2X2EA

Dynamin gtpase dimer, long axis form
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
341
Chain Sequence
MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDKHGTDSRVDEMLRMYHALKEALSIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYNAMIN-1
publication title G Domain Dimerization Controls Dynamin'S Assembly-Stimulated Gtpase Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 107
structure length 341
sequence length 341
chains with identical sequence D
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x2eA00
5DLQC 3QE0A 3EPLA 1KI7A 4HDOB 2QNRA 2QBYA 5LDDC 1E1RA 1LS6A 2ZS7A 3B9QA 2XEXA 4QBGB 3R7WA 5SZKB 3AF1A 1J70A 2JLQA 4RKEA 4B76A 1ZNZA 4BLSA 1G6HA 3IPYA 2GWHA 2QM8A 3REGA 1ZUIA 2VL7A 1XD2B 1XF9A 2VHTA 1CRPA 3W8RA 1U81A 2CL6X 3L0SA 1OFUX 2O8DA 3VFDA 5J4KA 3KKOA 2HYIC 4K46A 1JB1A 5K8UA 1HQYE 4GOKA 4ZI2A 4QNRA 3LY5A 2VEDA 4JKYA 4QRHA 3ZZUA 4IVPA 3DM9B 3GLIA 3E5HA 1UKYA 3HPQA 2IS6A 2DCUA 2GBLC 5FBRB 2LKCA 2W0SA 3QIAA 3KJEA 1JJVA 4Q48A 3GQBA 1P61B 1G18A 1JAHA 1XNJA 2XZLA 1Q3TA 4M1OA 2Q21A 4S2EA 3L0OA 4DDWA 2QPTA 4LBYA 5FL7D 1KJYA 3MAAC 4A4DA 1W2HA 2EW1A 4RZUA 2J7KA 2CVHA 3OEEA 4LCBA 2ZJ8A 1LF0A 2AXNA 3SR0A 4YDHB 3HU3A 4O3MA 3NBFA 3QY0A 2MSEB 4G5RA 1XTKA 4PHTA 2PT5A 2F3TA 1JEEA 1CJVC 1DBSA 4EPYA 4WAUA 2CLDX 4PZYA 1BOFA 3AF3A 2KBEA 2J0VA 5DI3B 2ZI5A 3EIEA 4LK2A 2KJQA 3GJXC 1E99A 4OJKA 5J4LA 3NC1C 1XJ0A 2EWVA 1DAIA 2FEOA 2XJ9A 1XJCA 3OIVA 3K0EA 4U00A 3M6AA 2X2EA 4IDNA 5KUTA 2YKGA 2Q3FA 1N6RA 5AWFC 4DCUA 1A4RA 2ZRAA 3MMPA 5AUQA 2ZU0C 2IEYA 1Q20A 4QM7A 2Y8EA 2QA5A 2QP9X 2Z0MA 5C4MA 3EZ6A 5AK0A 1MABA 1E0AA 3LBHA 4Q4AB 5FL7A 4BLQA 5L3QB 1ZM4A 2QGNA 3NBZC 5HZKA 4LV8B 2WJJA 3VNUA 2P6NA 2QZ4A 3CLVA 4N0DA 2H7VA 1KO1A 1VG0B 3QF4A 3LH5A 2ZJ2A 1P2TA 1E4YA 1XJQA 2OHFA 2CCKA 1E9SA 5KPJA 3W9YA 1DG3A 2WSSD 3EWAA 3IBYA 1GL7A 3U6KA 4EFLA 3PG5A 1NN3A 2ZROA 1TNDA 5FOTA 1FW6A 1XMIA 4HB0A 1KI2A 4JL8A 4Q1FA 1KKLA 3A6PC 1IBRA 2FN4A 4JS0A 4XIGS 1XXHA 4GBMA 1DS6A 4UXJA 5P21A 4D26A 1Z29A 1JBKA 2RGNA 4QBFA 2AFIE 4EPWA 1BS1A 4TQAA 1SHKA 2XOKD 1Q1QA 3SHWA 2ERXA 2C8VA 1YQTA 1U8ZA 4O0MA 3BC1A 2J0UB 4DCSA 1UAAA 4US1R 3GEHA 5CM9C 3SFVA 1R7RA 1UBEA 5D3MB 1Z28A 3THOA 1SVWA 4ACAA 1UKZA 1AS2A 3KJHA 2OCPA 3RNLA 2AKAB 1W4RA 4KVAA 3B8HA 4BFVA 2DBYA 2DY1A 3NHBA 4FCTA 4Q1EA 1OXTA 3SEAA 3T5DA 2FFBA 4ZCIA 2YOGA 4DLXA 4DVGA 3SYKA 3CWQA 4G5QA 2O8CA 3OFNA 3ZVRA 1FPMA 4B3DA 2DFLA 2WSSA 4RFVA 3UXMA 2B6HA 4MDEA 2CMKA 2YC4C 3L0PA 3GFOA 3IO3A 4MRPA 2JLUA 1NBMA 1W2GA 1SKQA 1TUEA 4BRUA 4GDFA 3CZPA 5JCPA 3OAAD 1RC8A 2ZSAA 1KKMA 1HT2E 2YWHA 3PFIA 3T15A 5DN6A 3H86A 4DB2A 4B6EA 3G0HA 3NDBB 4DB4A 1YZTA 3SBDA 3BFKA 3I92A 2ERYA 5H70A 1KI3A 3AKYA 3DPUA 3LQRA 5CB8A 1Z08A 3DM5A 2ODEA 3IKJA 3P27A 4A15A 1W4BA 2RHDA 5K8TA 3MWLA 4DUGD 4LOAA 4M9QA 3FFAA 2ODNA 4B3FX 1IOZA 2WKRA 2ZUBA 3AM1A 4PZLA 2QAJA 1T6NA 1IJFA 1KHTA 5CK5A 2WIBA 4LYAA 4RZXA 3VTKA 2BMDA 4CT5A 3P4XA 2YYZA 2GAOA 4I99A 3VR6A 2B8WA 4Q1DA 1P7CA 3TSZA 5JS8A 4YMVA 1IY2A 1GDDA 2HYDA 3CPEA 2QAGA 1M7HA 1WF3A 4DLZA 2VTKA 3CRW1 2AD5A 2F1HA 4OI1A 1G3IA 1NN1A 3LW8A 4KJZA 1B23P 1RFLA 1WBDA 5ANRB 1XTQA 1KI9A 2X77A 4PSKA 1QHHB 3OAAA 1KAGA 2GA8A 2E1RA 1KMHA 2YWFA 2IBMA 1IAQA 2HJGA 1R5BA 2EQBA 1F2TB 3CRMA 1C1YA 3EZ9A 3F0TA 3GJ3A 4F38A 4BUJA 5GADl 2GXAA 4H1VA 1Z06A 3AKDA 2IEZA 1NN5A 5FPSA 1JAIA 2GJKA 4IDPA 1FQKA 1XEXB 3OESA 4TZ0A 3IGFA 1FTNA 1XCMA 4I1OA 3FHOA 4DUGA 3MG9A 5IRCD 3DHWC 4QJ3A 2QQEA 2QSYA 3CPHA 5JEDA 2A3RA 2BBTA 3C5CA 3ZIAD 4HEJA 2DHRA 2XTZA 4Q7LA 2Q6TA 3ECCA 3QXSA 3HU1A 4MKHA 4C4PA 4FMCF 3THXB 1UPTA 4DDVA 2GILA 4BFUA 5TY0A 4FW9A 4ACBA 1ONBA 4LPKA 1Z6YA 2GZDA 5DI9A 5FUWA 1E6CA 1JEDA 5FOUA 4LHWA 1E2GA 2WJYA 4LJ5A 1YZGA 4E22A 4TL7A 2ZRPA 4XD7D 3GJ7A 1OYWA 3WYAA 4PHFA 1EFHA 1N6OA 1UBGA 2G1KA 2GCPA 4XWAA 3V4FA 3AGQA 1SXJA 2HJVA 1FNMA 4ERNA 5JRJA 4ZIRA 5HTKA 2BWJA 3RS7A 2V1XA 4RSGA 4LHVA 1AS0A 4HLUA 1Q0UA 4D82A 1RPZA 4CEHB 4TYWA 2OM2A 4FMDF 4OK6A 3UWOA 1MO5A 3EAQA 3H1TA 3PUYA 3UG7A 1KK1A 4Q9JA 3NWJA 1KI4A 4GMXA 1TEXA 3AKCA 3IO5A 3PQCA 3U3MA 5IF9A 2F9LA 5K8IA 4YONB 1GFIA 2AL7A 5B64A 5DIFA 3M4YA 5AJVB 2UKDA 3ZIAA 1Q3HA 4HAZA 1NMYA 2ZR9A 1G5RA 3ZZTA 5L8VA 1JR6A 1ZCBA 4QM6A 4A0FA 1T8TA 1E9BA 3NXSA 3CF0A 1I2MA 3Q85A 3TUZC 1MKYA 3ZS8A 4TMXA 1Z0DA 4BQSA 4ASUD 1IN8A 2O8BA 4XD7A 4LC1A 4W9MC 1EESA 2IA5A 3EG5A 2IXGA 1AZTA 2FGKA 2OXRA 4JMPA 5J47A 4C9BA 2RGGA 1VIYA 4D4MA 1Z0JA 4P0TA 2OAP1 1UJ2A 1HQCA 4B74A 4TYPA 4HAYA 1RRCA 1NVUQ 1EGAA 3CWZA 1YR9A 1EFRA 3SHFA 3FKQA 3CH5A 1H8ED 1CBUA 4HZUB 5KPDA 2ZM5A 3EWSA 5J40A 1G7SA 1G8HA 2GCOA 4KLNA 1OSNA 3X1ZA 2GK6A 1OHHD 3P32A 1RRGA 2WPDD 3TJZA 4ILEA 4LJAA 3QJYA 1II8A 2AR7A 5GJCA 4TMKA 3QKRB 4M0LA 1X8JA 1UF9A 2GVZC 1R5OA 2QL6A 1NJFA 2CHQA 3P26A 4EUNA 2ZRBA 2IS4A 3VKWA 3T1OA 1GKIA 1LY1A 5JSZB 2CL7X 5H68A 3NEYA 2GESA 2WWWA 4IKEA 4F92B 3P1JA 4AKGA 2FFAA 4PQYA 4PO1A 3VU9B 4MGKR 1W36C 1MRSA 4TTQA 2V1UA 2RKOA 3B2EA 5FTKA 2FSFA 4YC7A 4DLSA 4AKIA 4L9WA 2PEZA 2A5DA 2CLCX 5E7JA 1ZIOA 1GVNB 2A5JA 3A4MA 1W44A 1JECA 1G3QA 3LA6A 4G0NA 3KTAA 2OCYC 3BH0A 3AGPA 3QVUA 4PC3A 4TLAA 3HP1A 2RGNC 4FD2A 4KSBA 2UZIR 1P2UA 1E2EA 4D81A 4V0KA 3U7FB 3TAHA 4ZKDA 4LPSA 3LBIA 3RAPR 1Z2CA 4WXRA 1JJ7A 221PA 2FZLA 5FUYA 2V4ZA 5CM8B 2GETA 3EA0A 2G77B 1OHHA 3EIQA 1UEIA 3TW8B 4XTRA 2WPDA 3I1FA 2VHQA 2ZVPX 2IHBA 3I8XA 4URWR 5EZ5A 5EXXA 2WJVA 2PZEA 1X1SA 4M53A 4AY2A 2C9CA 3Q9LA 1CP2A 1T3LA 4B3BA 1L4YA 2XXAA 1I4TD 4IXNA 3ZQJA 3U3KA 5DGXA 2FEMA 5B30A 2IXEA 4DJTA 1QHNA 1KSHA 4IW3B 1OB5A 2ZE5A 4PAQA 3HR8A 4OJQA 2NGRA 1W4AA 4JIMA 4CT4B 5EE9A 1KI6A 2EFDB 4JVMA 5AJXA 3RSLA 5EXTA 1NG1A 4Q02A 2GTPA 1CJMA 4HB2A 1F48A 2WZQA 3AVYA 1ZAKA 3K9GA 1BYIA 1FP6A 2WWHA 1OH6A 2N1BA 1N6NA 1U8YA 4OHVA 4OHZA 4TSFD 2ZS8A 2GXUA 2EFEB 4MYCA 1ESNA 4LJ4A 2IYZA 1WCV1 1WB9A 3B85A 3V00A 2FV8A 3OIUA 3GLFB 2CL0X 1CJTC 3KXLA 4C3ZA 2VP5A 4CF7A 1ZM7A 1G41A 4EQ6B 2C2HA 1S3SA 1ZM9A 5F9FA 1NJGA 1QHYA 4PPFA 2VHUA 4NONA 3LXXA 2C03A 2JJ2D 4Q9LA 1CLUA 1AGRA 3KKQA 4NCNA 4P4UA 2W6IA 4TLCA 2OO7A 2RGCA 4A0HA 1XMVA 3RWOA 1HE8B 4PO9A 5JWOA 4LHXA 4ON9A 4AKHA 2PLFA 3SBEA 1F2UB 4HLCA 4OQMA 3B7GA 1V5WA 3M1IA 3QKTA 3A4NA 2B92A 2V3CC 1XXHE 2GF0A 4HSEA 2H16A 3KKMA 5IHPA 1SKYE 1O3YA 2IYQA 5CLLA 3WYGA 2FGJA 4IHQA 4XSGA 5JWRA 2H57A 2G83A 3NTUA 4TYYA 2R6FA 3I4LA 2RB4A 1R0ZA 3SU8A 1QRAA 1Z07A 2ZREA 4GP7A 3VHLB 3OZXA 2WBLC 2BKEA 2J0SA 1T3HA 4M9XA 4TSFA 4EJSC 1Z22A 2CEAA 3ZZ0A 2AX4A 2WKPA 3GFTA 4A0RA 4ZI3A 3R8FA 3LO5A 1AK2A 4HAVA 1E9RA 1DAKA 2WWYA 2H92A 2JJ8A 5FI1B 1A1VA 1GITA 1OKKD 3MJRA 1SGWA 1E32A 3VR1A 1SVSA 4IRUB 5HKKD 2ORWA 4DSTA 2XZOA 2W83A 4JLKA 1Z63A 2IS1A 3MFYA 4PTLA 3IUYA 3QF7A 1CR2A 4DT1B 5CK4A 2JJ2A 1FFHA 2R65A 1J8MF 3AVTA 4B3XA 3EZ7A 3K70B 2P2LA 4QC2A 3PCRB 5DISB 2VLIA 1YRBA 4F7WA 1Y3AA 4Q4AA 4A82A 5L3QA 2IUSA 3KFXA 2DWQA 3ND8A 3SN6A 1N6IA 2FWRA 3PXGA 4EAQA 1FUKA 3LDAA 1N5LA 1E69A 2R6AA 4OI0A 1NVVQ 3RRNA 2IYSA 4P33A 1Z0KA 2OBNA 1AM4D 1SXJC 1U94A 821PA 2FNAA 5BYKA 4DSNA 2I1QA 1R0YA 4HAWA 4Q19A 1UBCA 1NG9A 1PJRA 2GZAA 2ODWA 4M8NE 1EXMA 4YLGA 3Q3JB 1EX7A 1MOZA 2DWOA 2F1RA 4JBWA 2O8FA 3K09A 2REOA 5KDOA 1HV8A 1NP6A 5JBQA 4LHYA 1T0HB 1US8A 1TUIA 3EARA 3AVUA 3DKPA 4V0OA 4NYMQ 1I2DA 3E2IA 1KO8A 4RD2A 3P4YA 4C0QC 1OKKA 3MSXA 5HKKA 3GLHA 1S4QA 4XVQA 2KB0A 1EG7A 4TQ9A 2CHGA 1E2FA 2D7CA 1CRQA 4KBFA 3B9PA 3HPRA 4M21A 4HATA 1QDEA 1E94E 2ZAOA 4X8MA 1S1MA 1G20E 4ABYA 2XB4A 4M9ZA 3PVSA 2ZYWX 1F5NA 4I1VA 1E2QA 1BO6A 2FF7A 2V6IA 3NEJA 3ZVLA 3X1WA 4C7OB 3AP3A 5EQTA 4RZ2A 1AIPA 4IOJA 1X86B 4I1SA 1KI8A 1VECA 1XPRA 1HURA 2QGZA 2YZ2A 3QSYA 3CPJB 3AV0B 2ZRLA 1V43A 1YZNA 2MMCA 2ZQ5A 4LV6A 4Q21A 4BGDA 1FNNA 3I72A 2ECKA 2C99A 1TTTA 1U8AA 2NMVA 2J5XA 1T4GA 2IYYA 3CBQA 3CB4A 5JCZA 3QVVA 3KQUA 4WVFA 4G5OA 4IFEA 4MDFA 4PAMA 2GHIA 1XB2A 4F4JA 5UKDA 1E1QD 2ASEA 2IYWA 5AJYA 1XEFA 5JRZA 2ZRDA 1D9ZA 2HV8A 2CHVA 5C4GB 4EPTA 2FH5B 2BMFA 2JLRA 3JVVA 1Z47A 2QMHA 3LW7A 4HUQB 2OCAA 2HCJB 3RLFA 3N5CA 4D4JA 3CR7A 2Z83A 4IOKA 3WNBA 1M7GA 2GEVA 1PV4A 1B0UA 2V7QA 3AF4A 1NLFA 3LNCA 5FPHA 1YR7A 2XNDA 1E2JA 1SXJE 1Z0IA 3IDQA 1F3OA 4D2IA 4A8JC 4XWOA 2ORIA 1M8PA 4R9UC 1VCMA 2J7PA 2KWIA 2BHRA 4FI3C 2WKQA 2X8AA 4KHZA 1MO3A 1E98A 1ODFA 3BB1A 3L82B 1K5GA 4LV5B 1G6OA 3KL4A 3BFXA 4ARZB 3O8CA 4BECA 2IX3A 1IN7A 3CONA 2BBWA 4Q4HB 5EP4A 3RWMB 2VP0A 3B1VA 4AD8A 1N6PA 2CLSA 3ZGXA 2ORVA 2PZFA 4NMMA 3ZVNA 4OYHA 1H65A 4LWZA 2VP6A 3K0AB 5H8WA 1QHHA 1DAGA 4RFSB 2HCBA 3IBGA 2GJSA 3BJIC 2XTMA 1G8FA 1E1QA 1Q22A 3GJ8A 3GJ6A 1I4DD 4Q9HA 4NH0A 3TH5A 3TNFA 4BLOA 1F2TA 3PENA 1KDRA 3TGPA 3ICEA 1GUAA 1W7AA 4B33A 5LB4A 1M2OB 1KO7A 4I81A 1Q12A 4KV9A 1DTSA 1XEXA 4QGHA 3WMGA 3W6OA 5E95A 5BW8A 1BYUA 1COWD 3L8YA 3C41J 4MUAA 1X6VA 2G0TA 5G41A 5BN3A 2ZSFA 3KJIA 3F8TA 5BN5A 2AFHE 5BN4A 2ZSBA 4JVNA 3VHXA 2BOVA 4JZKA 3T1QA 3FYHA 4E07A 3WRYC 3THXA 1X8LA 3EW9A 2JIZD 1D9XA 1W5TA 1GRNA 4IDQA 4MYTA 1Q1ZA 1U98A 4D6PA 1VCOA 3C4JA 2ANBA 4TWZA 1Q1EA 1QG2A 3VR3A 3GLGB 3KQHA 1DAFA 4AIIA 1NI3A 4NHOA 4O2RA 4AC9A 4Q03A 3GD7A 1IXSB 3Q7PA 2YOFA 4W7SA 2B8TA 2VSXA 1NKTA 3K9HA 3AVVA 1G3UA 4FN5A 4L15A 2VHJA 4ZPXA 3NKVA 4CEHA 4TTRA 5EZ6B 4TYQA 2WOJA 1JXMA 1CS4C 1TADA 2EWWA 3TR5A 4C0AC 1Z6GA 2N42A 1XEWY 5DHAA 4QKQA 3U7GA 2PJZA 1RJ9B 2JLSA 1KAOA 1LVGA 2EFGA 2JJ1D 3GJ5A 4R2HA 3U3JA 2ATXA 1FQJA 3K0CA 4MA4A 1G3MA 3CKLA 2HF9A 1G4UR 4Z1MD 2QTHA 4NE2A 5KSOA 1P9NA 4BASA 2JIZA 1N0VC 1R0WA 1NN0A 2F7SA 2XZPA 4HDCA 4Y0VA 1W0JD 2REBA 4POAA 3RRYA 3G82C 1P6XA 1UDWA 3LVQE 4C30A 5E3HA 4Q7JB 2Q0HA 4MRSA 2GAAA 3DL0A 3SNHA 4DIEA 1UEJA 2JASA 1E2MA 5J4HA 3FHTA 2DFKB 1XPUA 3SJZA 1DELA 4O2LA 2WJIA 4GSYA 4V03A 3FWYA 4UJ5A 1GZSA 5AJZA 3TMKA 2ZRNA 4PO8A 1DAMA 4JSTA 2XB2A 1E9DA 1DOAA 5TARA 3O8BA 4Q66C 1P75A 1YE8A 4MYHA 5GJVC 3D8BA 3GJ0A 3QKSB 3A1TA 1G291 2VSFA 3ASZA 2RGAA 4FCWA 4HZUA 1YZKA 4LJ9A 4PAOA 4UKDA 3SS8A 3TVTA 2JEOA 4TMVA 4QBIA 4LX0A 2ZVQX 8OHMA 4BFXA 3EZ2A 4HB3A 3R8CA 5CB6A 5JZVA 1T0JB 2BEKA 1N6KA 2RAPA 3AF0A 4PQFA 3ZLJA 3DZDA 4ZDJA 2FMXA 3HYTA 1M34E 2VO1A 2OT3B 3QKRA 2BC9A 4UJ3A 2F55A 4FMCB 4Z1MA 1CU1A 1SZPA 3UATA 3IHLA 4MUBA 4QJ5A 2KSQA 1LV7A 1QHXA 4KAXA 4KBGA 1P72A 1W0JA 2N46A 5EE5B 2YWEA 3DKVA 4PHGA 3T34A 3VU9A 5AJWA 3IHWA 2JCSA 4M1MA 4B43A 2AKYA 1BIFA 1WXQA 3Q5EA 5DHFA 4ZCMA 4B3CA 2AWOA 5EXPA 4URYR 1FTSA 2XOKA 3D6TB 1TQ4A 3BWDD 3TQCA 5EUQB 1BKDR 1M7BA 3I62A 2VQSA 3IEVA 1PLLA 5IDVA 5BYJA 2AK3A 4JLOA 4M1SA 1MRNA 2WWGA 4B44A 1G9XA 3QEOA 4AYWA 3CUEF 4FMDB 4G1UC 4BE7B 4CEIB 2GEDA 2VHCA 2JLWA 2NO6A 4IEIA 4GOJA 5GVSA 4NCHA 4Q1AA 2C9OA 1JI0A 4MRRA 5JS7A 2CK3D 1E2NA 1IXZA 2B7BA 2ZR0A 3C7KA 5AUPB 1NKSA 3DOFA 3RS2A 1U0HC 3R9XA 1MT0A 2RMKA 3R7WB 2J87A 2ZI9A 3VX4A 3DDCA 1U9IA 3KXIA 4U5XA 1LF5A 2ODBA 3EIHA 2RGEA 3AKEA 2J1LA 3U60B 2FZ4A 3TSOA 4E5UA 4CVNA 1PLJA 2EU8A 3KXKA 4TN1A 1E9CA 1JXOA 2R9VA 1IN4A 3BIFA 1KK3A 2A2ZA 1PUJA 1FX0B 1X3SA 6Q21A 2YHSA 2W00A 4YXWD 1U0JA 4PANA 3I5XA 5JI3E 2ZRMA 3CH4B 2JAQA 3GLIB 4JBYA 3AVWA 2C5LA 1CULC 2ZTSA 2J0QA 3GFPA 2A5FA 1FZQA 2I3BA 2PZGA 4NKRA 4Q00A 4OI4A 1TF5A 3GLFA 2R8RA 3DMDA 2XGJA 1LS1A 4V0NA 3T12A 4EQ6A 1R8SA 3SI7A 4ZDWA 3FGNA 4AK9A 3B6EA 3FFBA 3L43A 4ZO4A 1KDTA 2CNWD 4BZQA 2PCJA 2ZJYA 2IUUA 4DWJA 4Q1CA 1ZD1A 2CK3A 3H84A 4QHYA 1ZC3A 5FOSA 4NPHA 4PC2A 3TUJC 3IEUA 3L0IB 1S9HA 1U0LA 1Q44A 2NQ2C 3BRWD 3K70D 2TMKA 3GEIA 3BFVA 5LD2C 3RS3A 1F2UA 2VF8A 2XX3A 3CIOA 3FMFA 4RY2A 5CDFA 2CE2X 4W5JA 4FWTA 4AKEA 3CNLA 1GAJA 2O0KA 1ZMXA 2VA8A 2XAUA 1Z83A 1WP9A 3Q5DA 2L0XA 4LUCA 3VKGA 1XU4A 3R9IA 3GLHE 4M1WA 4A2PA 2YINC 1ESMA 1JQJC 3VAAA 4CYMA 4YXWA 4DDUA 4US0R 2WOOA 3K1JA 3CF6R 1KY2A 3SYNA 2DFTA 3GEEA 4TMWA 3C8UA 3HJNA 1C4OA 2EYQA 1LW7A 1OIWA 3OF5A 3X1YA 3SE0A 2K5UA 3JVUA 1KDPA 2IT1A 4X8OA 2J9RA 1CR4A 1NMZA 4OHYA 4LJ7A 1P73A 2VP9A 2H5EA 2O0JA 3I8SA 1ZUHA 5CJ2A 3KJGA 2GEUA 4MKFA 1Z6XA 4QNMA 1Z5ZA 1U2RA 3VX3A 1J8YF 4BFSA 2CNWA 4URXR 3GPLA 2WWFA 3D7MA 4GOXA 4JYCA 4QGFA 4DT1A 4PPQA 2P5SA 2I1VB 2H8KA 4CEJB 2ZJOA 2OBLA 5FUXA 2ZYTX 3ZYCA 2AWNA 2WM9B 3TAUA 3A1VA 3NVAA 2ZSEA 1W36B 2H18A 1NIJA 3KKNA 4LYHA 1PUIA 1T3SA 4YDSA 2ZRIA 4TLBA 2VBCA 2FDCA 5HCNA 4NP6A 1KY3A 3LFUA 2F43B 2QN6A 2RH5A 1N0UA 1Y63A 3GCGA 4L8GA 3F3YA 1D2NA 1XXHB 2O52A 3S1AB 1TU3A 5EE1A 1VTKA 3W6NA 4M2LA 2ZRFA 4D25A 1N6HA 1XZPA 4B2IA 1R4AA 2ZAMA 4BEBA 3K9NA 3SC3A 5KNDA 3LX8A 3WXMA 3PJRA 2CBZA 2QTVB 4M4SA 1E0SA 3VQTA 1W0KD 2W6JD 2OESA 4M9SA 1E9FA 1R8QA 3WHLA 3AEZA 3IQWA 3KZ1E 3PUXA 4QG7A 1P60A 2HDNB 4R98A 4DCTA 2OCBA 4GT1A 1HE1C 4EFMA 4Q4JB 1HT1E 4AWXA 3ZJYA 2W0MA 3EA5A 5E7IA 3C14C 2D74A 2F6RA 4ASUA 4D0LB 2P5TB 3B5JA 3FDIA 5HZHA 1NL3A 2BJWA 2WMNB 5GJBA 4DEYA 4KSCA 2IYUA 4OHWA 5BQ5A 4BPBA 1Z3IX 3C15C 4DRZA 4DZZA 1ZU4A 2WV9A 4C7OA 4IVRA 1OFIA 1R0XA 1N5KA 1DADA 3LQQA 2EVWX 2OFXA 3FPAA 3NDPA 4NYJR 1KYIA 3T5GA 2D7DA 1FL9A 5EP2A 3BERA 4G3XA 4EKDA 1H8EA 3VMFA 4LZZA 2ZUDA 4GPTA 3ZQ6A 1WBBA 5JLJA 4OQNA 3WY9A 4PHHA 1F6BA 4X8LA 2D06A 3NG1A 1GILA 2GVDC 4CW7A 3DOEA 4IEEA 1SQ5A 4KYUA 1CTQA 4A6XA 4B6FA 4Q7MB 1W0KA 4TYNA 3QPUA 2W6JA 4EPRA 5EP3A 2O8EA 3JZAA 5H1YA 1VYTA 1E2KA 4HI0E 1OFTA 1XRJA 2ZEJA 4YQFA 3UANA 3X1XA 2GBLA 2ZI4A 3NBXX 5JI2E 1CF4A 1R6BX 2X1VA 3BBPA 4HLQB 1D2MA 2DB3A 1E0JA 1P2SA 3MD0A 1VCIA 1KZ7B 1E2HA 1VHLA 3TQFA 3A37A 2DR3A 3WHKA 4UXIA 2QRZA 2ZE6A 4WOPA 4YMUA 2EFHB 1L4UA 3PIRA 1PZNA 1F60A 2C98A 2ZYUX 4RCZA 4XJXA 4C0SA 1XD2A 5KOYA 2IWRA 2GJAA 1L7VC 3RVBA 4DSOA 1VIAA 1G64A 4OBEA 2V6JA 1RZ3A 5L3RA 4DKXA 1Z6TA 4RD3A 5TB5A 1OXUA 2BJVA 1ZU5A 2ZSDA 1E2IA 3PV0A 3DEFA 3U3OA 4OL0A 3RSOA 4KXFB 2R2AA 2XSZD 4B2PA 1VMAA 3THYB 4Q4HA 3ONWA 4EJSB 2D62A 3KKPA 3WP1B 2V8OA 3KB1A 1P9RA 3X1DA 2GDJA 1GP2A 1N5JA 1UM8A 1E79D 2VSOA 1OFHA 1KNXA 2FFHA 621PA 1XFAA 2HXSA 2UVQA 4C2TA 3OIYA 2XTNA 1D8TA 3K0AA 5KNBA 2QMUA 1AKYA 1A5TA 1KK2A 1S2MA 2J46A 2IK8A 4M1YA 2D4HA 3NBYC 1A7JA 1A2BA 3TVDA 3W34A 1E3MA 2PX3A 1T8UA 3IIMA 2HT6A 1GNRA 2QAGC 4HB4A 5AR1A 4DSUA 4F91B 4LJ8A 1DEKA 5HCIA 3A1SA 1ZNYA 5L3VA 3EPJA 5FFMA 3BK7A 1IM2A 2IWHA 1NVXQ 3QENA 1KSGA 5C18A 4PSVA 4UQOA 1P5ZB 1DVRA 3BXZA 4FMBB 3O47A 121PA 5IT5A 2AXPA 4MKIA 4UNNA 1IHUA 4JBXA 3CX7A 4PX9A 5DI3A 5FPTA 1SXJB 2OLJA 1VKJA 3PEUA 3KQNA 4G5GA 5J4YA 2Q3MA 3T1VA 5FH9A 4TL6A 4A0GA 1AJEA 4LY6A 1DPFA 2XSZA 5CJPA 2HEIA 5JWHA 1AA9A 2FG5A 2Z6VA 5EUMA 3GLGA 2RGBA 1RYFA 1E79A 4DHEA 4D0GA 3BS4A 1YVDA 2FA9A 1ZJ6A 2A78A 4Q4LA 3NC0C 1IN5A 2IHYA 1RIFA 4PQRA 4K8OA 1ZIPA 2ZRJA 1OE0A 1OXVA 2ZE7A 3W5JA 1GRRA 3BB3A 3THYA 3QQ5A 5GJWC 4ZCLA 1TMKA 4TZ6A 2QSZA 1VPLA 3QEJA 1XTIA 2ZJZA 3J81k 1QHGA 3GJ4A 3QXXA 1SVOA 4JL6A 2G88A 4OHXA 4L16A 5FOXA 2NPFA 2QQ0A 3X2SA 4F93B 3CNOA 4M1TA 2GCNA 3IQXA 4TL9A 1AQYA 5B57C 4WZAE 3ZS9A 1UADA 1YRAA 2ZI7A 1HH4A 4LBWA 4QL3A 3LRPA 4R2IA 4HLUC 1TF7A 4URVR 2MSCB 4B71A 1XD9A 2QT1A 3WYFA 4Q18A 4WA7A 1NY6A 1KNQA 4G01B 4IFBA 2PMKA 3EC1A 3NHAA 2YV5A 4V0LA 2KE5A 3MUFA 3QPWA 4N1AA 2A30A 2EYUA 4JLJA 1QBKC 1CXZA 2LWIA 1KOFA 3QUSA 1ZP6A 5J4VA 3U4QB 4BFWA 1N6LA 2B7CA 2AK2A 2QROA 3AVOA 1KIMA 1N0WA 1JPNA 2J0UA 2G0NA 4TQUS 3KQKA 1D2EA 1O87A 3PUWA 1T91A 2JATA 5D3MA 1RVDA 2PMDA 2ZRHA 3IIJA 4UNSA 1KJZA 4HUTA 3SFZA 2I4IA 4LGMA 3FKSD 4CIDA 2OEPA 1CR0A 3AVPA 5DH9A 2X19A 1E96A 1HYQA 2FSHA 2QE7D 2LKDA 2V9PA 1YZQA 1RYHA 5F3WB 4LC0A 4A2WA 2RGDA 4EPVA 2ONKA 3HWSA 5CLQA 5FR2A 4A8JB 2E87A 4P4TA 2C95A 1P2VA 5FTMA 3F5FA 4BEJA 3KFVA 1E1RD 1JR3D 4ESVA 4QHSA 3IPXA 5DYIA 4QGGA 1YR8A 3DO6A 4DDTA 2P67A 5LB2A 4IOMA 3LBNA 1DARA 1GTVA 3GLFE 521PA 3RS5A 5KSYA 4QHTA 4LBZA 2W2VA 5KNCA 4AG6A 4CGZA 2DWPA 2VH5R 5JHHB 5KSPA 4OK3A 2ZJAA 1UKVY 1E2LA 3TK1A 4EFNA 4PC1A 2RHMA 4WW0A 2P6RA 2WWIA 3Q7QA 1J90A 1XBTA 4NCJA 5FTJA 2NO7A 2NZ8A 3DMNA 4JLPA 2OUKA 3WMEA 4EDHA 1YZLA 1ZYUA 4P31A 3KUCA 3W8NA 1VG8A 1G7CA 3JZMA 4WBSA 3SZRA 3VNVA 1CR1A 3N2IA 3EPKA 3BOSA 1JALA 3RC3A 1XD8A 4CEIA 3BE4A 2WJHA 4Q9KA 4P4SB 3K53A 5CDFE 4NZYA 2JLVA 2QE7A 4LYFA 3EASA 2VP2A 4AYTA 4DC9A 2WHXA 2A9KA 4NU0A 3PEWA 4H1UA 2GXQA 1KDOA 1TL7C 1BH2A 4AYXA 2F9MA 1A82A 1KI6B 1JR3A 3VR5A 4DIDA 1MV5A 2ZRKA 5FL3A 3U7HB 5KU1A 5JHGB 1TX4B 4GZLA 2A5GA 3WRXC 1GRQA 1RRFA 1QVRA 1SULA 4BLPA 4JVSB 4FIDA 2R6DA 2P0EA 3LX5A 3UMRA 4Z51A 3DVLA 1QVAA 4DLWA 3D3QA 5SZHB 1FX0A 3RS4A 3ADCA 4QBHA 3MCAA 2QY9A 4TMZA 2BM1A 1OT3A 3UMSA 5KDLA 4OI2A 2MMGA 5JFGA 2IYLD 3RANA 1PLKA 4RZ3A 3D31A 4GNKA 1EWRA 3BH6A 1HTWA 4FINA 3EXAA 4KCGA 3ADBA 1XEWX 2FX3A 2ZETA 4TL8A 4CRWB 1VHTA 3L2OB 3N2EA 1QZXA 1N25A 4NYIR 4LDJA 2OBMA 4CZ2A 1ZM3A 5C2JB 2D2EA 4B75A 2KBFA 4JKIA 2IYXA 3AQ4A 2HXYA 4LJYA 5C1BA 1QF9A 1XMSA 2H1LA 1RW4A 2FPLA 2WJGA 2AD1A 1YHNA 3CW2A 4C0BA 2P6UA 1EFUA 1NF3A 1W36D 4JLAA 1ZC4A 1YU9A 5TVKA 4B48A 2GJ9A 2QM7A 4BLTA 2QP4A 3N70A 1IQPA 4GI7A 1DG1G 4KVGA 1XWIA 3B13B 3O8RA 3THWB 1W49A 1OJLA 4Q01A 3UMFA 3FHCB 4F4CA 1NNEA 3MWYW 1Z8FA 5EP1A 2NO9A 1Z2AA 2ZRGA 2O5VA 5KYKA 5ELXA 4JLDA 4LSGA 3BH7A 3CNNA 5G3YA 1EFTA 1FP7A 5SZJA 2OXCA 3MRSA 3U44B 2REXB 4XSHA 4DCVA 4C2UA 5B58C 1COWA 1GG2A 1PVOA 1S8FA 2BMJA 2Z4RA 3FMOB 2FSGA 4TLEA 4II7A 5CIQA 3TUIC 1XMJA 3T35A 2GKSA 4OKSA 1GNPA 2ZU6A 4Q1BA 3WBJA 5B2ZA 4R7ZA 4D4LA 3Q8XB 3B82A 2PJRA 2ZPTX 4BZXA 3QG5A 3T06B 1OW3B 2QP3A 1GNQA 1ZCAA 2ZR7A 2CCGA 3ZVMA 3BD9A 3HR7A 4P32A 2WIAA 3BB4A 3WBKA 2YNMA 3QXHA 1P62B 5G3ZA 5JMTA 1YZUA 4X8HA 4CEJA 1HUQA 4FCVA 2QT0A 4YMWA 3OFND 4IOLA 2JLZA 3FTQA 2G1JA 1VYUA 2NPIA 2WVJA 2FU5C 1IJEA 2HT1A 1FMJA 4U7DA 3LD9A 3V4RA 2O8FB 1NBMD 1KJWA 2F43A 4U02A 4P3YA 5FR1A 2Q9CA 1US8B 1Z0FA 1VCNA 3PITA 2BCGY 3S1AA 2G6BA 5DN6D 3V9PA 3NH6A 3QKUA 3GMTA 3QOFA 4B34A 1DE0A 2NTYC 2GZHA 3GLHB 1T5LA 1E2PA 2QPOA 4B73A 3EX7C 2AN9A 1S3GA 3AUYA 4M22A 5DNYB 1QHSA 3HDTA 2JJ1A 1SVIA 4D80A 5KO2A 4GMDA 2QG6A 1TPZA 1L8QA 1TF2A 3ICQB 1KZGB 1DO0A 1OPXA 1WQ1R 5JSZA 1ZINA 2ZXUA 1XX6A 1WDTA 1G7RA 1WRBA 2Q9BA 4RD1A 2WTUA 4JYBA 4Q4JA 1KO5A 4URUR 2GNOA 2BKUA 3AP1A 5CITA 4L9SA 1TU4A 4PFSA 5KSZA 1XCGB 5EJEA 3OEHD 3U5ZB 3TLXA 2OE2A 1GL9B 3QXJA 2ZUCA 3A1WA 1VDZA 3EC2A 1OV4A 3K09C 3KDSE 3SDZA 1LB1B 3K0FB 5AUNB 5FPKA 2ZS9A 3MLEA 3A4LA 4NL4H 2ZI3A 2FFQA 1S96A 2VPPA 2OV2A 1S9DA 5L3SB 1T9HA 2CJWB 2BVNA 2VYFA 5F2EA 4HAXA 2ZRCA 4J0QA 3A58B 1ZVQA 1NLZA 4RD4A 1RE0A 5HR5A 2GXSA 4D4KA 2RCNA 1TAGA 2WICA 4MRVA 4TTPA 1KSFX 4XVUA 2IYTA 3H4MA 4FXPA 4RVCA 2GK7A 3R20A 4NBSA 2BV3A 4RCYA 2QBYB 421PA 2QI9C 1VG9B 4MGZR 1RRPA 2XJ4A 4WZBE 1VG1A 4F4IA 1G8GA 4V0MA 4DLVA 2GRJA 2IL1A 4DXAA 3FE2A 5CIWA 4DEXA 1XTRA 2VRWA 2WSMA 3RDPA 4KITB 1XTSA 3U6BA 3OIWA 1OH8A 1NIPA 1CIPA 1LFDB 2NO1A 1SVKA 2NO0A 2G9NA 3LV8A 3I61A 3OEHA 5LD2B 3GLGE 3TW4A 3QI2A 2O8DB 2F1IA 5HE9A 1GSIA 3CZQA 3P20A 3PEYA 3IILA 1X8KA 1NLYA 2PL3A 4IJMA 3CRRA 4HAUA 4WIAA 2Z5FA 3B1YA 2V54A 4KFUA 2Q3HA 1HEIA 1JQLB 1OYYA 1W4CA 4NYIQ 2O0HA 1G16A 1M6NA 5HPYB 5DYGA 4Y0AA 1SXJD 1AQUA 4JSYA 3SJAA 4DLTA 2OLKA 3IIKA 3E70C 4ZKEA 721PA 1GL6A 4EJSA 2XNSA 4I1UA 1XZQA 1ELOA 1QHIA 5IK2D 3ZD6A 3TSWA 2C96A 4PPGA 4HDQB 4HYYA 3UIEA 5DSZA 3K9LA 1U99A 2IXFA 4KFSA 3T61A 1OH7A 1DAEA 2C78A 2BBOA 1WA5A 3RC8A 3DZ8A 2ATVA 3U61B 3UPUA 1AGPA 5FOVA 5F9HA 5EXSA 1TQ2A 1IXRC 1X1RA 2JDID 4LYJA 1KO4A 4NTZA 4WXPA 3FB4A 1W5SA 5HE8A 1W46A 2C77A 3KUDA 2R62A 3AB3A 4IXMA 1R2QA 3LVRE 2W58A 2OSBA 3ZD7A 2Z4SA 1C9KA 5C46F 1FOEB 5FPYA 5JJKA 1ETUA 3ASYA 3U7EB 4UNQA 1G5TA 4HZIA 3UK6A 3LWNA 2OFWA 1YR6A 2QORA 5K8LA 4I4LA 2F3RA 3QBTA 4AG5A 3NH9A 2VF7A 3W6PA 3WNDA 1UBFA 3CRVA 4OQLA 1G19A 4G5SA 1Z6AA 2PT7A 1G8PA 1KK0A 2AHOA 2SHKA 1MABB 1EFRD 4LI0A 3CRQA 4MH0R 5M04A 4KLZA 5FBWB 3U3RA 1T5IA 2WAYA 5FOWA 5IK2A 5J5CA 1DO2A 2PX0A 5DO9A 1G17A 1FUUA 1IY1A 1EWQA 1NY5A 1UKEA 3QF4B 3KX2A 5D3QA 2UZ3A 2OILA 2BCJQ 2J3EA 5FBLB 4C0JA 1MH1A 3LLUA 1G4AE 1W47A 2D3WA 4PC6A 2P65A 2JDIA 4XH9B 4ZDKA 3K0SA 1NRJB 2QMEA 4PR0A 2ZE8A 2ZJBA 4Q5IA 4QOSA 1NSFA 1OF1A 1TQ6A 2A7QA 4W5HA 5TV2A 4KU4A 2FSIA 4AURA 1SKYB 4DBLC 4DCNA 2GJ8A 5TXGA 1E9AA 4JVLA 1ZBDA 4E03A 4WZ6A 3CX6A 4FWIB 2CXXA 1OXXK 2W2TA 1P3JA 3AH8A 4JLVA 5DE3A 3LAWA 4EIWA 4IDOA 4A1FA 1ZD8A 3AVQA 3TE6A 2EFCB 4A36A 3CO5A 1IN6A 2NOAA 1BMFD 1OIXA 3L8ZA 1Q21A 4UXHA 3RABA 3HU2A 1GKUB 4ZV4A 3REFA 2CVFA 1AKEA 2ZANA 3U4QA 4QJ4A 1UDXA 1N5IA 1W1WA 2PEYA 4R71A 4NCKA 3K0CC 4OQXA 3KB2A 2YC2C 4B3GA 1Q1BA 4GP6A 2BM0A 4PXAA 1JR3E 3W5IA 1NVVR 1E2DA 2OAQ1 2IS2A 2QU8A 2O8CB 1EFCA 1SVLA 1J7KA 3RHFA 5CYOA 3SOPA 4JJZA 3I3SR 3ADDA 3Q72A 3TBKA 4UNPA 1NVWQ 3UKDA 4BFZA 2YJTD 2JLYA 2P3SA 3I32A 2CCJA 1HY3A 2JA1A 4BZPA 4C0HA 2CE7A 5GVRA 2J59A 1GOTA 5FBQB 1II0A 4A8JA 1A2KC 4E09A 3VKHA 3B60A 2WWXA 2KI5A 4NYMR 4BFYA 4UNRA 4KYIB 4XTCS 2IC5A 5JEEA 3GLIE 3T1TA 2ZYVX 3BGWA 4C0LA 2DPXA 1DAHA 1XCPA 3CX8A 2GF9A 4LBVA 1MO6A 2B21A 5KHOC 3B1ZA 1XTJA 4D0NA 3EPHA 1ZNWA 4JT4A 1EX6A 5G53C 3FMIA 1BMFA 1HA3A 4MGIR 1LTQA 2JGNA 3ND9A 2R6CA 3PR1A 4KO8A 3H2YA 1JPJA 4BFTA 2QTFA 3PUZA 1M1YE 4HUQA 1W48A 1NSTA 2BIFA 1GWNA 5BXQC 2W2XA 4LRWA 4BRWA 4MQBA 1E9EA 3MWJA 4OK5A 1OB2A 2HLDD 2WAXA 2YWGA 2IF0A 2BEJA 1L2TA 4MYUA 3O8DA 1EK0A 4RD0A 1YJ5A 2QAGB 5LPNA 1XPOA 5JJLA 2W6ID 2ZIAA 3QXCA 4RKFA 3E1SA 1AN0A 5FTNA 5A5GA 3AUXA 2Z43A 4NCIA 4P4SA 4URZR 2QMOA 3H0KA 4PPNA 5E7MA 5FTLA 3FVQA 1CJUC 2C04A 3QG1A 2VIIA 4ARZA 4DLUA 2NIPA 1KMHB 1I4LD 4PSAA 3A36A 4RJLA 4BWYA 4O25A 2V55B 2BMEA 4XWKA 1WE2A 3ETLA 2QUZA 1KI1A 3WNCA 1G7TA 3MWKA 4QGAA 4W5WA 1KGDA 1N3BA 2C9YA 3SJCA 4BLRA 4K81B 3SQWA 4QXAA 2J45A 4RFSA 4A6PA 2CDNA 4HLDA 4ESHA 4M1KA 3AVXA 1ANKA 3SJBA 1AS3A 1J99A 4CDGA 1G3RA 4N0EA 3OE7D 1S0UA 4B47A 3FOZA 2E9SA 2YVUA 5KDDA 1H8HD 3I73A 3QPVA 3W3ZB 4MGYR 4TT3D 2ANCA 5A0FA 2HLDA 3PUVA 1CKEA 1U9IC 5EE0A 1G21E 1N2CE 3G5UA 2MSDB 1II9A 1OXSC 2PLRA 5TDHA 3CF2A 2BDTA 3A1UA 1G1MA 3CR8A 4Q9IA 2IF2A 2ZI6A 1IY0A 2A5YB 2OFOA 1MR3F 4JJKA 4ZIRB 3GP8A 3SYLA 4MRNA 2FPKA 3UG6A 1SHZA 4PC7A 5CYPA 2FOLA 1OLOA 2VP4A 4AI6A 3B1XA 3B78A 4DLYA 4NDZA 2OZEA 3ZH9B 3W3AA 4IDHA 3RRZA 1JNYA 1LNZA 3MGCA 1YKSA 4A92A 2FJUA 2PH1A 4YMTA 5G40A 1GIAA 3THWA 1TEVA 2IYVA 1ZUNB 4Z54A 1TQDA 3FMPB 3TKLA 5LBIA 4KFTA 4TMTA 1OIVA 3ZDQA 3AP2A 2LCFA 3OE7A 3CM0A 3QBVA 1H8HA 4XOIA 4Z8YA 4YMSA 3HYRA 4TT3A 4ZDIA 3U44A 1RJ9A 2YOHA 1D5CA 3I5YA 1KTVA 1M74A 1VYVA 2X2FA 3M0EA 1MO4A 1G5PA 1ZW6A 3WMFA 1P4SA 2G3YA 2IW3A 2Q9AA 2XITA 2F1JA 1Z0AA 5EE3A 3VR2A 2O8BB 2D2FA 5A4JA 4US2R 1Q57A 1GKYA 5FUVA 1NBME 1CEEA 4MKGA 2HUPA 3MJHA 2NZJA 4N3NA 3K8YA 4B35A 4RD6A 4PZZA 4JLMA 3BORA 4GL2A 4A2QA 4GZMA 3RRMA 1ZD9A 4TLDA 4H9GA 4XVRA 1NMXA 2J41A 4QFMA 3NIBA 3U2QA 4KI0A 2GCOB 4OQFA 5TMPA 4Q7KA 5JECA 2ZJ5A 4JT2A 5KTYA 4GRAA 3UWKA 4LHZA 2ZITA 4NYJQ 2QRNA 3C16C 2ONJA 4V0ME 1II8B 3VR4A 5JJIA 3OHMA 4GFDA 5SZIA 1XDBA 4IVQA 1U90A 3QKSA 1P9WA 1IONA 2HF8A 2QPAA 4L5BA 5BWMA 1S1CA 2FPMA 3AF2A 1G8YA 3QNUA 4JLNA 4A9AA 2JLXA 5F98A 2OG2A 3ADKA 4L4UA 1WMSA 3TR0A 3SQXA 3K70C 1E4VA 3OEED 4LJ6A 2FE4A 2R6GA 4EPXA 2PBRA 3R9WA 1FMLA 1ZM2A 3BAFA 3RYTC 2V7QD 5FBVB 3LXRA 1GM5A 5AUOB 2XNDD 1J2JA 3TIFA 4C0KA 2IUTA 3C5HA 1XP8A 3KTAB 2NG1A 4B32A 2DFNA 4S35A 5E4FA 2PCLA 3W90A 2J7PD 2RGXA 1K5DA 3KQLA 3LLMA 4V02A 1OH5A 1CJKC 4DLRA 2QEQA 2H17A 2IYRA 1E0KA 3K0FA 3WP0A 3A8TA 3RS0A 1AZSC 1ZNXA 5FI0B 1K6MA 3EZFA 4KFRA 4MITA 4Q47A 4ITRC 2BBSA 2QENA 4KODA 2WMOB 4JL5A 5L3SA 1K8RA 3B1WA 2CJWA 4JLBA 1SVMA 1KSJA 1ZRHA 1D6JA 1RKBA 4B2LA 3PEVA 2O8EB 1R10A 2XXAB 1QG4A 3FKSA 3TRFA 1UFQA 2DYKA 2R44A 4Z8XA 1R5NA 1KMQA
chains in the Genus database with same CATH superfamily
4NFSA 3PGVA 4IPTA 4YP0A 4BBPA 1KI7A 1QWOA 3O9MA 2RH9B 2BL4A 4HDOB 1I14A 4IIGA 1JLKA 1E1YA 3T7DA 2ZS7A 5GMOA 4ZCPA 1TZ2A 4QBGB 2XRMA 1GTMA 3TCNA 4MUGA 2OHJA 1KE1A 3LP6A 2BI8A 2V6GA 2DFPA 2VLBA 3MT0A 4MIEA 4CNQA 5JS8A 2V9CA 2VL7A 5BWNA 4UUAA 3W8RA 1Q84A 1ZJYA 4TRNA 1W87A 4YT4A 4EKEA 3FSGD 4Y6QA 2EZUA 2ECPA 2WAAA 1OFUX 3QRWA 4E2FA 1T4DA 5J4KA 1O94C 1Z74A 2HYIC 1TYAE 1NMQA 5JV5A 1TO1E 5K8UA 4ZWNA 2PQ0A 3BQNB 1E18A 1JXQA 5AKJA 2X9VA 4OJYA 4PYRA 3SK0A 1QRTA 1A5ZA 5DLPA 1G2QA 2XY4A 2ZWVA 4ZI2A 3H1GA 2AZTA 3OLXA 3KZVA 3EXHA 1Y33E 2PKWA 4IVPA 4JKYA 4IJUA 4QRHA 5B3JC 5FP0A 4IJ5A 2J9ZB 4OJTA 4P2GA 1A76A 3R9KA 2W0SA 3SSAA 1GNVA 3LL7A 3KJEA 1IUPA 3QIAA 4TKZA 1WHSB 1FDOA 1JAHA 2BZ1A 4N65A 4YV7A 4ZZ1A 4DDWA 1IVSA 1BW9B 1GKKA 3TFQA 2YX1A 1SBTA 3F6RA 3G8YA 3GRVA 4MUXA 3AJRA 1TVEA 3H4IA 1TKAA 4RXMA 4ZTBA 3MTEA 3UV7A 2M6SA 1D7AA 4RE6A 1KMIY 3SR0A 1LF0A 4ZAFA 4YDHB 2G4LA 1KR5A 1AKMA 1FUEA 1T1IA 2J30A 3PNKA 4AZVA 1UODA 4OV6B 4EGAA 2V98A 1EUDB 1UC4B 3NGXA 1XTKA 1GV0A 4IZ6A 1E3QA 3E7FA 4K3VA 1LA2A 2F3TA 5FV4A 3LBAA 4PNZA 4NECA 4YI5A 3FH0A 3VYWA 1DTWA 1ZVVA 3RVLA 2PPLA 2J0VA 4D8YA 1B93A 3DUFB 4JR1A 3M6WA 3GJXC 4HDMB 1CDEA 2E55A 3H1EA 3NC1C 4M0FA 1DAIA 4FDTA 1SIWA 3ESBA 4MQ4A 4AJ4A 4CV3A 2OHXA 1BTOA 1XHLA 2IX9A 1KFCB 4IDNA 3FFXA 2UXBB 2Q3FA 2WYIA 1XALA 3D3WA 5G0SA 4IDDA 4OKIA 4QT0A 3U9TA 4DCUA 5FLEX 3FOFC 1A4RA 2ZWPA 3EAFA 4N7BA 4UHKA 2L69A 2ZU0C 3E61A 5E8RA 3UAXA 1D1PA 3ACBA 1QIDA 3N3AC 2AYXA 3H9JA 4R1OA 5FJIA 4RTSA 2Y8EA 1EVYA 1SUFA 2R5WA 3TNYA 2FUG1 2Z0MA 5JQWA 3W2TA 5C4MA 4GICA 1E0AA 4BXOB 4QQRA 2BTEA 3CQ9A 3LBHA 4D7AA 5KYWB 1N9KA 3AYZB 2ZFUA 1T2DA 4IGEA 4LG1A 2QGNA 4LV8B 4Q9DA 4IS2A 5AQEA 4K9NA 5FPPA 3LC7O 4RA6A 5ULLA 1KO1A 4Z4GA 4XPIA 5IANA 1Z6PA 2ZJ2A 1QCYA 4FD3A 2JKYA 5CVVA 3CVVA 1XJQA 5IM4A 5BW4A 1Z34A 4QSMA 5BY2A 3L4KA 1GG9A 2CUKA 3CH7A 1YS7A 2BMVA 1GL7A 2R8OA 3IBYA 5AI5A 3WDLA 3DBHB 3U6KA 2PUEA 3NOOA 2QGFA 1NN3A 2QW1A 2XRFA 3KFLA 3CV3A 3OZFA 5JBIA 3IUSA 3RBXA 1FW6A 2HAEA 5CT9A 4GGPA 4JL8A 4Q1FA 3A6PC 2IOQA 4AQ7A 3PFGA 2JZCA 4JS0A 1DS6A 1OX4A 5P21A 3RH0A 1JVNA 1UC8A 1JBKA 4F5WA 1Y89A 1IBLB 4DARA 1J9ZA 1O4WA 4YLEA 2ON6A 3MCTA 4B3TB 5SYMA 7GPBA 1QCCA 4KQCA 1RAAA 2ERXA 5CVUA 2C8VA 1JIUA 2HNAA 1YQTA 2E2WA 1U8ZA 1U6JA 3FDXA 4O0MA 4U7GA 4C7JA 5BT8A 2OC4A 3CF4A 2FE1A 4US1R 4PW0A 4Y18A 3G9UA 1W85A 4FT4A 4MDHA 5D3MB 1H0HA 1Z28A 3THOA 3I4FA 4QTUB 5JS2A 1NQXA 1RJDA 4ACAA 4DV1B 1NRWA 2OCPA 2I4LA 3OLQA 4MR9A 3HWX1 1IM5A 1FE8A 4R6XA 2QVBA 3KQTA 5G1OA 2XE6A 2Q4BA 3VBEA 1CHDA 4F3NA 1NURA 4X6LA 3H3XA 1XZEA 2BI7A 2C7BA 2FFBA 2OC9A 3KIPA 3NCTA 4C22A 1S8AA 2RAUA 1IC6A 3KT6A 4IMJB 5FAXA 1XTVA 3K0KA 3SYKA 3CWQA 4G5QA 2AH5A 1MX5A 3OFNA 2P2GA 1U2EA 1MQ8B 4B3DA 1AO0A 2P5UA 4FS8A 1BCSB 1CY1A 2ZRQA 4ZVMA 2OK8A 2CMKA 2OUIA 2JH9A 1RAEA 3T41A 4CL2A 1ADBA 1SKQA 1CERA 4AUEA 3PYMA 5TGTA 5FO0A 2MHCA 4J0GA 4CFSA 2UYHA 2YWHA 3ZHZA 2ZKLA 3OCXA 5KTSA 3GRRA 3ID6C 4JK3A 3MT8A 4EB6B 4EJ2A 2P7HA 2XZTA 1YZTA 5LUBA 4JBIA 2FEKA 4FZ5A 4G2TA 1CF2O 5H70A 4JROA 4AJIA 1Q7RA 1Z08A 4JUFA 3P27A 1W4BA 1A4XA 5A7HA 5EMJA 4EBBA 3QLVA 3KJZA 3L7DA 2HPZA 2Q50A 4EVIA 3FFAA 1YMVA 2OHVA 2OBFA 2O1WA 4M76B 4B4OA 4B3FX 2UXDB 3C97A 4BVJA 1TVKA 4CF5A 5AIBA 3U9LA 3DYIA 3AR8A 5IYZA 1QMPA 2HIHA 2M2IA 1UPCA 3PWSA 1RM5A 1YZVA 3P4XA 2C8JA 1A5SB 2JGEA 2OD7A 2GAOA 1D04A 1WCWA 3G89A 1Z7GA 4K6GA 1BEEA 1U1IA 3TXYA 1CCWA 1T9ZA 1NU8A 1H0SA 4IX1A 3VR5H 1P7CA 3RFVA 2QNBA 2WFLB 1NQVA 3X43A 4X6YA 3JD4A 3O1LA 4YMVA 4BFCA 2QDXA 5AH0A 3UA4A 2QAGA 2O50A 3DG9A 3QIVA 3LZCA 4TX1A 1N32B 3GGCA 8LDHA 3BTUA 1WX1A 2F1HA 2HPHA 1G3IA 4HF7A 5AW7A 4NULA 4DR1B 1A2QA 3QKWA 4PGGA 1JWLA 1ZD3A 4X20B 1A71A 1T8SA 1NVFA 2JIMA 3CVXA 3QM1A 3EMVA 1JKXA 4GE3A 4PSKA 1K9VF 4U6QA 1JEYA 4GOLD 1IB0A 1R0RE 1MW8X 1KMHA 3PLRA 3QELA 3M4JA 1RC0A 1PRYA 4Y2QA 4CFYA 1R5BA 2EQBA 4M8SA 4WT7A 4RSHA 5AHRA 4AZ0A 3FCXA 4H7KA 5AJTA 3LK6A 5DXJA 2WVGA 3L02A 1QIKA 3R2JA 1J33A 5DK6A 3IGFA 4TZ0A 3W5UA 1XCMA 4I1OA 2WHQA 5JFTA 5IRCD 3I58A 3UQYS 1E1KA 1MNAA 1L7MA 3UYKA 2HWXA 4P7FA 2ZUTA 2A3RA 5BNFA 1CUWA 1TDJA 2ACKA 1E3IA 3G0OA 4HNSA 5G02A 2HIGA 2QLMA 1ARZA 2XTZA 5ALYA 4F1JA 3GEBA 4Q39A 2GILA 2BP7A 5WRFA 2FWAA 4K9MA 1RLTA 4BFUA 5CB4A 5BMVF 3NW9A 4LPKA 1CETA 1Z6YA 1IWOA 3PE3A 5IDWA 1E6CA 4ZYXA 4IP0A 2XCLA 4BP3A 1QGOA 4F9FA 4Z9XA 4E22A 1S8OA 3BMOB 1Y3IA 1JKIA 3PCTA 1U1GA 4PINA 3ZXSA 3ST7A 5F35A 1TAUA 2QG9A 3P71T 1ICIA 1N6OA 2XDWA 1PJLA 1K68A 2C58A 2Z6AA 2VQ6A 4ERNA 5JRJA 4Q82A 3GUZA 5JT1A 4WI1A 4GVPA 4BPRA 1DQPA 1AS0A 3MWEA 1RPZA 5B58T 3VDQA 4CEHB 2CWDA 4TYWA 1X80B 2N0SA 4M55A 3O82A 3PUYA 5TSDA 1H3FA 3IBTA 4GPZA 1Z12A 3BF7A 1H6BA 2ZW9A 3B5IA 3UG7A 4ZJPA 3S81A 1CZNA 4P5DA 4YAIA 4GMXA 2GBFA 4JBHA 5AKKA 2X8WA 2BEWB 1OFGA 4P7BA 4QAJA 3AKCA 1WWKA 4C20A 4YY3B 2F9LA 3ZQUA 3VO8A 1WKVA 3PXAA 4Q05A 4L27A 4G56A 5DIFA 2JAWA 4PIMA 1FCJA 2NYUA 2UKDA 2O9JA 4ECAA 4N3GA 1GXSA 1Q3HA 2I33A 4HWKA 2ZR9A 4TSRA 1JR6A 5BOSA 3AUSA 5JAMA 4A0FA 3T3MB 1ORRA 3HHEA 3KQQA 3SHQA 3WGIA 1E9BA 1K6JA 1PSZA 1F8UA 3KOMA 3PPYA 2PXHA 3C74A 1U4NA 2QRJA 3BEDA 4LN1A 3Q85A 4QNNA 5C7OO 2Y67A 5A3SA 1CYDA 1OU0A 1DL5A 4ASUD 2W90A 1H1LB 1Q0PA 1AUXA 1TM7E 1TT5B 1Y3DE 3RYFB 3UNXA 2AFHA 4UBNA 1N33B 4TRMA 3TQSA 1GGKA 2RGGA 4V1CA 3ZD8A 2BAGA 2MSWA 2OAP1 3PNMA 5HKBA 4HAYA 1RRCA 3KAKA 3UT5A 3DDZX 2JHGA 1EGAA 1P7PA 2PT6A 1YR9A 3CWZA 1VYHA 3OPMA 4HH3C 1WSDA 4WWHA 3S2EA 5COQA 2FRDC 4BDSA 4HZUB 3IEMA 2P9FA 3FDZA 4YRGA 3LHKA 1F8YA 2ZM5A 1L5YA 1E77A 1OLXB 3S2SA 3J81A 4CKWA 3X1ZA 4M7WA 1OSNA 4JSRA 1GPMA 3BMQA 1ZJWA 2HK7A 3ORQA 5FFNA 2I8AA 2X13A 2YWRA 1OI4A 2GOYA 1LK0A 5CEEA 1HO3A 1MH9A 2FX5A 2HNKA 4MS1A 3NU1A 1UF9A 1Y5MA 3P26A 4HBZA 4NU6A 2CHQA 3X3HA 4EUNA 1CNEA 2ZRBA 3OLWA 5TE9A 3EG9A 1LY1A 1CUYA 4YRIA 3DWEX 2HPAA 2P41A 4V39A 3M3DA 5BR1A 3NIFB 1GR1A 1HG1A 1GA6A 5DSTA 1SU7A 1FUYB 1NNI1 2QWXA 3PNQA 1O1YA 3TZLA 3UJ3X 3RU7A 2JGMA 1EWKA 2VBFA 3EOZA 4L9WA 1F17A 1V2HE 4YJFB 5MGBA 3GK3A 3DOUA 4FNMA 3OQVA 3A4MA 3IP1A 1IWBB 2QF7A 5KWVA 4GOOD 3LRTA 3X1MA 3NTVA 1USUA 3RK4A 4ND4A 3NX4A 2I65A 3QVUA 4TLAA 1M5RA 3HP1A 1XNQB 1IY9A 3QI7A 1A8HA 5JARA 4X24A 4D81A 1TB4A 3HG7A 2VTBB 3CFYA 3HDHA 2I7VA 1NYTA 3RAPR 4PBSA 1JQEA 4JXJA 1JJ7A 1EE2A 221PA 3T7IA 3MBOA 4FFVA 4IRMA 3C24A 2JAUA 2X0EA 2CEKA 4C14A 2PV0A 2QLLA 2Z6UA 3TW8B 2P9ZA 4LDAA 2VAXA 4TS9A 4XTRA 5KVAA 2I4TA 2B5OA 2HA7A 2VHQA 2OR3A 2ZVPX 4URWR 2A4MA 1BX1A 3ZCUA 1BHQ1 4M53A 4BO6A 1QQ5A 1WUTA 3GMDA 3RBZA 1XRRA 4X1YA 5BO5A 4BEJA 4JWTA 4EI8A 5HTOA 4DKJA 4B3BA 1I4TD 3RIYA 4IXNA 3ZQJA 3U3KA 1NUUA 1VXOA 1YC5A 2FEMA 3IURA 3WRVA 1U28A 4HFMA 4EX7A 5B30A 2VWHA 3E4DA 2B25A 2IXEA 1RJWA 2P4HX 5JAQA 3MIIA 4IW3B 2A58A 3ETGA 1A9TA 1OVGA 5DHTA 1DC6A 3HR8A 4GPAA 4OJQA 3BFPA 4LISA 3ANXA 1W4AA 5SY9A 3IQFA 2P2SA 4RKWA 5LYJF 4CT4B 2QN7A 1KI6A 1PR3A 1Y9ZA 2E4AA 2Q8NA 3OPNA 2Y0EA 4JEMA 4JVMA 5AJXA 5JJ5A 4Y2PA 3SMQA 1A8IA 5TJ9A 2GTPA 1CJMA 4J2TA 1F48A 4D9KA 1NXPA 4I1PA 4EYGA 2Q2QA 3O8QA 3OU7A 3HJUA 2V0GA 2GK3A 2R66A 5ALNA 5BR7A 1YA8A 4JC5A 3A6EA 4IG9A 4LJ4A 4NJOA 5DEOA 4G4JA 3ZGNA 2H00A 3K8ZA 1FLAA 2FV8A 3OIUA 3EEQA 5ALQA 2CL0X 2XUOA 4NATA 5AJHA 3E6AA 4L4SA 4P7GA 2O4CA 2JHAA 1JH9A 3S1LA 3PGA1 5FBHA 4WADA 3GEDA 5JSHA 5CFMA 1Q91A 2C03A 4EG0A 2Z5LA 4MLCA 5K0EA 2MSNA 1CLUA 3T5BA 2NN3C 1RXCA 2W6IA 3UT0A 1YBMA 1RAGA 2C84A 3KETA 4ON9A 2JCXA 4C7MA 4HX2A 3QVJA 1F2UB 5K45A 1QUFA 1U5BB 3RC7A 1CUVA 3K5WA 3M1IA 1V5WA 4IR7A 4XPZA 2XBLA 2B92A 2GF0A 2N9UA 1MV8A 5KHAA 5AXCA 5IHPA 1I5OA 1NE7A 3L0CA 1SKYE 1K8YB 5LQJA 2BGUA 3UMGA 3WYGA 1G1AA 3F47A 2PWZA 4IHQA 4XSGA 1LH0A 2H57A 5E2BA 3U81A 3ILHA 1UJ4A 2ODAA 4KAJA 2R2GA 2DQYA 2RB4A 5CEJA 1R0ZA 2AN3A 1QRAA 3FB1A 4REQA 4N8EA 1SEVA 2BKEA 2C2WA 4I14A 2VDMB 2QUBA 1Q7TA 1N8SA 3MPOA 4Z7OB 4TSFA 3VPCA 1H66A 4A0RA 3SLGA 3R3ZA 1Y1RA 3URMA 3UENA 3V1TC 1AK2A 4GQBA 1E9RA 4YV1A 2FCRA 4BQFA 1CZRA 1ADJA 3SZLA 1OX5A 4EARA 2IYNA 2I6GA 2IPOA 3N2GA 4KVZA 4IRUB 1W9MA 1YONA 4DSTA 2AXEA 1RCUA 1L9XA 4RPLA 2W83A 1PP4A 1T8RA 1JKJA 2CY0A 2AN1A 3MFYA 3PFCA 2PD4A 4TKMA 5LNK6 2JJ2A 1C3OB 1I2ZA 5TMDA 4K9OA 5DMHA 4L3VA 2VQFB 2C00A 5CU7A 2YYAA 2E49A 3K70B 5D5QA 3AVTA 1CIJA 1Y6ZA 2YN0A 2FPXA 2I34A 4QC2A 5CD9A 5DISB 4B0PA 4J7AA 1M6VB 1UK8A 1Y3AA 4Q4AA 1DT5A 3EQ2A 1BVRA 1MD9A 2E89A 1YD7A 2PM8A 3TQQA 2IUSA 5AK5A 2GTHA 1E89A 2Q4TA 3MNFA 3JPYA 3PFFA 1QKIA 3PUIA 1QV7A 2WIFA 5I3ZA 4L7QA 3UHJA 4W8HA 4CDNA 2Y1GA 1V7QA 1W5EA 1O0CA 4OA5A 4E33A 1WEHA 2H9YA 2W8ZA 4B8ZA 4C3VA 1MAWA 2DJIA 2I1QA 2NSDA 5EWMB 4C2AA 4HAWA 1YOVB 2FSPA 3WGTA 1VMDA 4JAVC 3S40A 3NOXA 3E05A 3NJRA 5FUBA 3ZU4A 2I78A 2RHGB 2RJ3A 4ZT7A 2DWOA 2O8FA 3JQ9A 1TKCA 1NP6A 1EFPB 1JLLA 2GSDA 4MV5A 3DHEA 3SF0A 4XGRA 3EARA 3L5KA 2O6HA 3NS7A 4M1EA 3AVUA 4NOJA 3R7AA 4C0QC 4BVGA 1KO8A 2I03A 4LDZA 1NQWA 1PJBA 2B1GA 2O2CA 1IVYA 3IQGX 5LFAA 4RVUA 3PHIA 4YGYA 3WMWA 4F96A 1ISHA 3WOHA 2PD3A 3WISA 2RONA 4HATA 5CFZA 2EIXA 1PTJA 3WLHA 5IZ4A 3J80A 4H18A 4ABYA 1OQAA 1F5NA 2B8EA 3STWA 2F2TA 2IZ5A 2MYUA 2PKYX 3JQ8A 4BQIA 3MWDB 1E2QA 4E14A 1UFVA 2FF7A 3NEJA 3ZVLA 4EHIA 1CUHA 3D4NA 3X1WA 4C7OB 2NWQA 4YQZA 4DLLA 5CA1B 3AP3A 3HM2A 1AIPA 1KI8A 5FWDA 5TC4A 2HFJA 1HSOA 4J1TC 4ZOLA 3AW8A 5CPFA 1H6AA 2ZCUA 4FDAA 4HNAB 4PLPA 1QTQA 4LY0A 2ZRLA 4QPCA 4YI3A 1YDGA 1I94B 1YOBA 2X7XA 1F0KA 2O2DA 2DFDA 2C99A 4IX9A 1TTTA 1XROA 4CR7A 5AW9A 4G85A 4X7PA 3O31A 4ZREA 2J5XA 2MTBA 3CBQA 4S1WA 3VR5D 4ALMA 2NMVA 3D2CA 3FJ1A 1I2AA 2Q6KA 3QVVA 1XYYA 4WVFA 5JCZA 3SVZA 3BCSA 3CTPA 4IFEA 1JSLA 1Z4IA 1FFEA 4L22A 4ZARA 1KL7A 4QUBA 4R8MA 3QFSA 4PAMA 1JHYA 2GHIA 3LO8A 5UKDA 4RHEA 3VOTA 4F4JA 2UU9B 4NOKA 2CNOA 4N82A 5AJYA 3RUIA 4DJDC 5JRZA 2A0WA 1D07A 3RG2A 1DCFA 3ZJTA 3AR7A 5KWSA 2JLRA 3JVVA 3I42A 1C50A 3K6SA 3IIEA 4C6TA 4QTXA 1CV2A 3P0EA 4YJ3B 1MAAA 2P35A 4LCEA 4MK4A 5ICEA 4KR0A 5DYTA 4WOCA 3MTBA 5L9AA 4UCQA 1MFZA 1EZ1A 1M6YA 1QYVA 1JGTA 1T35A 2B4KA 3G8DA 1YR7A 5FPHA 4BNDA 4X93A 1SXJE 2G07A 1NOKA 3IP9A 3F2IA 1Z0IA 3IUEA 4EUKA 3ES9A 3R74A 4JASB 4EF6A 1B6RA 1KBZA 4UQPA 1OBVA 1NW9B 4IIJF 2KWIA 4WBNB 2X8AA 2J3JA 1E98A 3BB1A 3L82B 4YUVA 1K5GA 4LV5B 2ISCA 3KL4A 4ARZB 1AXEA 1MVNA 1KETA 1D0IA 1IN7A 3OIDA 5IS2A 4OPMA 4I4TF 3VSCA 1AKUA 1HE5A 4KYTA 4GMGA 4AD8A 4RTKA 2CLSA 4GZ3A 4JI1B 4DQ0A 1LJ8A 3EGDA 4UFNA 1I33A 3BQMB 4D9NA 1NNLA 3V7NA 4NMMA 1OVMA 1GQRA 4U9UA 1H65A 2J09A 5D7NA 4BMXA 1DXQA 1Q83A 1O9BA 2ZXFA 1VL6A 2V7EA 3BJIC 1E1QA 1IBSA 3TGPA 3DWFA 3NHMA 4BO1A 3ICEA 1F2TA 1KDRA 2WYHA 3EGEA 3QVKA 3TNLA 3ZDBA 1A97A 1QS0B 4KQHA 4QULA 3I9V1 4TT8A 3N76A 2EDCA 1DTSA 1XEXA 2BM8A 4RPHA 3S68A 2IU6A 3H8JA 3BIJA 4CCAA 1J0XO 1YQDA 1H93A 4RIEA 3JAKB 2AR0A 1X7WA 3M33A 5BW8A 3C41J 3IVXA 3E81A 4J0JA 4N0PA 5BN3A 3Q9SA 2ZSFA 3C3BA 2ZSBA 4KO1S 1WMAA 4PLFA 4EHJA 5BN4A 4JZKA 2ABWA 3FWZA 5JALA 4R01A 3B36A 2VYND 3THXA 1UBHS 3EW9A 4JYPA 5JAPA 4BO2A 3H5AA 4R7GA 4URFA 1FS4A 3WOVA 1NDQA 1ODIA 3OWXA 2JFPA 3JWHA 3W3AH 1Q1ZA 2PH3A 4HT3B 1A8PA 1U98A 4Y30A 4EY5A 5JSUA 2EP8A 1GKLA 2YNMD 5CVJA 2M98A 1B8UA 1T2UA 4W82A 3RPEA 1O08A 1TECE 4AIIA 1NI3A 1QAQA 3HYSA 4IH1A 1I5EA 2R6R1 2COEA 4IQ4A 4O2RA 4Q03A 2GD1O 5FF9A 5IN5A 4AC9A 3GD7A 1IXSB 3Q7PA 2QVXX 3V2GA 5FA6A 3I6ZA 5KOHB 3HVIA 1G3UA 1TCAA 3K9QO 2IOYA 4L15A 1PT6A 1UOEA 4KXMA 2E4UA 1HT0A 4B9AA 4S1NA 3WLNA 5E1BA 2PGLA 2WOJA 2X2OA 3I2FA 4J4TA 4OQDA 5KJFA 1FTYA 2YRXA 1EIZA 1ZL0A 4TTIA 3MN1A 1KMNA 2FG6C 4RQTA 5FOQA 1Z6GA 3A3PA 3AOGA 3U7GA 4F6RA 3IXMA 1LZLA 3U1BA 2X6RA 4D4IA 4KXNA 2KYRA 1ZICA 3FRHA 3T9DA 2XAAA 3WLRA 2A9OA 4P53A 1YZFA 4JELA 1TFUA 1AZLA 1QZ3A 1J23A 1E3WA 1G3MA 2H31A 2HF9A 3F1LA 3IFSA 1DIAA 5CMLA 4B3MB 3A27A 1N0VC 2PANA 1CRWG 1XZJA 2ZIEA 1ZWLA 2QLNA 4UU0A 3C1UA 5KREA 3KVNA 4J03A 1FMCA 4POAA 1LLFA 4POOA 3TAXA 1I8TA 4EMBA 2FZVA 4M88A 4C30A 4Q7JB 3VU0A 4TKVB 3WQHA 5JZSA 3ITDA 3EOBI 5FQOA 1UEJA 4DIEA 4ENVA 1E2MA 1HFEL 2I7CA 2WIGA 3FHTA 1G4HA 2INGX 1Z88A 5E2AA 2QN1A 2Z2YA 1DELA 2QK4A 2ALJA 3LKBA 4Y6OA 1JG2A 3SJZA 2W2NA 2WJIA 1JP7A 4JX9A 2CBGA 4XWTA 5B3LA 3ZDAA 1UIRA 3E7WA 3HJGA 3STTA 5AJZA 3R24A 4NWIA 5EXDA 3NAGA 3ONDA 4X94A 1L6RA 4JJAA 2G4VA 1DAMA 2G08A 3BKXA 5I48A 3O8BA 5GJVC 5CVDA 4G8JA 5BQXA 3QKSB 3A1TA 2VSFA 3AUKA 4FCWA 2RGAA 4PVDA 4LJ9A 4R0VA 5LIPA 3ESYA 1JJBA 1RYZA 2Y71A 3NTQA 8OHMA 4BFXA 4JA0A 1V5EA 2YCLA 5JZVA 1T0JB 3HUUA 1I32A 2VAWA 1IUNA 3E0XA 3HUTA 5BQOA 3VUFA 3E9CA 1ONSA 5K0FA 3DDHA 3HK2A 4C05A 3AHCA 3OTIA 3RHTA 1NWCA 2VO1A 1O58A 2HFKA 2JA2A 2OT3B 2RI0A 3QKRA 2G5TA 4C43A 2BFDB 2P0AA 4FMCB 1SZPA 3IHLA 1Q1AA 4MUBA 2HMWA 1YFLA 4QJ5A 4ND1A 1P2FA 3LJKA 4B6OA 2PNFA 1H0KA 1QHXA 1VL1A 1W0JA 1IZ7A 2WFZA 2O7VA 3JVDA 2HADA 4PHGA 3VU9A 3ZNOA 3G68A 4B31A 5JQGA 2AI1A 1T3GA 2NXWA 3IHWA 7REQB 3I12A 1WXQA 5G1PA 4ZCMA 3SR3A 5EXPA 4E4RA 2GBCA 4HTAA 4RTJA 4N76A 3D6TB 3HS3A 5LMNB 4YAOA 2I7TA 3ONFA 4B8YA 3OCJA 1XVUA 3I0MA 4UUPA 1GCIA 1EEHA 3AHGA 1QH1B 2VQSA 4L8FA 1Y81A 3IMGA 5IDVA 3IEVA 2RIRA 3E5RA 2ZCVA 3DXZA 4JLOA 4M1SA 4ONEA 2WWGA 2W9XA 4OQZA 4B44A 1G9XA 3BRCA 4MQLA 3WB9A 4E5SA 1H2BA 4X45A 2B69A 4FMDB 3QOYA 5F4BA 3MOGA 4DVJA 4DA4A 2GERA 3A2LA 3D1VA 5J43A 3COVA 5D1NA 1OU4A 1V47A 3I9OA 1RYBA 2PAAA 2VQ3A 4KX3A 4PM4A 5CA0A 4BE7B 3U09A 1HKUA 4W9NC 3GHYA 4UTZA 4IIBA 1F0PA 4IEIA 5GVSA 1CQJA 2B2NA 2I3GA 3TEJA 2C9OA 2B20A 2IY8A 4J0DA 4RO0A 2JIPA 4KE7A 3WLEA 2CV0A 1T1JA 4DV3B 1JI0A 2WU3A 3RSFA 1SCBA 2IHUA 1IL0A 1IN1A 1DFHA 3DOFA 3G2JA 3K1AB 1F5SA 5C8XA 4XGQA 4HH4A 3DE7X 4IY1A 3G0GA 5D6NA 1OT5A 5GONA 1Y4ZA 1HLGA 1JT9A 3FRJA 1AY0A 5K6RA 3G0CA 1U9IA 2BEVA 1CNMA 4MVJG 1HTTA 1C2YA 1L3CA 3FVWA 3H2BA 2AG0A 2RGEA 3AKEA 3U60B 2ZSKA 2FZ4A 3QX8A 5BV7A 4QUIA 2V4UA 2EU8A 4S3MA 1K3TA 1E9CA 1FFXB 2B78A 5DPMA 1KK3A 1J2RA 3U39A 3ZU5A 1DRVA 1PG2A 1X3SA 3HSSA 4AF6A 4C6RA 2A0KA 2HSDA 4IZHA 2YVKA 3ZI7A 4AIRA 3KB6A 1HOTA 2Y93A 2WTNA 1I9CA 1BGXT 3N2KB 4N3BA 4Y3UA 1ICEA 1P29A 4A03A 2PSDA 2QU7A 3IPAA 1IQ0A 1DG9A 2F17A 2ZTSA 3RLIA 3GFPA 2J0QA 5IWAB 1GPNA 3EY4A 3TD2A 2PZGA 4RX1A 3T9EA 3TRDA 3KQWA 2EOAA 3UW1A 1M67A 2BEUB 3DMDA 4FLFA 3G0BA 3GLFA 1ODCA 3LZDA 1ZOSA 4TVOA 1I6LA 4V0NA 5FI5A 1DQYA 1DBRA 3O4FA 2P3LA 5CT4A 3SI7A 3T12A 3FGNA 5F7OA 4J8PA 4UOEA 2H6EA 4H7EA 3FFBA 4WJKB 2DUMA 5TQ0B 3BA1A 1KDTA 1E2UA 2CNWD 3AHDA 4BZQA 2ZJYA 1FRQA 2IJGX 5ALMA 7MHTA 2CK3A 1HLDA 3UTCA 4IICA 3JXEA 2AE2A 3H2IA 5JH7F 4WOKA 4JEHA 1S9HA 4WCFB 1U0LA 1Q44A 3UGKA 2W2PA 3X44A 4UAJA 5CLHA 3QEKA 4C76A 3F6EX 4F6CA 3HHPA 5LD2C 3RS3A 3AZOA 4ODIA 2BGIA 5AKEA 1BHJA 4N7JA 4AZ3A 2VF8A 2WE8A 2XX3A 3N9IA 1YCGA 1GUBA 4LW8A 4OMUA 3AF5A 2CE2X 4UHHA 4W5JA 1H6CA 3WGQA 1GAJA 2VA8A 1Z83A 4E1VA 3PEFA 2L0XA 1AHIA 1JTVA 2R3SA 1D7OA 1XU4A 3L8CA 4XFDA 3RJMA 4M1WA 4BQQA 4YFYA 4CUJA 1TD1A 2OV8A 1PNVA 2PUFA 2YINC 2V0NA 1JQJC 3PFBA 3V7YA 3VAAA 2HBZA 4ARSA 3K1JA 4CU2A 1T13A 2XCQA 3CF6R 3I2YX 1SIBE 3RTEA 3AR4A 5F52A 5IXSA 3PUHA 4TMWA 3VC2A 3PJEA 3C8UA 2CV1A 4BVKA 5JANA 1LW7A 1U2PA 4UNIA 1QPGA 1VJ1A 4HDRB 3UB2A 2O2HA 1SUAA 1VPWA 2IT1A 4NJEB 4XJTA 4BTLA 4EJ6A 5FEUA 3UF0A 2OTCA 1P73A 1JE1A 3MERA 3OQHA 2O0JA 4J0CA 3IUPA 4A0SA 1PWHA 1ZSYA 5TEWA 3GCZA 2QRPA 3KV3O 3ODGA 3RTDA 1Z5ZA 4MPTA 3O2JA 1U2RA 4GYWA 3GPLA 1AZWA 1CUIA 5E1MA 2WWFA 3D7MA 4O4IB 3WTBA 4DGSA 4H7DA 4OGLA 5C0OE 4KWIA 5E38A 2OYSA 3HJBA 1Q19A 3OZVA 2OBLA 2VHYA 1X0XA 3ZYCA 1M1NA 2OMKA 5F2NA 2H0QA 4D43A 5ALGA 3AESA 5ALVA 5CFQA 1W36B 2VDRB 2H18A 3KKNA 1GR0A 3ITNA 1EFLA 4TLBA 2ZDQA 2VUTA 2D8MA 3VA7A 2NX2A 3FLMA 2A67A 3KQOA 3N0TA 2ODTX 2FSVC 5A7GA 1MOQA 2HA0A 1KXJA 5F23A 4YJ2A 3A9CA 3K3PA 3P9CA 4KQIA 3F3YA 4OP3A 3RKSA 3S1AB 5EE1A 4LY3A 4M2LA 4ZU3A 4B2IA 5BW6B 1V3UA 4FLEA 4OHBA 2ZIZA 1RWOA 1R4AA 2FWPA 2ZAMA 2JIOA 5HFJA 1U80A 1NX9A 3CE6A 4JVOA 4KRFA 1SMKA 3IAS6 3SC3A 3TRIA 1M76A 1O94D 2CNKA 3AJ8A 2G25A 4B7CA 4NZMA 2W6JD 1B16A 2RHTA 4M9SA 4CQLB 1NFQA 1WS6A 1ZEJA 1WXDA 5DBGA 4AULA 3IQWA 4C3UA 3T5MA 1I4OA 2XB6A 3DDWA 4DPLA 3DAYA 4FJ0A 4ALNA 1UXJA 2PFSA 3FW1A 4EFMA 1LI4A 2ACVA 3HMQA 4ZT5A 2YH2A 4LMRA 4DADA 3UXYA 3E7DA 5J5AA 4FX2A 1UBOS 1UMDB 4D3SA 2MJLA 1ZR4A 2P79A 3PVZA 2D3TA 2Z8XA 4XUEA 4DEYA 1DIOB 2F00A 4OHWA 4ZTUB 4BPBA 5EKXA 2X1HA 2FEXA 3KAJA 4DWWA 1TIKA 4DRZA 3T3IA 4DZZA 1ZU4A 1LDBA 4PWZA 3WS7A 1R0XA 1F1BA 1DADA 1N5KA 1YB1A 2XMGA 4RF3A 2O54A 3CSSA 2P6OA 4Z7NB 2VDOB 3NDPA 4NYJR 3JWEA 2VYVA 5THXA 3M6MD 4G3XA 2GPNA 2Q0SA 3M4NA 4LZZA 2NTVA 4GPTA 4PLCA 4AG3A 3ZQ6A 3LDUA 3JQBC 3RVOA 4AF8A 3BIWA 1O8CA 3V4LA 1FLNA 2O3TA 3DLCA 4YCAA 3E8XA 1ZSNA 1L7OA 1YTUA 1OLUA 1TOAA 3C6QA 3OTWA 3DOEA 4IEEA 2J9YB 1XL1A 3ZX4A 5HJEA 1O9HA 3LI2A 5GIPE 3VM6A 4B6FA 2W6NA 5KJCA 3QPUA 2GGSA 2FJ0A 2RH4A 1TM1E 1V3VA 4C2BA 5KNBD 1XMXA 5EP3A 2Q29A 3JZAA 1EDEA 1IU9A 1LFAA 1Y1LA 2ZR8A 3F7MA 1YDFA 3T99A 1E2KA 4B85A 5IM4F 1XRJA 2XT9A 3Q7IA 1U31A 2GUWA 2ZI4A 1K86A 3HE3A 2HIAA 4XQ0A 4UPEA 5KNLA 1A4IA 3NTOA 3QLUC 4HWTA 1ZI8A 3O83A 3ENKA 4GI1A 1VCIA 4F11A 1M33A 1GVHA 4LF9B 4UDXX 4GLFA 3TOSA 3WHKA 5JY1A 1NF9A 1GADO 1MX3A 1N8KA 1H2WA 2ATCA 3GDHA 3L0ZA 4GD3Q 1BE8A 4KSYA 4R84A 5GGXA 2JBWA 3VO9A 4YMUA 4R9VA 4DBLE 5ADHA 4C0SA 4QXOA 3H8VA 2GJAA 1MCZA 2A92A 3NCHA 4IH9A 5A5VA 1VIAA 4OBEA 4DKXA 1SC9A 1Z6TA 1VBMA 4GGOA 1E2IA 2HDWA 5C8YF 1FNSA 1TLLA 4OL0A 5C1DA 3KDPA 4Y8VA 4IS3A 3WL5A 1CW2B 3JWGA 2R8BA 5BW5A 1W93A 3WP1B 3KB1A 4FYMA 1P9RA 1NNUA 5L6MB 4ER0A 1GP2A 4YT5A 2NAPA 2FFHA 1HNXB 1MB9A 1QPBA 1U3UA 1KF0A 4Y1GA 1CT9A 1SEPA 4YAWA 4ZV9A 4RXUA 2JZNA 5BUSA 1UJ5A 1Y5RA 4I2VA 4KMOA 1YU6A 5I8PA 1U7DA 3SWWA 1KK2A 1L5SA 1LVHA 1JQDA 1SCUA 1WHSA 2KW5A 2J46A 2IK8A 4LXXA 2ZYGA 1T15A 3OWOA 5EHQA 2D4HA 3EVNA 3HXKA 1A2BA 3TVDA 1WDLA 2GD0A 4JP5A 4F2HA 1T8UA 2XUFA 3BHNA 1M2OA 3ORSA 2HT6A 2X9GA 4W1SA 3IHTA 2E4YA 3QU9A 3KZCA 3U26A 3V33A 3MMNA 3OBBA 5HCIA 3TQTA 4IYJA 3U4CA 1XRQA 3A1SA 1RM4A 2D5BA 1E4EB 4R2MA 4WLVA 1EU1A 3H3JA 2JFOA 3LT5A 3KZNA 4HKTA 1BCRA 3NHUA 4QUHA 3NWPA 1NVXQ 3E1GA 4OMFG 1KSGA 2G5CA 2XRYA 4LHEA 4UQOA 4FOTA 4GR4A 4BNWA 2AFVA 3RFCA 1M2KA 3O47A 4FMBB 3T5CA 3P2EA 121PA 2OAEA 4H7HA 2AXPA 4UNNA 5IT5A 3A10A 3QVLA 3CX7A 2CJYA 3BTVA 4PX9A 4QECA 1SXJB 4GE0A 2WNIA 4PBRA 2C83A 2FW7A 3DP7A 2EW8A 3EQZA 3NHYA 2ZAGA 3LHSA 4G5GA