2X2EA

Dynamin gtpase dimer, long axis form
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
341
Chain Sequence
MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDKHGTDSRVDEMLRMYHALKEALSIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DYNAMIN-1
total genus 107
structure length 341
sequence length 341
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2eA00
3S1AA 2DBYA 2GXQA 1IN4A 4HEJA 4GFDA 4NYIR 3X1XA 1DEKA 2F9MA 1E9AA 2VHUA 4ESVA 1SKYB 2OT3B 1TU4A 4MRVA 5FOVA 5JRZA 3OEEA 2ONJA 3TUJC 3FDIA 1W2HA 3U3MA 2JDID 4OQFA 4D0NA 1F2TB 1XJ0A 1E79A 4MRNA 5CK4A 4JZKA 4HI0E 5G41A 3QXHA 4HLQB 5IT5A 1AA9A 3KQUA 2HLDA 2PL3A 3R8CA 1KJZA 3VKHA 2ZS7A 1CJVC 3OF5A 3GFTA 1RFLA 5FTJA 4MITA 1N3BA 3REGA 1X86B 1JR3E 2YKGA 1H8ED 1E1RA 4HLUC 3UPUA 2AKYA 5JSZB 1P2SA 3AF3A 4BLOA 4ZDIA 4LHYA 2WJYA 5DSZA 3TR0A 2A7QA 2O8FA 3ZD6A 1SHKA 2VP0A 5FI1B 4TLAA 3OZXA 4TTPA 4B74A 5F9HA 2R6GA 1KO8A 2DFLA 4PSAA 2J0SA 2GRJA 4KSBA 1FOEB 3TIFA 2QORA 2QSZA 3WNCA 1EG7A 1VCMA 2A5DA 2GAOA 4C0BA 5E7IA 4GI7A 1AQUA 4A6PA 3R9IA 2ECKA 1JXMA 2C9CA 3NKVA 1XTRA 4HLUA 2R44A 5J4KA 2AK2A 4IW3B 4DHEA 3HYTA 4EJSC 4PO1A 1K8RA 2Q0HA 4KVGA 5EE3A 5L3QA 1H8EA 1OSNA 5FPTA 5KSPA 4AURA 1SXJE 2PT7A 3CPHA 3KKOA 1IXSB 3EARA 4FMBB 4JVLA 3TVDA 4B3FX 4A15A 4BECA 2XOKD 4LPKA 4B44A 1NN3A 2ZSDA 3RHFA 1MV5A 4D2IA 1ZYUA 3A4MA 4TQAA 4B6FA 3HR7A 4QOSA 3CRW1 3RWOA 4O2LA 3CRVA 5H68A 1UBEA 5LD2B 4AYWA 3THOA 1W4RA 1KMHB 4D82A 5DNYB 4LJ4A 3RS2A 2GJ8A 1M8PA 1S0UA 2PH1A 3RSOA 5DIFA 1ZNWA 2WPDD 2CL0X 4ZDKA 4DLTA 3MJHA 2ZJZA 4Q1DA 1KNQA 1JNYA 4KFUA 3IUYA 4OJKA 3RRYA 3B1VA 1KZ7B 4BPBA 2AX4A 2PX0A 4UNRA 1XD2B 2ZRDA 3K09C 2GZHA 1XXHE 4P4SB 2Z4SA 5KSOA 1NIJA 5KU1A 4XWAA 3BGWA 2IYSA 1X1RA 2XOKA 1UEJA 4EQ6A 3VR2A 3NEJA 4JT4A 1J2JA 1P75A 4KFRA 2DB3A 2AFHE 1U2RA 4PHTA 3QKUA 3ZS9A 1ZP6A 2W83A 4FCVA 3D31A 4IEIA 2ONKA 2E87A 5LPNA 2ZRMA 4E09A 3EX7C 2J9RA 1JI0A 2YYZA 5EXPA 3PR1A 1WXQA 4JJZA 4NPHA 4GSYA 4Z1MA 5H70A 1CJUC 2IT1A 1GNQA 3VR3A 2JJ2D 2GVZC 5EQTA 3PV0A 4OYHA 4KITB 3R7WB 3TW8B 1M1YE 1Q1BA 1E2PA 3AVQA 1XTSA 4URUR 3GMTA 2NO0A 3T1VA 1ODFA 3E2IA 4DLSA 2A78A 2OM2A 1MRSA 4IJMA 1IY2A 2ZI5A 2QAGC 5CYOA 1Q1EA 4LJ6A 1U98A 5JHGB 4AIIA 4HB3A 2HXYA 1OXVA 1VYUA 4NYMR 2GVDC 2ZRPA 3NC1C 4CYMA 1Q44A 3R9XA 1ZC3A 4Q19A 5H8WA 4KFTA 3QXXA 5J4YA 2P0EA 1CR2A 1M7GA 2JJ2A 2OLJA 5F3WB 1NBME 1HEIA 4A8JB 3K0SA 2ZRKA 4N0EA 5EE0A 1FUUA 1XEFA 1XNJA 2WOJA 2ZI4A 4CEHB 4MYUA 4WA7A 1QVAA 3Q85A 3EPHA 1IBRA 1P2VA 1GVNB 3GJXC 2R6CA 3W5JA 3RRMA 1FP7A 3NVAA 3UWKA 3VTKA 1N5JA 1KAGA 2F55A 4WOPA 1XRJA 4IXMA 1SQ5A 2Q3MA 1N5LA 1XCGB 2F6RA 1XP8A 4M1TA 2O8BB 2IYRA 3GCGA 3ADDA 1ZVQA 1IN6A 5KNBA 4CEIB 2CL6X 4V0MA 1ZUHA 1Q1QA 1S8FA 1LY1A 3F0TA 5J4LA 1W0JA 3U6BA 3K9GA 1YHNA 4FW9A 1VTKA 1OIXA 3OAAA 2W2VA 4NCIA 4JLBA 4YONB 1OHHA 2RGAA 4ZCLA 1G20E 2UKDA 5K8UA 2WJJA 3CPEA 4BE7B 1EK0A 5AJVB 4Q66C 3H4MA 4O3MA 4QG7A 1E2MA 2CHQA 5DO9A 4FMDF 4EFMA 1QVRA 2GXSA 4LJ8A 5IHPA 5JI3E 3PJRA 2YOHA 4QKQA 5D3QA 1OKKD 4CDGA 4LHZA 4ZPXA 2IXGA 4II7A 1G21E 4YDSA 4Z51A 1NP6A 1E6CA 1QRAA 4JLVA 1P62B 1W5SA 5BQ5A 3B85A 3KUCA 3TUIC 5BN5A 5CB6A 1O3YA 3ZD7A 5SZJA 2RGNA 4KFSA 3HU2A 4HAXA 1VIYA 4RSGA 3SQXA 2GETA 1PLLA 4QM6A 1G4UR 3EASA 4RD2A 1OHHD 2BDTA 1MO5A 3JZAA 3HYRA 4AI6A 3PUWA 3VR1A 2F43A 2CLSA 5FI0B 4Q21A 5IRCD 2EYQA 4OK3A 2C95A 4B71A 3CRQA 1KTVA 3N2EA 4CT5A 1E0AA 1D2MA 1KY3A 1F3OA 2MSCB 1FFHA 3QXSA 4EPYA 2WAYA 3CUEF 4OQMA 2IEYA 3K53A 4C2UA 3QNUA 4Q7JB 5G3ZA 4QNRA 1QZXA 2IS4A 4C3ZA 1YZKA 5KYKA 2Q9BA 4KJZA 5KOYA 2XGJA 2XB4A 1RYHA 5J40A 1YRBA 3Q7PA 1IOZA 1FTSA 1SGWA 1U0JA 2OCAA 3OESA 2IEZA 4LC1A 4DBLC 3EPLA 2O8CA 3BXZA 2ODBA 1FPMA 1UDWA 3M0EA 4Q02A 2FGKA 3I61A 1ZJ6A 3D6TB 4LBZA 2K5UA 3GJ3A 1EX6A 3PEUA 4WXPA 4GP7A 4US2R 5L3RA 1XU4A 1OXTA 4XJXA 2F7SA 2Z6VA 1XTKA 4W5WA 3WYAA 1GTVA 5EP2A 3R7WA 1OYYA 3TW4A 4AWXA 2QPOA 2O8BA 1RYFA 4AKGA 4PANA 1G8FA 5JI2E 1G8GA 3LLMA 3B1ZA 2QRNA 3K0CC 2R6FA 4IDPA 3QPVA 2EU8A 2IS1A 4OQNA 3MFYA 3FOZA 4TLCA 3M4YA 4G1UC 5ELXA 3WBJA 2ZM5A 1MOZA 1Z0JA 1FP6A 1QHYA 3O8BA 2YHSA 1FL9A 4KBGA 2DYKA 1Z29A 2ZR0A 4BLRA 2FZLA 1G8HA 5GJBA 4PHGA 4LYHA 5J47A 3K9LA 1NVXQ 3AQ4A 4OJQA 5FBVB 2DY1A 1RJ9B 2ZAOA 5GVSA 2XAUA 1ZD8A 2QTVB 4B3XA 3GEIA 1JALA 3PG5A 4A4DA 3QBTA 4KBFA 1IQPA 2WSMA 2JASA 1NJFA 1KI1A 3C7KA 2RAPA 3L8ZA 2DWPA 3I62A 4QGGA 4AY2A 3GJ8A 2V8OA 3I72A 4A92A 2GXAA 3FTQA 1T3HA 4F7WA 3EZ2A 3SR0A 4AKHA 3U3KA 4ERNA 3MWYW 2IUSA 5E3HA 4F4IA 3PIRA 3U5ZB 2RH5A 4RFVA 1UPTA 4B3GA 1KI7A 2CJWB 2OLKA 4JVNA 1G16A 4BLSA 4QHYA 3IIJA 4US0R 4XWKA 3U4QB 2DFTA 1DTSA 2ZI3A 4AK9A 1T5IA 3EC1A 2FWRA 1R7RA 1KY2A 4TLEA 3MRSA 5C4GB 3TGPA 2OEPA 3RS7A 1RRPA 2ZPTX 4B48A 4DSOA 1SKQA 5KSYA 3QQ5A 3GQBA 1KO1A 1VG9B 4JL8A 1EX7A 1GSIA 2BMJA 4PC2A 5TMPA 1G291 3VR5A 1DE0A 5FOSA 3AVXA 1N6KA 2IYWA 3EA5A 1EFUA 5FOWA 3GFPA 4TMVA 3QI2A 2B7BA 3ZLJA 2GK7A 4JKYA 1NNEA 4BZPA 1OW3B 4GP6A 4XTCS 1NKSA 2BBTA 3U6KA 1T0JB 1LS1A 3SEAA 1RJ9A 2MMCA 2RB4A 4QBFA 2GEUA 4B73A 2OFOA 1AIPA 1NJGA 4TSFD 5LBIA 2ZANA 2XXAA 2FU5C 1HV8A 2BHRA 2ZJ5A 3FFBA 2OBLA 1G5TA 3BC1A 1WDTA 2J0UA 2JATA 4KYIB 1LFDB 1E96A 4PXAA 2GJ9A 1QHHA 1Z08A 1OH7A 4W5HA 3VU9B 3THXA 1ZU4A 1EWRA 3GFOA 3WHKA 2BBSA 3IIKA 4JL5A 4Q4LA 2H57A 3A6PC 3QF4A 4UJ5A 2BV3A 4LPSA 2XTMA 4PPFA 1II8B 1KI8A 2F1JA 2VP2A 2RGNC 3QF4B 4R98A 1OLOA 4RCZA 3U7EB 1WQ1R 3TMKA 4ZDJA 5JJIA 1VHLA 2XNSA 4TSFA 4QJ3A 2WZQA 2AR7A 3TE6A 3GLIB 3S1AB 2CDNA 2PLFA 3DM9B 1O87A 4HB4A 3BH7A 3KUDA 1W36D 1U0LA 1W44A 4MKIA 2BBWA 1G6HA 2XJ9A 1LF0A 5L3VA 2HLDD 4HUQB 4AYTA 3W6PA 1OPXA 1YJ5A 5EXTA 4BEBA 1FMLA 4X8MA 4P3YA 3QUSA 1NVUQ 3LH5A 4OQXA 4RZXA 2BMDA 1XDBA 4QHSA 4V0KA 2VH5R 1L4UA 1ZAKA 3PXGA 1UJ2A 4Q4AB 1GKUB 1Z22A 1DAKA 2CE7A 4FN5A 2VPPA 2GCPA 5FBLB 3X1YA 1VKJA 2FN4A 3M6AA 4PAMA 4JLOA 4AKEA 3DKPA 4Q1FA 2D7DA 2BKUA 2C9OA 4NKRA 4JLNA 1HA3A 5P21A 3UMSA 3QSYA 3VKGA 1COWD 3Q5DA 2Q9AA 1P60A 3IBGA 4X8HA 3B1XA 1S1CA 3OEHD 2VHTA 3AP2A 2GCNA 3V4FA 4EKDA 2QTFA 2HCJB 1N6NA 2J59A 5TV2A 2CJWA 5BN3A 5K8IA 3NTUA 4QJ5A 4FIDA 3F5FA 2ZITA 2JAQA 3BIFA 2MMGA 1D6JA 2R2AA 1TAGA 4C0LA 2CVFA 2GF9A 4H1UA 4C7OB 3TH5A 4AC9A 2FX3A 2QSYA 4PPGA 2O0JA 3IQXA 5EE9A 3ZVNA 4N1AA 1UM8A 1W4AA 2D06A 4NCJA 4HSEA 2D3WA 4JLKA 1OIVA 2C77A 4QRHA 4GMDA 4MYHA 3ZYCA 3GEEA 3ZZTA 2D62A 4IOKA 1ZNZA 2AL7A 5DHAA 2CEAA 4IOMA 3THWB 1QG4A 4Q7MB 1Z6XA 2V9PA 3SBDA 1FNMA 5JCPA 1Q22A 4OHVA 4UKDA 4TTQA 2BCGY 4HUTA 1Q21A 4B35A 4OI2A 3CR8A 4TT3A 4JYCA 2LKDA 1OIWA 4BFYA 3PVSA 5BW8A 1OH6A 2XXAB 4DWJA 1N6RA 1GWNA 3EWSA 4ARZB 3I73A 4Q4AA 4JBXA 2Q21A 3CO5A 2ZE5A 2OE2A 4ZO4A 2VTKA 3CONA 2HF9A 2NO9A 2W6JD 4M9XA 3ZH9B 5CB8A 1XJCA 4LHVA 1OYWA 5JJKA 4I99A 4Z1MD 3T12A 5FOTA 5IDVA 2A5YB 2NMVA 1J8MF 1AGPA 2OCYC 4DCTA 2FSGA 1CP2A 1R8QA 5EXSA 3SYNA 4RKEA 3FVQA 3FMFA 3LXXA 2H8KA 4Y0AA 4TT3D 3ND8A 4E5UA 1YQTA 3LV8A 4BFXA 3OFNA 3ECCA 3LRPA 4WIAA 5GJWC 4URVR 1NRJB 3LVQE 4IVPA 1SXJB 2C8VA 1KJYA 3RLFA 3KKPA 4JLMA 3ZVLA 3Q7QA 4LV8B 1RRCA 1M2OB 1JBKA 3W90A 5HE9A 4ESHA 4FWIB 4GT1A 5DH9A 1A2BA 2FV8A 5TXGA 4GZLA 4A9AA 4JKIA 2FFHA 3DMNA 1YVDA 3PUYA 4Q7KA 4EDHA 1G3MA 2JLWA 4LJ5A 1SVOA 3O8RA 3T5DA 1E0JA 2P3SA 3SBEA 2AWOA 3SS8A 2I4IA 3B9PA 3RABA 3P27A 1OH8A 3BFKA 5BXQC 2G1JA 2VRWA 4Z54A 3NBYC 5SZHB 2IA5A 4WZ6A 4DZZA 2BJVA 1F60A 4U00A 4K81B 1KSFX 5HZHA 3MG9A 3UG6A 5HPYB 2YZ2A 2XZOA 2ZI9A 4OBEA 1XEWY 4O2RA 5C1BA 2P2LA 4IDOA 4X8LA 4D4MA 4DCVA 4A8JC 1T6NA 4LUCA 1FQKA 5DISB 2NPFA 1SVSA 3O8DA 1LNZA 4DIDA 3RC8A 3U60B 1G64A 1W0JD 1V43A 1NG9A 4TZ6A 4IEEA 4HB2A 2TMKA 4LV6A 3OAAD 5AR1A 4MUBA 5CM9C 4F4JA 2EWWA 2ZRBA 3WMGA 3FGNA 1N6HA 3G5UA 2W2TA 2FPKA 1GRRA 1NY6A 2HXSA 2ZXUA 4PAQA 4RD1A 1BIFA 3FB4A 1XZQA 1Z0FA 2DPXA 2GK6A 721PA 1N6IA 2ZRNA 3K09A 1FX0B 1NLFA 1ZNXA 2JCSA 4FCTA 1UKZA 1OKKA 4A6XA 5AJWA 1AQYA 2QPTA 3GLHB 4JVSB 4NYJQ 4DIEA 3EC2A 1FW6A 1G8PA 1P5ZB 3CB4A 3GLFA 3GLHA 3DL0A 1E4YA 3K0FA 4R2HA 4M0LA 3V9PA 1VMAA 3KB2A 1ZINA 2XTZA 1WB9A 4HZUA 4TL7A 3AKEA 1JEEA 3CM0A 2FJUA 1RIFA 2ZSEA 1FUKA 4MYCA 1AZSC 2R6AA 2ZRJA 3DVLA 3SOPA 3NDBB 1P9WA 4ZCIA 3RNLA 2OG2A 2QUZA 2ZR7A 3ZJYA 1KSGA 3IEVA 3NEYA 4NYMQ 5JECA 2ATXA 2R65A 3P4XA 3KFXA 4HB0A 3K0AB 5G53C 5CDFE 5JFGA 4XH9B 3VR4A 2OCPA 1OXXK 4C0AC 4I81A 2JLZA 4A82A 1ZM9A 2BOVA 3B9QA 1N0UA 3CIOA 2ZR9A 4DB2A 2XITA 2PCJA 2EYUA 2REOA 1VDZA 3ND9A 4DCNA 1F48A 3LBHA 4EAQA 5ANRB 3CNOA 2EFGA 3LXRA 4MRSA 1Z0IA 1DAEA 4V0OA 4PC7A 4Q9LA 2QMOA 4P31A 5JS7A 3ZVMA 4PHFA 2G83A 1W36C 2CXXA 2QZ4A 4HZIA 2QL6A 4DLZA 1VECA 2FFBA 2IYZA 1OFHA 3EW9A 1IM2A 4QXAA 3U3JA 4M2LA 4KVAA 4OHXA 3MSXA 1U94A 2ODEA 4JLPA 4L5BA 3BWDD 2EW1A 1WMSA 1UKVY 5CITA 3QPUA 2W6ID 4M1SA 1KDTA 2ANCA 5CDFA 4DEYA 4TYQA 3RAPR 5JZVA 2G6BA 2RGBA 3BH6A 4OI4A 1ETUA 2WWXA 4WAUA 3R8FA 1CIPA 4POAA 3W8NA 3B2EA 1NF3A 3QJYA 1VCIA 1HTWA 3W6NA 2QM8A 4PHHA 4ZIRA 1U9IC 3KKMA 1VCOA 2X2EA 4C0HA 3EPJA 2UVQA 2XJ4A 1ZCBA 5E7MA 3KFVA 1A4RA 1T3SA 1II8A 4ITRC 4MRPA 1T9HA 1Z83A 1E99A 3T1OA 3TAHA 2IS2A 4ZDWA 3BB4A 2AD1A 1E9CA 3UATA 2VQSA 5A4JA 4M1YA 3DO6A 4BFTA 2HV8A 1Z2CA 4J0QA 4HLDA 1QHGA 2C98A 3IO5A 5F98A 2QP9X 4IVRA 3GJ6A 2OXRA 1KDRA 4DJTA 4Q18A 4CRWB 4GPTA 3W9YA 1TNDA 1CKEA 2WTUA 1IJFA 2O0KA 1P9NA 1YZGA 2WKQA 4CF7A 3WBKA 5M04A 3U61B 2G88A 2ZJAA 2AK3A 3FKSA 3DPUA 3R9WA 4NCKA 1KI9A 1KI3A 4IRUB 2FSFA 1SVKA 4PQFA 3RYTC 3QKRB 4UNPA 1R5BA 2CK3D 1D9ZA 1E2EA 2EFCB 5FTNA 2CL7X 3NC0C 3NIBA 3TSZA 1YR6A 2QT1A 2GKSA 2FDCA 4ZCMA 1TUEA 2ZE7A 4B32A 1CS4C 1MR3F 2ZTSA 4RCYA 2OUKA 5DGXA 1UBGA 2R62A 4IVQA 4EPVA 1RVDA 4E22A 2EWVA 1ZMXA 4UJ3A 2OXCA 1X8KA 3ZGXA 2HUPA 1NL3A 3QKSA 3AVVA 4LYJA 1GITA 2ZYUX 4NU0A 4TWZA 2V1UA 5DN6A 1T91A 2LCFA 4Q47A 1G18A 1MO3A 4DVGA 4P4UA 2KBEA 1YR9A 4M8NE 4D81A 1Z8FA 2HEIA 3CX7A 3KZ1E 3MWJA 4XVRA 2CK3A 2CNWA 5B30A 2OBNA 3DHWC 4V0ME 4A2PA 4JVMA 2GJKA 4JMPA 1Y63A 2J0VA 2J0UB 4HATA 3L0PA 3AF2A 2WKPA 4CZ2A 2ATVA 2F3TA 3FKQA 2GJAA 3T1QA 1NSTA 2PMKA 3CRRA 3OIYA 3CKLA 4HUQA 4M22A 3RS4A 4FCWA 2H18A 3VX4A 3T1TA 1JXOA 1CRPA 2EQBA 2ZUDA 4MDEA 4OI0A 1EFRA 2WAXA 4D6PA 3OIUA 1WCV1 2XX3A 5LB4A 4B3DA 5DN6D 3U44B 4LGMA 4LHXA 3LFUA 2QU8A 1GKIA 4PX9A 2QMUA 3H1TA 3NHBA 3VR6A 1ANKA 1IONA 2LKCA 2PT5A 1XF9A 5HTKA 2IYTA 1DG1G 1QHIA 1R5NA 2BBOA 2OAP1 4I1SA 1KSJA 2NO7A 2Q6TA 5FL3A 1IJEA 2ZROA 3DKVA 3LDAA 5L3SA 1H8HA 2AD5A 2WIAA 3CF2A 1G5PA 2CHVA 1GILA 2VBCA 3RVBA 2ZIAA 1TF2A 3BORA 2RHMA 1G17A 1QG2A 1KKMA 1UDXA 3EIQA 2RCNA 2FG5A 5JS8A 2H16A 2V3CC 4CEHA 1JEDA 3IDQA 2AXPA 3SJAA 1TPZA 4TMKA 4A0RA 1IXZA 2J0QA 2VHQA 3QIAA 4TMXA 1US8B 1DBSA 3DDCA 1F2UA 4MH0R 3B7GA 5KSZA 1X8JA 1X1SA 3QKSB 1N6PA 4V02A 1N6OA 1CF4A 4DB4A 1J7KA 3PEYA 2NZJA 1KNXA 3QXJA 5AUQA 3CX6A 4E03A 2JIZA 3B6EA 4UXJA 5FUWA 3L82B 2IL1A 5D3MB 4G5OA 3L2OB 2O5VA 2ORIA 1I4DD 4Q1EA 1AK2A 1Z63A 5KPDA 1OXSC 1KYIA 5KTYA 2P5TB 4YQFA 1IHUA 2A2ZA 3TJZA 1OF1A 2IF2A 3KJEA 1KO5A 3K0FB 3GPLA 3EA0A 1YRAA 2FSHA 2BEJA 1A1VA 2DFKB 4CEJB 2PX3A 4M21A 3BERA 1MO4A 2F1IA 3FMPB 5FUVA 4ASUD 5JEDA 1PVOA 1E9EA 2QGNA 4ILEA 1P73A 1S9HA 4MGIR 2JLVA 4HAWA 3UKDA 5CIWA 2IHYA 1HT2E 1KZGB 2KBFA 4ACBA 5LDDC 4B6EA 1EFCA 2J5XA 4GOKA 3IGFA 2L0XA 3EZFA 5J4HA 1BOFA 3G0HA 1ZRHA 1GL6A 1DAHA 4RFSB 2HYDA 3A36A 2JLXA 3TR5A 1IN8A 2FF7A 4MYTA 1UAAA 2GZDA 4Y0VA 3ONWA 1D8TA 1PUIA 4NZYA 4A2WA 1P7CA 3A1UA 1P2UA 1CEEA 4IDQA 1IY0A 2ZRAA 4UNQA 2QTHA 4DDVA 2G77B 4RVCA 3CF6R 2WV9A 2IHBA 2ORWA 3DZ8A 4A36A 1HH4A 2FZ4A 1HYQA 3JVUA 1XD9A 1G3UA 5FFMA 4LBYA 3KJIA 3SN6A 4C0JA 1I4LD 3PUZA 1U0HC 4XOIA 3B60A 4LK2A 2JJ8A 3A1WA 1EXMA 1N6LA 3HPRA 3CR7A 3P32A 1P3JA 4KU4A 3UMRA 2D74A 2VHJA 5F9FA 3FHTA 2W2XA 4DXAA 1WRBA 1XB2A 3AVWA 2FA9A 4LHWA 4M1WA 1KGDA 2GXUA 3TNFA 1XWIA 1W7AA 1JQJC 1NN5A 4KAXA 4M1KA 2C03A 1K5DA 2FOLA 4BFUA 2AN9A 2YINC 1KO4A 2J7KA 2PJRA 1T4GA 1NVVQ 1JR3D 3RWMB 3U7FB 1KO7A 4JYBA 4AYXA 1G7RA 2J3EA 1JJVA 1GKYA 4RFSA 1UADA 3MJRA 5KO2A 1HT1E 3AEZA 2I1VB 3BB3A 1WF3A 4HLCA 3T34A 1E79D 2FFAA 1LW7A 5FPHA 3WRYC 3DEFA 1B0UA 2KSQA 1S3GA 1V5WA 1S2MA 2V55B 1OFIA 2P6UA 1E1QD 1XEXB 2AKAB 4MKHA 2QP3A 2ZYWX 5EXXA 2H92A 3LW7A 3H0KA 1D2NA 1N0VC 4B33A 4OI1A 1R4AA 3TSWA 1XTJA 1LB1B 3FWYA 1XZPA 1E1RD 3K9NA 4XSHA 4C0QC 3B1YA 1UBFA 1AKYA 1R5OA 2IF0A 2RKOA 2VA8A 1HE8B 3MAAC 3R20A 4BZXA 5C46F 4UQOA 3VNUA 1GG2A 5L3SB 4GL2A 2C96A 3EZ9A 2BWJA 4ARZA 1XD2A 4P4SA 1P61B 2O8DB 1E2JA 1KOFA 1KDPA 3EIHA 1N5KA 4ZKEA 4RY2A 4Q1BA 2GF0A 2UZIR 4R71A 3SJCA 1NVVR 1TF7A 1YZLA 4MQBA 4OHZA 1F2UB 4HDOB 1W36B 4OL0A 3GLIE 4DUGA 1PLKA 2OFXA 4V0LA 3E1SA 3KTAB 3LW8A 3LX5A 2QEQA 4TMWA 2QROA 3MD0A 1GAJA 1KMHA 1ZD9A 4GRAA 1NBMD 4KV9A 4PC6A 4RJLA 4XD7D 4D4LA 5KUTA 4ZIRB 1U90A 5TARA 5DHFA 2PBRA 1UBCA 2XEXA 3OEED 4KYUA 5DI3A 3IHLA 1G3QA 3UWOA 2G0NA 1CR4A 2F3RA 2JEOA 2JDIA 3BE4A 2NO6A 5DE3A 4F38A 1ZNYA 3NH9A 4BQSA 1OT3A 3DMDA 3SYKA 1KK2A 3K0EA 1COWA 4DDWA 1YZNA 2DFNA 1II9A 2BM1A 3CBQA 4DUGD 3PITA 5BYKA 1C4OA 4JLDA 4FD2A 4D25A 1E2NA 2GNOA 1MO6A 4F4CA 2O8CB 5TY0A 1TUIA 2DWQA 3ASZA 1H65A 5AK0A 5FTLA 4RD6A 3W8RA 2P67A 5A5GA 1E4VA 4QFMA 4F92B 1Q12A 1XFAA 5AUNB 3SHWA 1KHTA 2XNDA 3VX3A 4AG6A 3QKRA 3AH8A 1TMKA 3BS4A 2IWRA 3AF4A 4LJAA 1TADA 1XXHA 5KDLA 1S4QA 5DYGA 2LWIA 4B3CA 2ZETA 5C2JB 4I1UA 2VLIA 3FE2A 3LNCA 2KB0A 4DT1A 2Q9CA 2ZS8A 5EZ6B 1A7JA 2VF8A 3UXMA 3A1VA 1Z0DA 4EPTA 2QAGB 1TQDA 1JAHA 2F1RA 3WRXC 2NG1A 5AUPB 3D7MA 4LOAA 2ZYTX 1J90A 1W0KD 1BH2A 2JA1A 2WM9B 3UG7A 2X19A 2GESA 2XNDD 2ZE8A 4DLXA 2NZ8A 2VP4A 2IK8A 2WHXA 3WMFA 4GNKA 3A1SA 1GZSA 5FTMA 2ORVA 1WBBA 2QBYB 4Q1AA 3CF0A 1VYTA 1JJ7A 5B57C 1GIAA 1LS6A 4FWTA 1X3SA 3QEJA 3AVTA 1ZIPA 2W6JA 3C4JA 4MKGA 4UNSA 4OHYA 4US1R 1XEXA 5SZIA 3T61A 1FTNA 3W3AA 1QBKC 1JQLB 3AP3A 2WVJA 3W3ZB 3U7GA 5KNCA 3AVOA 4DDUA 3VMFA 2H17A 3MWLA 2GILA 4PO8A 1ZM7A 2YWGA 3ETLA 1G8YA 1ONBA 3KJHA 5CLQA 5FPYA 4C2TA 1W0KA 3L8YA 4LJ7A 1UEIA 2W6IA 4W9MC 1YZUA 4BGDA 3WXMA 3N70A 4Q1CA 1I4TD 1YU9A 3OFND 1A5TA 4WVFA 4Q00A 3AKYA 4R9UC 3THYA 3T35A 4P0TA 4DCUA 1YZQA 4YXWD 4XSGA 2JGNA 4JSYA 3LO5A 4V0NA 1CR1A 1JPJA 3CPJB 4D80A 1TX4B 1Q57A 2RGXA 4LBWA 1RW4A 1E2KA 5BWMA 5LD2C 3ZS8A 1E9FA 2ZSAA 4FMDB 2J46A 3VHXA 3VU9A 3THXB 1G4AE 2C5LA 4BZQA 1KK0A 1VCNA 4TYPA 2CLCX 3Q9LA 2YV5A 1U8AA 3AP1A 2VP6A 2IXEA 3PFIA 4W5JA 4BASA 2IYUA 4KLNA 3H84A 1XX6A 1Z6TA 1Z0AA 1DO2A 4ZKDA 4DKXA 3PQCA 4IDNA 3RS5A 3U2QA 5UKDA 1Q1ZA 1BO6A 1U9IA 3B8HA 3AGQA 4JIMA 5DI3B 4OK5A 2HJGA 3VHLB 1TQ4A 1R0XA 3GLHE 2ODNA 1PUJA 2BIFA 3EWAA 3F3YA 4FINA 4GOJA 4NYIQ 4DSUA 1XTIA 2QBYA 5DI9A 1RE0A 4A0FA 2W58A 121PA 3BBPA 3QPWA 4OK6A 4C9BA 2VYFA 1N25A 5HKKD 3CH4B 1RPZA 1R0YA 4M1OA 2ERXA 4UXIA 5EZ5A 5E4FA 3TKLA 2Z5FA 4NYJR 3IIMA 3KXKA 1Y3AA 1OE0A 1VYVA 2GBLA 4TYNA 2FE4A 4YLGA 1M7BA 1QF9A 2VP9A 1A2KC 3EG5A 4M9QA 4LSGA 1R8SA 3GJ4A 1U8YA 4TTRA 1SKYE 4YMVA 3U44A 5E7JA 3U4QA 3IPXA 5TB5A 3WYFA 3GLGB 4JSTA 1X6VA 1GL9B 2FEMA 3B1WA 1D9XA 2B8TA 3LLUA 4I1VA 2REBA 1E69A 4URZR 3G82C 1Z07A 2YC4C 3NHAA 4I1OA 5HKKA 1IXRC 3WHLA 2X8AA 3W5IA 1XCPA 3PENA 3RANA 5JWHA 4JT2A 3T5GA 3IPYA 3N2IA 1OB5A 1W47A 3SDZA 1AS0A 3WYGA 1NKTA 2PMDA 2ZJYA 1G41A 5H1YA 2IBMA 2CE2X 1G7SA 3C14C 4WBSA 2IXFA 3FFAA 4URWR 3L0IB 2UZ3A 1JB1A 1E32A 2DWOA 3SJBA 1SVWA 2D2EA 3RSLA 4Q4JB 2CCGA 5LB2A 4Q4JA 521PA 4LRWA 2XB2A 2QN6A 1K6MA 2GAAA 3WP0A 3QEOA 2Z43A 2EFHB 4EJSB 4JS0A 1DAGA 3FPAA 4JLAA 1P4SA 1OJLA 1R0ZA 4HZUB 2PCLA 2R6DA 1Z6AA 1Q0UA 1ZBDA 3KTAA 4Q7LA 4LBVA 4PO9A 1S3SA 4JBWA 1M6NA 4Q01A 2J41A 3ICQB 4EPXA 2OAQ1 821PA 2MSEB 3TQCA 1KSHA 4Q9KA 4B3BA 2P6RA 3MMPA 2OZEA 4G3XA 1DELA 5FOUA 2Z83A 4G5RA 3I3SR 3B13B 4XWOA 5JLJA 3IO3A 2BMFA 3U3OA 2CHGA 2BCJQ 2VSFA 5L3QB 4DSNA 1YKSA 2J45A 2YOFA 2H5EA 1RRGA 2DHRA 1X8LA 1VHTA 3MUFA 1AGRA 2NIPA 3L0OA 3AF0A 2GJSA 2G3YA 2BC9A 1G9XA 2PZGA 1Z47A 1SHZA 2ZVQX 3BH0A 3NG1A 1SXJD 4NMMA 2WWIA 1KI6B 4Z8YA 2WMOB 3SNHA 4A0GA 3GJ0A 5C4MA 2V1XA 1FNNA 2X77A 3GJ7A 4ASUA 4ZV4A 1BKDR 4LJYA 2WWYA 1OFTA 3ADCA 4F93B 1E2QA 2IX3A 1XMVA 3AV0B 1NLZA 1R2QA 3IEUA 5AJYA 3ZDQA 4PQRA 3GLGE 2E9SA 5KDOA 4M9SA 2HT6A 1CBUA 1KK3A 3SZRA 4DRZA 3AUYA 2WBLC 2YWHA 4RD4A 4U7DA 1NG1A 4TQ9A 2C78A 4TYWA 2IYLD 2HCBA 1OH5A 4PC3A 1R10A 4LI0A 2GWHA 3DOEA 2WWWA 1M74A 3HDTA 3C16C 2Z0MA 3JVVA 3GLIA 1Z5ZA 4MUAA 5AUOB 5AWFC 4MGYR 3WMEA 5JSZA 2RMKA 4HAYA 3WNBA 1AS3A 2WOOA 2QT0A 4Q9HA 4TZ0A 3Q8XB 1E2HA 1NN0A 2KE5A 4LV5B 4LYFA 3K1JA 3GLGA 2OSBA 8OHMA 2WWFA 3QVUA 4B47A 4OQLA 1J8YF 3QBVA 1VPLA 3B5JA 3DM5A 1Z06A 3CZQA 4JLJA 1ZD1A 5JCZA 4RD0A 4OHWA 4LY6A 1Q3HA 4B34A 3EPKA 2RGEA 5B2ZA 4PPQA 2QG6A 1HE1C 2QENA 4Q03A 3KQLA 1VG0B 3LQQA 1G19A 2J1LA 2YOGA 3TVTA 1JR3A 1NMZA 2V7QD 2CNWD 2JLQA 3CH5A 3THYB 1QHHB 3ZQJA 2CBZA 2QRZA 5DLQC 2P6NA 4URYR 4NBSA 1E9RA 1NIPA 3B78A 1E2GA 1SXJC 4DDTA 5FPKA 4FMCB 1ZUIA 3NBFA 4Q48A 4JBYA 4R2IA 3AVUA 3VAAA 1TU3A 1W49A 2F43B 3HJNA 2ZE6A 4TL9A 3QKTA 1EFRD 3I32A 1U8ZA 1NN1A 3I1FA 4QGFA 1T8TA 2IYYA 2YWFA 1UF9A 2XSZD 5CIQA 2JLRA 2ZI6A 3VFDA 3VQTA 1IY1A 1XPOA 4QL3A 4D0GA 3KDSE 1OFUX 4PSKA 1TEXA 2CLDX 4PR0A 5FR2A 4CGZA 2ZJBA 3HP1A 4AD8A 4EQ6B 3K0CA 1E94E 3SU8A 4M1MA 4NONA 1IN7A 2C99A 2YC2C 4D4JA 1KJWA 3OE7D 2CMKA 1G7TA 4RZ2A 2IWHA 1OV4A 3QG5A 4TL8A 1NI3A 1Z3IX 2BEKA 3PUXA 4RD3A 5JMTA 3C5HA 4A2QA 1SVLA 4Q5IA 2QNRA 3K8YA 4G0NA 3OEHA 3O8CA 4MA4A 3GJ5A 2G0TA 4Q9JA 3TRFA 1KK1A 2AXNA 2JIZD 2ZRCA 2ZJ2A 3GD7A 1NBMA 1ZM3A 4CEIA 3I5XA 1E2LA 1KI6A 3ZIAA 4XD7A 1P2TA 3H2YA 5K8TA 1RZ3A 3X1DA 3RS3A 4S2EA 1HURA 3Q72A 2G9NA 2FMXA 5FL7A 5JWOA 2GCOA 4WZAE 2GBLC 1PV4A 1S1MA 1W4BA 3P26A 4M4SA 4AKIA 4HAUA 2FPMA 2B21A 3L43A 3NBXX 4IFEA 3K70D 3ICEA 4QGAA 1ZU5A 1G7CA 2AHOA 2QPAA 3ZVRA 4DLWA 1EGAA 1GNRA 1ZM4A 2FGJA 4BRUA 1G6OA 1U99A 5DYIA 2O8DA 3ZQ6A 2ERYA 5FR1A 5L8VA 5SZKB 4C0KA 1FQJA 1T5LA 1AZTA 5A0FA 3CX8A 4IDHA 2H1LA 1CJMA 2ZSBA 2JJ1A 5FPSA 4IHQA 2Q3HA 2WIBA 4PZZA 2PEZA 3ZIAD 4FMCF 1MRNA 2VSOA 3RC3A 2N46A 4G5QA 1YZTA 2ZU6A 5EUMA 3L0SA 3UANA 1OB2A 1TF5A 1ESNA 1GFIA 1QHNA 2BJWA 3HWSA 5HZKA 2O8FB 2V6JA 1RC8A 3VKWA 1KMQA 1A82A 2VSXA 2VO1A 3CNNA 3T06B 4QNMA 4BEJA 2ZI7A 1L4YA 1U81A 2ZJOA 1XMSA 4NP6A 1KDOA 3VNVA 5TVKA 2ZEJA 2W0SA 4HAZA 3P1JA 2HJVA 3KKQA 2HT1A 4BUJA 3PCRB 2WMNB 1N0WA 3KQKA 4C30A 2FNAA 1KIMA 2AFIE 3BAFA 3KL4A 1CXZA 4L9SA 3KKNA 5CM8B 2I3BA 4DT1B 3NWJA 2O8EA 2ZUCA 1DAFA 2NOAA 4F91B 4CVNA 2BM0A 2GZAA 2EVWX 5JWRA 5JJLA 2A5FA 1MT0A 1RKBA 5IF9A 1GUAA 221PA 4N3NA 4KI0A 4PQYA 1N2CE 2FEOA 3Q3JB 4PAOA 1DG3A 1AM4D 2ZQ5A 1ESMA 2X1VA 5GJVC 1GNPA 1AJEA 4A8JA 2ASEA 4RZUA 1NMYA 3HPQA 2QE7D 4NCHA 5EJEA 3M1IA 3F8TA 1P72A 1TEVA 2CVHA 3IKJA 3OIVA 3QVVA 2QY9A 1E9DA 1C9KA 1N5IA 2F1HA 4GDFA 2OV2A 3LD9A 4PZYA 1E9SA 2I1QA 5CLLA 3GLFB 2D2FA 3HR8A 1WA5A 3FHOA 3CWQA 4GZMA 4IXNA 4DLYA 1VIAA 3I5YA 1MH1A 3SE0A 1HQCA 4C4PA 1BS1A 2VL7A 5JHHB 1M7HA 3MLEA 1LTQA 4NTZA 1WBDA 4DEXA 2RHDA 3UIEA 4EPRA 3U7HB 1I2DA 3K9HA 3TSOA 4QM7A 3K0AA 3UMFA 2WICA 3TBKA 2RGDA 2KJQA 3LVRE 4N0DA 4QHTA 2V4ZA 1XEWX 4D4KA 2SHKA 1L2TA 5EP1A 1CTQA 3BJIC 1MABB 3GP8A 1EWQA 1C1YA 3A4NA 1SVIA 1VG1A 2ZRLA 2IYQA 3CW2A 1Q3TA 5IK2A 1QHSA 3SFVA 4M9ZA 1TL7C 4RZ3A 3RDPA 2IC5A 3MCAA 5B58C 4BLTA 2OILA 1CU1A 1D5CA 5FTKA 1ZM2A 4XTRA 3OHMA 3CNLA 4U02A 5D3MA 5JBQA 3IQWA 2NTYC 3ZZ0A 2IYXA 2ODWA 1XPUA 1QDEA 4LDJA 1BYIA 1ELOA 3DZDA 3C8UA 3T15A 3DOFA 2NQ2C 2QMEA 5FUYA 1XMJA 4IOLA 2ZU0C 1CRQA 1UKYA 4EUNA 4G5SA 2QQ0A 1US8A 2Z4RA 2CCKA 4G5GA 5HCNA 5AJXA 2QAJA 5IK2D 1FZQA 2Y8EA 2ZS9A 2X2FA 3FMOB 1EFTA 4NL4H 1L7VC 3I8XA 1XBTA 3LWNA 4XIGS 4NE2A 2ZAMA 4H9GA 4PZLA 5CJPA 1NVWQ 2A9KA 3SHFA 3EXAA 1E9BA 1KKLA 1DADA 1PJRA 3QY0A 4NHOA 1LV7A 3E5HA 4B2PA 2B7CA 1TQ6A 2YVUA 4R7ZA 4BWYA 3HU1A 4C0SA 1Z6YA 2ZSFA 3TUZC 3AUXA 1YR8A 4ACAA 1IN5A 2D4HA 3A4LA 4IOJA 2P5SA 2BVNA 2IUTA 4EJSA 3FHCB 4CW7A 4KCGA 4XVQA 2BKEA 5FUXA 2WPDA 1EESA 4YMUA 5FBQB 2WSSA 4KO8A 4IFBA 1T8UA 1IAQA 2G1KA 1JAIA 3KXIA 4HAVA 4S35A 3GLFE 2FSIA 1TTTA 2WWHA 1W5TA 2EFDB 3BRWD 621PA 3P4YA 4B75A 1FMJA 1W2GA 1HUQA 1S9DA 4UNNA 3JZMA 3H86A 4M53A 1K5GA 1D2EA 1AKEA 4Q9IA 3SYLA 2YNMA 1VG8A 2A3RA 3BFXA 2O8EB 3PEWA 2GCOB 2OFWA 1F6BA 1YR7A 3LQRA 4MKFA 1NSFA 1Q20A 2AWNA 4FI3C 1E2FA 1ZW6A 3EZ6A 2PJZA 3CRMA 1G1MA 2E1RA 2R9VA 1UFQA 3I4LA 4L16A 4YMWA 5JEEA 2JLSA 5HR5A 1F2TA 1W48A 3RRNA 2WSSD 3D8BA 4YDHB 3P20A 1P9RA 4HYYA 4B2IA 2CCJA 4GBMA 1G3IA 1II0A 3BK7A 2GHIA 3C5CA 4WZBE 4MGZR 3V00A 2C04A 4L15A 3ZZUA 4BLPA 4WXRA 3U3RA 4DLVA 4YMTA 4TL6A 5FBWB 1XMIA 2QQEA 2VHCA 5GVRA 4KHZA 1CR0A 3WP1B 2ZREA 3EIEA 2EFEB 2B92A 4YXWA 3W34A 1SXJA 2NPIA 5EP3A 1Z6GA 1E2DA 4D0LB 3FKSD 1F5NA 4P33A 4EIWA 3OIWA 3KQNA 5FOXA 3MGCA 421PA 1L8QA 1DVRA 3X2SA 4DC9A 2H7VA 1MABA 2PEYA 5GADl 3AVPA 1ZIOA 2WWGA 4URXR 2QGZA 4QBHA 4TLDA 2WJGA 3BOSA 3ADBA 4V03A 3TLXA 4Q4HA 2HF8A 3NDPA 2FFQA 4EFNA 3QXCA 3W6OA 2P65A 1QHXA 4XVUA 1XCMA 4QBGB 5F2EA 2KI5A 4Z8XA 1Z28A 2WJVA 3WNDA 5FH9A 2ZUBA 2NGRA 3AGPA 4I4LA 3QE0A 1CULC 5KHOC 3BFVA 2VIIA 3EZ7A 4JL6A 5GJCA 1HQYE 3SFZA 1XPRA 3IILA 3LY5A 2JLYA 1B23P 3X1WA 2JLUA 4O0MA 5JRJA 3EAQA 2REXB 4L4UA 3IBYA 3QF7A 5FBRB 1E0KA 1WE2A 1PZNA 3AVYA 4TMZA 2XZLA 4QGHA 4QJ4A 5BYJA 1RRFA 1TQ2A 2PZFA 3E70C 4OKSA 2QMHA 2GDJA 3LBNA 3NXSA 3NBZC 2C9YA 4ON9A 2D7CA 4LZZA 1GM5A 3RRZA 1OXUA 4B43A 4BLQA 3KXLA 2NO1A 1G5RA 1E98A 1E3MA 1KAOA 4P4TA 4B2LA 1BMFD 3LX8A 3ASYA 4WW0A 4YMSA 1GRNA 2DR3A 2ZRFA 5TDHA 1G3RA 2C2HA 2J87A 4LYAA 4C7OA 2N1BA 5CK5A 1J70A 2A30A 5KDDA 1H8HD 1AN0A 2VEDA 4BFWA 4BFSA 5AJZA 4NH0A 2HDNB 4IKEA 2GA8A 1W46A 5J5CA 4JJKA 4KXFB 1JPNA 5BN4A 3SJZA 3CLVA 2QP4A 1NLYA 1CJKC 1NMXA 2XTNA 4Q4HB 4LX0A 3PUVA 2B8WA 1ZUNB 4PTLA 2FH5B 4KLZA 3AKCA 4CT4B 5EUQB 3C41J 2ZVPX 3QENA 3FMIA 4LJ9A 3I92A 3TK1A 4ZI2A 3LAWA 2RGCA 2GTPA 4NCNA 3K70C 2XSZA 1BMFA 3A58B 3KB1A 4KODA 3UK6A 2V6IA 1ZCAA 2HYIC 2RGGA 1DAIA 5B64A 1DOAA 3TQFA 4DCSA 4LCBA 1SULA 3OE7A 3FYHA 2YWEA 4A0HA 1GP2A 2B6HA 1JECA 2OHFA 4DLRA 1GRQA 1SVMA 3LBIA 3C15C 4LWZA 3B82A 4X8OA 2IS6A 1DS6A 3SQWA 3KQHA 3HU3A 4KSCA 2MSDB 1KI2A 1Z0KA 4B76A 4GMXA 1YE8A 4DSTA 1Z2AA 1WP9A 1KI4A 2VF7A 5C18A 2QI9C 1XJQA 4CEJA 2R8RA 5FL7D 2OCBA 1LVGA 3SI7A 1S96A 1PLJA 2V54A 4PPNA 1P6XA 2N42A 3IHWA 3J81k 4G01B 4QBIA 3A8TA 3KJGA 4EFLA 2ANBA 5E95A 2WKRA 1XD8A 1W4CA 2QM7A 4L8GA 4O25A 3GEHA 1BYUA 4P32A 4RKFA 2WJIA 3KX2A 4A1FA 2FPLA 2OESA 2VP5A 4ABYA 1EFHA 1I2MA 4BFZA 4CIDA 2QA5A 1DARA 2GEDA 5HE8A 3ADKA 4AG5A 4QC2A 3QG1A 2KWIA 4HDCA 1W1WA 1M34E 4BFVA 2O52A 3SC3A 2JJ1D 3AKDA 4ZI3A 2ZRGA 5K8LA 5EE1A 3LA6A 1UKEA 4K46A 1GL7A 3TAUA 3THWA 3K70B 3N5CA 2J7PD 3NH6A 4PC1A 2F9LA 5KPJA 3PEVA 4D26A 5EP4A 2W0MA 1GDDA 2ZJ8A 5EE5B 1CLUA 2ZRIA 1J99A 4MDFA 1DAMA 3BB1A 4PFSA 2OBMA 1T0HB 4LC0A 5G3YA 3D3QA 2A5GA 3BD9A 5KNDA 1FX0A 2XZPA 3CZPA 1E2IA 4GOXA 2ZYVX 3X1ZA 3QOFA 5HCIA 4BRWA 4HDQB 4E07A 2OO7A 3A37A 1R0WA 2QAGA 4FXPA 3AF1A 4MRRA 2J7PA 1AS2A 1DPFA 4TYYA 1ZC4A 5CYPA 4W7SA 2YJTD 1T3LA 1E1QA 4TN1A 4K8OA 4H1VA 4L9WA 4TMTA 3O47A 3Q5EA 4MGKR 5CJ2A 2WJHA 2DCUA 2IUUA 2V7QA 4UXHA 3REFA 2A5JA 3RS0A 1XTQA 2PLRA 3WY9A 4YC7A 4PSVA 1HY3A 2GEVA 2QE7A 1CJTC 4DLUA 2BMEA 4NDZA 1E0SA 1R6BX 4EPWA 2IW3A 2W00A 4U5XA 4TLBA 6Q21A 4TQUS 3AM1A 1JR6A 3MWKA 2O0HA 1NY5A 2PZEA 3CWZA 1MKYA 2IYVA 1LF5A 2Q3FA 3I8SA 1DO0A 1SZPA 1XXHB 5G40A 3AB3A 5J4VA 3V4RA 3A1TA 2ZRHA 1GOTA
chains in the Genus database with same CATH superfamily
4BNJA 2IHKA 2D8AA 3LRTA 3NHJA 1VIDA 4K6KA 4HEJA 1FU8A 5FBKA 2H2FA 3PFHA 3I5UA 3TM5A 3L8EA 1L4FA 3GH1A 1DEKA 1V3UA 1E9AA 5C8VA 4LJRA 3UJ9A 4C4SA 1TU4A 1NXPA 3LUHA 1ACLA 3M6IA 3SPXA 2CDBA 4EUHA 1YBFA 1QFSA 1O9BA 1EG2A 4M37A 3HCDA 3C4QA 2GTHA 3V4ZA 2HRBA 2JDID 5EQJB 4M0MA 5AVWA 4D0NA 4N6OA 1QAOA 2Y0BA 3HN2A 3JWEA 1FPQA 1GA6A 4YX9A 6NULA 3KLNA 4JZKA 3HY4A 5A7HA 1EJBA 1CUHA 5TPWB 1O4WA 4H4CA 4F3RA 4EG3A 4LN1A 1AA9A 4TVSA 1SCIA 2HLDA 5K0CA 1QGAA 3KQVA 3VKHA 1QYXA 1WXFA 3E9NA 1KPGA 1RFLA 2QD4A 5EA2A 3W06A 3TI9A 1X86B 1K5PA 2NADA 3BBLA 3F2VA 4EVQA 4KWIA 3NM4A 2YKGA 2DR2A 2QM0A 3N2GB 3UPUA 1RAIA 1TYDE 3E22B 1N1EA 4FB4A 5CAEA 1ORDA 4QULA 1W85A 1GT6A 2JCGA 2DCMA 4J0FA 3LWBA 2A7QA 2X86A 4FYYA 4ML3A 1SHKA 4PBTA 3TR0A 2JANA 2OBFA 3OZXA 4LECA 7MHTA 2R6GA 1RACA 3OE5A 2OKCA 2P9QA 5DX8A 1X19A 1XNQB 2ZUEA 1VJCA 4HN2A 1PW5A 3B2QA 4RX1A 3IAUA 3LZDA 5FWXB 2L82A 3PQ3A 3KRTA 3K5PA 3VU0A 1ZK0A 4OM7A 4C0BA 4UMEA 5EIBD 1YK0A 5EJ6A 3PC6A 1Q0QA 2AOTA 1PK9A 2G28A 1I9GA 3R9IA 4JJIA 4EHBA 4AJPA 5THKA 1JXMA 1XTRA 4X61A 1U9YA 3K4PA 2AK2A 4Q3NA 4BX9A 2IE0A 4EJSC 4UBKA 3RH0A 5K4GA 3NAGA 1WXDA 3EIFA 5EE3A 5L3QA 1PSWA 1ZFNA 5FPTA 4AURA 2X76A 4CKEB 2VJBA 2J6IA 3JWIA 5FWYB 2YUIA 3V7WA 4B3FX 4BQPA 3LC2O 1BOOA 4M87A 5G02A 4LPKA 4B44A 2YJ4A 1XZLA 4I9NA 1UMCA 3IDFA 2NPFA 1IB0A 1JG1A 5K6TA 4ZVOA 1V2HE 2BSXA 3CRW1 3TOVA 1CK4A 4TMFA 2PBZA 1D4AA 1TC1A 1D2RA 3A1EA 5CURA 1IBKB 5LBUA 1KMHB 3KDAA 5KTKA 5LQRA 3MXOA 1S0UA 3UJCA 1KS2A 3IOEA 4S1OA 1XQVA 3MJHA 4NV3A 5DZSA 2O23A 4AMZA 2K7FA 4Q1DA 2C4NA 3CGWA 2AN4A 2JFWA 1A8IA 1BVYF 3B1VA 1KZ7B 5ECGC 4MR8A 2Q49A 2Y77A 2AX4A 2FKNA 3BRWA 2GZHA 5KSOA 1VJGA 4NXNB 4XWAA 2QTAA 5HUJA 2WD7B 4WN9B 2CVQA 3L4BC 3VZBA 4HDMB 4RQUA 1A8PA 1Q1NA 1H2EA 3NEJA 1XLTA 3G89A 3QFRA 2PQ0A 1HT0A 2A5LA 1DXOA 2JHFA 4JLSA 2AFHE 4MLCA 3HU5A 1O77A 3IX7A 4CMKA 1YXMA 4PHTA 5K45A 1V8DA 1ZP6A 5EHXA 4YP5A 5LFAA 4R3UC 3D31A 1B14A 1G8KA 2ONKA 3IR7A 5LPNA 4AB1A 5JMOA 3N1UA 3CE6A 4GXNA 3KZMA 4MNTA 3EX7C 4X60A 2EX0A 1WDLA 1LJ8A 2YYZA 3R6LA 4MQLA 4H7JA 2O2HA 4JJZA 5HA5A 3F49S 3AERA 3ZTTA 3MTDA 4WK0B 1SU4A 4Z1MA 4CR6A 1DJMA 2XQFA 2J4FA 3CUVA 4R9SA 4B0PA 1GNQA 5AIBA 3I2GA 1QFZA 3MJ4A 4OYHA 4OYLA 5EFOA 1EFPA 1H3NA 3R7WB 4E1VA 1L4MA 3RK4A 4KITB 5LOVB 1Q1BA 1UOEA 2CXNA 4F5YA 3HDYA 3ROQA 1SZCA 1DJOA 2A78A 2OM2A 4MWGA 1MRSA 2F4VB 1AKQA 1IY2A 2VAMA 2ZI5A 6ABPA 2HI0A 4JQYA 4JP3A 2E49A 1DUIA 3NEAA 3PQEA 4KMMA 4HGQA 4RTPA 4I6EA 1VYUA 2VHEA 1JYFA 1M2FA 2ZRPA 4CYMA 4E70A 3GFVA 5KYYB 2O5EA 1O0SA 1ZC3A 4I4CA 1PL0A 3NNDA 2FQXA 4MVCA 4Q19A 4WN3A 5H8WA 5ETJA 2XB8A 5C8YA 1CR2A 4NH4A 1IUPA 2JJ2A 2OYSA 5FBHA 3AJ9A 4MV9A 5FBZA 5IN4A 1U02A 2C2MA 2OLJA 3CS3A 3DAHA 1P5FA 5KBYA 4TRJA 1RJFA 3T7JA 4A8JB 3F96A 1YKGA 1BDIA 1IULA 3NKLA 1QR2A 4NU6A 2PL5A 3KZVA 4MVYA 4WFIA 3UMVA 4O1HA 1A71A 3TDKA 1QBGA 2XXBA 3X2FA 2OGTA 4RKWA 5B3KA 3IAS6 4QDTA 1QC5A 4RJ2A 2ACVA 1CUBA 1L4LA 4PYQA 1USWA 1NDUA 3OZFA 2GT1A 4HHEA 1N1MA 1G2OA 4DLBA 2QX6A 2PMFA 2ZPAA 4G8CA 2OKGA 3TGLA 3UWKA 2DG2A 4JZYA 1JFVA 4QBTA 1ABBA 3CSUA 1C2YA 1PJZA 3G9UA 1XCGB 4PLGA 4F5DA 4UTOA 1X9HA 3GGDA 3C7DB 1RP7A 4OOFA 1RBZA 3X43A 3ZU6A 2UXCB 3GCGA 2NUTA 3WVNA 2NO5A 1ZVQA 4EMSA 1V25A 4YV1A 1I7DA 1FU7A 2ACEA 4GQBA 4KKVA 4V0MA 1IXKA 1MOQA 1VLHA 4I9FA 1S8FA 4PXYA 5DXAA 4RO0A 1W0JA 3V55A 4ZAXA 4KO4S 5DK4A 2PGIA 1VTKA 1HTTA 1L8AA 3ZHZA 3EEYA 4JH0A 1PL8A 1UK9A 1ZL2A 3IMFA 1POXA 2H07A 4YONB 4E6EA 5AUNB 2A9JA 3I1JA 4BMCA 2JARA 2SCUB 1RXUA 2LUOA 4CN8A 2WAOA 2WJJA 4BE7B 4R54A 2GS9A 3V8PA 1C8LA 5F77A 4O3MA 1E2MA 4J43A 5DO9A 4EFMA 1QVRA 3I9KA 1J9ZA 2BGLA 2YXPX 2OK7A 5D86A 1L3IA 2QUKA 3DL2A 5IXSA 3UYLA 3OIDA 4E2FA 1ZW1A 2YQ4A 3M3DA 1W96A 3G0DA 1UMCB 1UXOA 2YMQA 4C3OB 1KU6A 4II7A 4Z51A 1FTQA 5FA5A 2FW1A 4GX0A 1E6CA 2ECQA 4J0JA 1P62B 3O8NA 2AI3A 5BQ5A 1JEAA 1ZWLA 4R9NA 1O3YA 2C2OA 4F3YA 3WLMA 4H7FA 3HU2A 1G60A 1NI4B 1U3VA 3EZLA 3FR7A 1YZHA 3EASA 3N2YA 2XADA 2BDTA 2IY9A 3GUUA 3ZK8A 3UGQA 4P8RA 2WE8A 3QNWA 2ORYA 2D00A 3EVFA 5JDIA 4R51A 1OA0A 3QU5A 4I55A 1IK6A 1U9CA 4FGUA 1MX9A 4KIGA 4LRTB 1YOBA 3TLAA 4KFCA 4O2BF 4YV0A 1D2MA 3VNRA 1AU9A 1NLUA 4YRAA 4YB8A 4EPYA 1IEWA 4OQMA 3HZRA 1L7EA 2VJKA 4PZ9A 1TZJA 1U0FA 1M0EA 3SR3A 2JZNA 2EOAA 1Y6RA 1ADCA 1QZXA 4G1CA 4JT9A 4QNRA 5AVTA 3DE7X 1ULSA 4IIHA 1DJQA 1O94C 4HNRA 4D9KA 1CNFA 4QTUB 4OTZA 1FYFA 4TS3A 1YA8A 2JHAA 3I12A 3JD2A 1SC6A 3IB3A 1U0JA 2IEZA 3DC7A 3ZQ4A 6LDHA 4MQFB 1LC0A 2B4QA 2CZQA 3MOIA 4H77A 2ODBA 1IY9A 3MGAA 1F0PA 3MWDA 1GGKA 2K4MA 3IIIA 1GPDG 2RH9B 1KDVA 2GPWA 4G86A 3U7IA 5FB3A 3PEFA 1F06A 4XCXA 5K3BA 2WP0A 2NWQA 1I32A 4US2R 3BRQA 1OXTA 4XM0A 3AONB 2Z6VA 1MGOA 1B43A 1Z68A 5EP2A 3R7WA 2XUDA 3Q1KA 2J67A 2QPOA 4B3SB 2O8BA 4JI4B 4KX5A 5CB4F 2RIRA 1YH3A 5WRFA 1YZFA 2AKEA 3VKFA 1TTHA 3FVTA 3QFFA 3ZE1B 3ORFA 5BSKA 4MVJH 1ZQ9A 3N8GA 3RK1A 1CRZA 1YB5A 2W6QA 4UBMA 1G38A 2XF2A 4LKOA 2ZM5A 4MUFA 1QIIA 4MUEA 5HOQA 2FXIA 4FFBB 2DYKA 4KBGA 1U5BB 5GM1A 4ZYUA 1C7RA 3T1YB 4R2WA 1QTRA 1EJ6A 3CJTA 2AA3A 3LY8A 3IBTA 4LYHA 3FPCA 3WA6A 1FDSA 3AQ4A 4YT5A 3FIJA 2VTEA 4ZU1X 2PVCA 4FCCA 4FX5A 3D1JA 4FPXA 2GM9A 1RJ9B 2PLAA 2VXCA 2ZAOA 3D7LA 1XF1A 2XAUA 1ZD8A 2QTVB 3EODA 5ELMA 4C4TA 3GEIA 3VTFA 3UAYA 1IQ0A 3LI2A 1PJ4A 2JASA 5C5IA 2DETA 1CUGA 3L8ZA 2DWPA 4YALA 4A92A 3O2JA 4BEWA 2R8EA 3FKJA 1LBHA 3UHOA 4XARA 4L75A 1H6DA 1VCHA 4GPEA 3GEDA 1A4IA 3BWVA 2R8ZA 2Y1WA 2IUSA 3MWYW 5BV1A 1K98A 3A2KA 2XODA 2SCUA 1B7GO 3IP9A 2CJYA 2I3DA 5IMSA 2M6RA 4RFVA 4J1TC 1UPTA 1KI7A 3LCJA 1Q0PA 4JOSA 2Z09A 4WESA 3BE6A 3QEKA 3RUHA 2DFTA 2WEKA 3B51X 2ZI3A 3BULA 4N3AA 2UXBB 1FNBA 4BQEA 1T5IA 2K2QB 2FWRA 2MT9A 3BZUA 3O95A 4L02A 3RS7A 3LHSA 2ZPTX 3OEYA 1PJSA 1SKQA 2C83A 3IE1A 3GQBA 4DLKA 4W6ZA 3WB9A 1TQ8A 3DTNA 4GVXA 3VHXB 2VJMB 4AL4A 5DW0A 1UPUA 3VR5A 2AEMA 5FOSA 4CR8A 3AVXA 1KWKA 5HEKA 3T3GA 3EA5A 3KM0A 1B1AA 2HIAA 3OKFA 1WSBA 2JBAB 3JQ7A 4RAOA 3IUNA 3KZNA 1HZZA 4YK7A 3RBXA 1NNEA 1NKSA 2BBTA 3A6EA 4DNQA 1S8AA 3JVDA 3TPCA 3A0RB 1KZ6A 1UIMA 1T2NA 3E2MA 4N7BA 2RB4A 4R68A 1LZLA 4TXMA 5F7JA 5A05A 1Z18A 3R0ZA 4XDGA 1T4BA 3MA0A 1NJGA 2XYVA 4CMJA 1MO2A 1T2VA 1BCSA 1YD7A 3UOAB 5AKYA 3IEMA 3FFBA 1K97A 3S8MA 1G5TA 1N75A 1BCSB 2W2LD 3BC1A 1P3Y1 1WDTA 1DQRA 2AC7A 1PD0A 5KCMA 4J49A 2LCQA 4N39A 4N9WA 3F4LA 3AR7A 5DMHA 5HQTA 3R7AA 4KXYA 1F0KA 1RYZA 1ZGHA 2WFZA 4MSUA 4HNTA 3THXA 1ZMBA 4JL5A 1XRLA 1GUBA 1RWNA 1AUOA 1VKHA 2AVNA 5K03A 1U9ZA 3EJ6A 4QE3A 3KTFA 4UJ5A 2BV3A 1ULHA 2VJAA 1T9GS 1DKRA 4HWPA 2XIJA 3Q9NA 3QF4B 2ABWA 4R98A 1ODSA 1OLOA 1VL2A 4ND5A 3U7EB 5L51A 4JOQA 4DA7A 2WG1A 1VHLA 2XNSA 2EIXA 3BCHA 4TSFA 2V97A 3D2LA 5EGNA 2AR7A 3LGXA 3GLIB 2FUNB 2PXXA 4F06A 2CDNA 2GN0A 3I53A 5DM1A 1O87A 1OU4A 1OY1A 4HB4A 5BMOA 5JH7B 1LTKA 4YRZA 3UAXA 4MKIA 2BBWA 1LF0A 1I24A 3LT4A 5T6BA 3TRJA 3TEMA 2NTNA 1YI1A 5CXSA 5AW8A 3SHVA 2HLDD 5K0TA 2VRBA 3KV1A 3QX8A 2IH2A 1JZSA 1YJ5A 2I3GA 5HJ5A 1W35A 3D6FA 4PNPA 3VM6A 1RQPA 2I29A 2Z04A 1XZFA 2B20A 4M49A 4QREA 4UATA 4ZGBA 2NYAA 5JV5A 2O8VA 1SXQA 2WM2A 4OQXA 2CUZA 2BMDA 2H1IA 5EOVA 4YBRA 3GT0A 4PGHA 1L4UA 1ZAKA 3PXGA 4EA7A 2P9EA 5A06A 5GGYA 1J2YA 2CE7A 1BAPA 3AY7A 5AM5A 5T67A 2YJ3A 1E0DA 4X20B 2FN4A 3M6AA 4RL4A 3D3KA 1LQTA 5GONB 2DY0A 4N3BA 1MENA 2FSSA 1T10A 3UJHA 1NULA 3CT6A 1K27A 4KQXA 1RYMA 4Q3EA 4NKRA 4RA6B 4JLNA 1U0BB 5P21A 3QSYA 2UUPA 3E53A 4Q24A 4YHHB 1L4KA 1SA0A 3HN7A 3U37A 4BJ1A 5KQPA 5HF8A 1J8FA 3R7LA 2IEAA 3OEHD 3VISA 2VHTA 3DWGA 5AVRA 1YS4A 3V4FA 1DC8A 5EIEA 4TTSA 4EKDA 5CDSA 5HYVA 2QTFA 3H42B 1N6NA 4NPAA 3QVKA 3G1TA 4ZXPA 5TV2A 1BWRA 2XDYA 3TX6A 5JYCA 5K8IA 3QVWA 4QJ5A 1IZ9A 1ENPA 3MLAA 2QIOA 4TYMA 2JAQA 2FW7A 2MMGA 4GEGA 4ID3A 2QZPA 3PDHA 2CVFA 2GF9A 4ZO8A 5ALGA 4YROA 3D54D 2EZUA 1V48A 1SMKA 3F7NA 3GW8A 2FX3A 3WR5A 4AC9A 4AP6A 1MW8X 3HABA 3IQXA 5A62A 4NCXA 4IS3A 1H3FA 1ILWA 4J4TA 2QIPA 2X6RA 3ITKA 4NCJA 3C0KA 4MHOA 1Y4AE 4Z4IA 1OIVA 2HA4A 2SKCA 4E15A 4WCVA 2PUBA 4ZHQF 4CM7A 1I7PA 2YR0A 3GEEA 5DGTA 1TOAA 1NI5A 1EXNA 3I01A 3PGA1 4N6NA 4D8XA 5JDCA 4L50A 2UZ0A 3TXAA 1RADA 2LP4Y 4CM5A 3TOXA 3SBDA 2X3YA 3BZWA 3P5SA 2X8JA 3O8OA 2H00A 2A0FA 5K0GA 4U7JA 4TT3A 2JD2A 3C6YA 4JYCA 2W22A 1GSOA 4N0PA 4OBWA 3U16A 3PVSA 2NU7A 4UE3S 4FYIA 3EWSA 5SICE 6REQA 1PP4A 3M4NA 4Q4AA 4IDEA 2Q21A 2ST1A 1W5FA 1MGPA 1XPJA 2ZE5A 1UM9B 3Q12A 3PT9A 4YFYA 1HNXB 3CONA 5CB8A 2HF9A 3VNBA 2W6JD 1BXRA 1XDUA 2GAJA 1BG6A 4LRXA 5D2CA 2HA2A 3L0ZA 5JJKA 4I99A 4WJKB 3T12A 4Z1MD 5LLDA 4K9KA 3FNRA 3RKUA 1RLUA 4GPAA 1QTQA 3MB8A 3MTBA 5EXSA 2P40A 5A0TA 4I5EA 3GUHA 2PD4A 3TZEA 4NF2A 5JSYA 3STWA 3AT1A 2NTVA 3QYAA 4F46A 4R3WA 3ND8A 4DR5B 1SCNE 1YQTA 1HKHA 5JAUA 3DB2A 3L9XA 4E5YA 3ECCA 5FYDA 1OTYA 1OUMA 4WIAA 3LOUA 1PFQA 2IKSA 3JQFC 5B4VA 4E4YA 1GQYA 2XUOA 4J9UE 4ZAWA 3B8EA 4IF6A 2NUTB 3LVQE 3KQPA 4IVPA 4MWCA 4S2UA 1P2FA 4JLMA 3JRXA 5B1IA 2UZAA 4WE3A 4D8TA 3HLTA 4FWIB 5DH9A 5H4HA 4HNGA 2OXIA 4A9AA 2G09A 2C5HA 3IDSA 4GZLA 1RE1A 4P92A 5IP5A 3U3DA 3M1YA 4ERXA 1CYEA 1HQDA 2YHIB 1CUEA 1Z4KA 5DTIA 2BMAA 4Q7KA 4EI7A 1ADJA 2B7LA 2ZYDA 4FU0A 1J2EA 2JLWA 1ZZGA 5IJ9A 3I58A 4OG2A 4EJFA 4QDUA 4V38A 5D6OA 3O7MA 5C5DA 4S05A 4U2DA 1D7OA 4OAQA 1LLQA 4FDVA 3KO8A 3SBEA 3E9DA 3VYRB 2I91A 3MM4A 4RLQA 3DZBA 5BXQC 5I7VA 1OH8A 3REQB 1JDBB 3CLUC 2WU1A 4WZ6A 2J4DA 1F60A 1OROA 2X22A 5K3FB 4GR4A 2P6OA 1TRKA 2UYYA 4RHCA 2BTQA 4WGGA 3UA4A 4OYYA 2ZI9A 3EEBA 4NZPA 2V7BA 4W8OA 4BO1A 3ET5A 1JKFA 1O08A 3AM4A 1NBHA 3DDOA 4GUDA 4QT0A 3L7KA 1FXUA 2GERA 3LQ1A 1RBMA 4WADA 3FBGA 4R0NA 1X1BA 3HO8A 4X8LA 4ZAZA 4BNKA 1T6NA 5DISB 2AMJA 5IDWA 1V7CA 2I7VA 1H6AA 3LWZA 2C82A 1JQBA 5CT6A 4DUYB 3RC8A 3U60B 1G64A 3AZQA 2BH2A 1W0JD 3WZLA 2GPBA 1V43A 4O2BB 1NG9A 2F3QA 1SG6A 3D5QA 2E5LB 1N7IA 2RG1A 2TMKA 2V7VA 3ZDEA 1AMUA 1RBYA 1B0ZA 2GN9A 2BGUA 3MJFA 4B83A 1VJ0A 2VTBB 3PQ2A 3FGNA 4KQWA 3SJ7A 2W2TA 1RHUA 2VPTA 9ABPA 2OHJA 2VH1A 5DKFA 5KTNA 1NMQA 2DT5A 4RA9A 1Z7BA 4PZEA 1XZQA 2DPXA 3DXXA 3LHDA 1N6IA 1FX0B 4X64B 4DAEA 2QJFA 4M6WA 3B9BA 2C5AA 2QPTA 1OGIA 4JVSB 4DIEA 4KH1A 1FW6A 3MSCA 1P5ZB 4NPCA 3CB4A 2ZYSA 3GLFA 1SAYA 1DEOA 3RBZA 3PPXA 1UC5B 3HBAA 5DHUA 1VBFA 2AMFA 5I8ZA 3V9PA 2JG3A 4LF8B 4Z49A 2QL7A 2XTZA 2YJ5A 1O94A 4Z5XA 3FJ1A 5F1YA 2IPOA 5LQAA 2FJUA 1PS8A 5FX2A 5HKLA 1RHMA 2A1IA 3B52X 2RI0A 5AKLA 2FAXA 1XO1A 4WRRA 2C92A 1IG0A 1UFRA 4IDGA 2WUWE 2ZR7A 1QWSA 1XOIA 4JEIA 1KSGA 3TG2A 3PE4A 2EKDA 3NEYA 4NYMQ 3EHEA 1Y7TA 3V8NA 2YXBA 2R65A 2PX8A 3KFXA 1PFVA 2Q4OA 5CDFE 5I48A 8MHTA 2CXUA 4I5IA 1VL6A 4KWTA 4TKUA 3VR4A 2HR1A 1HOXA 1VL5A 2CNDA 4BWGA 3U7QB 4C0AC 3M9LA 1UANA 4M60A 2BOVA 3ETGA 3B9QA 4UHEA 1JTFA 4DB2A 2HHCA 1I14A 2EYUA 2IQ5A 1K2VN 1VDZA 4MR7B 1A04A 4L9AA 3LBHA 5AM0A 3NOVA 4EAQA 4FDTA 3PRYA 4IGFA 2BGWA 2EFGA 4MR7A 1Y81A 4MRSA 1A1SA 5LVAA 1Z9BA 2GVNA 3V3KA 2KYRA 2ZAYA 4JVOA 1FUYB 2NNWB 1CETA 4EY6A 4X1IB 4PHFA 4ZZ0A 5JS7A 5K6AA 2QZ4A 2FFBA 5FYQA 4YT4A 2J3HA 4A3SA 3RUEA 2VYNA 1R0KA 3WWPA 2XWQA 3EW9A 3U3JA 3UPDA 5P8WA 4AN4A 4OHXA 3MSXA 1U94A 4PYIA 3ENNA 1PWZA 4X66B 3BWDD 4H60A 1N5MA 1UKVY 3FTDA 2WIKA 2I99A 2GPSA 2ZB3A 3NDJA 2W2NA 3DVAB 4M1SA 4G2TA 1ZI6A 3RB8A 4D9FA 2V5UA 1R0CA 3FNBA 4NLLA 4MROA 2H29A 2LDXA 3HB5X 4HN9A 5IBQA 4WAUA 5JCJA 2XRZA 1CIPA 3O4VA 5CA1B 3L18A 3R8FA 1C1DA 3B2EA 5DWDA 4YRPA 3NKFA 1UFKA 1GPNA 2O3RA 3NV9A 2B3DA 3L9WA 4HH4A 1OVGA 2X2EA 2J48A 4JROA 3E6AA 4ZEOA 3V33A 1JA9A 2MR6A 4O4HB 3L4KA 2HFKA 1CVRA 2YHAA 1NR7A 4NC9A 2W93A 3EFEA 3GA7A 3TIVA 4ITRC 5A4DA 4LXIA 1AVTA 1RWKA 4HWSA 2CT8A 5L6LB 3T1OA 1IUOA 2C1EA 2XMGA 3ZGZA 3ZGNA 3OKPA 1GR0A 3R0XA 4G1EB 1QIFA 3DO6A 1GAXA 1YS1X 1Z2CA 1Z34A 5A4AA 2X4IA 1IWPB 1H2XA 3NGXA 4HLDA 4J0QA 4YRCA 4JUIA 1Q14A 2JD0A 2QP9X 1U80A 2IJGX 4NG5A 4JP5A 3ZCPA 1KDRA 1WO8A 2FF5A 2FMIA 4P7JA 1SUFA 2YH2A 3RR2A 2DHCA 2J3DA 3RFVA 3RUAA 2WTUA 1P9NA 4WNCA 2VHVA 4FKMA 3UJ3X 4V0RA 4MVJM 3QA3E 2HBRA 5M04A 1NKVA 1KDYA 3UUWA 3FKSA 4MOWA 4GQAA 3R9WA 2VXOA 1JT2A 1IJBA 1KI3A 2B61A 1SVKA 2FSFA 3CZRA 5LA6A 3VKUA 1XQWA 3AIIA 4UNPA 3JZDA 1E2EA 4V03A 2ZBEA 1T8PA 3FI9A 4JBGA 1TFUA 3PNMA 3K94A 1NAHA 3UJDA 5EGSA 3NIBA 5F3DA 5IAKA 3RUDA 5J43A 4B32A 2WWTA 4G1MB 1CS4C 2HA7A 2ZTSA 1AHNA 3INRA 3MQ2A 4RCYA 2A6PA 1BWSA 1UBGA 2F2TA 1VKOA 4FJ1A 2BFPA 4EPVA 1RVDA 4E22A 4AY4A 5KYUB 4UJ3A 3IMCA 2OXCA 2XCIA 2HUPA 3QKSA 4YO8A 4LF9B 4LYJA 1GITA 4M3NA 4EWLA 1NT2A 1Z7YA 3JCZA 4NU0A 4KE8A 2FN3A 3ZY6A 2V1UA 5A4FS 2FR1A 4J0CA 4RXMA 4YMIA 3WRVA 1PR6A 1YC2A 4M8NE 2HEIA 3MWJA 1ZCFA 4UCQA 4ZVSA 3WS7A 1UIRA 2XCTB 2JZCA 2R2GA 1W1UA 2X9GA 1IQRA 4I50B 3DONA 3QEMA 5ALWA 1B74A 3EZYA 2VDMB 4V1CA 1GPUA 3HM2A 3PLRA 4RANA 5KJ1A 2J0VA 4B3JA 1OI7A 4FONA 1OASA 4DHWA 4YCJA 4BRZA 1VLJA 2GM3A 1OLXA 2C7VA 5B1YA 1NSTA 2PMKA 1Q15A 3QWHA 1EB8A 1YZ3A 5I4BA 1QH0A 1XVVA 4HUQA 4FCWA 3T1TA 1JXOA 4MVJF 2EQBA 3RGGA 1XZHA 3OZDA 4MDEA 4DIBA 4NI5A 5CVUA 1PYGA 4ED9A 4M76B 3C6QA 3GARA 5DN6D 4LGMA 1QOQB 2JH3A 1UC4B 1LQ2A 1NQ5A 2HY7A 3LFUA 2BY4A 1LPBB 4GQIA 4PX9A 3GXOA 4WCFB 1TYEB 2FUG6 5I9SA 4H3VA 3R4CA 1IONA 1USIA 3G88A 3OI7A 5HTKA 1P9OA 1QHIA 4NEQA 1KTIA 5JD4A 4I1SA 3ZBQA 1F1JA 1SQSA 2ESRA 2OMEA 1CY8A 1IJEA 5CRIA 5EWJB 3DKVA 4CM4B 1WUTA 1ECPA 1H8HA 1URPA 1JQ3A 3RVBA 1DKUA 4YRGA 2ZIAA 2RHMA 4YEDA 1SB8A 1G17A 1T4CB 3EIQA 2EGHA 3ZI7A 5AM3A 3D6MA 1VL0A 2RCNA 3CHYA 2V3CC 5DGIA 5BMVA 3SJAA 5CFRA 1DV2A 2AXPA 1KMNA 4TMKA 5BNZA 4JUFA 2V6MA 1JZTA 3M8KA 4H6VA 2FP4A 2JB9A 4NESA 3T4EA 3C7TA 1W581 2PK3A 3HHEA 2J8ZA 3IVXA 4QU9A 5IZCC 2HA3A 4Q0MA 3IOMA 1N6PA 1RQ7A 5TGZA 1D0SA 2QRVB 5HK8A 4DCCA 2HMVA 1KNXA 2VZEA 5EVCA 3ERCA 2FX2A 4HZGA 3MTGA 4GBGA 4J1SA 3B6EA 1MQ9A 3L82B 2IL1A 5KOHA 1UDRA 2O5VA 1ODIA 5GONA 2PRIA 3T38A 2JKVA 4XX0A 3WMWA 2CLLB 1BN6A 2JLAA 3BDAA 3HC7A 3TJZA 5SYAA 1BE1A 1OF1A 1NQUA 4JJAA 1KO5A 3GPLA 4CEJB 3S2EA 5B55A 1Y89A 1WABA 4PZ0A 3NAZA 5AKJA 2R1TB 2F1IA 2PXHA 4YRMA 1DFIA 3JS5A 4ASUD 5AYVA 5CFPA 1JMYA 4DXDA 2QGNA 2VCEA 2YCBA 1PVOA 1S9HA 3ORRA 2HREA 1CQIA 5KNDD 5CIWA 3EWNA 4ACBA 1JG3A 4LJKA 4B6EA 2IU0A 1QP8A 4D41A 3OZBA 4GOKA 1LK5A 3HFGA 4ME6A 1RWMA 5IT0A 2YRFA 2FEAA 4C21A 5BURA 1Y0BA 1L7DA 1ZRHA 1GL6A 3DA8A 4RFSB 2XW6A 4B3TB 5DRYA 1QSGA 3G0CA 1QONA 1VL8A 4DNXA 2CXPA 4G8DA 2FW6A 3O5AA 2YN0A 5F98A 1NNI1 3R5JA 2IZZA 3H11A 2NP7A 1Z6QA 4NU8X 1D8TA 3OPVA 4WK4B 2XDAA 3VH3A 1XU7A 2MWMA 4MRMA 2B4YA 1EE9A 3A1UA 4IH9A 5G0WA 4XKJA 2FLWA 4UHBA 4A2WA 4CE6A 4CU5A 5BVHA 3MEQA 4BN0A 1IZYA 3CT4A 5BOSA 5KMGA 3I9FA 3QEAZ 3FTFA 1N3YA 2WV9A 3JW8A 4HAOA 3GRKA 4D97A 4F45A 4A36A 1Z45A 3JVUA 4GWLA 3EXHA 4HQ0A 5FFMA 1K86A 3KJIA 1DB3A 3LSYA 3IUMA 5TE9A 1FQOA 1R15A 1U0HC 3L4BA 3PUZA 2PAFA 4MEAA 1EX1A 2JJ8A 4NENA 1N6LA 1S2GA 4KN5A 4QUGA 2I6UA 1RPAA 2I03A 2R6HA 4BXOA 4WOJA 2JHCA 4KU4A 1MDFA 3HUUA 5F9FA 2W2XA 3OG9A 4MCHA 1E63A 3MYYA 1XB2A 2XLCA 3Q6MA 1MEOA 4IQ8A 4Z9YA 1GQOA 3NHKA 4RNDB 4AJIA 4OAOA 3ETEA 5AFSA 1XWIA 5E7QA 1TO2E 4KAXA 3IQDB 1Z17A 3U26A 2ZLBA 3AL3A 3VYTB 4XIYA 2C03A 2FOLA 1TJYA 3AWDA 1EQUA 4BFUA 2YINC 3N3AC 4B0OA 3SC6A 2H2DA 1NVVQ 1JR3D 4F4FA 3ZJ4A 1KO7A 4Z86A 4RK7A 4GZ3A 1CHDA 2BF7A 2J3EA 4EBBA 2WR8A 4ALNA 2CHUA 1A0OA 5LZ5A 1DV1A 1OV6A 3K9QO 1QP0A 2CNLA 4NABA 2I2FA 5ALNA 3DSRA 4DV0B 3MZ0A 3ZVKA 4LZOA 3WE7A 1EUCB 2IXAA 3H1EA 5AHRA 3HVIA 1Z5VA 2VWGA 3KHTA 1LW7A 3P2IA 4HBGA 3SZ3A 4CLRB 2V55B 2XNKA 1OFIA 4OREX 5EXXA 3ZKWA 4K05A 4OUKX 5K0LA 1XPRA 4B4WA 3QLTA 4B33A 2A9VA 3IYLW 3TSWA 3B48A 3WB1A 1BS2A 2VJDA 4LCEA 3FRJA 3ZOZA 1Q7EA 1E1RD 4D1YA 2QJTA 4POOA 3WAGA 1IXYA 4B9AA 1KF0A 1H5UA 5JNTA 5AOAA 1R5OA 1C9MA 2VA8A 3MAAC 3HVRA 1LDMA 3TG8A 2Q5OA 3VNUA 4K26A 4NZ9A 4UQOA 3D02A 4MKZA 5FLYA 5EJ9A 4ARZA 1I5RA 4DV2B 4X65B 3NOQA 5IFLA 2PKXA 4CUKA 2IP4A 3EIHA 3H4TA 3OCWA 2E3JA 2GF0A 4BX3A 2XNHA 4EEZA 1AK1A 1K7SN 1I3NA 2QX8A 2X6QA 3AU9A 3KJFA 4W9NA 1F2UB 4OHZA 3T5TA 5B2FA 3T5PA 5GIOE 1PLKA 2NYUA 4PLZA 4EP1A 1O5IA 3OQ6A 4R16A 3LW8A 4F04A 1UWVA 3ONVA 1Y6QA 3MD0A 1GAJA 4F4HA 3AERB 1QORA 1NBMD 2AGVA 1BFDA 4IINA 4W4TA 3RVOA 4RJLA 5KUTA 1KORA 4D45A 1Z5UA 4ZIRB 3I9OA 3MUNA 4KTVE 5TARA 5B4UA 3OTQA 4ZOLF 1C1HA 2AZ4A 1PK8A 2FSVA 3KPJA 3LC7O 3LO8A 4W7IA 5DI3A 5EESA 1J23A 2B37A 2F3RA 3LBFA 1GGEA 3G3EA 4DVJA 1T5BA 3OZEA 4YGYA 2QTLA 1DBRA 4V24A 2PFSA 4OXNA 4WN9A 2FDRA 2CLMB 1XZCA 1TJNA 1KK2A 4G5YA 4J29A 2BUBA 4XYLA 1ENYA 2DFNA 1YZNA 3CBQA 4DUGD 5AESA 1ZN8A 1B16A 4JLDA 4HXEB 4KQ1A 4DM4A 9LDTA 3R6DA 5DPMA 5JISA 3ASZA 4TXNA 2WJAA 4PO3X 1BU8A 5BUSA 1E4VA 4QFMA 3SHWA 2GLTA 2PKCA 2V9CA 1Y7IA 3C3XA 4RF4A 2LE0A 2Q7DA 1I5OA 3QOXA 2EKQA 3ACDA 3RYFB 5IKPA 2AOWA 1SY7A 1SK8A 4L4RA 4MV4A 3AF4A 2H0QA 3GRFA 5CPFA 2DLCX 2VHZA 5FV4A 4HCJA 4B3CA 2ZETA 1Y80A 3HJAA 3R44A 5AHOA 2Q5FA 2VLIA 5A6SB 5EKUA 5C2JB 4YUZA 3HA7A 3TEFA 5BUZA 4Z9AA 5F2OA 3ZCTA 4B6QA 4IHJB 2H5IA 4QYWA 4GF5A 3H97A 4CKCA 5HZMA 1Z0DA 4EPTA 3IV6A 1TQDA 2PKRA 3EGXB 2VT2A 1GYPA 4YGXB 3MWEB 2BPOA 2OAEA 1CUWA 2EEZA 1W0KD 2LZ0A 3ZWCA 1R4MA 3DLIA 1JWAB 1T1RA 3F1LA 1I0ZA 1NR5A 1AV7A 1LPSA 2F8LA 2XNDD 2GQ0A 3GNQA 1GPLA 3CTMA 2B25A 2HJSA 2R79A 2QRGA 1NZFA 3I4FA 4HFNA 2IK8A 5BN4B 3BXPA 3A1SA 3AW8A 1GPKA 4GNKA 2VK1A 3E18A 3NHRA 4JR0A 5F64A 5FTMA 1T8RA 4MB2A 5GP1A 3VPAA 1VYTA 1YS2X 1THZA 4Z3KA 3VR5H 4K6CA 3FBTA 4FWTA 2YHUA 3KPUA 4R2XA 4AUKA 5KVVA 5KYWB 1RJEA 4UNSA 1EDZA 1KAMA 1VSVA 2XRFA 4US1R 3SF0A 3ZKWB 5ULLA 4P86A 3LTNC 4J6FA 1K8QA 5EEHA 3SC2B 3HKCA 3AP3A 3W3AA 3W3ZB 2WVJA 3KJZA 4DDUA 4RTKA 1PWXA 1A9RA 2F4NA 1UMBB 3L7CA 2WMDA 1E1YA 2YWGA 3B6MA 3O9MA 4PO8A 2IVZA 3JTEA 5DM4A 5IJXA 2HM7A 4MHTA 1MAAA 1JIJA 2ZJ6A 2AC2A 3LKDA 4M1QA 3F6EX 1KFCB 3GGOA 4DTIA 4BGDA 4IUYA 4ZGGA 5BVGA 3WXMA 1EK1A 1I4TD 1XDZA 1YU9A 3UBMA 1A5TA 4D5GA 4Q1VA 3SD7A 4UHDA 1C50A 3LPCA 4Q00A 4CV2A 2I6GA 3BQ9A 4M36A 4XB2A 4XSGA 1JSRA 4EA9A 4YAKA 4D80A 1Q57A 2AOVA 4JGIA 4LBWA 4EX7A 4XVCA 2V7PA 5T7BA 1TZKA 5LD2C 5J2TF 2ZSAA 3AFGA 4U9IS 1JHYA 5EIHA 3VHXA 1M8GA 1B2LA 2XDWA 3SLRA 4G85A 4HH3C 4KB5A 3VAYA 3D2BA 5FUBA 3ZPXA 4BZQA 1VCNA 4REMA 3V7FA 3PRKE 1IHDA 1X87A 2CGEA 3EPRA 2CLCX 1MJFA 3Q9LA 3C74A 1F6WA 2GSWA 4GU5A 3UV6A 2IXEA 3PFIA 4W5JA 4LFAB 4ZHQA 4LY0A 2I33A 1DO2A 4W1QA 1WB6A 3PQCA 4O5OA 5C81A 5JBIA 2GCEA 1IN1A 4RK1A 3G8BA