2X2EA

Dynamin gtpase dimer, long axis form
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
341
Chain Sequence
MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDKHGTDSRVDEMLRMYHALKEALSIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DYNAMIN-1
total genus 107
structure length 341
sequence length 341
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2eA00
5H70A 2OLKA 2VP9A 1KKMA 3GFPA 1XNJA 3LBHA 1G1MA 2BMDA 4KSBA 1G18A 4PC1A 3ZS9A 3GJ7A 2XEXA 4PHGA 3CRW1 3VTKA 3K9LA 4BRUA 4KYUA 4KHZA 4A6XA 2FFAA 3AVWA 2Y8EA 3VR5A 3C4JA 4BEBA 5EE0A 621PA 2PH1A 5ELXA 1XU4A 4DBLC 1G3UA 2P67A 1A2KC 3KJGA 2CK3D 3EIEA 3KKPA 2H16A 4K8OA 1G8GA 1E32A 4DUGA 2YKGA 4FCWA 1HH4A 2GCOA 1KK2A 3K9GA 2GXSA 4IFEA 1ZAKA 5H1YA 3T61A 2P3SA 2VSOA 3RVBA 1DAMA 2PZFA 2XB2A 3ASZA 3SE0A 4L4UA 1DARA 1MR3F 3B85A 4C7OA 3VR1A 4IDHA 1NLFA 2GXUA 1UPTA 5F9HA 3UANA 2REXB 2G88A 1VYVA 1ZNWA 4Q9LA 2CCJA 5HTKA 1SULA 4ZDIA 4LY6A 2HV8A 1T5LA 4JL8A 4KBGA 5AUPB 5L8VA 1G20E 3PV0A 2CHQA 2HJGA 2AFHE 4M8NE 3TQFA 1OIXA 1AKYA 2IW3A 1ANKA 1VIYA 3PITA 4NH0A 2IUSA 3RAPR 5KNCA 3SBDA 2AWNA 1DAEA 1QHGA 3U3MA 4AKIA 1D8TA 4TL9A 2ZI9A 5HR5A 3H1TA 1LNZA 3IUYA 2GJKA 4MYHA 3GQBA 3OHMA 1PLLA 4RCYA 1GITA 3K53A 4ASUA 1F2TB 1TF5A 2N46A 2QSYA 2BOVA 4H9GA 1DG1G 3QVUA 3QBVA 3MJRA 4M53A 1NKTA 1SVIA 4BUJA 5BW8A 4QGGA 3MWJA 4DJTA 3W90A 3N5CA 5KSYA 3DKVA 3I5YA 3HU2A 1XD2B 1KY2A 5EE1A 1SVKA 3HR7A 3REGA 5CYPA 3KUCA 4DLTA 1KZGB 1GOTA 3C7KA 4MUAA 2F3RA 4Q1BA 1E9EA 3KL4A 4RKFA 1I2MA 4OHYA 1KNQA 3SN6A 3RS7A 2E9SA 1RJ9B 3DMNA 3X1YA 1UBEA 1ZU5A 5LB4A 2CHGA 2QPTA 3A36A 1XCPA 3AVOA 3I4LA 4NCNA 4NE2A 2IYYA 2FG5A 2ZRNA 3WNBA 2IYLD 5KDOA 2ZE8A 3UG7A 1U8AA 2QPAA 2XNDA 4K81B 1DAHA 1U2RA 1LFDB 2Q6TA 1ZD9A 3EW9A 4KVGA 3BOSA 4RD4A 1NN5A 1NMYA 3KQLA 3GP8A 3PCRB 1ZM4A 2BVNA 3CX6A 3TE6A 2O52A 1XX6A 1ZJ6A 4BLQA 3I3SR 4L9WA 4EAQA 2OBLA 1XPRA 1D2NA 4NCJA 3LD9A 2YWGA 5C4MA 2IYSA 1AN0A 1W2GA 1AS2A 1AM4D 5LD2B 1RE0A 1SXJC 1HT2E 3OEEA 1IN4A 1OH8A 3W6OA 3ZQ6A 1OYWA 3RWMB 5AK0A 1K6MA 1UM8A 3Q5EA 3OEHD 4C0KA 4UXJA 2GJ9A 1C1YA 1P75A 2KBFA 3KKQA 1UBFA 1OH5A 2HYIC 5CITA 2R2AA 4BLTA 4U7DA 1E0AA 1Z08A 1ZUNB 2WSSA 1TL7C 2X2EA 2OAQ1 4DLUA 3BIFA 2HYDA 1YR7A 4DLSA 3VX4A 2G77B 3B6EA 4HYYA 5AR1A 3A4MA 5DN6A 4NYMR 2QI9C 4A0RA 3CNOA 1E2PA 1S1MA 4XWOA 1W5TA 5DLQC 1MO3A 3KUDA 3K09A 4YXWD 4TLAA 2WZQA 3NBZC 1E2FA 2OUKA 4E09A 2J0UA 2O0KA 1U0JA 3ZVRA 1CTQA 2RKOA 2ZRHA 2OAP1 2R8RA 5JRZA 2FSHA 1RFLA 2R6CA 2REOA 3AKEA 2WVJA 2CVFA 2OZEA 3FKSA 4LJAA 3JVUA 3RNLA 1XCGB 3RSOA 5BYKA 2Z0MA 3BRWD 3O8BA 1A1VA 5D3MB 4LJYA 3GLIA 4JLJA 2OHFA 3ETLA 4JLNA 2WJGA 3QY0A 4C0SA 4TYNA 2JLZA 4R2IA 1VMAA 5L3VA 3WNCA 4RD1A 1P9RA 4LUCA 4AKHA 1SKQA 1ESMA 1G8PA 5TB5A 2P6RA 3AVUA 1KI2A 2NO0A 2PT5A 1SKYB 3ADKA 5FOXA 2VP0A 4IVPA 1T5IA 2N1BA 2DB3A 2ZETA 4POAA 1P9WA 2MMGA 1N6RA 1SHKA 3UWOA 4B43A 4D6PA 5F9FA 4BFTA 3D8BA 5K8TA 1AS0A 1L7VC 3C16C 1LS6A 1DOAA 4JVMA 4CRWB 4DCUA 3FFBA 3HU1A 3P4YA 4LSGA 3TQCA 1P7CA 5J47A 2VRWA 3I73A 2WAYA 2PJRA 1S2MA 4LZZA 4UKDA 2WKRA 1G4AE 1N5IA 2EU8A 1DAGA 1JR3D 2FEOA 2ZRBA 2ZTSA 3CUEF 4JVSB 2AKYA 2GCOB 2FU5C 2BJVA 2QY9A 4AYXA 1RRCA 4ZDWA 1ZM3A 2QEQA 4O2RA 3ADBA 1KI4A 1NY5A 2SHKA 2D62A 2RGGA 2F9LA 4JBWA 3SU8A 3A1UA 2XTMA 3C5CA 2VA8A 2HCBA 4A1FA 3HJNA 3NEJA 3B13B 2W0SA 4PR0A 4DLVA 1V43A 3BH6A 1L2TA 2WMNB 2P6NA 2H5EA 3BORA 5EQTA 2JLUA 5FBLB 2WWIA 5CLQA 1F6BA 1N5LA 4Q4LA 5LB2A 1J99A 2XSZD 5FOUA 1BO6A 1G3QA 3MAAC 4IJMA 4B48A 2QT1A 3NDBB 2YHSA 3RANA 2W2VA 3RS3A 1G3IA 3C41J 3FFAA 1Q3HA 4DRZA 3D7MA 3FB4A 1WCV1 4Q9HA 5EP4A 4P32A 3VX3A 3NXSA 4GOJA 4L5BA 4EPVA 1KIMA 3M1IA 3LAWA 2WOJA 3Q5DA 2QRNA 4AKGA 4DSTA 2GXQA 5KPJA 2A78A 1YR8A 3VNUA 2V55B 1RVDA 1U8ZA 4Q9JA 3U3JA 3ONWA 3HPRA 3K70D 5GJWC 2WTUA 2GKSA 2QA5A 3LFUA 2IS1A 1KGDA 3VR6A 4EQ6A 1MV5A 1FPMA 3N70A 4KLZA 4RJLA 4JLMA 4AI6A 2AKAB 3EC1A 1R0XA 2RHMA 2J87A 3BD9A 4OI2A 1EK0A 1LF0A 2G0TA 1X1RA 1D9XA 4Z54A 2QGZA 5TY0A 1WB9A 2J0QA 5J4LA 1N3BA 2JASA 2FDCA 3U7EB 2ZJBA 4D0NA 1SXJE 4A2QA 2WPDA 1NN3A 2F7SA 2UZIR 5F2EA 5FUWA 5CB6A 1ZNXA 2DFTA 1G3RA 5DHAA 4TZ0A 3S1AA 1R8SA 4ACBA 1FFHA 4M1SA 2VSXA 2H17A 2CCKA 4Q21A 3B9PA 2GAOA 2ZJ5A 3AVPA 4M1OA 4Q19A 3GLFB 4D81A 4EIWA 3BWDD 1M34E 3RS5A 4TLDA 2MSEB 3PENA 1W36D 2IF0A 4FIDA 4HZIA 1Z0FA 2DFLA 3U7GA 4LGMA 3HU3A 3CLVA 2AXNA 1A82A 3OEED 3UMRA 2OG2A 3X1ZA 5JWOA 4JKYA 2ODEA 1SXJD 4Q4AB 4BFZA 1SKYE 1VDZA 1V5WA 4GNKA 1A2BA 4LYHA 3OFNA 4D80A 2WHXA 3NBXX 1II9A 3AKYA 3FDIA 4B6FA 4Q1AA 1EFHA 4HLUC 1EG7A 1CR0A 3TW8B 2ZSFA 3TGPA 2V7QD 2ZR9A 2VSFA 4HDCA 4KVAA 2QGNA 2JJ1A 3A37A 2GVZC 3BC1A 3K0AB 4ZV4A 1QVRA 3FHCB 1E79D 1U81A 4LJ9A 3NKVA 3THYA 1W2HA 3SI7A 3T5GA 5JWRA 3B1ZA 2RGCA 1IONA 2BEJA 3FOZA 5FTNA 2QAGB 4YDHB 3B7GA 4DSOA 4YMSA 5BQ5A 4R98A 3IHWA 3ZQJA 1IY1A 1KOFA 1W46A 1UADA 5JMTA 3CZPA 1OFTA 1E2IA 2J0UB 3L0IB 4RD6A 3ZJYA 4TN1A 2GZHA 2Z4RA 2ZE7A 2YWEA 4TMVA 2QTVB 4C30A 2E87A 1N6NA 4MYUA 2V7QA 3AVYA 3IO3A 4WW0A 2NG1A 4HSEA 2CNWD 3UWKA 1VCNA 3SQXA 4GFDA 4ERNA 5JBQA 1YRBA 3V00A 3AEZA 4PSVA 4G5QA 1XTIA 4LJ4A 1ETUA 1CJKC 4A0HA 2CMKA 3QXCA 1R7RA 5K8UA 1ZD8A 4Q48A 1E0JA 2C9CA 3WMEA 2NIPA 2ZRGA 2B7CA 3CNLA 3W5JA 5L3QA 1YHNA 1TU4A 5JLJA 2WIBA 3CR8A 4V0LA 1SVMA 3P20A 2IXEA 1G8FA 2GEVA 2Q0HA 2R9VA 4Y0AA 3R7WA 2IWRA 1BIFA 1M7GA 1TTTA 1P2TA 1G64A 4LHVA 4LV5B 1R5OA 1LVGA 2IL1A 2OE2A 2OCYC 3W8NA 4FMDF 3EPJA 2ZRPA 3IGFA 1JJVA 4Q03A 5CK4A 1S3GA 4N0DA 1E4YA 2OCAA 5FUYA 1TADA 4FMCB 3GLGB 2ZSAA 2GVDC 2W00A 2KSQA 3E1SA 4OHVA 2RGAA 3E5HA 4TMWA 4WAUA 3A1WA 2XJ4A 4QNMA 1HEIA 1HQYE 2JLQA 3GD7A 4V02A 4WVFA 5ANRB 3B82A 3BE4A 2IUUA 2HUPA 3P1JA 2FV8A 2FOLA 2BV3A 1NJFA 4C0AC 1GSIA 1GRNA 1QDEA 5CDFE 4LC0A 1YZNA 1HY3A 3MJHA 3R8CA 2IWHA 3EPLA 1W4RA 4NHOA 3QEJA 4BEJA 2QE7A 1BMFD 3T15A 2BIFA 3B8HA 4QGAA 3O8CA 3U4QB 3E70C 1KDOA 1P6XA 4IXNA 1OKKA 1ODFA 1GILA 2PEYA 4PHTA 1KK3A 4KO8A 5KNDA 2PL3A 1N5KA 1OT3A 3JZMA 1E0KA 2IT1A 3PIRA 1LF5A 1F2TA 2WICA 4W9MC 1M74A 5JFGA 3IDQA 1YZQA 2JCSA 3MGCA 1DE0A 3TVTA 1L4UA 1VYTA 1II8A 2B7BA 1Z5ZA 2OO7A 1ZU4A 4JLDA 3AVVA 1YR9A 2BMJA 3TSOA 4IEEA 4Q00A 3AF1A 4S35A 3QNUA 1KKLA 1QHHB 1W4CA 2IYTA 3VMFA 4EJSA 4HAWA 1IN6A 4ARZA 4US2R 2EQBA 3B5JA 1OKKD 4DCNA 2O8DB 2CL0X 4FCTA 4FWTA 3NH9A 3WRYC 1PUJA 4TQ9A 2X77A 3FHOA 4DZZA 4LOAA 2DWQA 5IK2A 1O87A 1R0WA 4B3CA 4AYTA 4B6EA 4D26A 4M22A 1Z0IA 3U44B 1CR4A 4ZI2A 3IBGA 3WNDA 2CE2X 4B3DA 2NO7A 4IW3B 1SXJA 4YMUA 1HTWA 4CGZA 2QN6A 4P4SB 2VHTA 3ND8A 3L82B 3OFND 1GL9B 2R6FA 3ZVLA 4BRWA 3ADDA 1Z28A 4WOPA 2XZOA 4NZYA 2J7PD 3SJBA 1DO0A 4ARZB 1AS3A 1HE8B 2V9PA 3K1JA 3VNVA 4G5OA 3W9YA 5HPYB 1RC8A 2IEYA 5FBRB 3BS4A 2F3TA 4KSCA 1E3MA 3KQUA 2GHIA 2ERYA 3T1QA 3RS0A 2ZJAA 3A4NA 4EQ6B 2LKDA 2VTKA 2ZRFA 2VHQA 3CX7A 2R6DA 3BXZA 3QKRB 2O8FA 3RS4A 5FTKA 3R9WA 1ZP6A 2ONKA 4XOIA 2RGBA 4RZ2A 1F5NA 2VEDA 2Z83A 3QKUA 3I5XA 5FTJA 3DOEA 1UKYA 5FR2A 3KKMA 5CJ2A 4L16A 3WMFA 1RRFA 1CF4A 2F1IA 1VHTA 2G3YA 2G6BA 2WSSD 3E2IA 4HAZA 4IDNA 1KJZA 1YR6A 4MYCA 4XWAA 3TJZA 3WMGA 5CB8A 3LXRA 4OI4A 4KU4A 4Q7LA 2W0MA 1E9SA 2ODWA 4HLDA 4AC9A 3NHAA 2HF8A 4FI3C 4DIDA 2JEOA 2W58A 3K0AA 5EUQB 5J40A 1SVOA 2A3RA 4BASA 2ZRKA 2I1QA 3L2OB 1FUUA 5JJLA 3FWYA 5JS8A 4OHZA 1IQPA 1J90A 4TMZA 3TR5A 2ODBA 2QMHA 4WXRA 5TXGA 1G9XA 2ZJZA 4QFMA 2MSDB 3QG5A 5TVKA 4ZIRA 2PMKA 3PXGA 2VF7A 1QHXA 2FF7A 1N6OA 4NTZA 3J81k 1P72A 4ZCLA 1XBTA 1GM5A 5E7IA 5FI0B 4B75A 4W5JA 3DZDA 2O5VA 4IVQA 2NMVA 1XCMA 2OBMA 1ZIOA 3CWZA 1E9CA 4GZLA 3O8DA 4YQFA 1NRJB 1DBSA 3SFZA 3WHLA 1GKIA 3QXXA 1OXTA 3SC3A 2OFOA 4DSNA 2CL7X 2ZRAA 3UMSA 4DLRA 2QSZA 5L3QB 4QBGB 4V0NA 4HAVA 2L0XA 3W34A 4MGIR 1F2UB 5IT5A 1CR2A 2Z5FA 1M7HA 4NMMA 2P5SA 5KPDA 1Z8FA 1AZSC 3EWAA 1PVOA 4CDGA 2DWPA 4EPYA 2WJVA 2ZVPX 1MOZA 2G0NA 2TMKA 4Q1FA 5AJWA 2CLSA 2AN9A 2BC9A 1R2QA 5LDDC 2GJAA 5HCIA 4L8GA 1R0ZA 1G16A 1GKUB 1W0KA 1XMIA 2ZUDA 4BFVA 2HCJB 1NVVQ 1OXXK 2OFWA 3TUIC 2XGJA 5FOVA 1R5BA 1RW4A 3ZZTA 1G6HA 2CVHA 3ZDQA 2WJHA 2KB0A 1RYFA 4UNPA 4TTRA 3REFA 3AGPA 2ZVQX 2WWWA 2R65A 3WHKA 4Z1MD 4D0GA 2B6HA 1ZUHA 1VG1A 5FPKA 1KSFX 3ZIAA 3RSLA 3SJCA 1X8KA 2YC4C 1TQ2A 4E22A 4URXR 2GEUA 3NC1C 3A8TA 1HYQA 5G41A 221PA 5DISB 4U00A 2W83A 2XAUA 1RPZA 4TT3A 2F6RA 3EA0A 2XZLA 5SZJA 4PXAA 2PX0A 3DMDA 1OH7A 5CIWA 4LBZA 1XTQA 1FX0A 4FCVA 3QI2A 3SJAA 3TNFA 5CYOA 1NBME 2ZR7A 1YKSA 4JMPA 3KB1A 5KDLA 2NPFA 1D6JA 1AGPA 2MSCB 4BZXA 1ZM7A 5G40A 1CBUA 2JGNA 4LJ5A 4BGDA 2ZSDA 1XEWY 2J9RA 4RCZA 2VP6A 5L3SA 2X8AA 1KSHA 1OHHD 2PEZA 4HDOB 4OHXA 4PHHA 3X1WA 3CBQA 1QHHA 1OFUX 2EWWA 2P65A 4F4CA 1NVVR 3GJ8A 4OQFA 1Z6TA 4X8OA 2FWRA 3FPAA 4NYMQ 4A82A 3KDSE 2V4ZA 2RHDA 3DPUA 5C18A 3KJIA 3RHFA 5E3HA 2GTPA 4PANA 1X8JA 2NOAA 2D2FA 4Q5IA 4B35A 5KU1A 3ZD7A 2IYXA 2IYUA 2NTYC 1NBMD 1SZPA 1WQ1R 5LPNA 4LK2A 1S3SA 2DY1A 4G01B 3ZZUA 2Q3FA 3TUZC 3RC3A 1E2LA 1OV4A 3TIFA 1KK0A 1BKDR 1CU1A 4Q01A 4L9SA 4HEJA 4PPQA 5KTYA 1Z22A 4QM6A 2QM7A 5FL3A 2O8EA 2QQEA 1UF9A 2G83A 4EDHA 3VHLB 2EFCB 2HEIA 3QKRA 3VR3A 1TMKA 4RFVA 4EFLA 4NCKA 5GJVC 4XVUA 3A58B 4KLNA 3QXSA 1SHZA 1HUQA 2ZI4A 1E2DA 2ZYVX 3PUVA 1U0LA 3TRFA 1Z2AA 2RB4A 2ZYTX 5G3YA 3N2EA 4B3BA 2OESA 4PC3A 1L8QA 1BYIA 2ZI5A 4DLWA 4QBIA 2IHBA 3B1YA 3A6PC 2ANBA 2W2TA 1X1SA 2O8BB 2HXYA 2IBMA 1T3LA 4MGZR 3CRQA 2AWOA 3NBYC 4A6PA 4ZCMA 3T1TA 4ESVA 8OHMA 4IHQA 4PC7A 4RD2A 1G3MA 2YV5A 2XTZA 2CJWB 4BFUA 3K0EA 3VU9A 2VO1A 1YVDA 2PCJA 4NKRA 5GVSA 5AUQA 1SQ5A 3AF3A 1XFAA 2DFKB 4LHZA 4TMXA 1G41A 5K8IA 2V1UA 4QKQA 1W36B 3THWB 4AG6A 1AA9A 2X2FA 4PQFA 5KSZA 1KHTA 3HYRA 4PFSA 2VYFA 4C9BA 4TYWA 1AJEA 1FNMA 2F55A 3IEUA 2EFGA 4PQRA 4I1VA 2FSFA 1UDXA 3CONA 1QF9A 1ESNA 4FW9A 4TTQA 4BQSA 2YJTD 2J46A 1ZMXA 4B3XA 1JPJA 4NYJQ 1S9HA 3LX8A 5JEDA 3VKGA 4YLGA 4R71A 4R2HA 2IHYA 2N42A 2P6UA 3IO5A 1CR1A 3K9HA 2GRJA 4C0QC 3R9IA 4ZDKA 5AJXA 3BH0A 2CL6X 2C04A 3BAFA 4M1YA 2O8FB 4F91B 4P33A 2I3BA 2WWGA 1E9AA 3CZQA 4JL6A 5CM9C 5FTMA 2XXAB 1LTQA 2QNRA 4CW7A 2FA9A 3R8FA 1KDPA 5HZHA 2B8TA 1E2JA 2ZI6A 1Y3AA 3MWLA 1BS1A 2ZS7A 2GA8A 4LPKA 1GNRA 2HJVA 3MCAA 1Q1ZA 1ZM9A 2O8CA 1Z3IX 2LCFA 1QHYA 3KZ1E 1E9RA 4PO9A 3BJIC 1J8MF 3MD0A 4ASUD 4QJ3A 4KFUA 2DFNA 4WZ6A 3SS8A 4JVLA 4B76A 3C14C 2CK3A 1CRQA 3CRVA 2A9KA 2MMCA 4U5XA 1D9ZA 4JYBA 4FN5A 4BLPA 1FNNA 3H2YA 2DHRA 1E1RA 3UMFA 1JPNA 2FH5B 2WSMA 4PZYA 4IOMA 2QAGC 4LJ6A 3DO6A 4Q4AA 3KXKA 5DO9A 1HA3A 3T5DA 3TMKA 821PA 3L8ZA 1QG2A 3AVXA 4YDSA 3GLHA 4DEXA 4OI1A 1KJWA 3ZH9B 1YQTA 2PX3A 4LHXA 3CRMA 2J59A 3WXMA 4GOXA 1DVRA 4Q02A 2VP2A 3PQCA 4YC7A 1DAIA 1II8B 3EWSA 4KCGA 3UG6A 1VG9B 2YOHA 4LI0A 1U94A 2C9OA 1ZM2A 3IKJA 1G6OA 1T9HA 1IN7A 721PA 1Z6GA 5DE3A 3TLXA 4HATA 3GEEA 3S1AB 1JEEA 3CB4A 4GI7A 4GOKA 4P0TA 5JZVA 4EPTA 1OPXA 4ILEA 4PSKA 2ATXA 2JATA 1CLUA 3VR4A 2WOOA 1R10A 2ZAMA 1G5PA 1R0YA 3CF6R 3T35A 3EX7C 4QL3A 3X1DA 1JI0A 4JZKA 1UEJA 3KTAB 1OE0A 5B30A 1C4OA 1XF9A 1FQJA 1SXJB 1TUIA 4V0ME 2ZS8A 5AUOB 1KDTA 5B2ZA 2GBLA 2NPIA 2ZE6A 2JLVA 1P73A 1IBRA 3U7FB 4Q7JB 4M0LA 5D3MA 4RFSB 2GK7A 4I1OA 1OYYA 4Q1DA 1QHNA 5B58C 1U98A 5KSOA 121PA 2JA1A 3FE2A 5TV2A 5JI3E 1S1CA 2HT6A 3OAAD 2Q9BA 1KTVA 3KKOA 4B44A 4CF7A 1X3SA 2ECKA 2JJ1D 2Q9CA 2ZE5A 1GUAA 1Z6XA 4XD7A 1YJ5A 2C77A 2WKQA 4B47A 3EPKA 3CKLA 2BBOA 5KNBA 2OT3B 4EPXA 4J0QA 4JLBA 4WZAE 2XNDD 5GVRA 521PA 3U3KA 2KJQA 2IXGA 2GAAA 4OK3A 1KI7A 2NZ8A 4RKEA 4ZIRB 4CEIA 2JJ2D 3TK1A 1EFUA 1NVWQ 1MRSA 2F43A 2QQ0A 4G5GA 4QHTA 3GLHE 4EJSC 1U0HC 2JLWA 3MRSA 3B78A 2VL7A 2WJYA 3NDPA 1E9BA 3HPQA 5FBWB 5G3ZA 3GLFA 3SNHA 5H68A 4NP6A 1BH2A 1ZBDA 1WXQA 3OAAA 1OJLA 4OBEA 5JSZA 4QJ4A 3LLMA 1JALA 1FX0B 2GILA 3QKSA 4LBYA 3NTUA 2GCNA 5E7MA 4NU0A 4XVRA 4C4PA 1BOFA 5J4YA 3LBIA 4TSFD 4P4TA 1NVUQ 1W47A 3AP2A 4FD2A 1MKYA 1P61B 4G3XA 1UFQA 4R9UC 1XEWX 1F3OA 5GADl 1ZIPA 1WA5A 1NN1A 1DPFA 2HXSA 4CEHA 1E9FA 4JYCA 1HURA 2V6IA 3R9XA 4MYTA 4PTLA 5AJVB 4PQYA 5DN6D 1KYIA 5M04A 3RC8A 3PEYA 5JHGB 2WJJA 2BHRA 1K8RA 4C2TA 3BFKA 3CF0A 2BJWA 3SZRA 2QE7D 2ERXA 1HQCA 4XSGA 4DCSA 5A4JA 4O2LA 5K8LA 1TU3A 3WP0A 1KI6B 3K8YA 2ZIAA 4O0MA 4TLBA 4US0R 2WJIA 1OXSC 1E98A 3LV8A 1Q1QA 1MH1A 1JR3A 1WRBA 2C8VA 3HDTA 3NVAA 1GL7A 2P5TB 4I99A 5DI3B 5DIFA 1VTKA 2UVQA 3BFXA 4GZMA 4JLKA 1E2NA 4IDOA 5G53C 4DSUA 5SZIA 2GZDA 3OZXA 1P3JA 3B1WA 4M21A 1IJFA 3EASA 4U02A 3QG1A 1WE2A 1KO4A 3G0HA 1EFCA 1BMFA 1F48A 1KI9A 2XZPA 3OIWA 2XSZA 1KSGA 1YZKA 1CJTC 2ZRCA 4GMDA 2JIZA 1JXMA 3CF2A 1TQ6A 2GJSA 2PJZA 3H0KA 4UNNA 4A4DA 5F98A 2IS4A 1ZUIA 3IPXA 4MKHA 4DB2A 1N5JA 3AM1A 4A2WA 2OXRA 1N6LA 2GBLC 3H86A 4NYIR 1E9DA 1EWRA 2FZ4A 3G5UA 3QIAA 3QJYA 3B1VA 1QBKC 1OB5A 1VCOA 1G8YA 1B0UA 3AP1A 5A0FA 2W6JD 1UEIA 1G5RA 4P3YA 3HWSA 1GNQA 1XMVA 4B33A 3A1SA 2AD5A 2VHCA 1E1RD 1N6KA 2QG6A 3PEVA 4NDZA 3ZIAD 2HDNB 4UNQA 2ZXUA 2ZJ2A 4LCBA 4N3NA 1ONBA 5C1BA 2BKEA 1W5SA 2RGNC 1HV8A 4DDUA 2A7QA 3LLUA 4TT3D 1DO2A 4V0OA 4TL8A 2IK8A 4LDJA 4KV9A 3Q8XB 3W5IA 3M6AA 4HAXA 5KUTA 1Z63A 1OB2A 1KI8A 1XJ0A 3GLIB 4TZ6A 4Z8XA 4LHWA 3PUZA 1UAAA 2QZ4A 2JDID 4N0EA 2IA5A 4BZQA 2EW1A 4KODA 3PG5A 2FPMA 4OQMA 2BMEA 2V8OA 4AY2A 3D3QA 3CH5A 2ZROA 3EZ9A 1Q20A 4Y0VA 2C2HA 1IXZA 1W1WA 4OJKA 2XB4A 1EFTA 1Z29A 2IF2A 1T8TA 2JLRA 1OXVA 2WWXA 3U6KA 2VH5R 3NC0C 2A2ZA 1UKEA 4XVQA 4AD8A 3DHWC 2ZJ8A 3RRYA 5UKDA 3NG1A 4WA7A 1XB2A 4EPWA 3R20A 4JLAA 4LYFA 4B2LA 1H8HD 1J70A 4M1KA 4CEHB 1HT1E 2J5XA 3GJ4A 4TQUS 3KJEA 5DYIA 4KAXA 1RKBA 1X86B 4PSAA 4E5UA 3I92A 1U9IC 4A0GA 4URYR 3QKTA 2CE7A 4A8JB 4BE7B 3GLIE 1DADA 1N0UA 4MRVA 5HE9A 5EP2A 1IY2A 2AL7A 3LO5A 1NBMA 4YMVA 3OF5A 4ON9A 4GDFA 2HLDD 1JQJC 4EPRA 2YOFA 1KY3A 2EYUA 3SFVA 4IFBA 4TMTA 4XJXA 4Z8YA 2ZSBA 2O8EB 2C99A 5EP3A 4RZ3A 5P21A 1G17A 3L43A 1KO7A 2QMUA 3QENA 1K5GA 1HE1C 2A5GA 2GETA 4OL0A 3SBEA 1X6VA 3TBKA 4WIAA 1S0UA 1D2MA 2G1JA 4ITRC 1NP6A 2GF0A 4QNRA 3K0SA 2JJ2A 3U6BA 3IIJA 3QF4B 4B34A 4MITA 1L4YA 4C0JA 5DI9A 1G7CA 1KO5A 1QG4A 3Q85A 4MA4A 2OSBA 5A5GA 2D7DA 1VECA 1AZTA 1GIAA 4RFSA 2AX4A 4MUBA 1RIFA 3MWYW 4LJ8A 2WMOB 1A5TA 4PPGA 1TF2A 4DCTA 3CM0A 4A15A 1GVNB 1UKZA 5EE9A 3PUXA 4JLPA 1YRAA 1IM2A 3LH5A 1W0KD 3FGNA 5GJCA 4Q9IA 3IIKA 3DL0A 1LY1A 4HDQB 3PEUA 2FX3A 4GRAA 3SDZA 3UXMA 2XTNA 2GCPA 3DZ8A 1G291 1RZ3A 3P4XA 1XJQA 5HKKD 1FW6A 5GJBA 1EXMA 2IEZA 3O47A 4M1TA 1XTSA 3DM5A 3UATA 1RYHA 2RGEA 2IYVA 3QPVA 1Q12A 3KXIA 4JJZA 3AKCA 1KDRA 4KJZA 3RRZA 4NL4H 3I32A 4PC6A 2ZRIA 5FPHA 4FINA 3O8RA 4IEIA 2QP4A 1NLYA 3V4RA 2JLSA 3DKPA 4M9XA 2V54A 3CH4B 2H18A 4DWJA 2ZI3A 3EC2A 4YONB 3F0TA 1KMQA 1GRRA 3QF7A 421PA 2D7CA 4URVR 5DH9A 2YOGA 3IQWA 1E1QD 2ZRLA 2AFIE 3NBFA 2CBZA 4LBVA 1XD2A 3LW7A 2GESA 4D2IA 3T34A 4H1UA 2FFHA 1EFRD 3X1XA 4Q4JA 1NSFA 4BLRA 1VYUA 1W49A 4PC2A 2P0EA 4DVGA 3CX8A 1JB1A 5JCZA 4DDVA 1OHHA 5L3RA 4ZCIA 2AXPA 4TLCA 3RS2A 5AJZA 4RVCA 1JEDA 4JBXA 4QHYA 3EZ6A 5KDDA 4Q18A 1FL9A 4E03A 1IXRC 1G8HA 1Q21A 2ZJOA 2NO9A 3BB1A 3JVVA 3CNNA 2VPPA 5C2JB 3FKQA 3GFOA 5KYKA 1B23P 2JDIA 5J4HA 2KWIA 4FXPA 3K70B 1GTVA 5E4FA 5JRJA 4O3MA 2H7VA 1IAQA 4NCIA 2BWJA 4AIIA 3MMPA 3U5ZB 2YVUA 1G4UR 1BYUA 2A30A 4HI0E 5KO2A 1G21E 2W6JA 3VQTA 2JLYA 4HZUB 4HUQA 2HT1A 3RDPA 4BFXA 2WWYA 2DBYA 1CULC 3IILA 5BN5A 2BMFA 5F3WB 2C03A 4A36A 2CDNA 4HLUA 1AKEA 2D06A 3OIVA 4DLXA 3CW2A 4JT4A 2NO6A 1AQYA 3SYKA 1RRGA 2VF8A 4LPSA 1IN8A 4GSYA 5JCPA 4TL6A 1XDBA 4QOSA 1Q0UA 3RRMA 3GPLA 5HZKA 2HF9A 3AUYA 4PAQA 2QP9X 3QPWA 3BB3A 3EA5A 2KBEA 1Z0KA 3BBPA 3DM9B 2J7PA 1JR3E 1XD9A 2FMXA 3EXAA 4TLEA 2ZU0C 4AKEA 3KX2A 1ZNYA 2J7KA 4OQLA 1KI3A 3F3YA 4A0FA 1N6HA 2J0SA 1AQUA 1UBCA 1U99A 3LNCA 1A7JA 4IKEA 1G7SA 3P27A 4Q4HA 2ASEA 4MQBA 3I72A 3ZD6A 1H8HA 1E2HA 3QBTA 2E1RA 4JBYA 5FPSA 4B71A 3KQKA 3K0FB 4LYAA 3CR7A 4AWXA 4EFMA 2EFDB 3THWA 1XTJA 1JQLB 4A8JC 1AIPA 1I4TD 1ZYUA 4CZ2A 2F9MA 4DB4A 4I4LA 1TEVA 1TX4B 2BDTA 2W2XA 4HB0A 4C0HA 3AB3A 4HLCA 4JSTA 4PZZA 4BFWA 2IYZA 2UZ3A 2C95A 3ECCA 4X8MA 2QAGA 2PBRA 1VG0B 1OFHA 1XJCA 1R8QA 4TYPA 4Q1EA 1W7AA 2O0HA 1N0VC 2O8DA 3UPUA 4V0KA 3N2IA 3BFVA 4PO1A 3LVRE 4W5HA 2KI5A 3LQQA 2JLXA 2RGNA 2DPXA 3U4QA 4MH0R 4QG7A 5HE8A 5FUVA 3VAAA 4DCVA 3I61A 1OIVA 4JS0A 4EUNA 2GXAA 3H84A 3A1TA 4P4SA 3QF4A 4D0LB 1F60A 2OLJA 1W0JD 3PFIA 4CYMA 1PLJA 3L0OA 3IEVA 1KJYA 3QKSB 4NYJR 5B57C 3VKWA 1NVXQ 3QSYA 4RSGA 2QBYB 3EAQA 3LY5A 1ZRHA 5EE5B 4TTPA 1E1QA 1TAGA 2BBTA 4G5SA 4AURA 1P60A 4LV8B 5JI2E 3SYNA 1XP8A 4KFTA 4BFSA 4RY2A 3OIYA 1GFIA 1Z0DA 5HKKA 2F1RA 5EXXA 2B8WA 4HUQB 4MRSA 1S4QA 3K0CA 3GLGA 3L0PA 4O25A 3GLHB 4OYHA 2VQSA 1VCIA 3NEYA 3UKDA 3GLGE 1Z0AA 5CJPA 3FMIA 1E94E 3PR1A 2D74A 1AK2A 3CWQA 2A5DA 1SVSA 4M9ZA 2BBWA 5AUNB 5EUMA 4WZBE 3EPHA 1WF3A 4OI0A 3OIUA 4XH9B 2FJUA 2UKDA 4FMBB 2ZU6A 1IHUA 1UJ2A 3RWOA 1KSJA 1EWQA 2GF9A 5AJYA 5E95A 3SR0A 1MT0A 1GDDA 1P4SA 1UDWA 2CHVA 3FYHA 3EZ2A 2ATVA 3K09C 3Q3JB 2XX3A 1W44A 1IJEA 1QHIA 4Q4JB 2ZUBA 2QP3A 4Z1MA 3AF4A 3LRPA 4ZO4A 4TMKA 4M4SA 5IHPA 4S2EA 2J41A 2ZRJA 1H65A 3LA6A 1MRNA 2WBLC 1TQ4A 3FVQA 4LBWA 4PPNA 1E96A 1T3HA 1FP7A 3QQ5A 4Q47A 3VR2A 5TDHA 5IRCD 2QENA 3T1VA 2ZS9A 3GJ6A 4CT4B 1OFIA 4I81A 3K0FA 1G7TA 3DDCA 2ZJYA 1E2QA 2X19A 3IIMA 4MRNA 1PJRA 3LWNA 4RZUA 4MKIA 4IOLA 4GP6A 4BLSA 4D82A 3B2EA 4UJ3A 1N6PA 4DT1B 1TPZA 1QZXA 2FFQA 2GK6A 4C0BA 2IYRA 4MGKR 1DAKA 4IOKA 4DUGD 4M9QA 4ZDJA 3ZLJA 3QEOA 2XXAA 1XEFA 4M9SA 3WY9A 4X8HA 3ADCA 4Q1CA 2P2LA 3H4MA 1Q1EA 3QPUA 4PPFA 5BN3A 4XD7D 4HB3A 3U60B 2ZANA 2VIIA 3QXHA 5EJEA 1VCMA 3T06B 4JLOA 2F1HA 1KO1A 1WBBA 2RH5A 5JS7A 2VHJA 3MSXA 3IHLA 4IXMA 1J8YF 4JL5A 4B2IA 4B73A 1M7BA 1Q44A 2YC2C 5FH9A 4A2PA 2DCUA 2ZUCA 1W4AA 2G9NA 1J7KA 1RRPA 3KFVA 1M1YE 1ZNZA 5DI3A 4UNRA 3Q7PA 5FI1B 3P32A 4A8JA 3GMTA 1R5NA 2ZSEA 4MDFA 3ASYA 2QT0A 4F4JA 2B92A 2A5YB 2ZRMA 5CIQA 4EJSB 1OXUA 2D3WA 2I1VB 1Z6YA 1WBDA 1NG9A 2XJ9A 3V9PA 4ZPXA 3IPYA 2CLDX 1KNXA 1ZW6A 5JJKA 1US8A 1QRAA 4OK5A 3CO5A 1NNEA 3TKLA 1T91A 1WMSA 2WPDD 4QC2A 4UJ5A 3PVSA 4IDQA 4CEJB 2OEPA 3LXXA 4LX0A 5EZ6B 3TAUA 2EFHB 3CRRA 1YZLA 3KJHA 1FUKA 3NH6A 5FL7D 4LC1A 2ZAOA 3GEHA 2Z6VA 5TARA 4L15A 2GJ8A 2BM1A 3BH7A 2V6JA 1FTNA 4OHWA 4UXIA 2B21A 4JSYA 4GL2A 3V4FA 3FMPB 2ORWA 4PO8A 2QMOA 4GT1A 4N1AA 1KMHB 1GWNA 4C3ZA 5J4VA 1NSTA 2YYZA 5FTLA 4CIDA 2WAXA 3SOPA 1DTSA 5C4GB 1P5ZB 2QMEA 3KXLA 4IDPA 4MKGA 3Q7QA 3D31A 3CPEA 4ZI3A 2EVWX 3QUSA 5EXTA 2ZI7A 3WYGA 4B2PA 4DDTA 2ZRDA 3OE7A 2EYQA 4M1WA 4EKDA 2OCBA 1VIAA 1JECA 1U90A 2FFBA 3FMFA 2CCGA 1XEXA 2YWHA 4D4JA 3G82C 4TYYA 1E79A 4DC9A 2OILA 3EIQA 4M2LA 1D5CA 4URZR 1T0JB 1O3YA 1SVWA 4F92B 2XOKA 4F93B 4D4LA 2PCLA 1E2MA 4G5RA 1Z07A 4KFSA 1CP2A 3AGQA 1E69A 2H1LA 1OH6A 2EWVA 2QPOA 3LQRA 2Q3MA 3GJ5A 1DELA 4TL7A 3A1VA 4GBMA 1S9DA 5DGXA 1EGAA 3A4LA 1FMLA 4UXHA 2V3CC 2OM2A 2IS6A 2Q21A 2NGRA 3WBKA 1XMSA 2PLRA 4KBFA 5EP1A 1ZVQA 2GEDA 3BERA 2FGKA 4RZXA 2OXCA 1N6IA 2IS2A 1S8FA 4I1SA 4W7SA 1MO6A 3B60A 3K9NA 1T6NA 4YMTA 5D3QA 4DLYA 3VFDA 4NYIQ 2OCPA 3GJ0A 2XOKD 2FNAA 1Q57A 2G1KA 1NLZA 2FSGA 3T12A 1Z2CA 5EXSA 2QAJA 2BM0A 5JECA 3DVLA 4TQAA 4MGYR 4P31A 1Z6AA 4URUR 1JAHA 3CIOA 4IOJA 2VP4A 3T1OA 4ZKEA 4D4MA 1MO4A 3F5FA 1E0SA 2QL6A 4QBHA 3FTQA 3WYAA 2IX3A 1LB1B 1G19A 1F2UA 2J0VA 1FZQA 1EFRA 4LHYA 4DXAA 4XIGS 2JAQA 1LS1A 3RLFA 4FMDB 3NIBA 1TQDA 1XXHE 1NL3A 3AF2A 1KI6A 2RCNA 3KQHA 2YZ2A 3TR0A 1KK1A 1P9NA 4F38A 2AR7A 1DAFA 2AK2A 1SGWA 1KZ7B 1X8LA 3DOFA 4OK6A 4XTRA 1VKJA 3HP1A 3L0SA 1R4AA 4H1VA 4MKFA 2YWFA 3AUXA 1PZNA 4LWZA 3Q9LA 3R7WB 4JT2A 1XZQA 3M4YA 1W36C 2NQ2C 4B3GA 3MFYA 3ZVNA 2C78A 4JJKA 3VHXA 2W6ID 2FEMA 1XXHA 2VLIA 5KSPA 5L3SB 4HZUA 5TMPA 2R6GA 1OSNA 2R44A 2WKPA 2AK3A 3P26A 5FPYA 5EZ5A 5HCNA 2XNSA 1TUEA 5CK5A 2NZJA 2O0JA 5FUXA 3LVQE 2XITA 1GG2A 3L8YA 4QGFA 3BB4A 1JR6A 4RD3A 2YINC 2I4IA 3AV0B 3AVQA 2FPKA 1T8UA 3HYTA 4Q9KA 3WRXC 2RAPA 4IVRA 1UKVY 4CEIB 3THXA 3W6NA 2LWIA 2VBCA 1P2SA 1U9IA 4QHSA 1XEXB 3AH8A 2ZITA 3DEFA 3MWKA 5FOSA 1Z06A 5FBVB 3GFTA 4HUTA 2J3EA 1CJUC 4XSHA 2BEKA 4AG5A 3I8SA 1P2VA 2ZYWX 2CEAA 1AGRA 4Z51A 5AWFC 1TEXA 1YE8A 2CXXA 3U3OA 3CPJB 2HLDA 3EZ7A 1N0WA 2QUZA 3JZAA 3HR8A 2V1XA 5FOTA 2D2EA 2PZEA 1GZSA 1JXOA 3THXB 3IQXA 3OEHA 4QJ5A 5CM8B 5KOYA 2FSIA 4QRHA 6Q21A 1XPUA 1YZTA 1FQKA 2KE5A 4DHEA 3OE7D 4TWZA 3TSZA 2J1LA 2ZPTX 1M2OB 2R6AA 3C15C 3TSWA 4HB2A 4RD0A 3W3AA 4R7ZA 3AQ4A 5FL7A 2PZGA 5JWHA 1XWIA 2Q9AA 2C96A 2RGDA 2ZEJA 2QTHA 4X8LA 3TW4A 3FHTA 3TAHA 2FPLA 5J4KA 2ZREA 3M0EA 1GP2A 4BFYA 3PJRA 2VHUA 3WBJA 3WYFA 2O8BA 1VPLA 4HB4A 2BCGY 4DDWA 1I2DA 4YXWA 1II0A 1ELOA 3ICQB 2F1JA 4XTCS 1QVAA 2IYQA 3SJZA 3EZFA 4C2UA 1KAGA 1T0HB 3ZS8A 2REBA 3FMOB 1S96A 3CPHA 4QXAA 1I4DD 4C0LA 2VP5A 1US8B 1P2UA 3UIEA 4DIEA 4KI0A 2ZQ5A 3QXJA 4HAUA 2NO1A 4KYIB 4GMXA 1TNDA 4QM7A 3THYB 4NPHA 3SHWA 4QGHA 4GP7A 5DYGA 2DWOA 5FPTA 1YZUA 5FR1A 4BECA 3KFXA 1EX7A 1G5TA 3RYTC 3W6PA 3QE0A 1Q3TA 1Z83A 3LX5A 4B32A 3THOA 2QTFA 1Q22A 1M6NA 4FMCF 4UQOA 3ZVMA 4D25A 1NN0A 1E2GA 5JJIA 2FZLA 3NWJA 3QOFA 3BK7A 1KMHA 1MABA 3EG5A 2BCJQ 3KB2A 1WP9A 4F7WA 3EIHA 4PAOA 1ZINA 1P62B 1PLKA 1CXZA 4XWKA 1IXSB 4MDEA 5E7JA 2IUTA 1XMJA 3ICEA 4LRWA 1CKEA 3SQWA 4Q4HB 1DS6A 2ZYUX 3UK6A 4PZLA 5KHOC 1COWD 1GAJA 4JKIA 5IDVA 2WV9A 1T4GA 1NY6A 2F43B 2GNOA 3W8RA 2D4HA 3KTAA 1TF7A 4DLZA 4ACAA 3TVDA 4TSFA 2PMDA 3U7HB 2H92A 4NBSA 1KAOA 1VG8A 4G0NA 5JSZB 2WM9B 3MUFA 2QM8A 4YMWA 1H8ED 1I4LD 2PLFA 2Z4SA 2O8CB 2OV2A 4II7A 3KKNA 1E2EA 3BGWA 1XPOA 1N2CE 1CJMA 3OESA 4JVNA 3K0CC 1ZCAA 2AD1A 3PUWA 1DEKA 1Q1BA 2WWFA 2X1VA 5DHFA 4ABYA 5H8WA 3GEIA 4G1UC 2FN4A 5SZHB 4GPTA 1Z47A 5BYJA 1NG1A 1FP6A 1FOEB 3B9QA 4A92A 5B64A 2WIAA 1KO8A 5DSZA 2CNWA 4AYWA 3RRNA 1CIPA 4Q7MB 5C46F 3Q72A 4CT5A 1G7RA 2DR3A 2FE4A 4BWYA 4JIMA 1RJ9A 3D6TB 3AVTA 4BPBA 1OF1A 1OW3B 1ZCBA 4CVNA 2ODNA 1EX6A 2WWHA 4P4UA 4PHFA 3WP1B 1UBGA 1H8EA 2PT7A 3X2SA 4MRPA 4LV6A 4LJ7A 5JHHB 1YU9A 5JEEA 3U44A 3EARA 3I62A 3SHFA 2A5FA 2BBSA 1XTKA 4FWIB 4KXFB 1MO5A 1OLOA 2ORVA 5CDFA 5LD2C 1IY0A 3NHBA 3GLFE 1NJGA 1LV7A 1T3SA 4K46A 2JJ8A 4DT1A 4BZPA 3KQNA 2GZAA 2IXFA 4JLVA 4WBSA 3C8UA 1M8PA 4ZKDA 2W6IA 1MABB 1JBKA 4KITB 2H57A 4A9AA 1XXHB 2ONJA 4HAYA 4DKXA 1CEEA 1C9KA 3MG9A 1E6CA 2C98A 3VU9B 1NIJA 2QROA 5BN4A 5IF9A 1GNPA 5FOWA 1IN5A 1GKYA 2JIZD 3IBYA 1U8YA 4V03A 2K5UA 3W3ZB 1Y63A 3K70C 2C5LA 2C9YA 1ZC4A 4CEJA 1E2KA 2LKCA 1PV4A 2YNMA 3TUJC 4BLOA 1VHLA 1CS4C 1FTSA 4OQNA 4I1UA 1WDTA 3C5HA 2EFEB 2QU8A 4WXPA 4B3FX 3F8TA 1NF3A 4PX9A 1XD8A 4E07A 2GWHA 5DNYB 3AP3A 3ND9A 1DG3A 4F4IA 1JJ7A 3AKDA 4V0MA 4US1R 1ZC3A 3RABA 1CJVC 2RMKA 1QHSA 2ORIA 1E4VA 2CJWA 4MRRA 1YZGA 2H8KA 4OKSA 5FBQB 3U3RA 2BKUA 2QRZA 5LBIA 4IRUB 3TH5A 3GCGA 3ZGXA 4DEYA 4D4KA 3ZYCA 1A4RA 1E99A 5BXQC 4Q7KA 4Q66C 3SEAA 3I8XA 2ZM5A 2IYWA 3VKHA 1JNYA 1NMXA 2CLCX 3GJ3A 1NI3A 1NMZA 1ZD1A 4B74A 1D2EA 1GL6A 4QBFA 5CLLA 2A5JA 3U2QA 1R6BX 4OJQA 4C7OB 3SYLA 2QORA 1K5DA 4OQXA 4M1MA 1W48A 1NIPA 2OBNA 2J45A 1W0JA 2Q3HA 3U61B 2RGXA 4W5WA 1J2JA 5BWMA 5FFMA 1KI1A 2ZR0A 3QVVA 5IK2D 1NKSA 2GDJA 3GJXC 4NCHA 1IOZA 4URWR 5J5CA 3B1XA 5EXPA 3PEWA 2QBYA 4AK9A 1Z0JA 3PUYA 2OFXA 1XRJA 4LYJA 1W4BA 2FGJA 3FKSD 3LW8A 5EE3A 3LDAA 4TYQA 3AF0A 1COWA 2R62A 4KFRA 1OIWA 1CRPA 3MLEA 4EFNA 4UNSA 4ESHA 1JAIA 1FMJA 1PUIA 1LW7A 2ANCA 4PAMA 2IC5A 1XTRA 1GRQA 2AHOA 1SVLA 2Z43A 3LBNA 3I1FA 3ZZ0A 4HLQB 1XZPA 4NONA 5SZKB 2DYKA 1EESA 1N25A
chains in the Genus database with same CATH superfamily
2VP9A 3HSKA 2XXAA 2A1UB 1L1RA 4XPIA 1HX7A 3D8SA 4P0PB 2IPOA 5DBFA 3IKVA 1G18A 4MV8A 2CXHA 3G8BA 3GJ7A 3ORFA 4OIFA 3W77A 5AW0A 4KYUA 2VWPA 1GPJA 1WPXA 1L9KA 2Y8EA 3VR5A 5EE0A 2XT6A 3QTBA 4RXUA 3ZWBA 1B76A 1ID8A 2P67A 2JFQA 3KJGA 1QV9A 3EIEA 3OUUA 4XGRA 2PX4A 4K8OA 1G8GA 3VISA 4FCWA 3I5UA 1HH4A 4DBVO 3G02A 4CIAA 1KK2A 3TM4A 4AF6A 2WU0A 4F5EA 4CKWA 2GXSA 5H1YA 1N2XA 5FD8A 1O58A 3H1BA 1PYOA 3PS9A 2XB2A 4MUGA 1MIHA 3UWMA 3G59A 1DARA 4MUKA 4Z3KA 2WYWA 3VR1A 3R3UA 5AK6A 1U4NA 3OZAA 1NA5A 2IUEA 3CLSD 5D1HA 3RW9A 3T3OA 4XSVA 2IKQA 2BY4A 1VYVA 3KKKA 1WUTA 3U81A 5CEEA 2NAFA 2XE8A 2XQGA 2W5UA 2YZKA 3NVDA 4O4LA 3ZE8A 1T5LA 3JRNA 5EJIA 4Q3DA 1G20E 3N2NA 2CUTA 3E22B 1VOTA 1J56A 1OIXA 3N2ZB 4JU8A 4C4YA 4AIRA 5LWQA 3LF1A 2C5EA 1CE8A 2IUSA 3F9IA 1U2QA 4ZICA 3SBDA 5CAEB 1DAEA 2AMLA 4O4HB 3HUDA 5REQB 3U31A 3GGJA 1EDZA 3FF1A 3UAZA 4C07A 2FW8A 3WOVA 5HR5A 1LNZA 1O6CA 2GJKA 4Y0NA 4I1PA 4B4DA 5JRDS 4LDQA 4GL4A 4RCYA 5ALRA 1F2TB 3PX7A 3MD9A 4H9GA 4G1CA 4LXXA 4ANFA 5CT9A 2ZYDA 1SVIA 3DE6X 3PX2A 2D5LA 3QNMA 4WOBA 3M34A 4DJTA 3HJGA 3RVKA 5C0OE 1C2YA 1ZVJA 1PDOA 3E81A 1F1BA 1KY2A 1SVKA 4RV9A 2AYXA 4NR0A 1GAQA 1RLUA 2NU8B 3TD9A 3VU3A 1AX9A 1LLFA 5BSGA 3U0BA 1E9EA 1X9GA 4I5IA 4F71A 5FWNA 4MQEA 4JB0A 3BMOB 3FETA 1IEWA 3QFFA 4C78A 3WB9A 4XYBA 4ZV9A 3X1YA 4CCYB 1K1EA 2CHGA 2OOSA 2Y27A 3VYWA 5CRIA 3SC2A 2EJWA 3OBIA 3AIKA 3M3DA 5T7BA 5KDOA 5G2OA 4O2AF 1P1FA 1U8AA 1JVSA 3MNFA 1IJBA 1PJ4A 2Q6TA 1T9DA 4CLHA 1NUAA 3EGDB 4FK8A 4F96A 1EVKA 3RSGA 1DRJA 4CMIA 5TQ0A 3KUXA 3H7IA 3RAFC 1ULBA 2FMHA 5DBOA 1Y4UA 2LCIA 1ZJ6A 3A9TA 2N9UA 1XPRA 2ZIUB 2CVOA 2DUMA 5FPPA 4O63O 5J1SB 2LCQA 3K4HA 8MHTA 2Q99A 2QOEA 1DAPA 5C4MA 4JKOA 2IYSA 4KTTE 3DBLB 1X7ZA 3AB7A 1SQFA 3K9QO 1DZIA 4MI9A 4R54A 1SXJC 4OL9A 1OH8A 1K5PA 3O0TA 2E7ZA 3PL1A 2CB0A 1VE6A 3ZQ6A 2J85A 3RWMB 1K6MA 1NXOA 4C0KA 4UXJA 2GJ9A 3I28A 1P75A 2Q5QA 2Z3VA 2ZOSA 4RFLA 2NUTA 1QPZA 4ZQBA 1UBFA 2VC2B 2GA9A 4W1QA 1FXWA 4FZVA 1EQ2A 2HYIC 1E0AA 1BROA 1QAQA 3CG0A 1Q74A 4HDKA 2QG9A 2SBTA 1N2JA 1RCFA 1J09A 4DLUA 4GPD1 4KQWA 2G77B 3B6EA 2P0YA 1GAWA 1QGAA 1TMOA 3A4MA 4L50A 4NYMR 1T2FA 3WLNA 2QI9C 1BJKA 2C1XA 2PJDA 5K51A 1OUMA 1C3EA 3C7AA 3L7KA 3GDGA 4MV4A 1N7GA 1CUVA 1JFRA 5HKLA 1PR2A 1S1MA 4LDAA 5JW6A 1KC1A 3K09A 4YXWD 4H35A 2VOEA 5EHXA 2WZQA 1VKZA 2OYCA 4E09A 4I4TA 2O0KA 3A0UA 2A9PA 2EKQA 4HF7A 2OAP1 2R8RA 4O08A 5IN5A 5JRZA 1ZJ5A 2CXUA 4FNMA 3LGXA 5JATA 5D87A 3KPWA 4H18A 2QKYA 3AONB 3AKEA 1Q84A 3QWFA 3KIPA 3PIDA 4WXHA 1VI6A 4DMUB 4Y1FA 5L45A 1IC6A 1VC2A 3GVPA 5AM2A 4DRYA 2Z1MA 1JG6A 1EFPB 3RSOA 5DKFA 2PGNA 4MYDA 3FDXA 1KY5A 3BRWD 3O8BA 1ECGA 1N9GB 1PI3A 3HRIA 4LJYA 4DV1B 2WKWA 4LE0A 1KP2A 1KVQA 4LMPA 2GKGA 1CG6A 2OHFA 4JLNA 4U3JB 1KETA 4P92A 4NOLA 4EGSA 1X14A 4TYNA 1XZJA 4W5RA 1YT5A 2V9CA 4W4TA 5D6NA 4HVTA 2PE5A 1Z17A 2J9XB 4M98A 1P9RA 1X1EA 2P6RA 3JXEA 2D2VA 4D8YA 1KI2A 4F9EA 3KZKA 4JB3A 4D1YA 3OJCA 3KOXA 4QUKA 3SEQA 2VP0A 1R9GA 5GV7A 4DBLE 4OFZA 1O0SA 4AXXA 3VKHA 1TQHA 3WL3A 3BUSA 2MMGA 2PWYA 2SCUA 1MA0A 2QZZA 2XEDA 1I36A 3DS8A 4A6DA 1ZIYA 5CDUA 1D6SA 1J9ZA 2GM9A 3HLKA 3KSUA 3O84A 3U5TA 1SU6A 1I7NA 2WUGA 5EKSA 3S40A 4JJ7A 2TECE 4GXQA 3EXEA 1L7VC 2X86A 1LS6A 1DOAA 4X97A 2P79A 5AK5A 1I4WA 4DCUA 3FFBA 3TQCA 1P7CA 2B4AA 1WTAA 2D8MA 3X43A 3F97A 4L5IA 4HTAA 4LZZA 4G4IA 1IHDA 2VDRB 3J7TA 1N5IA 2F2TA 4YP5A 1DAGA 1JR3D 2ZTSA 3ZUPA 4X3OA 2AKYA 2GZ3A 4QYWA 4X1YB 2BJVA 3DF7A 1RRCA 1M67A 1PSZA 1ZM3A 4O2RA 4O1IA 4O2BB 1KI4A 2PAAA 5J2TF 1KFJB 2D62A 2WHRA 3A0RB 2MU1A 9LDTA 5GONA 3SU8A 1XTVA 5GV8A 4KACA 3WZLA 1CDDA 1PJLA 2FWBA 3EXEB 3AHJA 2F3QA 3IR6A 3O9ZA 2ZUVA 3D6MA 4E3WA 2XBUA 4DLVA 3SAJA 2WJ3A 2H5EA 4GECA 3BORA 5A4DA 4RNCA 4MA5A 3WLLA 1BSVA 3VPXA 1RRMA 3IQHX 1TLLA 1L5NA 2XSZD 3VZSA 1RRKA 1BO6A 2FXVA 5FOUA 2ATCA 4UBMA 3NDBB 1SG6A 2NYVA 4K86A 5KJ1A 2WTXA 1W34A 4X60A 3FI9A 3RS3A 3C41J 1ZA2A 3FFAA 4IGFA 2UUCB 7MHTA 3OJLA 3A6HA 4ODIA 4DRZA 1BWQA 3BIJA 5JFOA 2OWEA 3FCYA 1WCV1 3OTHA 4S1VA 1C9MA 4BO2A 1P9OA 4L5BA 3HP4A 3LAWA 3NB0A 4E2FA 1UQUA 2WOJA 4OA8A 5E7QA 4AKGA 2AX3A 5CVEA 4DSTA 5KPJA 2X76A 3RSSA 2A78A 3LJKA 4YRMA 3IPLA 1RVDA 5DLDA 2BEVA 4Q9JA 3U3JA 4GVLA 3ONWA 1O5TA 2X6RA 3AOGA 3KHKA 5FWXA 3LFUA 4J2OA 3JPYA 2E5LB 2IS1A 3N70A 1FPMA 4RJLA 4JLMA 3GLRA 2ROQA 3EZXA 1XZHA 5JY6A 3WB1A 3NUQA 1K8XB 1J22A 2J87A 1VB5A 1WWKA 4OI2A 4QRIA 4RIEA 4Z4GA 1TA4A 2Y1OA 4R2JA 4CUKA 2IH4A 1T36A 1X1RA 4X20B 4L4YA 3UAGA 4MW0A 1O95C 1V7CA 2W4QA 1WB9A 1W93A 3S68A 5GIOE 3E7DA 2BGMA 2FDCA 2ZJBA 2DM6A 1KAQA 4YACA 3HCFA 1NN3A 3UWPA 4JP5A 4MV5A 5CB6A 1AB5A 3T0FA 2HA2A 2R25B 3JYQA 5AVWA 3R24A 3PNBA 1MQSA 3ORYA 4GM4A 1A9XB 1LU9A 1DX9A 2VYCA 3N87A 4WNYA 3VC2A 2H17A 3B9PA 2GAOA 2ZJ5A 3AVPA 4AW9A 3FYTA 1RLTA 4EIWA 3UK2A 2ECQA 3MILA 1Y82A 3TW8A 4P58A 2MSEB 3IAFA 3LM8A 4D8TA 4E5SA 1NV8A 3CZ9A 3GLKA 1H9BA 3JASA 3OHSX 3ZWCA 4XX0A 2OCKA 2QTGA 1J5PA 1QGZA 4KQFA 1Q17A 1W52X 3BA1A 4Z1MD 2E4XA 2OXFA 3CLVA 1DHTA 2VDJA 2XMQA 4RORA 1SWWA 2PKQP 3DBLA 3TSCA 2BGWA 2I0FA 5I9SA 1RXSA 4FUQA 3GP3A 4MUFA 5E1BA 1TEZA 2I91A 1P3DA 4Z0PA 5EMNA 2ODEA 1SXJD 5EKXA 1DXQA 3ZWXA 2FP3A 4NZ9A 1V5WA 3UMMA 2IPLA 4OAPA 4TSRA 2HMUA 1MG0A 1UOPA 3AO0B 4QJBA 5F5XA 3H2JA 4MR8B 1II9A 1KARA 3FDIA 1JDSA 2WD8A 4Q1AA 5FBKA 1EFHA 1YV9A 3K9CA 5K0TA 2ZSFA 1DWOA 3HNPA 3IODA 4G36A 4RL4A 2ZR9A 3NVKI 4KVAA 2JJ1A 4Q0MA 1XC7A 3WDKA 1QVRA 4M3NA 1E79D 3K3PA 3NKVA 5DM0A 4BJ1A 4YLYA 3FSGA 3MUNA 3T5GA 2AQHA 2HCFA 2P6PA 1IONA 3A27A 3B1ZA 4I5EA 5EAIA 5F73A 3QU9A 4DMKA 3P2IA 5FTNA 2QAGB 4YDHB 4ZANA 5JV5A 1UODA 4U7GA 1I10A 4CU2A 2VNHA 3D4PA 3AIMA 3ZQJA 5ARDA 2FUEA 3PT9A 4NAUA 4WZAA 1EA5A 5I7OA 3GJQA 4R1OA 5I9NA 1AN9A 1OFTA 5GONF 4FT2A 2Q4EA 4I4TB 4RD6A 2VHYA 4WNIA 4IKOA 1KE2A 4C4TA 3LHSA 5L7YA 5MF6A 4HLNA 3FGPA 3E9YA 3LHDA 4PRLA 3ZLUA 2QTVB 3IV6A 3JAWB 4NOMA 2VUTA 2BT4A 1WJGA 2PQMA 2V7QA 3ZWKA 3AVYA 1PJTA 4WW0A 1E60A 3A14A 1MXHA 1AGYA 2UXBB 5DK4A 3AEUB 4HUJA 3S3TA 1TT7A 2RK3A 3ST7A 4C3OB 2CSXA 4O5OA 2M6RA 3DR3A 1YRBA 2HIAA 1N5MA 2OFPA 1A8PA 2OSVA 5F2OA 3MS7A 3NWBA 3PNKA 4B6QA 1WOMA 3GX1A 3MMXA 2I6XA 1R7RA 3OT1B 3HCNA 2P9FA 5AKHA 1SXGA 3H9GA 2ZRGA 5HQJA 3R7FA 1K7EB 3W5JA 3NHSA 5FLEX 5L3QA 2F3PA 1JHAA 9ATCA 1KQGA 4CEHB 1JTVA 1PS8A 3RRJA 3BVPA 1BA3A 3IA7A 5JQGF 3EDRA 5AI5A 3ZEAA 2IPXA 2WVAA 1M7GA 2ZVDA 3C85A 1TVCA 3L7NA 4MQUA 4QYIA 4X6LA 1U1IA 3JZIA 2YHUA 3HY3A 5I9BA 4LV5B 5KJCA 3STHA 3UJHA 2BFFB 2NUBA 3ZNOA 3EPJA 3V8PA 4Q03A 1ABEA 1JJVA 3IGFA 3CZMA 4R9SA 4RPHA 2DERA 2OCAA 1T8PA 1HLGA 1XNHA 1QONA 2CDRA 4EB0A 4MR7A 2CNBA 2RGAA 1JAXA 2EZTA 3D0QA 1JDTA 3ZYZA 4INZA 3E7FA 1EP2B 3DTNA 3IJPA 4HMPA 4CKEB 5BR7A 3J7AC 1UAGA 4GPIB 4EOGA 3BE4A 1GPDG 1XTPA 1Z7GA 2XD9A 2XUIA 4FGLA 2A0KA 2GN4A 2HMAA 4PGGA 4W82A 5CCEA 2DH6A 4ZALA 5IVDA 2FOLA 1SCKA 3DEIA 1GN9A 4BVHA 4KRFA 5K6AA 4I50B 2VTDA 3MELA 4OGWA 3VH2A 1ATIA 1SKUA 1NOKA 1YVPA 4LF7B 4EUKA 1Q0LA 1WSDA 4J43A 3PDUA 4DADA 5IMSA 1RWWA 3MCZA 4KNWA 3R8CA 3KQVA 4JEIA 4PCVA 5BQOA 4IJVA 3EPLA 2IY8A 3CUTA 2GKOA 3E15A 2A9FA 4BEJA 2WTNA 1Y48E 4QGAA 2G1PA 1RD4A 2HGSA 3AFHA 5KQSA 4KK3A 1NT4A 1XQVA 4OX9Y 4PZPA 2WR8A 2H1VA 4IXNA 4R1TA 2IP1A 2D54A 5JTTA 1P9LA 4PHTA 2DKNA 1XYGA 4IJUA 3RB8A 5EWMB 3SK0A 1EIZA 2VAPA 2PL3A 3HB1A 1N5KA 1OT3A 2V7XA 3VTZA 3PIRA 4KUEA 2C7GA 1LF5A 3OPQA 4CKCB 1TKBA 4Y6RA 1AKTA 3VBCA 3IDQA 5JS2A 3EH1A 1BS9A 5JFGA 3JSXA 5IXSA 1DE0A 2D5IA 1MEJA 2NV2B 4KWCA 5T67A 4LQDA 2AW5A 5DULA 5DOZA 1Z5ZA 1O0BA 1GZVA 4NZMA 2Y1CA 3TSOA 4X5OA 4Q00A 3VV2A 3AF1A 4WJKB 2QAIA 3UK0A 5C51B 1BA2A 3ZXYA 8ATCA 1QHHB 4KQKA 2Q3CA 4Z2YA 3VMFA 4EJSA 4HAWA 1MLDA 1IN6A 1QDUA 4ARZA 4CFZA 3KCQA 1I0LA 3PGKA 4X95A 2O8DB 4LNUA 2I7TA 3RKSA 4ZEMA 1VPEA 4PYOA 4X64B 1C41A 3MHPA 4ENUA 1PUJA 3WQHA 5BN3B 3H0CA 1ILEA 4R8MA 1R0WA 4TX1A 4YRIA 3HA7A 5LLSA 3TQQA 5JPDA 3LQ1A 2CE2X 2RK4A 3KJZA 1FNDA 3GGOA 3NHFA 2NO7A 4B3DA 1RM3A 1IB0A 3WIEA 4EL5A 2C5AA 1IU9A 1KJJA 3UQYS 3QUBA 3NWPA 4WDQA 4FZJA 3V6LA 1Z28A 5HS6A 1JXAA 3A9VA 5IVIA 4FW8A 3GA7A 3KC2A 3PFCA 4TV9A 3HGTA 3GRUA 3RTCA 3EGOA 4RA6A 4KSYA 5JBNA 5JO0A 2F3TA 3WKBA 5BUSA 1J0AA 3N8KA 4NENB 2ERYA 4BO7A 1I5OA 4K6MA 1XCOA 1HT0A 2WIJA 2ZRFA 3K94A 3A2LA 1K3UB 3CX7A 3JQFC 3KR2A 5AM1A 3BXZA 3QKRB 1H4VB 4ZMBA 3R9WA 4L4ZA 5K8VA 2DTXA 2ONKA 4XOIA 1E5TA 3QKUA 3W5UA 1V9SA 1NC1A 5FTJA 1WL8A 4OXQA 2NSLA 3UWSA 4QUBA 1G21A 4XPZA 2ZT8A 4KRGA 2C8KA 1UKYA 2HIGA 3MCWA 4E2YA 1C9YA 1W85A 1YVRA 3W6ZA 3ZQUA 1RRFA 3JAMA 1VHTA 2G6BA 3ZDFA 3E2IA 3WWOA 1BX3A 1MJGA 1TD1A 1KJZA 1QJCA 1E1CA 2QVZX 2WILA 2X0IA 3GJYA 4M60A 1BQ3A 1DI0A 3LXRA 4IGEA 4OI4A 5CLHA 2H0AA 2P6MA 3CXRA 1E9SA 1E6WA 4IV0A 4V1CB 1YFLA 1CV2A 1G5HA 2A4MA 4IMRA 5B1SA 4DIDA 3K0AA 4WN3A 4GLFA 2C2GA 3L2OB 1U5BB 4GI3A 3WDLA 1WKVA 2PH7A 4OHZA 4KNYA 3TFWA 3DKKA 2G17A 2WFMA 3GCXA 4RXTA 4TMZA 5TNXA 1UR5A 1K7FB 2ODBA 3L1JA 1W85B 2JFHA 5KOHB 1D1QA 2YJZA 4JEHA 2CUZA 3JX9A 4QFMA 5TVKA 2RGRA 2PMKA 4EENA 2XNCA 4DIMA 2OZVA 2FF7A 3J81k 5AHWA 4B3MB 1JKIA 3I0MA 1R16A 2BZ1A 1XBTA 3ACDA 4KDFA 3A6ZA 3OC6A 3BA6A 3TBHA 5FI0B 4B75A 2YXDA 3EF3A 1VLJA 3B70A 3DZDA 5MFZA 3N0VA 1MJGM 2GM4A 4ZGGA 1XCMA 2OBMA 1T2AA 2NUPB 3OO0A 2XUGA 3CWZA 3H5RA 2EATA 3L4SO 5I6DA 2OZLA 2OV8A 4YQFA 3G49A 1EK5A 5ER9A 3N2GB 3GZNA 2QYHA 3E1GA 2Y76A 4J91A 4DLBA 4EHJA 3T5PA 1OXTA 2I3GA 2PMEA 2R1VB 5DBIA 2CL7X 3UMSA 5JZMA 3R0XA 4H0FA 2Z8ZA 3E5MA 3AXTA 3DJFA 3DPIA 4GGPA 1G42A 1YCFA 4YECA 1QRUA 3WMXA 3KYIB 4RF5A 3LPDA 4ECAA 5HFJA 1J8DA 1CR2A 2FTKE 1JHYA 1Y0BA 4NMMA 1W25A 3IPAA 4LSZA 1SVNA 1CRLA 4OQPA 3SZGA 2K2WA 4QLAA 4CM6A 3EWAA 5KPDA 1PVOA 1GUDA 2JAUA 3BICA 4OHMA 2HCTA 3KYDB 3PGVA 1U2PA 5DOVA 5EUBA 2WJVA 3ESDA 1MOZA 1BWRA 4KYVA 1SUPA 2TMKA 4Q1FA 1C7IA 4LJRA 5K6TA 4JSRA 3NYWA 4OSOA 1QCYA 1YD7A 1EB8A 1Y1SA 4C0LA 3V8EA 1UXGA 2OB1A 3DD5A 3IOEA 4ZT5A 3ZGLA 1L8XA 3I9FA 1T2UA 2P3QA 3QMWA 4AROA 1PT5A 3TUIC 1AGNA 2XGJA 1R5BA 4HWTA 1FDUA 2CVHA 3P0EA 1PIWA 3VSEA 4B3SB 5LA6F 2WJHA 4XUEA 1HMPA 1M6HA 4ZAFA 1E9VA 1NYQA 1MC1A 3I34X 2ZVQX 3BRQA 2QMQA 3KYDA 1NBWB 3GRKA 3A3YA 3LDGA 3M2TA 3CCCA 3N8GA 2EBFX 1KU0A 1O89A 3JCZA 4QOJA 1NXTA 2B6HA 3FWPA 4TT8A 3UHJA 1JGTA 3GN1A 5FPKA 1ZH4A 1QE3A 4ARUA 3RSLA 5L9AA 4XR9A 1RBQA 2YC4C 1HL3A 4URXR 3LWDA 1KQFA 2GEUA 2PMFA 3NC1C 3A8TA 2G28A 4L8VA 5AVXA 2C1ZA 221PA 4H0CA 4MUYA 2XAUA 3KEGA 3I04M 4I6GA 3SZLA 1RCTE 2JH9A 4JQYA 4BNHA 1LC3A 5K0EA 4H1HA 2PX0A 4MLPA 4DUYB 2FMKA 1B6TA 4RULA 3QI2A 3VAZA 1G4HA 1KMNA 2OZLB 3E4CA 1NW4A 4I4IA 4FB5A 4BZXA 1F38A 5FLKA 3X3HA 3M4XA 5FB3A 4F2HA 5G40A 4D3XA 4HWRA 2JGNA 1HOXA 1YIDA 4MP3A 4BGDA 2ZBRA 1T2DA 5EJFA 1P2GA 2AGVA 4H08A 1UK6A 5IVHA 3LX6A 4WA8A 4LF9B 1KSHA 3EMVA 3H2KA 1G59A 4PHHA 2VK4A 2BHTA 3OA2A 5BT8A 1J42A 3IMEA 1N8KA 3C6ZA 3RPEA 1LDEA 1Z35A 3NGXA 3CBQA 3ROEA 2EWWA 7ABPA 4J7CA 2H51A 5TQVA 2ZCVA 1H2BA 2HKIA 1A9YA 5EERA 1ISGA 3ZU6A 4OQFA 4JB8A 2O48X 2Z2ZA 5K8CA 1QRDA 4Y2GA 2AJ8A 1Z6TA 2HWYA 2P91A 1DFGA 2DAPA 3CJQA 3DULA 3AEQB 1BDHA 4CMGA 5M29A 4JBHA 3ZW8A 1XEAA 1EI9A 1PN3A 2RHDA 3N0XA 3QFTA 4JCCA 3RHTA 1JLMA 4HPXB 2H4HA 3RHFA 1RIIA 4BNZA 5LLDA 1VE5A 4I9UA 2II6A 3H75A 1IATA 2NZUG 4PANA 4KX5A 5H3HA 4CKCA 4DM7A 3EFBA 2VUHB 2Q1YA 4LY9A 2B1IA 2H31A 4HNGA 5DEIA 3H9JA 1WXXA 4HNUA 3GUZA 1TM3E 3SVLA 4BQFA 2QR3A 4ENQA 3RREA 1NBMD 1SZPA 1ULUA 1WQ1R 3O9MA 4M86A 4BB6A 1ABBA 1PCXA 5K0SA 3ZZUA 4NK5A 1VXRA 3TQSA 3RC3A 1E2LA 1OV4A 2WHYA 2QZPA 3TIFA 3TB6A 4BMNA 2P7HA 2YBEA 1C1DB 1VJ0A 4HEJA 5KTYA 1KBOA 2ZYRA 4MB2A 2E85A 4FOTA 2WWYA 3U3DA 2BF4A 3H4TA 3U40A 2QQEA 3Q8KA 4PWZA 5IM5A 3G5MA 2IW1A 3N3AC 3OPXA 2QMZA 1JQKA 4II3A 1C2TA 4AY4A 3QKRA 4AJEA 4N8SA 4NCKA 4EYQA 4LF8B 1NGSA 3TZ6A 2A0UA 1XQ1A 3BFPA 3BD7A 2FPPA 1PVVA 2JCYA 3A58B 4LOLA 4XVUA 3I64A 1XLUA 2XY4A 4UCQA 3RKRA 2IUFA 4YO7A 2YTZA 2PVPA 3A6LA 2ZI4A 1YDGA 1CDOA 5AVOA 3TRFA 2XNJA 3LBAA 4L73A 4N3BA 1QKJA 2WDPA 2OESA 4UATA 4B3BA 4C2BA 5IVKA 1BYIA 2C29D 2HHAA 2F00A 3DZFA 1PVDA 1ZMBA 2C4TA 3GAAA 1IBCA 4M0PA 4FWBA 4XGIA 2IZ0A 1K3FA 2P2SA 2FRDA 5LXTB 2C7RA 1Z13A 1SIOA 1T24A 4ESVA 3QVOA 1PWEA 1ZGAA 2VDUE 2H9YA 5FWYB 1E6MA 1NASA 1QO0A 1MTOA 2OECA 3C1UA 1G3MA 1WPQA 1ECPA 1ZXBA 2CJWB 3EAGA 4W8HA 5LA6A 5TJHA 4CLXA 3LOQA 1FP4A 1U31A 4H3SA 4O4LB 4QOEA 1S2NA 3VH4A 1ZAYA 3VVLA 4I5GA 5KOHA 3KKEA 5IU6A 5JDIC 2C2XA 3EQ7A 3Q40A 4JYZA 3ENZA 3NJ8A 4NKRA 5GVSA 4KGVA 3CE6A 4UHJA 1SQ5A 4IIJB 1XFAA 3C1OA 2DFKB 3AUKA 4KPYA 1EAMA 4LHZA 5JAOA 1YUBA 3ZD8A 3PLRA 2GBFA 1U2GA 5HK9A 2BFWA 4J75A 2X2FA 5I4BA 1NMQA 2CDCA 3THWB 1EGHA 2J6IA 4QPNA 4E2ZA 2F55A 1H3NA 1NVAA 4JFRA 2XA1A 3GGSA 1FLNA 3ODPA 1QF9A 4BQSA 2YJTD 1GADO 2TS1A 3JW8A 4B3XA 3MEQA 3VZPA 4NYJQ 1D1PA 2BDUA 4PN7A 5AW7A 5JEDA 1FLVA 4RIIA 3SG0A 2P6UA 3IO5A 1CF9A 4WLFA 4QEZA 3K9HA 3MAJA 5JWRA 4ZDKA 1Z4PX 3BH0A 3BXOA 5AHRA 4C89A 1SUFA 1E9AA 3CZQA 3IPCA 1WBJB 3PC8C 3NOOA 4FYHA 1CQJA 1LTQA 4UAGA 3U9SA 4CW7A 1SUBA 2FA9A 4Y2XA 5ALYA 2ZJFA 4KLCA 5HK8A 4A27A 3LF2A 4YJ3B 3TQOA 5HZHA 4KMMA 5A6VA 2H8GA 3MFQA 1RJGA 2GA8A 1GNRA 1T6ZA 3NT5A 2HJVA 2WP8J 1ZM9A 2GHTA 2HH9A 3IP1A 3NFRA 1N33B 4AMVA 3SLRA 5HMMA 3DEKA 1Y1RA 3MD0A 3SKYA 3HGMA 1DQRA 4GR4A 3TVYA 2DFNA 3SS8A 1BJRE 2X23A 4ZN6A 5DCYA 1N2GA 2R85A 4Y9RA 5T64A 1PR4A 1OZAA 5THXA 3FNEA 3CRVA 4NI5A 2AR9A 3X0DA 4FN5A 5AM5A 4I4CA 4ZQHA 4D57A 1CQJB 1T1JA 1FNNA 2VLBA 2C20A 1E1RA 1GQRA 3HN2A 1Y81A 5D5QA 5DTMA 1TDJA 4ZYVA 3U4MA 3AFNA 2WSMA 1DDOA 3E9RA 4FFWA 1KBZA 4Y2JA 2OM6A 2QAGC 2QRLA 3JZDA 4J1TA 3DO6A 4QOIA 5DO9A 5B7PA 4YRSA 1QG2A 1SOWA 2IHZA 2Z57A 3F6YA 2LP4Y 1XRMA 2JI8A 2INGX 4I4TF 3GLHA 5FHQA 4X24A 3AVXA 1YRHA 2OC4A 2FPUA 3ZH9B 3JR3A 1N2ZA 4J76A 1QF7A 3O1LA 3WXMA 3SF0A 4GOXA 3QYFA 3SBOA 2H5LA 1THMA 3L1IA 1YMQA 3S2IA 4YV1A 3G7UA 4Q02A 2VP2A 3PQCA 1L1QA 3EWSA 1II8B 2OG1A 3NDJA 3UG6A 1LWNA 3EXFA 1XCLA 1DXOA 1U94A 1VMDA 4JZYA 2JNWA 5L40A 2JHPA 4DR3B 4HBGA 4EKIA 1T9HA 4X1OA 1Z6GA 1YUNA 3BGVA 4WCVA 2WFLA 2W98A 1XG5A 2ECPA 3OX1A 4Y6PA 3GEMA 5DE3A 4BDSA 5IHXA 2MSLA 3S1AB 1JEEA 5A4AA 4GI7A 5IZCA 4ILEA 3ZBPA 3WVNA 3QY9A 2ATXA 2Z3ZA 1FVFA 2CKDA 2X14A 3HUFA 2QQFA 2EBUA 3SVTA 2R8EA 3X1JA 1QB7A 3NLLA 1M8JA 1A04A 2OCXA 2JGIA 2VTVA 2LNDA 1DPGA 3VR2D 1Y4DE 3QBEA 1U3CA 3QWIA 2WA2A 3U19A 2VF5X 5CGZA 1NZFA 1DKPA 5AUOB 4WBNA 3FOFC 5A0VA 4U7FA 3BF7A 3KAQA 2A33A 4RVSA 2GBLA 2NPIA 4EKYA 3II6X 2KPOA 2K7FA 2MHCA 2QIPA 3R3WA 4O4LF 2R8ZA 3U7FB 3RU3A 2BP7A 4M8LA 5IJWA 1OYYA 2O3SA 3WWPA 1CEQA 3PQDA 5B58C 3ELUA 4JOSA 4RW0A 121PA 1UWLA 2ID8A 2V3VA 4ML3A 5TV2A 2IV2X 5JI3E 2HT6A 3ABRB 3SIPA 1KTVA 1QTRA 2CLMB 4W9RA 4B3HA 2FQYA 1SUEA 5AHXA 4DJJA 2Q9CA 2XMZA 1Y7IA 2M1ZA 2NXCA 2XCIA 3VXKA 4DNPA 2C77A 4IUBS 4CETA 1ULAA 4LHEA 1E5VA 3IXQA 2DU8A 1MFZA 5MN5A 2XCTB 1EM8B 2OT3B 1OVGA 4J1TC 3LMKA 4WKNA 2CHFA 3G0BA 2FDXA 1EDEA 1W8DA 2JIPA 4J0QA 4YO8A 4DA9A 1V8OA 3O7MA 2GD2A 5GVRA 5FAXA 1POWA 1WO8A 2KJQA 3A1NA 4WUTA 2E2WA 2NZ8A 3R7SA 2PGOA 1GQFA 2PZ8A 1PRYA 4IIVA 3NGLA 4TWJA 5DXAA 4YV7A 4G5GA 3GLHE 1L6IA 1QV7A 2C2BA 3B78A 2VL7A 3MRSA 3PFFA 2POQX 4PLHA 5A5VA 3S4YA 5B55A 4HQRA 3KVYA 2AMYA 3C87A 3RTGA 5BSEA 3EVNA 4R01A 5JSZA 1KBQA 1XLWA 2FF5A 2GILA 4ZXPA 1OI7A 3EXFB 3AFMA 2ZXUA 2YH2A 4FNOA 2Q4OA 3V1KA 1X15A 1U5CA 3LU1A 3DHEA 1LDYA 1J21A 4N7MA 4J16A 3DGFC 4HX2A 1W47A 3L8MA 2ONCA 3LG2A 4FD2A 3LTNC 1JPUA 4UDXX 4XUGB 1YQWA 1L4MA 1P0IA 5J23A 3PE4A 1ECBA 2QLMA 4R9UC 5CU7A 1F3OA 3ANSA 1ZIPA 5GADl 4GM1A 3IL2A 2NU8A 2B61A 2JHGA 1E9FA 4QEDA 2YL2A 4EM6A 3QX3A 3R9XA 4EHFA 1IH8A 4MYTA 2B2CA 3EYAA 2HBQA 4G41A 4L02A 4PQYA 4DQDA 5M04A 2WJJA 1YR3A 3PUKA 3NASA 1EQAA 1OWNA 2BELA 2BJWA 2OYRA 2ERXA 1HQCA 2QUAA 4AKTA 4CQMA 2XLCA 3PWKA 5L3ZA 3UQZA 4B3JA 5BVGB 3K8YA 4UBOA 1EUQA 1BGWA 3T3PB 4JXKA 1Y3HA 4CNQA 3JSAA 4GS5A 1UDAA 4N5DA 2IV7A 2LE0A 4X85A 2C8VA 1XZBA 1P5FA 1WMAA 2I4MA 4M9CA 5ALVA 5D8DA 1MOSA 3AILA 1YS1X 4BGEA 4AZ0A 5FJIA 2AFIA 2Y6UA 2Z2JA 4RPIA 4DAEA 3L6CA 4KREA 1VTKA 1PNVA 4IVNA 2CUNA 1U2TA 4YT5A 1SAYA 2WU8A 5EIWA 4AAYA 5KTRA 1ZGCA 1ZK2A 4YUVA 1G21B 3G2MA 3A2MA 3PC3A 4PLTA 3GHHA 1NKVA 1J2YA 5BQFA 2C9ZA 1XDUA 3ZOKA 2XZPA 3OIWA 1IHOA 4MW9A 4DG5A 2PO5A 2I67A 1LCIA 2ACKA 2JIZA 3KJFA 5A05A 3UT5B 3OVMA 5BR4A 3PCTA 4A4DA 4OKIA 1ENOA 3JQAD 2CNLA 3ILYA 4FDAA 5IBQA 4A2WA 1Y5NA 4RV5A 3H86A 1E9DA 3IE0A 1CC1S 3PE3A 4NU8X 1EWRA 3S28A 5CB4F 2PUJA 1ZX1A 4CM3A 4RVUA 5TQ2B 1R27A 2W9XA 3B1VA 3E35A 1QBKC 1R4MA 1VCOA 3GRFA 3BL8A 2DF8A 1GNSA 2CYCA 1JG3A 4BB9A 1F14A 1PEYA 2Y2UA 3OQNA 1CZUA 4AT1A 1XMVA 3A1SA 3V32A 2AD5A 2JJMA 1L8LA 2VHCA 3DZBA 2AQIA 4WMLA 2WNIA 1JQAA 2HDNB 2L42A 4PAWA 4AO7A 1CQWA 1RKXA 3PK0A 3UAYA 4N3NA 4C7XA 3ETNA 4ESEA 5EG5A 1NXWA 1W9MA 3B38A 5FORA 1HV8A 4DDUA 2A7QA 3LLUA 4TT3D 3U48A 3D5EA 3KQWA 2WABA 3QLVA 4V0OA 4BE9A 4YP6A 2IK8A 4LFBB 2VPQA 4YX9A 1RP7A 1LI5A 2D7DA 5KYUB 1M34A 5BMVA 2GEJA 1WXFA 3PUZA 5DTRA 4HL6A 1RWVA 1XCJA 1A5ZA 3OKFA 2IA5A 4PSUA 4WJLA 1H69A 1BE6A 2BMEA 3CG4A 4ND5A 5TLSA 2VJLA 4BNDA 3P0IA 3IVMA 3SQNA 1AZWA 3D3QA 3NAZA 3CH5A 3EZ9A 2J0EA 3SS7X 4HXYA 1BKSB 2VAWA 2FN8A 4WK4B 2XB8A 1TYZA 2P41A 2GERA 5GP1A 4WOCA 3FMVA 4JGIA 4MUXA 1JIVA 2EX4A 3Q3EA 3KOYA 4ZQIA 3C8DA 3FYSA 4O8ZA 3T9CA 4AD8A 4M1EA 4E14A 4H1WA 3UAOA 3B53X 3GT0A 1N2HA 1O03A 2YJ5A 4B3IA 2XIJA 1O4VA 4FKZA 3PYMA 4LYFA 1J70A 1B16A 2NZYA 1X80A 4M1KA 2B8NA 1L1EA 4PLYA 4CMHA 4TQUS 3OIDA 4EA8A 1NBEA 2JI6A 3CV3A 2HJWA 2BR5A 4RXMA 4C7KA 3I92A 2XKAA 2I6SA 2QDKA 3BM5A 3S2ZA 5EJGA 1IM8A 2FMUA 3HBFA 5ERYA 2H2IA 4BVGA 3NALA 5IUNC 4RGBA 2DZDA 2EHDA 2CE7A 4RIHA 5JXWA 2HIHA 5LMCA 3GLIE 1DADA 1GXSB 1TK2A 2H1CA 4MRVA 4RHYA 4YJHA 4YMVA 1ZH8A 3LO5A 4X1YA 1QGED 4RF4A 2JKVA 3AM3A 2BKAA 3OF5A 4M89A 5CTJA 4GDFA 2ZBPA 3GFGA 5AVQA 1XDGA 1XVAA 3SFVA 1PFUA 4RTPA 1J8VA 4ZK2A 5F64A 1HKHA 5E9WA 2ZSBA 2OWDA 3M6XA 4B0PA 2C99A 1JEAA 1V11A 2HSWA 3BRSA 4RZ3A 4ZAXA 1NT2A 5ILGA 3NS7A 2VDOB 3KSBC 3KQOA 1ISIA 1KEUA 1KO7A 2QMUA 2QN7A 3GLQA 2Y71A 4HWGA 2IHKA 4OL0A 2A5GA 4JUDX 2RE8A 1P33A 4N3GA 4J0HA 1S0UA 1D2MA 2O2IA 1AKQA 2J3JA 2GF0A 4WCFC 4UM9B 2JJ2A 3ICEA 4PFKA 2VNKA 4I9HA 3IIJA 4IIGA 4KQJA 4RO0A 5EMKA 1H2XA 2Q0QA 1PE0A 4MITA 4DUZB 1L4YA 2PUGA 3KWFA 2QVLA 3LYHA 1QG4A 1FQWA 1K0UA 1JI3A 3ROMA