHA 1NG9A 5IRCD 2RGDA 3Q5EA 2ZRNA 5AR1A 3AF0A 3A1UA 5GJVC 3F8TA 1OHHD 2XGJA 1KDPA 4G5SA 5CJPA 4LJ8A 3VR3A 1FMLA 1OW3B 1XWIA 5JLJA 3VNUA 3DKVA 2V6JA 3U6BA 1W5TA 5GVRA 4P4UA 3RNLA 2WSSD 4MH0R 2IXFA 3I72A 4HDCA 5TVKA 1S2MA 3IQWA 3UMSA 2J0SA 4TQAA 3DZDA 4KFRA 2XNSA 4HAXA 1WMSA 4UXJA 4JMPA 5AUQA 3QF7A 1NN1A 2RCNA 3BK7A 1VIAA 3EZ2A 4M1MA 1ZM7A 4RD6A 3UG7A 1TQDA 2RGNA 3EARA 5E7IA 3UK6A 3REFA 1SGWA 2G83A 1AS3A 1I4LD 2AN9A 3HJNA 4NPHA 2ZAOA 4BPBA 3QKRA 4PHGA 2H8KA 3BB4A 3C4JA 3TW8B 1ZD8A 2FWRA 4KBGA 2VEDA 3SE0A 1MT0A 2VIIA 1KI8A 1TQ4A 2GEDA 2AXPA 3EZ6A 3B1VA 2AX4A 1VG0B 4JVNA 4M1YA 2IYVA 4PHTA 1Q44A 4A36A 3Q7PA 4B76A 5GADl 4ILEA 4Q01A 3U5ZB 4A2QA 4TQ9A 3PR1A 1T8TA 3OHMA 1S3SA 6Q21A 4R2HA 4CYMA 2G6BA 4A8JA 1DAKA 2OCPA 4IRUB 4IDPA 3LBHA 1IN7A 1JR3E 1AKYA 1Z0KA 4LJ6A 2ZE8A 3GFTA 4V03A 4B74A 2FFAA 2ZAMA 2DY1A 1N5JA 3NC1C 1GRRA 2CL6X 5FOSA 2ZRKA 1N5IA 4MKGA 2FPLA 3A6PC 4Q7JB 4PQYA 2J0VA 4DLSA 3CR7A 3JVUA 1XJCA 2VSFA 3TQCA 1W0JA 4Q00A 2W6IA 5FUWA 4D6PA 1IQPA 3QOFA 4MRNA 4US1R 5BQ5A 5DH9A 4ASUD 4D0NA 5BN5A 1KZ7B 2IS4A 1W4AA 3AV0B 4M4SA 3SC3A 2HEIA 4ZPXA 1U90A 4EFMA 2YINC 3CNOA 2CHVA 5BXQC 3U60B 4A2PA 2A5YB 1EX6A 2OAQ1 2RMKA 1I2DA 2QE7D 4QXAA 1NVWQ 1RYFA 1MABA 2ZI9A 1KSJA 3THXA 3IEVA 2HYDA 2WJJA 1ZIPA 2H18A 4DCSA 3EC1A 4DLVA 5JS7A 3W34A 1W4RA 4HAUA 2GAOA 3T1OA 1HQYE 4QL3A 4JL5A 1QHNA 2ZITA 4MGYR 1PLLA 1N0WA 2W6JD 4O25A 4QNRA 3VKWA 5AJWA 2FGJA 1XBTA 3U7GA 1BS1A 3W6NA 3CPEA 2C99A 4EJSA 4M1OA 3CH5A 2ZRCA 4AWXA 4Q48A 1P9WA 4IOJA 2D62A 1KO5A 3WMGA 1G6OA 2KBEA 1E6CA 2ORWA 3QG1A 4WXPA 4DZZA 4ZO4A 4F4IA 3QXJA 2J7PA 1E32A 2GVZC 4P4TA 5G3YA 5L3SB 4C9BA 2QAGA 3AKDA 3ICEA 3P32A 4Q03A 2A5FA 3MGCA 4Z51A 2IYSA 3KQLA 3I4LA 2I3BA 1NN3A 2PZEA 2WPDA 4ZKEA 2ZI6A 4ERNA 3OIWA 3WP0A 2QM7A 3LNCA 3LQRA 3SHWA 1E98A 3M1IA 4RKEA 4URVR 3GMTA 3GLGE 2ZI3A 4HZUA 5H70A 2V1UA 1T3LA 2D06A 3CM0A 5L3VA 2F43B 4C0BA 2YWEA 1YRAA 4L16A 1N0UA 3ZS8A 4C0KA 1E1QD 1XNJA 4OQMA 4Q9KA 2DR3A 1UBEA 2J0UB 1RJ9B 1YJ5A 4O3MA 2IYXA 3W9YA 2WMNB 4QKQA 3SFZA 1D2EA 4PAQA 4D0LB 3I5XA 4B2PA 4KLNA 2GKSA 4ACBA 5LB2A 2F1RA 3BS4A 3SI7A 1NF3A 4JVSB 1KK3A 1I4TD 2OV2A 1ZBDA 3IIMA 1TTTA 1G3UA 1W46A 2GESA 1DVRA 2FZ4A 4I1SA 1IHUA 2LKDA 3UXMA 2QP3A 3H4MA 2DB3A 4TYNA 2RHDA 2R6FA 1NVVQ 4HDQB 4JLVA 2ZYVX 1U81A 1JECA 2Z4RA 1FUUA 4M9ZA 5CLLA 4BLOA 1ZAKA 2OBLA 4IDQA 2OCAA 3G0HA 1OFUX 2IS6A 2WWFA 4Q5IA 2VH5R 4RD0A 1SVSA 4MRRA 4LGMA 3BBPA 2RKOA 3C5CA 4BLQA 2VYFA 3QXHA 3WMEA 3LXRA 4GFDA 4LC0A 3MSXA 2OCYC 1IN8A 1O87A 1Q1ZA 2VL7A 3FMPB 4YMSA 1W0KD 4B73A 4ZCMA 4JYBA 1AQYA 3GCGA 1N6RA 2J59A 2AD1A 3QXCA 4H1VA 2UVQA 4PHFA 2ECKA 3ZGXA 5IF9A 3RHFA 2HJGA 1E3MA 4PHHA 3ICQB 1RIFA 5A4JA 1X8LA 2DFKB 2B21A 2VP4A 4W5JA 1XEFA 4JLJA 1S96A 4XWAA 3R9IA 3PEVA 4NCHA 3KKMA 3AKYA 3NWJA 4QBHA 3B5JA 2ZPTX 4KITB 2XX3A 1SXJA 2L0XA 1QHIA 4I81A 1BO6A 1QG2A 4LYFA 3CUEF 4O2LA 1VPLA 4LJ9A 5M04A 1E9SA 1NMYA 2PJZA 3LX8A 3DMDA 4QOSA 2F3RA 4Q9HA 1Z47A 2IA5A 3TK1A 4XWOA 1XTJA 3CWQA 1G20E 3CH4B 2WOOA 3GLGB 4GL2A 4RD1A 4CF7A 1G7CA 2FEOA 4TYWA 1Y63A 2K5UA 3NBXX 1KNXA 4MA4A 5FOTA 5JJLA 2ZREA 3P4XA 3C5HA 4YMWA 2QSYA 5FOWA 3RS7A 1ESNA 2D2FA 3CRMA 4MGZR 4PO1A 5KSZA 2PJRA 2DFTA 1DAGA 2GETA 3GPLA 1UFQA 2AWOA 4AYTA 4DUGA 5KU1A 1W2HA 3A4MA 1KY2A 1GILA 3P1JA 3PUVA 4AKEA 1L7VC 1N0VC 4KCGA 2RH5A 2RGEA 2D7CA 3MFYA 3ZZUA 1XZPA 3U4QB 4A0HA 2PX3A 3D6TB 2KI5A 1FQJA 2W58A 4IOLA 2JLVA 4CEHA 1WB9A 3SJCA 1G3MA 4ZKDA 5C1BA 1RRFA 1WQ1R 3VNVA 3UATA 5JRJA 2AHOA 1ZD1A 1OB5A 1JQJC 3DPUA 2ONKA 1KY3A 4GZMA 3T5DA 4YXWD 1Q3TA 3UG6A 1KI1A 2PLRA 3KTAA 4P4SB 1AS0A 1WCV1 3THYB 1GNRA 1ZVQA 1U8AA 1KJWA 3B78A 2VSXA 1EWQA 1MO4A 3NH9A 4MITA 2KSQA 1OXXK 2OBMA 3QSYA 2JJ1A 2BOVA 3L2OB 4NKRA 1ZNYA 2IHYA 3A1TA 1L4YA 4GOXA 4CW7A 2WIAA 1GAJA 4CT4B 1Z0IA 1NVVR 3IPXA 4EKDA 4G5RA 3TE6A 1K8RA 1MO6A 1R7RA 1UEIA 1N6IA 3CX8A 2GDJA 2GJAA 5TMPA 2EU8A 2R62A 5FTLA 5B2ZA 4NU0A 4TT3A 2C9YA 2QM8A 4Y0AA 3TUJC 2WJIA 4B3BA 2R6AA 1YR8A 1OXSC 4JJZA 3X1ZA 4QHSA 2V6IA 1XTKA 1RC8A 3GJ3A 4V0OA 5DNYB 2ZS9A 2BCGY 2IC5A 3VAAA 3MWYW 1EFCA 1SKYE 4LWZA 4DCUA 3WMFA 1P7CA 1G3RA 4K46A 1IOZA 2ODBA 3TW4A 3CONA 3QIAA 2OFWA 1S9DA 2ZJ8A 3OFNA 3SYNA 3V00A 3UANA 1Z83A 5TXGA 3RC8A 2QTFA 1P9RA 3LQQA 4DIEA 5KOYA 4QHYA 2GBLA 1LY1A 1IAQA 1LW7A 1W0JD 5EZ6B 1J8YF 2JLQA 2WKPA 3ND8A 5L3RA 4B2LA 4QM7A 5J5CA 1XPUA 4HAVA 3VHLB 1E2QA 3K0CA 4MQBA 2AXNA 1F60A 5ANRB 3SZRA 2XXAB 3CF6R 5BW8A 3A1VA 1FTNA 4TL7A 1VYUA 1C9KA 1QHGA 1VHLA 3ZZ0A 2IS1A 1RJ9A 2CDNA 1E2MA 4M1SA 3IPYA 2NG1A 2X2EA 4MKIA 2V7QA 4JLAA 2PT5A 3QY0A 3VU9B 4MYUA 3B7GA 2W2TA 4CIDA 3IHWA 4D2IA 2OESA 2DPXA 4BFUA 4KODA 4LV6A 4DB2A 1US8A 1Z06A 1XRJA 2HCJB 3IEUA 2REXB 5JEEA 1QVAA 2N46A 5AUNB 2ZRIA 4LBZA 2NZ8A 2ZM5A 1L2TA 3OEHA 4FINA 3K9HA 5IHPA 1L4UA 2CLDX 3KXIA 4IVRA 5K8LA 2YZ2A 4F4CA 4NDZA 1DEKA 1WP9A 2V1XA 1QG4A 4FMDB 4G5GA 3K09A 1P61B 2FE4A 1HEIA 2DWOA 1D8TA 4HAZA 3FFBA 1P4SA 3KQHA 1PJRA 1VCOA 3EZ9A 2F9LA 3HR7A 1EESA 4X8LA 2XTZA 3RS2A 3EAQA 4IHQA 1OJLA 1G4AE 2WPDD 4B3DA 1U9IA 4G1UC 3TR5A 1WRBA 4OK3A 4OL0A 3EPJA 1E99A 4LHZA 5F2EA 2H16A 2FNAA 1KNQA 3B2EA 5KNCA 2AR7A 2BBOA 3K1JA 1T5LA 1XXHA 3WYAA 1YZUA 3CBQA 4OQFA 1QVRA 1E1RD 1E0SA 1OIWA 3A4NA 3O8RA 1SKYB 2OLKA 3QUSA 4C7OA 3RRYA 3WP1B 5J40A 3VR4A 3I61A 2WOJA 4C0JA 2DWQA 4TMWA 2EYQA 4KHZA 4K81B 1LS1A 4POAA 1Q12A 2IYWA 3R7WA 4E5UA 4B33A 5JSZB 1OKKD 2OLJA 5GJBA 3EPKA 4PAOA 3QKRB 1WBDA 4MDEA 4WXRA 1RFLA 4CEIA 2WWIA 4DHEA 3K9LA 1TU3A 3TAHA 1Z6XA 2ORVA 2ZI7A 4URYR 5F98A 2FDCA 2CNWA 2ZJ2A 3U7FB 1YZTA 2FPKA 3JZMA 2QROA 2HJVA 3RSLA 3T1TA 4MRPA 4YMUA 2O8CA 5HKKA 2R2AA 4Q47A 1W36B 4A8JB 3ECCA 3V4FA 1IBRA 1OPXA 5C46F 1CEEA 4TTQA 4MUBA 1XF9A 2KBFA 1G8HA 1I2MA 2Z4SA 1SHKA 4DDUA 2REOA 2W2XA 4AC9A 4AI6A 3ZD7A 3RWMB 2OE2A 4BFVA 4LYHA 5EXPA 4C0AC 2GXQA 1Z2CA 4NHOA 3U3OA 4BASA 1B0UA 2A78A 2QI9C 2ZRFA 3ADBA 2OM2A 5TDHA 1E94E 1M74A 1CULC 2PMKA 1H8HA 1E2HA 1NP6A 1VCIA 4QJ4A 1AK2A 3QKSA 1ANKA 3RWOA 521PA 4TMXA 2NMVA 1U0LA 1IONA 1KI6B 1IXZA 5DN6A 5KDDA 4RZ2A 3DEFA 3AVVA 4C3ZA 2IUTA 1R0YA 2ZROA 2ZSDA 2H17A 1MABB 3Q7QA 2QP4A 4JVMA 4DSUA 2ZIAA 2O52A 2IHBA 5KPJA 3RC3A 4RD2A 4X8MA 4OJKA 3H86A 4N0EA 4R71A 2XNDA 4Q4HA 2ZJOA 2CE7A 2ZVPX 4KSBA 2P67A 2ZJZA 2BBTA 5HTKA 1FUKA 2Q6TA 2VLIA 2B7CA 3GJ8A 3PVSA 4URWR 4AY2A 1F48A 2QRNA 4MYTA 3VR6A 5AUPB 4NZYA 4JZKA 2EFHB 2FSGA 4TMTA 4EJSB 1CJTC 3ZS9A 4BGDA 1NJGA 3CR8A 4A6XA 4AD8A 3MG9A 4DUGD 2ODNA 1R5OA 1BH2A 2G1KA 1RE0A 4JLNA 3QE0A 4CEJA 1CJKC 2G1JA 4NYJR 2FSHA 2QY9A 2V54A 4XD7D 1EK0A 4M8NE 4QRHA 2DFLA 3W3ZB 2OO7A 3M0EA 1ZW6A 2HCBA 1JR6A 2QAGB 1SXJE 1UF9A 3GEEA 3T34A 2OZEA 4D4JA 1CJUC 3BH0A 3SEAA 2PZFA 1MO5A 2FPMA 2ZS7A 3HP1A 4PPQA 5FL7D 2JASA 3GLFA 1KAOA 2ZUDA 3B13B 2D2EA 1TF2A 1KMHA 5HZHA 2YOHA 4LHVA 2F55A 1NBMA 2JEOA 1NLYA 2XZPA 1IXRC 1D5CA 3I73A 4OK6A 5FTJA 2CMKA 4DSOA 1WA5A 2QNRA 3W5IA 3AKEA 1N6PA 4LBWA 4RFVA 3RDPA 5B58C 4L9SA 5IK2A 2V3CC 3CRQA 4QGFA 2GCPA 2R6DA 3EWAA 3LRPA 2JJ1D 4JLKA 3DDCA 4WZAE 1F2TA 2VSOA 1H8EA 1AN0A 3HDTA 3P20A 4TLEA 2CHQA 2O5VA 3U7EB 1DAEA 2P3SA 3GJ6A 3PUWA 2NZJA 4C30A 4UNQA 1EFHA 3HU2A 3BC1A 4U5XA 5KSPA 2YC2C 4TT3D 2G9NA 5EE3A 3THWA 1LVGA 1VCMA 4BFWA 1ZC4A 1U99A 2XOKA 2B92A 3BD9A 3NEYA 3OF5A 4N1AA 2GJSA 1Z2AA 2FZLA 3MUFA 4DSTA 2ZRAA 4NH0A 4D4MA 1KTVA 4OI1A 4QGGA 5CDFA 1KI9A 3H2YA 4WZBE 4DB4A 3EG5A 1KO4A 4V0LA 5G3ZA 3FOZA 3EPHA 1FP7A 3WBJA 1GL6A 2I4IA 3P27A 3KUDA 4Q1CA 4OHWA 3RRNA 4JKIA 2ZRJA 2RGGA 4DDVA 2JLRA 3AF4A 3AP1A 3BH6A 2RGAA 3AGQA 3LA6A 1P75A 3FKSA 2ZSBA 3IO3A 4BLTA 1X3SA 4LJ4A 4M21A 3AKCA 2C96A 3DZ8A 5CK4A 2Q9AA 1Q1BA 5LPNA 4LHWA 1E0AA 1NI3A 2IYLD 2P6RA 4W7SA 1GNQA 2NO6A 2QGNA 1UM8A 3L8YA 1MV5A 4PAMA 5AJZA 1LTQA 3U3MA 3U3RA 3H0KA 4TSFD 2DYKA 1UADA 1JR3D 3EA5A 3Q85A 3GLIB 4TQUS 4AKGA 2V7QD 2QPTA 4ITRC 4OHYA 3W90A 3IILA 1GDDA 4ZIRB 4GP7A 3U6KA 5JSZA 3L0SA 4LV8B 1G6HA 3TKLA 3ZDQA 3HU1A 4ZDKA 1SXJB 4IOMA 2LKCA 2V55B 3KKQA 1E9BA 4Q19A 3WY9A 5BN3A 1CRQA 3MD0A 1RRGA 2VP5A 4KFTA 3AQ4A 4UJ5A 1AQUA 4K8OA 2KE5A 3LW7A 5JJKA 1Q20A 1ZU4A 3BFXA 1ZRHA 3OAAA 4DKXA 1DG1G 1NMXA 3N5CA 2ONJA 1CR0A 1A2BA 1CLUA 1M7GA 2A3RA 4OKSA 3R9XA 4JKYA 4ZV4A 3VKHA 1TF5A 1GUAA 1E2EA 3EIEA 2XTNA 4IEIA 5KSYA 4IJMA 3TGPA 3OEEA 1XEWY 2W0SA 4KFSA 1E2LA 2EFGA 1LF0A 2YJTD 3QEJA 2ODWA 5ELXA 1J7KA 2EFCB 2VP9A 1YZLA 2ZEJA 4OHZA 4B35A 4EAQA 4LV5B 1A82A 4NCIA 5G40A 3ZJYA 1FW6A 2QSZA 2BEJA 2RGNC 3ONWA 4LRWA 4Q1BA 1Z22A
chains in the Genus database with same CATH superfamily
1X7ZA 2O8BB 1IIRA 4Q66C 4QDKA 3TH5A 2P9CA 3WNZA 1X8KA 3VKGA 4I08A 4QYIB 1XJWA 2P6PA 2VO1A 4HNTA 3HHPA 4GI7A 2NTYC 1NSYA 1K9SA 1QF9A 3OOHA 3THSA 5ITWA 2I6SA 3KJNA 3NHPA 3I9NA 3BULA 2OFXA 2GT1A 2Z1NA 2ZS8A 4D9KA 1SZCA 3IEXA 1JQEA 3INTA 4JB0A 3NKVA 3FPAA 4P58A 1K7SN 1NJ5A 4QPJC 2P0EA 5EP4A 3OZAA 1N0IA 5ER9A 1N2IA 1QGZA 4C1BA 4EPVA 5IXYA 5JRZA 4ER0A 5HHTA 2H85A 5F2NA 4IJWA 3H9QA 3N28A 1XU4A 3IUSA 5T8KA 4RTRA 3KTAB 3VR1A 3LVFO 2VK4A 4N6NA 1T3GA 4QGHA 3SVZA 4MMXB 4E03A 2NYRA 5IUJC 4DV7B 3ZHUA 3OZXA 4I66A 2P6UA 3M81A 1XTQA 4MAAA 1UOPA 3TRFA 5K0FA 2RGUA 3PPXA 5FTNA 4FCWA 3TCNA 3WHKA 3CZMA 2XB8A 5JI3E 4N3AA 3U44B 1P73A 1Z16A 3C8DA 2H08A 4GE3A 2REBA 3QXSA 1HDZA 3GRAA 4YV2A 3LWNA 4AUEA 5FPSA 4E5KA 5JTUA 4DV2B 3KHKA 1JXOA 3NNNA 1H1LA 1E77A 5GPBA 1LI4A 2JKYA 2I66A 4ARZA 1AK9A 1XXHE 3ORRA 2WTAA 4G8BA 2NSDA 2PVCA 3KQYA 4X3CA 3RWBA 2FWMX 3LUKA 4LC9A 3LKVA 1XRPA 3M7IA 4OL9A 3AHJA 1YQTA 1EJ6A 4QBGB 4R9VA 3T3OA 2EBFX 1KAMA 1JWBB 4HJXA 4IXTA 4WOKA 2OPHA 3DOJA 2AI1A 3AJ8A 3V55A 3IIEA 1J5XA 3WGVA 5BRAA 4BEBA 1NPTO 1WDWB 3I8XA 3QELA 5JEDA 2AFIE 4NAUA 2VWQA 3OE7A 2Z83A 2WG2A 1SKMA 4MS3B 3H6HA 2FSUA 1PL7A 4RF5A 2KX7A 1QRAA 2OOSA 3QW4B 5T4BA 1XAGA 3UXHA 4KMSA 1O94C 1R37A 3OCJA 3DGFC 1QGDA 4IIUA 4WCFC 3WWYA 4F3NA 2GDZA 1MW8X 1Z5UA 4C3UA 3T3EA 1T4CA 5A3VA 3LYHA 1J09A 2C2XA 2CKDA 1M6WA 1NKTA 4FONA 4P33A 4KO1S 4E5DA 2BGKA 3HN7A 2HPAA 1D1TA 2ZTSA 3IP8A 4H0NA 2ERCA 2FEAA 1PZHA 4Y6RA 1MFZA 2UYHA 3QH4A 5CH3A 4A6DA 4ALLA 1GTZA 3AT1A 1QQ6A 3CHYA 3P4YA 4Q1FA 5U9CA 5DM70 1BGVA 3LYLA 2YNMA 3OJCA 5JY6A 3ND5A 2BV3A 2NZVG 4CM7A 3U1BA 1SPXA 4FWTA 1SQ6A 2V58A 3IGFA 2XUPA 5LMZA 2JLXA 1IH8A 2IY7A 4QAQA 4DA6A 2WIKA 5H8WA 3DE0X 2H4XA 3QPUA 3ABIA 1DU4A 1LSOA 2ZU6A 2W6NA 3NHRA 2PGOA 3QWFA 2IPAB 5CFLA 2D5IA 5JD6A 3KZOA 2H7CA 2X41A 5L51A 4FU0A 2IJGX 2IZ7A 1YVRA 4G1FA 4Y2SA 1ESEA 3HGMA 2ZIWB 5LUAA 1C7JA 1Z36A 2BLNA 3U3JA 2P40A 1ZNZA 4INAA 4RY0A 3AF2A 4WBXC 4MQFB 3U26A 4DJAA 1H69A 2QRGA 3U13A 1M34E 2VJOA 4AMZA 3BTSA 3IURA 4LC1A 1DBQA 2EGGA 3L1VA 4NEHB 3SOZA 4M89A 5AW0A 5IYZF 1TJ4A 2HHCA 1KSHA 4NYIQ 4URUR 3IYLW 3MVEA 2LIVA 3PUYA 5FTKA 2PKCA 1EDOA 2WLSA 4PLTA 2Y9PB 2UDPA 2I2FA 1R74A 3E9YA 3T1VA 3U1VA 2PUEA 3DCJA 1TZBA 2Q6LA 2GFQA 3BWYA 2G0TA 4NCKA 3QEMA 4BOYA 4EYOA 4ZI7B 4ENSA 1SD5A 1FP6A 1MRNA 5DTIA 3AR6A 4J3NA 5AVYA 4LMAA 3UV3A 4Z3OA 3ZWCA 5JI2E 3TCKA 5I4KA 3QYJA 1JFVA 2IK8A 3R1IA 3K0FA 5EE9A 1NUAA 1MAUA 3U4HA 4TSRA 1RLMA 3BRSA 1BQ3A 1GKYA 1Z08A 2O3TA 2JJMA 2ZBGA 2XUQA 3H75A 4RY9A 3WG9A 5IK2D 1YFLA 2TYSB 3K1YA 4UC0A 3IEVA 2EIXA 1E3DA 3ZY6A 4O4LB 3OCWA 4I4TA 3IB6A 1KIAA 1MJNA 3O90A 4UNSA 3PKZA 1UAYA 9GPBA 2XWSA 3P5BA 2YRFA 4FI3C 3CKLA 4NOJA 2CL7X 2Y0DA 4FUTA 3T4UA 2C58A 1JEAA 3M70A 4TV8F 2IPOA 5LOVA 4JR1A 3PC7A 1A71A 3U7HB 1R10A 1FF9A 5AVQA 5H1YA 3R7WB 4E6PA 3PFCA 2WEKA 1TC1A 1V5IA 2PLWA 3C8MA 4NZZA 4X7MA 4PC3A 3B38A 3RTGA 1ZI8A 4Y2GA 1PS8A 4L3OA 1QX3A 4RXTA 4JXKA 4WXEA 4JC8A 5I8ZA 4KAAA 1EFRD 2L17A 2QORA 3H99A 4UBOA 3ZWBA 2Q5LA 2IU6A 4Q7EA 2F48A 1K66A 4G1EB 4CV3A 2A8YA 1SNYA 2PWPA 3GJRA 4ROTA 2JLYA 4FHDA 4RA9B 2YRXA 1LTKA 1CS4C 2R9VA 3N6XA 5EJ2A 4DRXB 2O23A 2BONA 1NL3A 1WOYA 3AUSA 4G3XA 1NZFA 3TZ6A 4EY5A 2QUAA 5JNVA 2ZQZA 4QU8A 1ZD9A 1CUEA 1I3KA 3M3HA 2JA1A 3O0TA 1MW9X 2QSJA 2VKQA 1WW3A 5DM2A 1Y1RA 2WAXA 2XSZA 3O74A 2C0CA 5MHTA 2CVOA 4JOCA 3MJ4A 5G02A 2F1JA 5CXQA 1CQJA 4C3VA 1T9HA 1YBMA 5IAEA 1SXJC 3BMOB 5BWBA 4LOAA 4KE8A 3OHPA 3AZOA 1TECE 2PA0A 2WT8A 2Z8YA 1QZUA 2MIIA 1Z5VA 1CP2A 3HJUA 1OIXA 5BNTA 2CLOB 3ABQB 1I9CA 1FTSA 5FORA 1BX3A 2YH2A 1IWPB 4OQXA 3VPHA 5K3EA 3L0YA 4BFLA 1ADBA 5JZVA 2RI1A 4Q3EA 4D43A 1PN3A 3HPRA 1QKJA 3WRYC 2BVNA 1ONOA 3U40A 3PCXA 3PDJA 1P2FA 3QKSB 5D5HA 4OD0A 5HE8A 4X6XA 5ALFA 3HCFA 5LJLA 1BC5A 4EKIA 5K8UA 1DOAA 4YGXB 4BVLA 5KVAA 1P4GA 2OORA 3B8EA 5EUBA 3AEKB 1FFCA 2XT6A 5F1YA 3MWDB 5EMKA 3PICA 1P4RA 1YVDA 4WADA 2CBXA 1KEKA 1C50A 4HX2A 3KKEA 4L15A 4HGOA 4I1VA 4YRIA 2P1ZA 2O8FA 3LM8A 1FDTA 4Q4HB 1N7JA 2Z30A 3NWEA 5HYVA 4MGIR 4E4RA 1JL3A 1KZYC 1Q3HA 1RDFA 1ZA1A 3L04A 3LPDA 3O47A 1E5QA 3N0TA 1ZH8A 3WTBA 2AQIA 5KSOA 4AJ2A 4JP1A 5KJCA 3BQNB 1E3IA 1N75A 3ITNA 5DKFA 3EUWA 2J08A 4Y98A 5I8PA 1ML3A 2O7QA 3I4FA 1SQ5A 5DSTA 1IFXA 4NECA 2Y27A 1VMKA 4PM4A 4B6PA 4RV4A 4S3MA 3RVQA 4XVUA 1T1JA 2LCFA 4YH1A 3IB3A 5BURA 3VO9A 4RTJA 3WKCA 2ICAA 3DFKA 4V1CI 4BLRA 2QN6A 2HADA 2J41A 3AB8A 2VAVA 3EF3A 4EDFA 4MDYA 1KQOA 3I58A 5CM8B 4F5DA 2RH9B 4YASA 4DVGA 2BFBA 4MZDA 1E63A 2X0NA 4F11A 2IH4A 1EYZA 3ASVA 3QMVA 2VHUA 1Q57A 3PFIA 1F4VA 2MYUA 3TNDA 1DDGA 3LBIA 3ZDRA 1GZ7A 1JEEA 1WPQA 3JQAD 3DPSA 3S99A 1Y9EA 4QUKA 2PMDA 1IEVA 4MV5A 1Y5LA 2ZYSA 2XZDA 4QNMA 1Q1GA 5CYFA 2ZIZA 3TM4A 1QFZA 3EGWA 3DTNA 4KQ1A 4DLRA 4WESB 2YYAA 2NU8B 4XWTA 1HTWA 4HWGA 3CH6A 3D6AA 3IAM1 1ZGCA 1SUFA 4UUPA 4LWOA 2CL0X 2FPPB 3FB4A 3WB2A 2PKWA 1UEXC 2VPIA 1WBBA 5H3CA 3IAHA 1CEYA 1KK1A 4REOA 4DMKA 4BGEA 3T5GA 2FSIA 1O58A 5C8YF 4Y6PA 2DLNA 3KD3A 2CJWA 1OLUB 4WOPA 1D09A 2VNKA 2HRQA 1EMDA 2X7XA 3GU3A 3DUFB 3I05A 2JBAA 4QPNA 5SYMA 3OX4A 5LBUA 1W6RA 1KP9A 4DSAA 4KR7A 4N0MA 3DL4A 2GA8A 2D59A 1X70A 2PL1A 3L43A 4TXNA 1E6LA 5L45A 1DX6A 3DYBA 3K9GA 2BI4A 2Q5CA 2QU8A 3CSSA 5K4AA 1DARA 2OQ2A 3IKLA 3G5MA 3QE4A 3VVLA 3P9PA 1FEZA 2PLNA 4Q3BA 1L7OA 3CF4G 2CNLA 5TT0A 5ADWA 4C2UA 3B51X 5IARA 2COKA 1EUDA 2JGIA 2OBXA 2KQUA 1UPXA 5E1OA 5ESXA 5I47A 3PX7A 3KVRA 4EO7A 1XRSB 2GD2A 4CVNA 2GJKA 3ROEA 4MVYA 1VRCA 1JMYA 5IAGA 4V0RA 4BV9A 4CN9A 2A5DA 3WGMA 3I34X 4GKBA 1H2WA 3ZOZA 2P27A 2ATVA 2WJYA 5BN4B 3VUFA 4TS9A 2QP9X 1CR6A 3KDSE 2JIPA 3PGVA 4IVQA 3QMMA 3TZEA 4PINA 4ZT4A 3O6VA 2VC2B 5C53B 2QDKA 1I0ZA 4U00A 1TXGA 3SK0A 4CQLA 2WWYA 3DE7X 2JHAA 1B7GO 1Y89A 2AFHE 2W22A 3MS4A 4W63A 2JIDA 5G2OA 3EVNA 3V8BA 1JDTA 2PSHA 3GFVA 1A9YA 2IUYA 5JHHB 2ZT6A 4JJKA 2VTBB 2UV8A 2NO0A 1TUBA 3LFUA 4X8OA 5JBIA 5F7OA 2C2WA 3OE5A 2JAPA 2JFOA 4KRFA 4RIGA 5LZ7A 4BN0A 4GVLA 4L0CA 4P7GA 2CDBA 1VE9A 1G9SA 3Q3EA 4E22A 4BNUA 2B6HA 1YMUA 1WABA 1E96A 2AMJA 5LWQA 1V4BA 4OHKA 1YZGA 2RHBA 5LD2B 3DE5X 4K28A 3L8DA 3CFYA 3FI9A 5IU6A 1PGJA 4XGIA 3KKKA 4ZTZB 1ZMRA 4KQIA 1BTOA 3W4JA 2O5RA 1U5CA 4J0QA 2BFNA 4IG9A 3RW9A 4AM8A 3CX4A 4IIJA 1RPZA 5C52B 3NVDA 2X5KO 1DADA 2VXBA 4Z3KA 1TTHA 4G86A 3DMTA 5D1NA 2OV4A 4CM9D 5LIPA 4M7RA 1R64A 3U3DA 3UMYA 2EBWA 1UJCA 2HMSA 2WTBA 4DC0A 3DZCA 5CAEB 1WXDA 3SDBA 4DABA 3NAGA 1T5IA 4O29A 4W1SA 1A9SA 2QG6A 1FDOA 1NFQA 2IEZA 3L0BA 3NKLA 3SAJA 4DJFC 3E4DA 3D8UA 5J47A 2IBTA 421PA 1DJQA 1P0PA 3MINA 5TY0A 3MJSA 4B3GA 1QYVA 3OQ1A 1N6KA 2Q2NA 2ZJYA 3ISVA 4PG5A 4DJTA 1HEUA 1MNAA 3NBZC 4P7KA 3RAPR 3IBGA 1N6OA 3QRWA 1ZUD1 4JBWA 2SCUB 5CA0B 1DAMA 2YASA 3ACDA 2VPTA 3HYCA 1L7AA 2PH1A 4UEQA 4BO1A 4CCYB 4WA7A 2HU2A 3UOGA 1U8EA 5DHRA 1QBKC 5C8XA 1AA9A 4JLSA 4IEFB 4MRAA 2QW8A 3H65A 1CDDA 1HOXA 1S2OA 4MVJH 4OK5A 4B7UA 3C6QA 5IT0A 3HO6A 5EWLB 4HAYA 3VBCA 3N53A 3RHTA 5REQA 2FWJA 2GWHA 2ZULA 1F2UB 1HRDA 4M86A 1P80A 1WHTB 5HCIA 2IZ6A 3SNKA 3T9DA 5CIQA 2IGBA 4AAYA 1T6ZA 1SN7A 4COKA 1S1CA 4TYPA 1IM8A 3COVA 2H8GA 1OB2A 3FPJA 3CNEA 2C83A 2P2LA 3K6JA 1M2JA 1YA6A 4MUIA 1P74A 4K9PA 1VZ2A 2B99A 3NO4A 5B64A 1V45E 3L6EA 4C22A 1W5SA 4L8WB 4S1NA 4EGSA 3WIUA 2RGBA 2AMLA 2AR9A 2HV8A 4QLAA 5KYUB 1M2WA 2WY2D 5J4HA 4X5OA 3GRZA 1V16A 2IYRA 1P7WA 4BMVA 1FYWA 1LPAB 3JQ8A 2FR8C 1TZKA 4BNGA 3H4VA 2FOXA 4B0PA 2D1RA 4C0QC 1GTRA 1Y5IA 1KPHA 1E1QA 3STXA 1HLGA 5BV1A 2J3JA 3I8SA 1XALA 3KHSA 2WVAA 2X7JA 5FBLB 3JD4A 5CGZA 2I03A 4YUYA 3UCXA 2XUFA 3SHFA 4RFLA 4U2FA 1HXHA 4BUJA 4RX1A 1RXSA 2WW8A 2P5SA 3EIWA 1YUBA 2HMYB 3MMPA 1KEWA 3OE4A 3IAEA 1LF5A 3MOIA 4MW1A 4NMXB 5I9MA 1TIPA 1W34A 2G17A 2V4MA 5FRDA 4BO6A 3WGKA 2CZQA 2JKZA 5CLFA 1VZ3A 4QODA 4YNBA 3L1KA 1E2GA 3JVEA 1GRCA 1YVEI 4LXTA 5CHEA 4C0HA 4PO9A 2BBSA 4LYDA 1EK1A 3EA4A 4DCNA 2H54A 3F0TA 2MSKA 4TRNA 5LYJA 2AJLI 4DR2B 4EHHA 3ZI7A 2PS3A 3B20A 2HY7A 2XVYA 1ECGA 2Z8XA 4MUYA 5EXTA 5ITSA 3PWKA 4QATA 4NLLA 5K8TA 3PDHA 2QLFA 1TL7C 3OMWA 5FUVA 4XB1A 3OQVA 2ZYAA 1Z13A 3GUZA 4ZOLB 2IUSA 3QKTA 5BQFA 2FX5A 3SDSA 3JAMA 1V6AA 3BGVA 1JHQA 3W8DA 5EKSA 1MH1A 2O3RA 3DVAA 1XD9A 4C7VA 4UKDA 5KHOC 2HH9A 3GELA 1SVKA 2GAAA 4TKMA 5FUMA 3SF0A 3VDMA 5CX1A 5KWVA 4UM8B 2PUAA 1QBGA 1T10A 4PS0A 4PU0A 3BWXA 2H1SA 3NYIA 4DIBA 5KMGA 5FNZA 4W5WA 3ETHA 1MO3A 2EQBA 2FX3A 3K0AA 3P9ZA 1RJDA 4C4SA 2O8DA 1DKOA 1SZPA 5FF9A 2FY8A 3B1KA 3IUJA 3WYNA 3C3DA 3TIFA 1YQWA 4LF6B 3CINA 1LLFA 3N2KA 1EGMB 1LI5A 5B3AA 3FSGA 4IHJB 3AUYA 2ZBEA 1YHNA 1VLJA 2TRSB 4M0LA 5D6NA 3QFFA 5CLJA 3QXXA 4NFYA 1ZFNA 1RBYA 2ZYUX 3BH7A 5TEVA 3D7SA 3T1QA 5DM0A 3GLHB 4P92A 1T3HA 2QBYB 1XMPA 3AESB 4YRZA 5E4JA 2JHFA 2PWZA 5GJCA 1PZFA 4ANFA 5CFMA 4EH1A 1F7VA 3TRIA 4EJ2A 4L85A 2WM8A 3PA8A 3KQSA 2OFFA 2Z6VA 4C0LA 4M9QA 4GYKA 4BMXA 4J03A 1D5WA 2W0MA 3AVYA 2IE0A 3PFGA 3V1TC 4YV0A 1RZRA 2XQVA 5DW3A 4RVSA 2QVXX 2QVBA 5BVHB 3BD8A 3C3PA 2ACEA 4ZTBA 4UCWA 5AIAA 5HE9A 4II2A 1D9ZA 1QG6A 4B4UA 1V11A 5JUWA 4XCQA 1U0JA 1H85A 1W47A 4B84A 5GWXA 2Q6VA 5L7WA 2IDJA 2PXHA 1JFTA 3UIEA 4J76A 5P21A 4FDVA 2R00C 3PHIA 4L5YA 5HTOA 1OYWA 2I29A 2O3SA 1WOMA 4IV8A 4LI0A 3RG2A 3RU9A 4ZQBA 3OH8A 3RKSA 1ZI9A 5K4HA 4YS6A 3TKAA 2MINB 5JASA 4MUMA 1LWNA 3VC7A 2QT0A 2MYTA 1UFVA 4N7BA 2H4FA 3KCNA 1MJHA 1P1KA 1IN1A 2AN1A 5JCPA 2A14A 4M0PA 4OBBA 3OQ6A 4RH0A 4YMIA 3C3CA 5LA6F 2II6A 1HDXA 1UAGA 2VUSA 4Q9LA 4E46A 2AW3A 1JJVA 1ZJYA 3RIEA 1A1VA 3VJRA 1PZXA 1ULZA 5KJ6A 4NFHA 1L5WA 4DLYA 1DQRA 5B30A 3K20A 1GP2A 3OP4A 4E07A 1Z0ZA 5TC4A 3GCZA 1JIQA 4HUQB 4Q4JB 2X8JA 2FRVA 5E3IA 3A3KA 3ROXA 3ESYA 1BDBA 3CF0A 3V8EA 4DLLA 1OIVA 3QVSA 3WYBA 2XDQB 4OB7A 5TV2A 2JJYA 3DG9A 2F8LA 3JVDA 3RTDA 3F97A 3G2OA 3NU1A 2VCYA 1LC0A 5BT8A 1XD8A 1NLFA 2W90A 2OV6A 2NU7B 1SZJG 4TWIA 1ZJ5A 4YXWA 4FBMA 5JJCA 3BMQB 4RCYA 1OAOA 4D0GA 3SYKA 1LVUA 1H1TA 3QW2A 3F6CA 2Q99A 3A3PA 1THTA 2WWGA 4ZDIA 1A77A 1I3OA 3CU5A 1XUOA 4MYDA 1XHFA 3TX2A 4YCSA 1NJSA 1XQXA 5DI3A 4RD3A 3KX2A 5K6TA 1VLZA 2Y1DA 1AQIA 3K70B 4N5IX 1WEKA 3P96A 1S9HA 5CLIA 4B83A 4EFNA 3FWYA 4N12A 4ZJUA 5DK4A 5EZYB 1NXSA 2H1LA 1SVOA 1OASA 3BXGA 2YFKA 1JS1X 3OM9A 3ZY3A 1FX0B 1B73A 1FFDA 5E8RA 4MEBA 3W77A 1O4VA 5BV2P 5LD2C 4PFSA 1A1SA 4XYMA 1SVLA 4II3A 2YZKA 1RIIA 3OZEA 5HF9A 3UV7A 1M2HA 2ZJ6A 1B0PA 3ZDFA 5DM60 3GNLA 3RU7A 4H6XA 4BFSA 5ILOA 1ZM4A 4GMGA 2GNOA 4Q1EA 4MJLA 2H2AA 3BWBA 1Y1SA 3FTCA 3QEOA 2E9SA 2H7VA 4FE4A 5IG2A 4X6YA 5T4FA 3DTYA 4OP1A 2ZGVA 4LE1A 3V42A 3TW6A 5C34B 2DJ5A 2O7VA 4RFSA 2FK8A 4U3JB 1Z6ZA 1PR1A 1KJJA 1LQTA 3QWAA 2X3YA 2PRJA 1P81A 1CZRA 1UPTA 3A3OA 2R8XA 5EIXA 2I3GA 2O2IA 1RVV1 1XMJA 4JT8A 4JYZA 2ZE5A 3DM5A 4QULA 5K0LA 3VISA 4GZLA 3PUJA 1R0WA 4FQ8A 2PZJA 4PYLA 5JDCC 2ANCA 1KE2A 2C94A 5E7MA 2CEKA 4DCVA 4YAUA 1YUMA 3BSSA 4UE3S 4JUBA 2O2SA 4WX2B 3SOPA 3G0BA 3MCAA 4FZ3A 3CEHA 1YTLA 5AJVB 1SBCA 1ZRSA 2GKOA 4PRZA 5EWJA 4RWEA 2Q1XA 4I36A 3OTOB 1GQYA 1W1WA 4NJEB 3D8TA 4CLXA 3ZI4A 4RZIA 4NE2A 2OHJA 2XPCA 5EY5B 2Y6UA 3OIYA 2IY9A 1UDWA 3KOOA 3PRYA 1VI2A 2H00A 4LJ5A 4MVJE 1E9AA 4Y7DA 2RCYA 2WMOB 4O2BF 2QG9A 3E9ZA 3FPBA 3LO8A 4F4HA 1XTRA 2H57A 3PHJA 4E09A 3GI1A 3SC2A 2HNBA 3M9LA 1B6TA 1YASA 1BSVA 1PSZA 3TN7A 2IYZA 2VPZA 1A2KC 2XWBF 5G0TA 1S2LA 3I39X 2W48A 5BSVA 1X6VA 2QD3A 3BAZA 1NXOA 4X1IB 4CQJA 2CBZA 3JR3A 5KYGA 4D9NA 3O2QB 4RGQA 1DEXA 5K01A 5LMCA 4QXQA 3ZHOA 5H4GA 5BV7A 2BRUC 3NTUA 3AFGA 2L18A 4FFMA 4KR6A 4RK5A 5SZKB 4UZEA 2H65A 3LHDA 4KU4A 3WFZA 5KCZA 5TS2A 4O1IA 2CNKA 3NTVA 3UJ9A 1SHJA 2Q41A 3UAOA 1G19A 2GEJA 2ON6A 2EEPA 3O4VA 4MVJG 4EJSC 3M8KA 3QLUA 3ZQKA 4Q0MA 3SM3A 1APBA 3VSCA 1QZ3A 2GSWA 3CPSA 4PCAA 3EY9A 4OFBA 3FHOA 1O8BA 3U9LA 3KSUA 4AKHA 3M4NA 1G42A 3JATB 4G0NA 2CXSA 5LN1A 1XP8A 1ZH4A 4UQOA 1DEOA 1H65A 4NBTA 3GL9A 1VE5A 1S8NA 3TO5A 2OGTA 3E1GA 3VNRA 4R0NA 3ED1A 1QIFA 2XNDD 2PMEA 4JP8A 4PRKA 4D81A 2TMKA 3G23A 2VA9A 3ZVMA 3IR7A 2VSYA 3R5FA 4L5CA 4UTOA 3RVKA 4BV3A 5KYNA 2Y92A 4M83A 1UUFA 5FBHA 5ALEA 5H83A 3DHVA 1O08A 3SZOA 2R6GA 3W8FA 3V6MA 1KDYA 1H2FA 2R66A 1PTJC 1UEJA 4HADA 1Q17A 1XK6A 1YI1A 2DBZA 2H06A 1WTAA 4HMPA 5LB4A 3LECA 4XIIA 1FY2A 3LCMA 1UM9A 3LUBA 1ADCA 2WZCA 3LLUA 4JQCA 4NMMA 4XIFA 2Y1OA 2ZW9A 4GBMA 4R2LA 3TS1A 3CUYA 1XD2B 1HT2E 4HY3A 1BXZA 4Y9UA 4YQYA 5EQDA 4BNYA 4CODB 1QRSA 3KSRA 1SJ9A 3B3JA 3LGAA 4O8CA 5JSYA 4D3FA 1RQ7A 2X7HA 1HEYA 4LXYA 1EAYA 3AWDA 2Y1WA 5DWVA 2MMCA 1AO3A 3VMFA 1DBVO 4IJUA 4U5QA 4S12A 1N6LA 4S04A 1C30B 1Z0FA 1N9KA 1WMFA 3OT1A 5LZ5A 3ZWVA 4ECEA 3NKFA 4CLHA 5KQRA 1NBMD 4IVNA 2AWNA 4DRYA 1W9HA 1A7JA 4EYEA 2AOVA 3GJ0A 3Q3JB 4RGVA 2PRZA 2PO5A 3LCUA 3QX3A 1JTFA 3EGEA 5IH3A 5DFAA 3W6UA 4ZYYA 1U9JA 4RJIA 3RAFC 1MIOB 4FFOA 1M75A 2QQ5A 3C3MA 3ZZ1A 2P90A 4AULA 2OXCA 1L1RA 2PBZA 1Y4UA 3NGLA 2IHZA 2YQ4A 4KH1A 1XOIA 2PSJA 1RLTA 3FNGA 3I32A 4XRRA 3F4BA 1KQNA 2JD1A 1LDMA 4M46A 2PO7A 5EHZA 2J3KA 1NP3A 1VKJA 3EXIA 4MJ7A 3S55A 4RDHA 1DQPA 4ED9A 4W5QA 2A88A 2CD9A 3IQZA 3CE9A 1QH8A 2QRJA 4GC5A 3VDNB 3DB1A 2J6IA 3HWSA 4OCZA 4DGQA 4IMJB 4KNYA 4M0EA 3PNVA 1CF9A 3CUTA 3LLCA 2P11A 3ILSA 4JOSA 1K89A 2OXEA 3DMFA 2BM9A 3EIXA 2W8BB 4IIFA 2OHXA 3DZIA 4KTVE 2ZRLA 3OCCA 3CS3A 3DVLA 4D4LA 2XVXA 4NCBA 5IABA 3ANLA 3OTQA 1ULSA 1Q2XA 1Z17A 5F4BA 4FVTA 2R0QC 1F12A 3N8GA 5J58A 5D87A 1ZK2A 4PE5B 3L8GA 1IJKA 2J0EA 2OZPA 4TZTA 1ZIXA 3D6NB 3EE6A 3FA2A 1JU4A 4M9XA 4KZKA 3KSBC 1VG8A 4MWZA 2WSMA 1VFNA 4XDYA 1JJBA 3HWWA 1DKNA 2Q4BA 3I9KA 4LX8A 7REQB 2C5AA 5MFZA 1JWLA 2IXAA 5BR7A 1W4CA 4ZYXA 2F1OA 2GEBA 1PJQA 3E3NA 2QX6A 4MWCA 4Y30A 5AK6A 3WHPA 4D9EA 1K4MA 2IYQA 4URXR 2W93A 1KJIA 4NEGA 1FNMA 2ZBRA 4IDOA 1ISPA 4W7IA 1P1IA 5D86A 1K8XB 4LZWA 2I65A 3NC4A 4GGOA 1YAJA 4XLZA 2C9BA 2ZPUA 3UAVA 1UDCA 4W5NA 2ZJAA 4QC2A 5AO9A 4EBBA 4LRYA 5FHQA 3WLHA 5K8IA 4MMYB 3W9UA 3K5IA 4U7HA 4JC0A 4QG7A 3U2QA 3HZZA 1W581 2Q21A 3H9JA 4GPZA 3QWBA 3UGJA 3F71A 3H3XA 2CB9A 1KFEB 1T5HX 2H2WA 4QFDA 3L0PA 4XD7A 1PCXA 2A9JA 2UZ0A 3NXKA 1O2DA 4R1UA 4AKIA 3VUEA 4OM8A 1QGUB 3PC4A 4WCVA 3K70C 4IS3A 1A4XA 3BWDD 1DC5A 2C3PA 4Y2TA 1K6IA 2YHAA 1ZU5A 2OY0A 4WFKA 4QPDA 4AWAA 5EPEA 3VR5A 5A3QA 3FDZB 3RUAA 1D1PA 1G8JA 4YMVA 2A59A 1T36B 2LNDA 5CLQA 5KJ1A 3N75A 4F7WA 1LV7A 2R5FA 3BUSA 2RHOA 4G9GA 2XA2A 3M89A 3NW9A 3DE1X 4OKIA 4Y2QA 5FUQA 2DT5A 3P9QA 2B5WA 4AMGA 4PZUA 1I6LA 2FPUA 4HB0A 2XF2A 1WZNA 1AX9A 1U8FO 2A7QA 1NJFA 1ICIA 3BZWA 4QGAA 1UT6A 3G2IA 4IEEA 5IJ0A 5LQRA 4JAVC 2G6TA 2QQEA 1F6BA 2PQ6A 3GP8A 1VHQA 2IQIA 4X00A 1NVUQ 4BFZA 1XLTC 3I01M 2FFBA 2CGEA 2WHEA 4KE7A 4GD3Q 2UZAA 3NVAA 4J7AA 4U7DA 1S3IA 1WEHA 3ZJ4A 1NG1A 2ZJ4A 3N8IA 1KQ3A 2AV6A 2X5OA 1QC5A 2GJ9A 3BF7A 2CSXA 2ALJA 1FSZA 2P9BA 3DHYA 1FDSA 1TADA 3I6IA 4M8KA 2WNHA 1TM2A 4L51A 4M55A 3UKDA 1PLJA 1KA9H 3SXJA 2PKYX 5HIAA 4OJQA 4ZDJA 2GZ2A 1FBTA 2IY8A 2X0IA 1MP0A 4BZXA 5COQA 5EZSA 4ENQA 3TMYA 2XMQA 4LJYA 1PEAA 4FW9A 4I4TF 4EO9A 3G9UA 5DI9A 2VAMA 3MFQA 4F7DA 5HKBA 3HQ4O 5C5EA 4HDKB 4EDHA 5T6MA 4DR4B 3HCRA 1UOQA 2I6XA 1A8IA 5LOVF 3STVA 2GI4A 4D5EA 4HYYA 4QHTA 4CGZA 3KUCA 2B1JA 4HLCA 4GI1A 2HPHA 4YP1A 1KDRA 3E9RA 3FWPA 2C1ZA 2PGXA 4JHLA 4D4IA 2YQZA 2VP3A 1X92A 3H8JA 3KJEA 1B0AA 2CDAA 3IV7A 1NQ5A 1SPBS 1N34B 1KARA 1QDEA 2OBBA 3FPHA 3LPMA 1XEAA 2PUJA 3A6KA 2CV0A 1TGVA 4JBYA 4U2KA 3REOA 1JHXA 3BCRA 2PDAA 4Z0TA 4QQ8A 5GAJA 5BV0A 1WZEA 3L7YA 4W9NC 2A1IA 1JDBC 3VJKA 2GBLC 1DIAA 4DN6A 4D4HA 5KYVA 2QVZX 5JPIA 4BVAA 4P5EA 5EMLA 3RFUA 1JJ7A 4RZXA 2PX5A 1X2BA 4J7XA 1Z2PX 3KZ1E 4DV5B 1Y8RA 2WUFA 3COPA 4YHBA 3HEMA 3L49A 1BROA 4C08A 1V4VA 3T5AA 1E0JA 3AL2A 4CR8A 1KERA 1ODKA 3QNMA 2HK9A 2GEFA 2Q4DA 2WILA 3SSOA 1FU4A 2CHGA 3G9XA 3AR3A 2YVAA 2BTQB 4FWIB 3PJDA 4BNXA 1TQ6A 1WXIA 3B6EA 4YJHA 5BXQC 4KGXA 4MV6A 1J1ZA 3ZCTA 2FA9A 3SBEA 3RD5A 1NQOA 3O7WA 4MW5A 4XAQA 1MRSA 5CX1B 3QIVA 2N9UA 3IKJA 1PX2A 1XK7A 3P7MA 1TW2A 1OE0A 2JCYA 3F7OA 1TVKB 4JGBA 3BJIC 2WF6A 1NNSA 3KZKA 3C3EA 4EY3A 2RHJA 3TLZA 3RJZA 4XA8A 3TL2A 2G88A 2BWJA 3EOBI 3TYXA 2JCSA 3VTFA 1Z0SA 3R0VA 2PRKA 1DAFA 1GSAA 2R3SA 1C1HA 1WMEA 1GVHA 1QHHB 2IT1A 3G6WA 1YNSA 2M1ZA 3LJKA 5DT2A 3SLGA 2YNMD 5AM1A 3MAGA 2HT6A 1JLSA 2BMEA 2K2QB 3M4YA 2C95A 2NM0A 1JIUA 3D43A 1WMBA 3FLMA 4BNKA 1W25A 3HRIA 4PC7A 1A4RA 4E08A 2F4VB 2OP0A 1NLUA 4AF7A 1T26A 4B44A 1OFTA 4C43A 1SU6A 2TSYB 1YS9A 1I1HA 3A6DA 4HNGA 2NPOA 3LDAA 4EB6B 2PKEA 1B43A 4DLWA 4DDKA 1ACLA 4JKOA 2CLIB 3NPMA 4P2GA 1G5IA 4TL6A 5E9JA 1DAPA 3L1UA 2BFDB 1IRIA 1NW8A 4C5CA 4MKXA 4D98A 3L8ZA 4ZJYA 4OI4A 1GD1O 4CL0A 8OHMA 5ICCA 3ZNNA 4OGGA 1LJ8A 2OILA 2WM9B 3OLWA 4DV6B 3HKCB 4J0HA 4JYCA 2D4HA 2FUG1 3VHXA 5C7OO 2PT7A 2RHCA 3LVBA 1QJ4A 4R54A 3RS3A 2FRXA 3SU8A 1T1RA 1SWVA 2AOUA 3FYTA 3FMFA 4MV7A 5EN4A 5FJIA 1U5BB 4HDOB 4IXWA 2DMRA 3U4GA 3CJQA 2BFCA 1GTG1 1HZJA 1U7WA 2RC5A 2ROQA 3GGOA 3L02A 1T0HB 4BN4A 5FP0A 5SY9A 2V5UA 4IDFA 2QN1A 5DHFA 4FM9A 2HSWA 4WVLA 4GKKB 3CUUA 4PSKA 5EWMA 1XMQB 1T2EA 4KFUA 3UMVA 1SA0A 4NG4A 3K31A 1V5EA 3GDHA 5KUTA 1C7ZA 1G4HA 1QRDA 3AEZA 3WLNA 3PEWA 1XNHA 1R6TA 2CC2A 3I6MA 2A9RA 2P9GA 1UP4A 3GEMA 3HYNA 4HL6A 3UAGA 4KBYA 3UGTA 3PEYA 3VQTA 2R84A 3ZLBA 1XVUA 5CNJA 5BWNA 3GDOA 4P5PA 4PC6A 1DTWA 3HA3A 3WGNA 3B8HA 3U7RA 4BHTA 4E1BA 5A9SB 5HZKA 3AVUA 3C15C 3C70A 3A9TA 4X71A 5TPZA 3WLFA 4AYXA 1Y8QB 4BJHB 3U4QA 3ME5A 4YRQA 4HMQA 2V8BA 2DWCA 4E3WA 1XPJA 3LMKA 1I7LA 2VDRB 2VDKB 3KB8A 4I99A 1OYOA 5I9TA 4ZJPA 1OA1A 4C4PA 1B26A 4EY4A 1ID1A 1Z29A 3VZPA 4B6EA 2ET6A 1DAHA 4XOIA 1CU1A 2Q28A 3AYZB 1TPZA 4HXEB 5IHXA 2FHPA 1KQPA 3SR0A 1WG8A 1KBOA 4AY6A 2AMYA 2C84A 3E5RA 1A7KA 1UBMS 3M1AA 2FI1A 1B23P 3ETLA 4M6WB 5E0OA 1U7OA 2FG5A 2AG0A 1ZIOA 4OKNA 1PT8A 1LK0A 1TJNA 5A5EA 5K99A 3P9RA 5EKDA 5GIPE 2NWQA 1X7YA 1KQGA 3CVWA 4EI7A 3FBTA 2M6SA 2EJWA 2VF8A 3BHIA 3DL0A 4OHPA 4MB6A 4MGEA 4MVJM 1QPZA 2PX4A 4MCIA 4YRFA 4ALJA 2XSZD 1CEQA 1K63A 5BWMA 3JYHA 1SVNA 2EFDB 5SYNA 3E2MA 3GBVA 2OENG 1ISGA 1I36A 2JARA 3F7NA 2R7LA 4KDEA 3FPSA 2R1VA 4R40A 2QNBA 3Q5DA 1FPMA 4TWBA 3KXDA 4HQ0A 2NT4A 1JXQA 1KH1A 3NEJA 2YHIA 4F2HA 1P7YA 1H0SA 2PQMA 4XR4A 4DQVA 4PSAA 1NUQA 3U4IA 4I1RA 4LXGA 1ICEA 1UBOS 3W2IA 2FFQA 2D8MA 3C2QA 1I24A 3OZBA 5AKZA 3TAUA 4DKJA 3MMXA 2FG6C 5IBCA 1NX9A 3RSCA