2X2OA

The flavoprotein nrdi from bacillus cereus with the initially oxidized fmn cofactor in an intermediate radiation reduced state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
b'MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NRDI PROTEIN
publication title Tracking Flavin Conformations in Protein Crystal Structures with Raman Spectroscopy and Qm/Mm Calculations
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Flavoprotein
total genus 41
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x2oA00
4FGLA 2M6RA 3KAQA 4C14A 5F4BA 1OBVA 1FLAA 5JROA 1TLLA 2QX6A 4N82A 1OFVA 2OYSA 2Z9CA 3U7IA 4BMPB 2BMVA 4PU0A 3S2YA 3NHSA 4QOFA 1DXOA 1DXQA 2ZKIA 4QOHA 4ESEA 4XDHA 1H66A 1I1OA 1FUEA 1AKUA 3HLYA 1YDGA 4YQEA 5LMCA 2KLBA 2FVXA 2W5UA 2AMJA 1RCFA 4FX2A 3SVLA 2R96A 2BZSA 4LA4A 1SG0A 3NHJA 4YAOA 5LLDA 3HR4A 2Z98A 3K1YA 2KQUA 1JA0A 4BMOB 3KAPA 2MOKA 1J9EA 4D02A 4LAFA 4H2DA 1BU5A 2QR2A 4DIKA 1FLDA 3L9XA 3B6IA 3QFRA 4N9QA 1NNI1 3KEGA 2QMZA 1J8QA 3N3AC 5F51A 4ICIA 3TE7A 5EAIA 4Y9RA 1D03A 1KBOA 1QRDA 3TZBA 3K20A 1F4PA 4PTZA 3OX1A 4FGKA 3UXEA 1AKRA 4HS4A 1GG5A 2X2PA 3UXHA 1CZHA 5TGZA 1RTTA 1E5DA 3GFRA 3NHRA 3RPEA 5LBUA 5EMNA 1C7EA 1AKWA 3NHFA 1TIKA 1AZLA 2HNAA 2RG1A 3F6SA 2QWXA 2Z9BA 1SQSA 3OJXA 1XYVA 1ZX1A 1BVYF 4GR9A 2N1MA 1T5BA 2Q62A 3ESXA 3LCMA 3GFQA 3NHPA 3B6MA 2BN4A 3B6KA 2FLVA 3R6WA 3GFSA 4NULA 4H6PA 1XYYA 3NLLA 1YOBA 3NHUA 2V9CA 1YKGA 2V5UA 2X2OA 4ZVNA 4FGJA 5B3KA 4ZVKA 4U7GA 4F8YA 1B1CA 3FW1A 2XOEA 1AG9A 2V5VA 3N39C 4CF6A 2R97A 1C7FA 3O73A 1DX9A 2B3DA 2HPVA 4NLLA 1FLNA 2QX4A 5B3LA 4C0WA 1FX1A 3W77A 3F6RA 1JA1A 2QX8A 4PTYA 2GSWA 4GQIA 3W7AA 1QHEA 3ES9A 2A5LA 1FLVA 2OHIA 1OBOA 3GAMA 2QMYA 4Y7CA 2M6SA 1QR2A 5FA6A 1CZLA 4QOGA 3JSXA 2MT9A 3FX2A 4U7FA 2OHHA 1RLIA 1J9ZA 1CZOA 3F2VA 4CETA 2FZVA 1J9GA 2XODA 1V4BA 5F12A 3OWXA 1AMOA 3OJWA 3U7RA 4YAUA 4QOIA 5LJIA 3NHLA 1YCHA 1CZRA 1RLJA 2FCRA 3NHKA 5ULLA 4DILA 3FNIA 4Y9UA 3FVWA 2MWMA 4XDGA 2FDXA 3QE2A 2QX9A 4DY4A 1KBQA 1CZKA 1VMEA 1AHNA 4C0XA 3NHWA 4U7HA 2BF4A 5BUCA 2F1OA 3D7NA 3KLBA 4QOJA 6NULA 2WC1A 3FJOA 5LJLA 3W79A 3OWHA 1AKTA 1ZWKA 4QODA 5LBTA 1XT6A 4LTMA 1FVXA 2FX2A 4ZVLA 4GI5A 3ESYA 4M0CA 3G5MA 3F90A 3TEMA 4C76A 1YCGA 4LTDA 4QOEA 5LVAA 3OX2A 2Z9DA 3N3BC 1D4AA 3EYWA 5NLLA 4YAWA 1D04A 3ZHOA 5FX2A 1WSWA 2BPOA 2OHJA 3QFCA 4R81A 2MTBA 2HNBA 4ZVMA 4N65A 4OXXA 1WSBA 1YCFA 1CZUA 3NHYA 1QBGA 3B6JA 1H69A 2FZ5A 3P0RA 1AKQA 2FOXA 4J8PA 1YRHA 1CZNA 1XI2A 3NFRA 4S24A 5EA2A 1AKVA 1FTGA 3W78A 3O2NA 3EDOA 2FAXA 3OX3A 3ESZA 4LTNA 3HA2A 3L9WA 2ARKA 1X77A 4YAFA 4HEQA 4YALA 2D5IA 5NULA 3OVMA 3LT5A 1T0IA 5A4KA 1ZWLA 2Q9UA 5FUQA
chains in the Genus database with same CATH superfamily
2BKVA 3GJRA 4ENTA 4F56A 3FMVA 4I55F 4MKIA 3NCHA 1CS0B 4D9KA 5F7XA 3CU5A 4OL0A 1Z26A 5JHGB 1SUAA 5CVUA 2OK8A 4W7HA 4M7RA 1B0AA 4B4WA 1DCTA 4GRAA 4QJ4A 5C8YB 1JG1A 1S8NA 2HA4A 2EJWA 2I2AA 2Z8YM 3G5LA 3IBFA 4K1XA 1NA5A 1YQEA 1ZSYA 2FZ4A 1XF1A 3HRIA 4HN9A 1X9IA 4AY3A 4CF5A 6CHYA 5EESA 1P1RA 3G89A 1J24A 4EYKA 2QXTA 2Y1OA 5KOIA 2OTCA 2BI7A 4AF8A 3BF8A 3CUKA 5GONA 1JDSA 5JH7A 1GFIA 4NMLA 4OX9Y 1YR9A 2CMDA 1ZI9A 3K0EA 3MHPA 4TV9A 1OFTA 3WJ7A 4N82A 4LMPA 1TZKA 4EQZA 4G0ZA 2PR2A 5KBYA 4J03A 4H1HA 2BW0A 1BKSB 1JEJA 3CH5A 3DLIA 3KUUA 1XQYA 2GZ3A 1K88A 2AL7A 2CVFA 5B7GA 3C5VA 4L4SA 3VKUA 3T12A 1C30A 3HEMA 4A0RA 1C0IA 3HXPA 2PX6A 5ALXA 2E4WA 2QN2A 4F97A 5HJEA 2NTJA 3BGVA 2D5BA 2QK4A 4LV6A 4EATA 4QOHA 3TMAA 4W6ZA 4YROA 4P93A 3ORRA 3ABQB 4CIXA 1GCUA 2AKYA 4V03A 4ESEA 4BVKA 1N77A 2A9KA 3G7UA 2GK6A 1BNCA 2GR9A 1XNJA 1I1OA 4AY2A 3ZXSA 4DM7A 5F98A 5SZIA 4CQJA 1P74A 1V25A 4ASUA 2YL2A 1IAQA 1FX0B 3GVXA 1E6KA 4RYLA 3HZZA 1Z9BA 3GBSA 4H0FA 1KMQA 3M34A 1XA4A 5H16A 3WJ2A 3ZWVA 4XSHA 5I9TA 3BMXA 1PJCA 3TRHA 4MYHA 2W5UA 4GP6A 1OOEA 2NNLD 3A4VA 3ZGZA 1J2TA 1V11B 2O3RA 5DASA 1UMDA 1KAQA 2LCIA 4FX2A 4NENA 3LWBA 1ULTA 1H5QA 1R4MB 2FTKE 2W6NA 3BCHA 3K8YA 1HLPA 1MAHA 3FMOB 2Z83A 3LU1A 4OLFA 5JCOC 1VKRA 2YXEA 3D2LA 2RD2A 3OQPA 1U7DA 4BE7B 3D6NB 1EHYA 2DFNA 2QI9F 3ECCA 1UZMA 3KOZA 4HDMB 5LKRA 4ZMSA 1JPNA 3EIOA 3GLGA 2GVZC 4RK5A 3K6JA 1QYDA 3CR3C 4ZV4A 2H1HA 4I50A 2RGUA 3NTQA 2MOKA 5K20A 4JMPA 5JAPA 2XCLA 5G0WA 3HE3A 4IVNA 2PSJA 2I8LA 3L84A 3Q5EA 3L6UA 4OQYA 3T7TA 3TBFA 1XEAA 1WG8A 3NYQA 4KWTA 5E6RB 3IT1A 4Q3KA 4GOND 2ZBUA 3HYCA 2ZETA 1AMNA 4ZHQB 5GM1A 1KKLA 2X9QA 4C01A 8GPBA 4RO0A 1YJ5A 2QTGA 4LE1A 4Y8VA 3KQHA 2RHHA 2XEXA 1T9DA 1X15A 2EZ8A 2X6QA 2F17A 4WNCA 2H85A 4M37A 5AM4A 1W0JA 3JASA 4NBSA 1T0HB 2IITA 5CM9C 3UJ7A 1QZZA 3G82C 2O8VA 1HE4A 3U0VA 3W6ZA 1A82A 1TIPA 2ONKA 2VP9A 3F4LA 1THMA 4ZOCA 1FP6A 1NLUA 1YKSA 2Q3BA 2Z43A 2HRBA 3GLHE 3GMIA 4MJXA 4NBNA 5IVIA 4A2PA 4DW8A 4D99A 1AV6A 2CKDA 1T9AA 5HDQA 1IQ0A 3BMNA 3OO1A 4WDQA 1L4HA 4DR1B 4B0OA 1F4PA 2VSQA 4YJFB 3OX1A 3E05A 4LMBA 1QRRA 3RRZA 1NPTO 5J4VA 3DMPA 2H63A 4J49A 2WOJA 3IMGA 1O87A 5HF8A 4JI2B 2X2PA 4PQRA 4AJOA 1CY8A 1J99A 1P91A 3EAFA 3W7BA 2GA9A 1XCPA 1HLGA 1T4CA 2FCAA 4JCCA 4YGYA 1K4MA 1NBMD 1TYEB 4GZ6A 4QU8A 3IIEA 3KM0A 3LH5A 1Y7PA 4HNVA 4GS5A 4BX8A 1VPVA 2PWAA 3C0KA 1G8JA 4TMZA 4Q4DA 4KN5A 3EAGA 3KYBA 3UWPA 1RAGA 2V6BA 4MO2A 5EMNA 2OA0A 4PGAA 1EBFA 3RB8A 1Y98A 2OQRA 3AP3A 3U17A 2GTPA 4U5QA 2J0EA 4B4DA 5KYTA 1E5XA 4EG0A 1CUIA 3PX7A 4NQRA 3PDJA 4YMIA 2VQ3A 1JBKA 3UENA 2A9OA 4HEA6 2D1RA 5A5GA 1BE6A 2DT8A 4X1OA 4G5GA 5J63A 5AKJA 1Z6ZA 2VYND 4PHCA 1DEXA 1ZMTA 2Q2VA 2AI3A 2D54A 4FFPA 4RQTA 4EZBA 3WGIA 4OHYA 3CYFA 1IM2A 1GVNB 1P6UA 2P11A 3AK4A 3H8JA 1VLVA 2JHCA 1XYVA 2C97A 1KC3A 1YZVA 2XF2A 3QFFA 2AE1A 1RKQA 3EVFA 2DRIA 2KW5A 3VPHA 1EFPA 2IZ7A 2YJ6A 1GY8A 4CCAA 4CZ2A 1RRVA 2YY6A 4FDUA 1TTTA 1AQLA 3DMDA 1BWQA 3DTTA 4YMGA 2AN9A 4AKHA 2WPDA 2OB1A 3Q8KA 3SE7A 4BLQA 2YYYA 2ZS9A 4OXKA 4KE7A 2N1MA 1SCUB 3TIXB 4W7IA 2PK3A 1UJNA 1Z5VA 3AT1A 3BWDD 2VJPA 4UM9D 2JHFA 4H1TA 4MTLA 4FEGA 4XB1A 4ZQFA 1IN4A 1HC7A 5EWJA 1KC1A 2FWMX 4DQUA 1CB0A 1XCGB 3HN7A 5LOVB 1OXXK 3KQLA 1G66A 1F38A 1M10A 4BGDA 1RM5A 1TRHA 2ZATA 3W5AA 2C1ZA 4D9BA 1UOOA 4JX8A 3UT0A 3DFZA 4AUNA 1IN8A 2XBUA 3LDAA 4YI3A 2WWIA 1E6UA 4Q16A 2P69A 4XM0A 4HN4B 4E7PA 3ILVA 5LXTB 4NOMA 2JGFA 1WMAA 4IIJB 4YCAA 1E4EA 3OZTA 4UXHA 4X71A 3TGWA 3UTDA 4J6EA 4B6EA 2PPLA 1XNQB 3ZE6A 1OH6A 2YJGA 4OYLA 2IV2X 5LYJB 2HQSA 2X7JA 3MWEB 3P0EA 3PCTA 2YS6A 3ROTA 1LC3A 4A8JC 1O95D 1NR1A 3DW3X 3W3AA 4HNGA 4V3CA 4XPZA 4ZEWA 4QXPA 5CHYA 2XOEA 1X8KA 1MF7A 4Z1MA 3KKNA 1II8B 3LY9A 4I4CA 1A9QA 1KE1A 5DXFA 4KITB 4GWLA 1I3LA 2EG9A 1IDN1 3CW8X 3IVCA 2WUEA 3OPVA 4QTXA 2YJ4A 4RK6A 5BSUA 3TW8A 2HHCA 1Q1NA 3HVUA 3SXPA 1XRSB 2RGEA 4HGOA 2I7VA 1GDDA 1RLOA 5KVAA 5LQUA 2GCIA 1CR6A 1UBLS 2C07A 1LXCA 2CFOA 4MEBA 3UOGA 1Y3BE 1ZR2A 2DJIA 5D86A 1PFKA 2NM0A 4NPAA 1U3TA 2H9IA 2QSYA 3IJEB 3GOQA 3MG9A 2NYUA 5LA6F 4BLVA 3TRJA 5H02A 1LBIA 2ZIVB 1B8NA 3B82A 4B3SB 3I1JA 3PXXA 4Y1RA 4DJ5X 4F3RA 3C4QA 3YASA 1F14A 2IK8A 2I4NA 4I7EA 4Q6BA 2C77A 4DV7B 3ZDQA 4B7CA 2X5XA 3SLRA 4NEQA 3U7FB 2ATEA 1TT7A 1XZQA 2Q46A 2D2IA 3T4EA 5BN5A 4YRMA 3HUFA 4W63A 1R2QA 2FGJA 3KUKA 3JAMA 1RP1A 2OHHA 5HPYB 4ZZIA 1T6ZA 3G17A 4ITVA 4Q9IA 2FA9A 3BIOA 3H11B 2G0AA 2W6IA 1B26A 1KEEB 1O0SA 3PC4A 3WS7A 2OUKA 1YR2A 4BNKA 3EZ6A 1C8VB 2XODA 4O2BF 4EKGA 1OFGA 4X65B 3USCS 2CNWD 4NE2A 2BJHA 5KDDA 4FPXA 1EINA 1RI2A 2ZI3A 3QVSA 2XF8A 1QLWA 2A14A 2CF6A 3A05A 4KE8A 3UMBA 3W4KA 1KJIA 1NRIA 4LZOA 4RA9B 2LR0A 5C53B 1QH0A 1SCKA 3CZ9A 3WBJA 4MQ5A 2I2FA 2JAWA 1YFJA 4YR9A 3C6XA 3OURA 1JR4A 5I45A 4MAMA 2BE9A 2PFKA 3NX4A 4D9CA 1FDUA 1E1NA 2B2CA 3BB3A 4BFCA 1S89A 4M21A 2W2LA 3U4IA 1AKYA 1L4BA 1EGHA 4GD3Q 5A5EA 1SOWA 3DBIA 3ICEA 1JHAA 1IY8A 1J49A 3A9WA 3DEAA 3MWJA 3JVDA 1JFLA 4PE5B 5GZ1A 3KK0A 4N3CA 1CG6A 4AUEA 1YZYA 3N28A 5B57C 1FRFS 2PX0A 1D5WA 2FQYA 1XHLA 1VSBA 1W9HA 1Z0AA 2VBGA 3KKEA 5ED0A 5FFNA 5JVDA 1XLUA 4J91A 2OXTA 4L6AA 5KOJB 1GUBA 3HDTA 3IT3A 3PDWA 4WECA 2VJBA 4X1KA 1AURA 3QVJA 3R0VA 4KAAA 2NO6A 3FAKA 3LKZA 3S5JA 1MLDA 4Y9UA 2NZUG 3KL2A 2EWWA 2QUJA 3SYLA 1D2CA 4MVJA 3MPUA 4YAEA 1WXFA 3AWDA 1O03A 4WINA 2IYZA 2FDXA 2KE5A 1UJ4A 4NBKA 5I7WA 3A32A 1KI1A 2OCXA 5E0KB 1KEZA 3EARA 4IDNA 3RAEC 3I9KA 4BGIA 4BX3A 2XUHA 1TZMA 1VBKA 3EG9A 2EX4A 2YC4C 4EYEA 1E3IA 5L3QB 3FNRA 2IZ1A 1SKUA 5JMTA 4C2TA 1XKTA 4L8WB 3SVZA 1GA6A 2GEDA 2ZJ7A 4FMDB 4G65A 3NVKI 4PPGA 4G86A 4ZCTA 1I2ZA 3C14C 5AW0A 1NNLA 3TMYA 2G7ZA 1BS2A 3I5UA 4KQJA 1KYWA 2VYFA 3SC3A 5M04A 1E0JA 3FJOA 3TQIA 1Z12A 5B64A 3GG2A 4QGFA 1VRWA 2C2BA 4C78A 3FCAA 4B34A 4FUQA 2OHXA 3L5OA 4DLVA 5JAZA 2JEZA 5CA1A 4N5IX 1R50A 5IKOA 1JEOA 1YNOA 3GC6A 3QEMA 1SXHA 1U3UA 1ENPA 2CHEA 2PZKA 1GQSA 1L7DA 5C18A 3A2NA 3Q87B 2C3MA 4HWSA 4L27A 2PKQP 1WZIA 3NT2A 3CWCA 4HPXB 4UM7A 4ZT6A 3FPCA 3RSHA 1RXWA 4A3SA 5D3MB 1VGQA 4XOUA 1ZOSA 3TSZA 1YCGA 4WLOA 5C3MA 1COZA 2YHAA 2O3JA 2ZBDA 1M5UA 1VKZA 2F43B 3PGVA 3ZN2A 2NZJA 4C03A 4J0CA 1WA5A 1G19A 2CBGA 3IOCA 3VR2A 4N0DA 1E9AA 4UNNA 2EKBA 5ALNA 3JAKB 1E1CA 4B84A 4I66A 1TCUA 3ZTYA 1GVHA 3R7BA 1SVOA 3MTJA 3W2EA 1UIRA 1KNXA 4ZALA 1UMBB 3G8DA 1Z4MA 4HMQA 3OT1A 4IYJA 4JU9A 5L51A 1G9SA 4YFVA 2XB2A 1Z18A 4X6XA 1DC5A 2F1KA 4RDCA 3X1ZA 3U49A 1RHQA 2A8YA 3ACCA 5JANA 1D04A 1EGMB 2PH1A 1KO5A 3S5UA 2OZEA 3KHTA 2QRVB 3MK31 1QQ5A 4FOLA 2IIVA 1T4GA 2G09A 2PY6A 2RI6A 1J22A 2GN9A 3NBZC 3ANLA 2FJ0A 3F9RA 1BS9A 4LSGA 4MVCA 1TT5B 2QRPA 2WJYA 4Y2UA 2QPOA 2GBPA 2I0FA 3DYIA 4H3SA 2OHJA 1FBTA 2PLRA 1KEKA 2HH9A 3ZXYA 3DJFA 1X2BA 5LQAA 4B3HA 2BTOA 2HDHA 2PKYX 5KNBH 2VDJA 1JEQB 4LBWA 1IRIA 1FY2A 1VMIA 3O4RA 5DX0A 1XQWA 1PN3A 3ZWNA 3E9MA 4BLOA 4F9FA 5KNDA 1QPZA 4B74A 2XRFA 4AJ9A 1ZM3A 3GEIA 3OZWA 1YCFA 2BELA 2OCAA 3EIUA 3MJEA 1JIIA 2C4KA 3QF4B 4MICA 5D51S 1YVPA 3GLQA 5AVXA 3GLVA 2XZTA 3PTZA 3PLAE 1UBOS 1EK5A 1WM1A 3HVIA 5KU1A 1Y4AE 4CL3A 3T3NA 4JLAA 3UJ3X 3LQ4A 4IUCS 1CU1A 1DPFA 2ZBRA 3QXJA 3OPMA 4FC7A 3UJCA 1V26A 4Q0MA 4CUKA 3IAAA 2HSEA 3GR6A 2QT0A 3CF4G 2V4MA 2B4TO 1E4YA 1XTBA 3R3WA 2G3YA 1GXSA 1AKVA 2JCGA 5K0LA 3ZCUA 4EMBA 1H5NA 2ZUDA 5EIWA 3DD5A 3FYUA 5EWLA 3TL3A 1IBRA 2JLQA 4INZA 1Z13A 1IBMB 3JATA 1YHYA 2ZTVA 3C6YA 3UK7A 1OAOC 3ND9A 1H2FA 3A3OA 4BFLA 5KVSA 4M6WA 3R3HA 1RQPA 4JGIA 4YRTA 4BFVA 1K08A 5D6OA 4JJ4A 4Y9DA 1TAQA 2DWOA 1SAYA 1YQDA 1XVVA 2R6JA 2UZ4A 4CKEA 1YL5A 2ARKA 4Q15A 3Q3JB 2QXUA 2ET6A 2P1ZA 4QD3A 2HWUA 2ZRDA 2H51A 4PHHA 5E9QA 3SYRA 4DE5A 2XMBA 3ELBA 4IIEA 5FPHA 1KJWA 3FWNA 5IDYA 1YDFA 2BSAA 5FB3A 4MCJA 2V74B 1NY5A 2H1OA 4H0NA 5EVCA 3ER8A 3NORA 2ZT6A 2J09A 4YYEA 1O0CA 4GU5A 3OHPA 1IQPA 2Q9UA 3O1LA 1PKXA 1JZQA 2P8SA 3J7TA 2YVQA 1U0OC 3BQMB 4FCWA 4QUAA 5CLGA 3RSFA 4ZEMA 3O8OA 3RIXA 2IEDA 2QRGA 3SBOA 3QUBA 1B2RA 4DDTA 5A9SB 1IVSA 1B14A 1O97D 1R6XA 2JASA 3WIDA 1DKPA 1OLSA 1T2UA 1K89A 2O2DA 4MUNA 3VFDA 4BNDA 4QZVA 5ICCA 2FPPA 1T0BA 2ZUSA 3EWNA 4KDEA 3WYCA 3ZZTA 1ZC3A 1WU8A 1ODLA 4D8XA 2AYZA 5CPFA 4K9KA 2YV5A 2AMVA 4EHFA 2W93A 5BR7A 5I5EA 3EXIA 5JCXA 2WQ7A 1Z88A 4NCXA 5TRTA 4ZOEA 5HCIA 1SBHA 3K0AB 1Q84A 2D0PB 3I9V6 2FQWA 4H7EA 2YHIB 5G1NA 1J2EA 1EK0A 3KHUA 3BEDA 2YFKA 2XHZA 4DV1B 5FNVF 9ABPA 3IULA 4JYPA 4Y6OA 1PR1A 1WMBA 2C82A 2OYSA 4IOJA 3ICWA 3LC0A 3G85A 4YBRA 5K1ZA 3JARB 2J32A 2H48A 3WHIA 5EP1A 2CYBA 4L5YA 4Q1BA 1S1CA 4PU0A 3T5AA 1Z68A 3K4PA 3OZAA 3OHMA 1V1MA 5FKJA 1F5NA 4ZU6X 2BE7A 1A97A 1LQ2A 2ID8A 5EIOA 2ES4A 4Q00A 2HQRA 2JARA 4KYTA 4ZT4A 3NVAA 4JAVC 3RT9A 3AINA 2E49A 2Q8PA 1ZICA 3E4DA 4YJ3B 3D8HA 3GI1A 1W96A 4OUDA 1GYRA 1YR3A 2FOLA 2VDWA 1W88B 2O3UA 2OAQ1 4DHWA 1CEXA 4K46A 1Z83A 4LK2A 3PIDA 5AT1A 3L8FA 3OCXA 1ISGA 2R25B 3ZJ5A 4PC3A 1UPTA 3PHBE 3LGAA 3JD1A 2MU1A 5DTQA 1FUUA 2QIOA 3LBYA 5FUVA 1Y5RA 5CUQA 3O92A 4YDSA 2BGLA 4FDAA 4AD8A 4ZVRA 1EPUA 4II2A 4KR2A 1LD3A 2I99A 4R3UC 4QRIA 5EJFA 1MOSA 2ZSAA 2DT5A 3WNDA 1FB5A 4NZ9A 2Q7XA 1TZCA 2ZRNA 4BNFA 4MV0A 2IEAA 2O14A 1XRPA 4INJA 4LC1A 1DS6A 2XMGA 5CLHA 3RWBA 2AXQA 3PUZA 5I7UA 2C9BA 3CW2A 2IXGA 3GJ4A 5GZ3A 1E1YA 3DB2A 1H8HA 3QNMA 4GZMA 4GX5A 4YCNA 3AETB 1JA0A 2Q21A 2OQIA 2DBYA 1ZD1A 2O6LA 4Y30A 4RMHA 1B76A 4RF2A 5EGNA 2CGEA 3LGXA 4B3TB 2F8MA 4N48A 1JHUA 5CIWA 1P3JA 2QV7A 3M49A 5BPHA 1U8ZA 3PJDA 3ONNA 2PE5A 3SN6A 2NU7B 1DAOA 2BGNA 4NS4A 5HE8A 2ODEA 2OKGA 1K9VF 4PF1A 3VVCA 1QQAA 3R5XA 2R6GA 3EQ2A 4IWYA 4W99A 1BMDA 4FFBA 1FLDA 3K0CA 4F2DA 2O48X 3PUKA 2CVOA 3V1NA 1BN6A 1DG9A 1EZZA 1R64A 4Q24A 5D3KA 1G4HA 1NW6A 3AI7A 1GL9B 1B43A 2ILTA 2R3SA 2I6TA 3IGFA 1GTG1 2W8ZA 4BNWA 1N32B 1AU9A 1HL7A 1X1DA 2GZ2A 3GZTB 4FDTA 3EDCA 1F0KA 3QLVA 2IXBA 1ZMOA 4LVNA 4BNJA 1DRUA 1T6BY 4M36A 4YDHB 4DKXA 2BSXA 4P35A 3DKVA 2PH7A 3OUUA 5E9JA 1O08A 5IARA 1NX9A 4M46A 4WGGA 3VQTA 1EP1B 4C4YA 5EXSA 4Q3AA 4QXQA 4X6UA 5DH9A 4C4XA 1PR3A 2I7XA 2RAPA 2X8JA 3LBIA 4RDHA 1TDJA 4XX0B 5G53C 3T0IA 1AK1A 4PTZA 2VYNA 3HCCA 3CIFA 3A2MA 3L0PA 4BE4A 1ZDMA 3PGLA 1AKRA 1L5MA 1ZCZA 3FKSD 4HS4A 4HC4A 4UEKA 1LSUA 6YASA 1RJ9B 4MITA 1WCIA 5EMJA 2UZIR 1PS0A 3DPIA 1DOHA 3MTGA 1GEEA 3FOCA 5A1JA 2F3PA 2L0XA 4NFLA 1WCWA 2FJPA 4KGZA 3RV3A 4ZTBA 5K7SA 1U6JA 3N9IA 3HADA 2XNDA 4MI6A 2PUGA 3E5NA 2YZ2A 3VR4D 4BAUA 4DEVA 5BNTA 2FUG6 1KFEB 2A5GA 2RBKA 4R69A 3CVVA 2C1XA 2O0LA 3L0ZA 1DAMA 4JITA 2BKUA 3G3EA 5E3JA 5B3JA 3VH4A 4C4OA 4D4JA 4DMKA 4EBFA 4ISBA 1QH1B 3M7IA 2G0TA 4ZMRA 2DECA 1UJ6A 4JLBA 1VA5A 4UULA 3AJ9A 1PJLA 3CT6A 4NNJA 3TE6A 3MPOA 1JALA 3C39A 4U6QA 4NONA 1Q6YA 2XQJA 4XFKA 3DZKA 3JQGB 1WUHS 3PTAA 2B3TA 1GTRA 2XWBF 3DE3X 1MABB 4MKRA 3P2EA 3GZJA 3CLRD 5D1HA 3PWTA 1NRXA 3U09A 2BEWB 3AUXA 1JZSA 4UCFA 2VPWA 1DNPA 4UUBA 2J3JA 2QU8A 5AXBA 1O95A 1JEDA 3BXHA 3A2KA 3NW9A 4ZPJA 2Q4RA 1RACA 2XOKD 2X7HA 5KQMA 2DCMA 5EJ9A 3WLJA 4EUNA 2J3QA 4HWKA 3WLHA 2PKRA 2MSLA 1ZZEA 4O4JF 3FOWA 4IXMA 5EP4A 4D97A 4HNTA 1L4FA 1ADFA 3WWPA 1WZNA 4X7PA 3ZVKA 3KDSE 4D79A 3LBFA 1H4SA 3VNBA 2FLVA 3A06A 4KE6A 1K66A 3H2SA 5FOWA 3THSA 1XD9A 2XOXA 1PTJA 2HIGA 2VDVE 2QTHA 2XVZA 1AB6A 1ADBA 1XYYA 4J4HA 3BC1A 1YFZA 3HYNA 2WIAA 3O4IA 4ZARA 5DGHA 3RHFA 1JYFA 3RVNA 5KC8A 2JIQA 3WL8A 1UKVY 2JHAA 2ZROA 5DNUA 2AEFA 3DBVO 4UVDA 4B6JA 1BFDA 2AR0A 5GIOE 4MYRA 1KBZA 3SJBA 3O8DA 4QYTA 3N86A 3AF1A 1RRGA 3KJQA 3GY0A 4CMAA 4YUZA 1YB5A 2Q8QA 4K9LA 4MLDA 3Q3CA 5K0BA 3W6UA 3EN0A 1FVOA 4Y0AA 5IBRA 1K7XB 1SRQA 3FTDA 4LQCA 1MO5A 3D4LA 4KPYA 2F4NA 5A2GA 1TAUA 5BT9A 1QX3A 2HLDD 1NYLA 2IY7A 2C4WA 4ZT3A 1G8SA 4DV2B 2OLJA 2ZIZA 2ADFA 2HF2A 2AX4A 2P9FA 3A11A 3OUZA 3ZWXA 1PHRA 1Z2PX 2FVYA 4ZI7F 2ASVA 3TTVA 5IDXA 5K8VA 1M34E 2Q3JA 4RX1A 2HV9A 3F47A 4XUDA 1DC8A 3DTNA 5SY9A 3WMXA 2QVYX 4KDFA 1Q2XA 4RD4A 1K2VN 3V6MA 3G13A 3K30A 5JSZB 1GGEA 1E2GA 1TKBA 3A4MA 1XOIA 5CU7A 2FFRA 5DBHX 4UU8A 3EAQA 3AKCA 2GN4A 1N2CB 2CNWA 3LQ1A 2WV9A 1OLOA 3PRJA 2NXJA 4TWAA 1Y1KE 5KIAA 5IC5A 2OFXA 1YRQA 2XUFA 3GCDA 4Z4GA 3ID6C 2M2IA 2CVPA 4YP7A 4E70A 4EARA 2K7FA 4ZAZA 2WAXA 4TV8B 1LKZA 4JL5A 4C88A 4JGBA 4WJZA 3ZE2B 5CBKA 3LC7O 4IMJB 1JBQA 1YJBA 3DONA 4ND8A 4LNUB 2ZT8A 1CQJB 3ODGA 1GLGA 5EHGA 4G0NA 3PTLA 1CE8A 3B1FA 3TLKA 2PQ0A 3P5SA 3A1UA 1Z5ZA 5DIFA 1N2BA 4NARA 2YV3A 3NYIA 5TEWA 3P9IA 4GT1A 3LOQA 3VPDA 2I34A 1L5YA 4UPDA 1QIEA 1WF3A 2OV2A 1TYDE 3AHDA 2HM7A 4L16A 3C2QA 1RCUA 4A9AA 1QR6A 1VHLA 4QUDA 5C46F 1HBJA 3JYQA 4L0CA 4TS9A 5FI3A 2Q2OA 3KV3O 4LX8A 3U40A 4YQZA 4GWKA 5K4HA 4Q39A 4GI1A 4RD6A 5MDHA 1WVMA 1ZGHA 4IDPA 1DTWA 3O0DA 5BYBA 5AW2A 5JNVA 3HXOA 1NI3A 2HPHA 4IW3B 5FLXA 2GM5A 4EY4A 4ARCA 3ZJVA 4NG5A 1JHXA 1RXEA 3AR7A 1CJCA 4BB6A 1RAAA 1XPRA 2FU5C 5CLQA 1Z5NA 3TZEA 2NYRA 1ZY2A 2YYZA 3DVLA 5A4JA 4CKWA 4EW3A 4I14A 4F9EA 3D54D 3BWVA 3VYRB 1OT3A 3JTEA 3M0EA 4X84A 5FAXA 2ZIUB 1JEEA 1UDCA 2J31A 4YCBA 3AEKB 1BIFA 2P62A 1BXKA 2ZVJA 4OQXA 1JU4A 3CO0S 5BN4B 2EJBA 3DCNA 5EXDA 1NXQA 1UC5B 4KYVA 1F6WA 1G2OA 1IN6A 3KAJA 3WKDA 4CUZA 3FR7A 3KPUA 4A4DA 3G23A 1LLCA 4KQ9A 3EC7A 5JXJA 2O9JA 1YDMA 4DSOA 5IKXA 1PD1A 3M70A 3PR3A 4OFXA 3TRKA 1S3GA 5ITZA 5KJEA 3V4FA 3R1IA 3K9HA 3H5IA 3QIAA 3KC2A 4B81A 2GDZA 4UTPA 3KSMA 2FSUA 3BBPA 2HU8A 1JGTA 5L8VA 4DB4A 2GLTA 3OTIA 4RVCA 3L07A 1XAJA 3NHAA 2ZJ4A 2V1UA 3H1TA 2CXRA 2W58A 3MBKA 4E21A 2NVUA 4OK5A 5FORA 2PD6A 2XYRA 1Q83A 1RWQA 3UXMA 3IKTA 3SXJA 1GRVA 2HD4A 3OETA 3DMTC 2BTEA 1JFFA 2P2GA 2UXBB 3ASVA 1SVSA 1U5CA 1VBNA 2O0JA 2W9XA 2XR1A 3GFTA 1HTBA 1V6AA 4HQOA 3WX0A 3A25A 2HQ1A 4OXRA 2BF4A 5CYGA 1GARA 1WL8A 2QRLA 4BLWA 4P22A 5ETJA 4YXWD 2RI0A 1XLWA 3V4LA 2AR9A 4LZWA 5HOQA 1R0WA 4WLVA 3BE5A 4JY7A 1FTSA 1ZKMA 2JH3A 1E63A 2ZS7A 3CC8A 2XUAA 4MS3A 1KK2A 1WJGA 2GXAA 3H04A 3RUAA 5LJLA 2O05A 5KEIA 3W5BA 1RABA 2FK8A 1LK5A 1H0RA 4ZQHA 2GSDA 5JJBA 3S1AA 3HXLA 4XUEA 3ABSB 2FUCA 3PHJA 2HA2A 2NV6A 5LBTA 4BUCA 1L9XA 3EBLA 1SKYE 4F4JA 4EPTA 4YRSA 2IUEA 4UEQA 1TXGA 2W6ZA 2A9PA 5CCEA 2OV3A 4NZNA 2IUUA 2HMSA 4PEVA 1I5EA 4F1KA 3MWLA 1KARA 3ELDA 3Q8MA 2QG4A 3BXPA 3ENWA 4JOQA 1LY1A 4EYQA 4D9GA 4BTLA 2AD5A 5E7JA 4C76A 5A9RA 4J16C 5AQ1A 3AR4A 1A1VA 3BXOA 4OG2A 1KJJA 3SZMA 3T4UA 1GZ4A 3SJ7A 2FUKA 4YASA 3HBJA 2JGIA 1BHO1 4W9MC 1PI3A 2VJQA 4X63A 2JFHA 5GONF 3UJHA 1EP3B 3V6LA 3GV0A 2JFZA 2WHXA 1AXEA 4JYZA 3ZVNA 2I4OA 4CM1A 3GFOA 4FZRA 1KZ6A 4BFYA 3P9YA 4C1NA 1V9CA 3IMKA 2WI8A 1E2LA 2YOGA 2FZCA 3M2PA 3P9SA 4JLDA 4MMYB 2F8SA 1AC5A 4M1QA 5G4KB 1ODIA 4Q3EA 4Q7LA 1DIAA 3EOBI 2PZBA 2Z5GA 1UPFA 3L5KA 3ZPXA 3JALB 4CIBA 3E3AA 1OT5A 3IAS6 1GNPA 1JU9A 3FCUB 4BO9A 4MQEA 3QWFA 5AVQA 1LQTA 4BZPA 1YIDA 2BFDA 3C8UA 2XQIA 2P40A 1U6KA 5LU9A 4KJXA 4E94A 3ZC3A 1EAYA 1IIRA 1YI8A 1J39A 1NM5C 2EF1A 4FR0A 4O33A 2QD1A 3U3KA 1JZTA 4LBZA 1EVLA 1LF0A 1JNXX 5BVHA 4RY0A 2VQFB 4EG5A 1OFUX 1TI7A 2ISSD 2XKJE 4HTAA 4YUVA 4CRWB 4DMMA 2QLBA 1XDDA 3EGOA 5IDWA 1HDRA 4C4PA 1M76A 4R81A 3DAHA 3CX6A 4REQB 2JLBA 1QDUA 1W35A 3O9ZA 1DG1G 3S28A 3EIHA 3HVKA 3RRFA 4AVYA 1E9FA 3N2NA 4FE7A 2ZXUA 2YY7A 1W94A 1TVKA 2VCYA 3GP5A 3IP7A 5IDVA 3T7CA 4I5FA 4DKJA 1XZKA 3HB9A 1W9MA 3U4CA 5C3UA 4GOMD 1E9EA 2A1TR 3F97A 5EJMA 3V8PA 3ELYA 2QAGC 1WX1A 5A9TA 3F9CA 5CEJA 5KWVA 1I7DA 5JQGF 1QFSA 4LJKA 3D6AA 5KYXA 4ND4A 1E2PA 3O75A 5GAJA 1MUUA 4B44A 2BTQB 1A72A 1TC1A 1Z3IX 4HYQA 2HXYA 4NYJR 3C5CA 1C7QA 1OGJA 2PJUA 1FTGA 3U1BA 3CVWA 3ZDAA 4XX1A 1RYBA 4JQZA 4XYGA 2QMEA 4ZGWA 1GYPA 3GDOA 2H07A 2R6DA 1YL7A 3CR8A 4QJIA 4RYDA 2QW0X 4FXPA 1FU8A 1MR3F 1WUTA 4LYEA 3GW8A 4MWOA 4P3XA 4P0QB 2NP7A 1JAYA 5DEOA 4CV3A 2GPTA 4PPQA 3TYXA 4FT4A 3NYWA 3L9WA 3PFBA 4IPTA 1P1KA 5J40A 4TQ9A 4IEFB 4HDSA 4P82A 1J0DA 3B36A 2LRHA 5JO9A 1X77A 3EIQA 3P9PA 3RRXA 5IAEA 4Z4EA 2Q41A 1KTIA 4DQXA 2IIBA 3CZMA 1NJ1A 1V7PC 3HN6A 2IHTA 3KB8A 3P0FA 3MJSA 4HS9A 2NT4A 3TCXB 4OI0A 2BBWA 4Q12A 5A4KA 3R5FA 4R1QA 2J9YB 1P7YA 2AQ8A 3NTOA 4QBKA 4X92A 5FUQA 4NU8X 2P78A 1MXFA 1EFRD 4K9SA 4YRDA 1KYZA 3I2FA 2GHRA 1M2JA 3IOEA 1NAIA 5H70A 5GZ6A 4JJ7A 3UHJA 4WY2A 3ZZ0A 3I09A 1DELA 1G0NA 1PAUA 3LC1O 4LRTB 3Q9SA 4LXXA 1JSXA 5LNK1 2MINB 2QUBA 1E0SA 1XAGA 2HRZA 3FBGA 4II7A 3ABOB 4HFNA 3I04M 2KWIA 4ZHSA 5HNKA 1ZIOA 3CH6A 3TVDA 4C2AA 1V16A 2DWPA 2YINC 2YN0A 2E21A 2XE8A 3DULA 5EJ5A 1H2HA 3KT8A 3LLCA 4N5NA 1Z4IA 2BFCB 1H8EA 4DNQA 5BOVA 1E6MA 4ESHA 5DMXA 3W1EA 3U7IA 1CNFA 4HAYA 1A8SA 1C1YA 3GZNB 3GJTA 4BMPB 2PG3A 4Z54A 1ZRHA 4HLNA 1FJ2A 1E7YA 5DJ5A 3THOA 5HR5A 4GP7A 4R2HA 4EMSA 4JBWA 2NSDA 2VH5R 3QWIA 3CF2A 3NHSA 4DVJA 3FVTA 3KT6A 2FDCA 1WWKA 2VWGA 4GGMX 2VPTA 3P2MA 1ONNA 1R8SA 4LE0A 5DB4A 3WOHA 3BXFA 2NACA 2C2ZA 3HDVA 4L6IA 4DLRA 4EPXA 1S2DA 3MJTA 1PW5A 4UCWA 4B46A 4ZAFA 1DXYA 1G42A 1KNQA 1V8PA 2IOFK 3NV7A 4GNKA 4UFPA 2EX1A 2BLNA 2YQ4A 4ESVA 3S8MA 2GCNA 1KK3A 3HYTA 1TMYA 3K2IA 7ADHA 3FOEC 3H65A 2QHXA 4GVLA 2V7PA 4EVRA 3RS0A 2AH5A 2C3YA 2R6R1 3CUYA 4F3NA 2VP0A 1TW2A 2KPOA 5AKLA 4AU1A 2J3HA 3KE9A 3LK6A 4MUEA 2RGCA 3R9WA 2P5YA 1K6XA 1G2QA 1QK4A 3BBLA 1Z4NA 3VR3A 4E51A 1JWLA 1E3MA 1E3QA 1IBCA 3GAFA 1O94C 2ZVDA 3W8NA 2HYDA 3QFHA 1TQ8A 2W90A 3PR1A 4ZO7A 5EKUA 3EA0A 4NF2A 4EYGA 4BHTA 1C81A 3MC1A 4K2AA 4MW2A 1BQ3A 4WKCA 4ZREA 1M0WA 3CNNA 1BROA 1TZBA 2J8ZA 3U56A 1EM8B 4J4BA 4Y6GB 2HZ7A 2XDYA 3DXZA 2HLNA 2HYIC 4J7XA 5ALTA 3S55A 4YRGA 2NQ2C 5TDHA 2OBBA 4IDOA 3DFIA 2OYRA 3HP7A 4ZI2A 2W2TA 4MJ3A 1U65A 5I47A 2VZ0A 2QL9A 1KPHA 3GEPA 2II6A 4JIMA 2O23A 1F8FA 1RQNA 1ISPA 3I4LA 3RUPA 1IXRC 4JX9A 4K9DA 5REQB 5TV2A 2C94A 2A5FA 1JXOA 2FGKA 3E8XA 2JJ8A 1C1HA 3B12A 5L45A 3OE1A 1G18A 1QH8B 2GBLC 4KSYA 3IUQA 4WN9A 1Q2UA 3AY6A 3B6IA 3BSSA 5LP6A 4TTAA 4FS8A 2GUGA 4D0RA 4NFSA 3NBKA 3F3KA 3DPUA 3X1MA 3BRSA 3D7RA 4DUPA 4JUBA 5JU6A 3A6LA 3GEHA 5L9AA 1N1EA 2SKEA 2WM2A 5K0ZA 2CK3A 1IM5A 1MX3A 3UMFA 2IH5A 4ITRC 4MRVA 4X8LA 2DUMA 2VRBA 1VPWA 2WWHA 3O82A 3KYDB 1GL7A 2GD2A 1AQNA 3RLIA 4COOA 1TGYA 3A28A 3TEJA 3QOXA 2NX2A 3DMNA 3TSOA 1UWVA 1KJ9A 4JVMA 4WJKB 1K75A 3NAGA 4UZSA 1PEDA 3VR6D 2FW1A 2VHXA 1ZNWA 3RTDA 1SXGA 3QIVA 3L7YA 5AK0A 5FWAA 2JI9A 4G5YA 4ARBA 3L6EA 2OC4A 1O5TA 3OMLA 1L5OA 2CFCA 3WYBA 3X1XA 2P6RA 1G20E 2IHKA 2J59A 2ZJFA 3L0OA 3PQCA 4C29A 4EHHA 2WWTA 2XNHA 1LX6A 9LDTA 3AUAA 1MDFA 1MVNA 2FNAA 2PL5A 3K94A 4KVZA 1BRTA 5L7YA 2OAEA 1OI2A 1RYMA 1W4RA 4WASA 4LUCA 3T5CA 3WK9A 1NW7A 1WXXA 2HNKA 3C3BA 3E9ZA 4HQ6A 3UMRA 3PDIB 4BRSA 3G8YA 4BZWA 3AVQA 1E1RA 1RWKA 5CH3A 3WISA 2ZYIA 1NMQA 2IU0A 2GMWA 1NI5A 1PR2A 2C5BA 5JIBA 2IVZA 1X13A 3A4LA 1X3LA 5H3LA 3WXMA 3AHFA 4BIIA 4AP6A 1TCVA 3WGGA 2HADA 1JQBA 3EULA 2Y2UA 2H1CA 4ADSG 5HZKA 3GIWA 4A92A 4TLDA 4A0SA 4GDMA 4O4IB 4FB5A 1W1WA 1XCMA 2QJTA 1U0EA 2PX2A 2Z4TA 5JZOA 1H05A 5KDOA 1F8GA 3KPYA 5JS6A 1RZRD 3LTEA 4N5LA 3I8XA 1KP2A 2YHBA 1AN9A 1LCIA 5REQA 5AOAA 1PJBA 5FBKA 4I8DA 1QSGA 3D7LA 2FLKA 4B35A 2VAPA 1GN9A 2JH9A 4WUTA 2PUEA 3PE4A 4KX5A 5AVRA 2AZXA 3RR2A 4KKVA 4KO8A 2X1LA 5MN4A 4YA6A 1EWKA 5DN6D 2ZSFA 3K09A 3NHPA 2XVAA 4OSOA 1HGXA 2OO5C 5IXSA 4FC6A 4DC0A 5G4LA 4P3PA 4PS1A 2CE2X 2CLEB 2V97A 3TUIC 3LNTA 3AJDA 4MQLA 4NJEB 1IPEA 3STVA 3N2GA 3KOUA 5EYPB 3OEYA 5DZSA 3SQNA 3T6KA 1MQAA 2BOVA 2I7TA 1CT9A 1YR7A 2B4KA 1KEWA 1X8LA 1FF9A 2ROQA 2V9CA 1KIFA 3IMEA 4XQ9A 3AF2A 4YP9A 4ZCSA 3RK4A 4CCWA 3CBQA 3N2ZB 3O2JA 4HDCA 3CM0A 3VPAA 4ZICA 4JOCA 1S8OA 2YVUA 1ZEMA 4OOFA 1CXZA 3ZHZA 2LP4Y 4P80A 1R0RE 4MVJF 1WABA 3HWWA 5FULA 1P0QA 2XRMA 4V0RA 4O4LA 3E27A 4R8RA 1V0JA 1QMPA 4UCXA 4UHFA 3KLNA 2JJ2D 5C4MA 3COJA 2IZ5A 2UXCB 3ICCA 5F2EA 1WVIA 5IJWA 3V80A 4IQFA 1SG9A 3OIFA 4YJHA 1JR3E 2ORED 3O73A 4OQQA 3RVKA 3WQRA 2J5XA 3QENA 4ENQA 4JEMA 1G7CA 5ESWA 3AVOA 3F5SA 1MIOA 3BIXA 3RVRA 5A5VA 3A1NA 4UBMA 4LXTA 2HXSA 3D4BA 2QL6A 1OZGA 3NH6A 3IESA 4RC9A 5EIHA 4BB9A 2UZ0A 3BGDA 4KR9A 4OHWA 5HUQA 5ICGA 2W4MA 2CZGA 4KACA 3GJ3A 3IIKA 3WSVA 1E7RA 2IOFA 4FLFA 3ZI4A 5JBQA 2JNWA 4EI2A 4JVOA 4X91A 4OA5A 2PSDA 1GPYA 4JXKA 3WL5A 1GZ7A 4D6XA 3PPYA 3KOYA 4RPIA 4A1OA 3Q11A 1JKMA 2OEPA 4XDZA 3B9RA 3U3ZA 5AK4A 2G82A 4C6TA 1J70A 3U4DA 2GAFA 1QKKA 4XB6B 5AQEA 2CL6X 3CRNA 2PAFA 1JEYA 1ZJYA 2NGRA 3LSTA 1XSEA 3OE7D 4KVGA 5EIBC 3VHRA 1X7HA 3ZW8A 1L4MA 2C1EA 4Y1EA 1GADO 1VI6A 1RWXA 3C7AA 5KSZA 1GV1A 1QR2A 2VK8A 2Y1CA 4OQ4A 3OEWA 1OX4A 2QUHA 4DCVA 5JNUA 4QBHA 4K81B 4PGGA 3HCPA 3CHYA 4RD0A 3K4QA 4J6FA 4CKYA 2B5VA 4EG6A 1WHTA 2CL7X 3GCGA 4EGAA 1CRZA 5J47A 3HVRA 4OMFG 4NAVA 2WTMA 3PGKA 4J7UA 1IMOA 4MV8A 2CV1A 2O52A 5TIIA 3SYKA 3OQ6A 5KSYA 3D3QA 4HF7A 4F21A 1RI3A 1CY6A 2V59A 3L1UA 1K8XB 4P4NA 5JRZA 1FW8A 4BN0A 3DLAA 4G5XA 1SFRA 2LGJA 1Q0SA 4ATNA 3URMA 2I66A 4I9FA 4GAEA 3SX2A 2F4VB 4FD3A 1MX1A 1W4AA 4JQCA 1PSWA 1R4AA 2OV4A 1AMOA 1NVTA 1C9JA 4H17A 2CXHA 2VT7A 2X14A 3LQQA 4MS4B 4DBLE 3RUEA 5BWMA 3U4QB 1V9LA 3N76A 2VVTA 1W0CA 3LXMA 4FW9A 4EZEA 3FLMA 1HDIA 2GHTA 3FF4A 1XDZA 2KI5A 2XI4A 3EUWA 4JT9A 5D5QA 2DETA 2G71A 3G2NA 1NF3A 1YZKA 4R1LA 4AX8A 2RG7A 4F72A 2AIRA 2ZRKA 2HCFA 3T3EA 4BRZA 1T8WA 2WHPB 3NP7A 2XITA 2B6NA 2R47A 1JXQA 1TJ3A 1NFRA 3ACBA 4ARZB 2PTGA 3LX6A 1JPUA 1I4TD 3EXEB 3KJEA 1C5KA 4B40A 1F06A 5EKXA 4Q7EA 1UT6A 1AJEA 4FOSA 3L7AA 1C3VA 2SBTA 2X4DA 3R6GA 4BZXA 5LMNB 3QEAZ 3MJFA 1XYGA 3EUAA 3ZW9A 2N75A 1M5RA 3QE2A 4J94A 1Z5WA 3RYCB 3IE1A 2QBYA 1IG3A 1TVCA 1XQXA 4WZ6A 1NBAA 5KDLA 4FEAA 3IQFA 5BVGB 4PLZA 3RU7A 1OPXA 3BHNA 4IZHA 1MU0A 2PXXA 3N8NA 1WB4A 1OYWA 3DUWA 3Q88A 4TL7A 5KQRA 3D7NA 1NC3A 1Z6YA 1XZCA 1PS9A 2IYWA 1JHPA 2YZMA 2RFLA 4J3JA 1AQIA 3B2NA 4YIKA 2GNAA 3EFOB 1D4ZA 4KVFA 2VWPA 4CM4A 5BXYA 3GVPA 3K5PA 1ECBA 3UHOA 1Z2EA 5E8RA 3I3OA 4I9HA 3W79A 4HAOA 2EARA 1CFZA 2BEUB 4UTNA 3GNSA 4D9NA 2JAUA 3ND6A 1YU9A 4RA6A 3U62A 4CQMB 3IP8A 3H6KA 1JW9B 5BSGA 5JSUA 1HYEA 1SPXA 4H6WA 3ZGLA 1QHSA 2BHNA 3PR2B 1LDBA 1VB3A 2I87A 2QM3A 1COWA 2WW8A 2X76A 3A9UA 4OKIA 1Z2OX 2GJKA 1PDVA 1VTKA 2QLFA 3B89A 3PFKA 4EUEA 3DDSA 1YJQA 5CB4B 1FVXA 1G5HA 1E3WB 1XEFA 1QZ3A 1GQOA 1DO2A 2H5EA 1RI4A 4DIEA 3L05A 4LYDA 2XYQA 1PJSA 3H05A 4Y2YA 1X8JA 4BRUA 1YDEA 3WDKA 4ZYZA 3C3XA 5E7IA 2VPPA 2WT8A 1GNTA 1GQ2A 4LKRA 4HDRA 1DEAA 4PY2A 4CNQA 3HJFA 2B20A 2R62A 1Q0UA 4QDKA 4XJXA 1CF2O 1CUSA 2AB0A 3VHXB 1PZFA 3GCXA 1I2BA 4U2GA 4QAJA 3VO2A 3FNQA 2FOIA 4MV3A 4C5CA 5EIEA 2GYYA 5CMLA 3MEQA 2OV6A 5KTMA 1QNFA 1RZ3A 3I2GA 3OP4A 5CAEB 1KOLA 1Z73A 3EEQA 1RVV1 2GCOA 2FR8C 4EWLA 2I7DA 3OZUA 1I0LA 3WFIA 2H06A 4M1ZA 4GI7A 2JKZA 4JJGA 2E55A 2VUHB 2A9QA 2Y1DA 4KLRA 5C37A 3BQ9A 3MUOA 1HEIA 1DJNA 3GPDG 5DI3A 3FHJA 4DNFA 3KR2A 4BJHB 1ZNQO 1J1UA 3EGXA 2P2DA 3KZNA 4KQHA 2B61A 2CJWA 3NDBB 2PKQO 4YY3B 1OTYA 1D7AA 2D1QA 2ZGVA 3H86A 2WF8A 4UUPA 2CJFA 1TUIA 4MZXA 4XB2A 2XT0A 1E2MA 1VIMA 4PZLA 4D26A 4EG3A 2GZMA 2GJ4A 1WD7A 3KSUA 1XAIA 4JR2A 1PUXA 3GBVA 1PT5A 4UVGA 4GDFA 3NTLA 2XV1A 4YBZA 2MTBA 3TRDA 3LK7A 3MXTA 4C05A 3O2SB 4UNSA 4JKOA 4I99A 1LI7A 3PEEA 4N7MA 3RW9A 3GDWA 5D1NA 2XCRB 2A2ZA 3VC7A 1UADA 1V2HE 1WNTA 3CX7A 1TJ4A 2E48A 2EKLA 5BQXA 1POXA 3FRJA 2RDMA 3OAAD 3GPLA 4DQDA 4DCNA 1E5QA 2H5JA 1HORA 1W5EA 1Z0FA 2X13A 2OORA 2QPAA 4B71A 3GUCA 4QVKA 1PL7A 3BB4A 3F7NA 4KQCA 5JCZA 3WYNA 1WDTA 4DV3B 1MC1A 4MGKR 2JJYA 2VFAA 1CZNA 1K6JA 3FSJX 5SYMA 3LPDA 4LJRA 3AVVA 4RJIA 1BC5A 4RSGA 1E79A 5KNBD 1EKXA 2LW7A 3WFJA 2C2GA 5U4QA 1R8YA 3TS1A 4CM9A 4LQ4A 1QGOA 3MTQA 4BFTA 1FE8A 2XXAB 3CNQS 2VDKB 3F67A 1O6CA 1U2SA 2QQFA 1UOEA 4Q1EA 2PLAA 1D1TA 4LYGA 5C34B 4AZTA 3LECA 2M32A 4AQDA 4KXNA 3RWOA 2V55B 2LNDA 3WL7A 3LPAA 5C9ZA 1QOZA 5EE1A 5HZMA 4D8TA 1M3SA 1HLFA 3MS4A 5FJIA 1RAIA 2FQQA 3L7OA 1MW8X 4JH0A 5ARCA 5FA8A 2AMYA 3R5SA 1ODFA 1FEZA 2LUOA 2IZ6A 1VKOA 2B7LA 1FDIA 2JW5A 4DPKA 4W9RA 2GJ8A 4A36A 3R5JA 4OBWA 4MWZA 3F78A 3QX7A 4IYRA 1GNQA 1C3OB 1OLUB 1V3VA 2BFEB 1G5FA 2QLTA 3ANSA 3D5TA 4NL4H 3QJGA 3DM5A 2QSUA 2HUNA 3WIOA 3PPWA 4LWZA 4NMHA 1VBFA 2J9FA 5EXXA 3DHNA 5C1DA 4FZ3A 1JNYA 1L5ZA 1QBKC 3V32A 5FTWA 2BV3A 5HP4A 3EQ9A 2H0QA 3EEIA 3PXEA 1AN0A 2XD9A 4NK5A 1JQKA 4O8ZA 1MOZA 2I65A 3A1TA 3DE4X 1AD2A 4RVDA 1C41A 4L0DA 2NUTA 2VHEA 4QQFA 1IBLB 1SCJA 4X7MA 3DWIA 1J56A 1ODJA 1X8XA 2ZIEA 2Q4TA 4YNBA 5C5EA 4CMHA 1T24A 2Q0XA 3LBNA 1RFGE 3ZJTA 4LYFA 2XMRA 4PYNA 4NG4A 3H4MA 1ZD5A 4N7RA 5ALDA 3EPHA 1MTZA 2BMVA 1VPTA 2R7KA 3FZGA 3R9XB 1YR8A 2ZYHA 4WGFA 3ENNA 1X7WA 5DYWA 1GKYA 4ZZ3A 4GNRA 5TQ2B 2XTJA 3VO9A 5FV7A 3T7RA 5LSAA 5KNCH 2FWBA 2IYPA 4GVXA 3V00A 3UWSA 5JCJA 1JHQA 1NJ6A 2X1VA 4WZAA 3DBRA 3N2EA 4BRWA 5JWRA 2AN5A 1QO9A 3H7AA 2IYNA 3MT7A 4U0JA 1QH9A 2BJWA 3HKCA 2YVAA 5KHOC 1HOTA 1VJDA 2FWPA 4H7FA 2J0UB 4WLFA 2QORA 2RHLA 4WK6A 3TB4A 1X7YB 1ZLYA 1SUSA 4TZ0A 5K4GA 3AF6A 4Z51A 4EUSA 4F4UA 3TG8A 3GQBB 4P6VF 4NJMB 1GA4A 4E5UA 3CPJB 1AGXA 3Q6IA 3ZWDA 3TJMA 1DUSA 1N36B 1U99A 4WN3A 3TBHA 1JYSA 1QLHA 1URPA 1W581 3QW4B 1VHJA 5THQA 3U26A 1UM9B 5BQOA 3MJ4A 5EFOA 4ALNA 3TAXA 2TYSB 3L1VA 1KVRA 4UJ5A 3LA6A 5BV2P 5LLDA 2FZGA 4MRMB 4L7VA 3KHSA 1ZI8A 2P2YA 3TZ6A 1BCSA 5BSKA 3QV1A 4X97A 4XLTA 3JVVA 3K9NA 4NSNA 2JFFA 4KRYA 3OUTA 2IGTA 4OY3A 1H65A 1NRWA 2OBNA 1XMXA 4JNCA 3RJMA 2DXIA 2IH2A 2D7CA 3PQ5A 4P4TA 2I67A 1WD5A 2VN8A 3U9LA 1PT6A 1VJTA 3PCXA 4D74A 1DWUA 1WF6A 1LUAA 1U6IA 4QIHA 1Y1RA 1J25A 3TWOA 2CW5A 4Q21A 3FE2A 5DHSA 1KKMA 1KJZA 3GELA 3PK0A 1JFTA 1NMXA 3PHCA 4AW9A 2QMOA 2VNJA 3E7WA 4DAEA 1T9KA 2W4IA 4FI3C 3Q12A 4MW1A 3MB5A 3EF0A 4M89A 3WO0A 3ZWCA 5K5EA 2L69A 3LXXA 3KD3A 3ZUPA 2R7NA 5AJYA 5EL0A 3JCZA 5KYWA 4C5BA 1D1QA 3RYFA 3O4GA 4Z2AA 3EY9A 2XZOA 2SHKA 1W4CA 1Z62A 2JGDB 1M74A 3AMVA 4DMRA 1Q92A 1S0UA 1GQQA 4M1OA 2J07A 3N3AC 5DNDA 5G02A 2OOKA 3V2HA 1EJBA 2VJMA 7REQB 1VYUA 4UHHA 2E4ZA 4FFVA 5BNFA 5MGNA 1Q57A 1PFQA 1W8IA 4N6NA 2E4VA 3BIJA 1UDXA 2AWNA 1RLMA 4OMUA 4QYXA 3GJ7A 1UBSB 2Y0EA 2DFPA 1PJ2A 2EKQA 3E8SA 1IUPA 4RMJA 3UCXA 4HLCA 6ADHA 3VZDA 5BWCA 4FGKA 1CW2B 1VA4A 5L53A 3VTZA 1DOAA 1SVLA 4EFLA 3FY4A 2Z1MA 4AUKA 1FTYA 1T3LA 1VKHA 2YNMA 3TSYA 2BFFB 1UBUS 3NALA 3ZHVA 1B0PA 2X0IA 2FFHA 3E7DA 4MPDA 3DMRA 2O3TA 5H81A 4NV1A 4FYXA 3DBLB 1NYRA 3CKYA 4JQOA 1JILA 2C95A 4JCOA 3ZEIA 1SCQA 5G1OA 2AG8A 3UJNA 1BGXT 1EDBA 2G4VA 3G79A 3QU4A 1Q14A 4YJ2A 1QTQA 2VEDA 3ZYCA 3LDUA 3KXKA 1G7RA 1IBSA 1JWBB 1VCIA 4TQUS 1AZSC 1J06A 1TADA 4R1PA 5ALKA 3H9GA 3O8BA 4BTVA 2Z3VA 2RJ3A 4EL5A 2JLXA 2PIAA 4LBVA 4J0EA 4M22A 4P7FA 4A7PA 3W4IA 5JC8A 1PJTA 4TKVB 1DPGA 1MTOA 3CEAA 4NS1A 1KXJA 2CFRA 5GOTA 2WICA 3BVPA 3L18A 2SECE 2Z2JA 1VP9A 1Y4DE 1W19A 5DE3A 2O5EA 2BFMA 3WGZA 1M6NA 2HN9A 3AY3A 3IVAA 2AUMA 2RI1A 4MJ7A 3DGEC 1GRCA 4XUCA 4XZ3A 1DQNA 4IZIA 4Q9HA 3HEAA 2UVPA 1KQ3A 4J0JA 3OY7A 4IP0A 4R2WA 4PX2A 1SHZA 3FTNA 5AKGA 4G5HA 1FP4B 2QVZX 5AD1A 3OQOA 3WKBA 3AJAA 4GXNA 5F33A 1P8JA 1ZRSA 2H4WA 2ILVA 2YMLA 2ZPAA 3UPDA 2IHUA 4G36A 4JQSA 3UIEA 2XA2A 4Q3NA 4BV9A 3DFKA 1OJLA 3O8NA 3U37A 4BJ1A 4K9OA 3ZD9A 3THRA 1YB4A 2C9MA 3HU1A 5FBQB 1IY2A 3VPFA 2X5NA 3JXEA 1UUFA 1V2GA 2DPXA 1X19A 3TNJA 2PCJA 2APJA 4YEDA 4BWGA 1R7RA 2GAOA 1PWXA 4Q3OA 3WA6A 4L8FA 3CB4A 3PNOA 4GPD1 1DAGA 1YXMA 3KSBC 1FNBA 3ANXA 1E2JA 3EZ7A 3ANTA 3AY7A 1PGPA 2YJ3A 1UT5A 4P3KA 5L95A 3GFVA 2XSZA 2WYOA 4JK3A 4AN1A 3H4VA 4D3FA 5IJ9A 4QLBA 3P2IA 2HK7A 2WOOA 5EE5B 1DARA 4YP0A 4DLUA 1VYVA 3GD7A 3VDQA 1OREA 2YKGA 1IZ7A 4X95A 1Z39A 3S6JA 2C4NA 1YH3A 4FSXA 3NEYA 3NRCA 4J1NA 1PGQA 5GMOA 2R8ZA 3GLGE 3OE7A 4H3HB 1PD0A 1W30A 1MNQA 2N0SA 2FPGA 2X5JO 3B7GA 4Q7KA 2GT1A 4ZOLA 1NZDA 4CIYA 3TW0A 1G4AE 3G2OA 1P6XA 3M4JA 1GPKA 3QQ5A 4B6PA 1NQ5A 4P4LA 2YWGA 3NV9A 2OK7A 4OJNA 2PUVA 3FPJA 3W2FA 5JZSA 3B9PA 2B3DA 2YCLA 5DNWA 3DTVA 5GY7A 2QYHA 3LCCA 2B5OA 3EXHA 3WLRA 5FWNA 1RHKA 4OV6B 3FOZA 5KPJA 1A4UA 3PE3A 2HMVA 3GLFB 2FN7A 2PU7A 3FMIA 1HTWA 2GCEA 3I3SR 4FMPA 3K5IA 1PQYA 1TUBA 4I5EA 4D44A 3WK6A 1N5MA 3NTXA 2WF7A 1H1TA 2XMDA 4AJ1A 2QX8A 5H80A 4G0UA 1P9WA 1OA0A 4NFHA 1F2TB 2XMZA 1RI1A 3HM2A 1TCAA 1U0GA 4FYJA 4I2VA 4D8VA 4DC9A 4FGZA 3MERA 1L9KA 3NBXX 1KF0A 2C5HA 2VKTA 4RE5A 1Q1QA 4KN6A 1H22A 1VG9B 4BLTA 1BWPA 3LRXA 2F1RA 3DOUA 4R40A 5CLIA 2IPNA 1V1RB 3ZNNA 4B45A 4PC1A 4RL6A 3KU4A 4IWNA 4JYCA 4LF5B 1ZQ1A 4FDVA 3I76A 1XEXA 3PU6A 1P17A 1W6UA 3COPA 3V48A 2O5RA 3ZDYB 2BKAA 3L0CA 1F2VA 3PGMA 3BDAA 1T1JA 2VF7A 1T9HA 3AQ4A 3DV0A 4V0SA 1D2NA 2AT1A 1CZOA 2AOVA 4UE2A 1U1EA 1R0ZA 2F9MA 2XH8A 4HGQA 3VU0A 2FMTA 3BMOB 1MAVA 2VUUA 1NDUA 3NJRA 5ILQA 4RFVA 3RRJA 5IFKA 1GT6A 4X20A 4DV5B 1N6PA 4Q3BA 2KS6A 3LXUX 1VSTA 4TTTS 2AN4A 2RAFA 3HPQA 3FDIA 4RJJA 1AO0A 3BD7A 1I7NA 1RRMA 4JFRA 1GT91 4CCSA 4PS0A 2AK2A 1XMPA 1KI6A 4YJDA 4WFJA 1RWOA 5E4TA 5HTKA 4FIZA 3KPVA 1P0MA 1UPAA 1Y3HA 3LQFA 1S2NA 1R88A 3B13B 4KMSA 4QFMA 4WK0B 1Q3TA 3ISTA 2XMPA 4UPVA 1UKEA 1VHWA 1ZD2P 3WGTA 3ZDBA 4L76A 3UHPA 3JD3A 4B6OA 1ORDA 1NLMA 2WTAA 2X3FA 2XE7A 3OA2A 4I4TA 3QE9Y 2A35A 2BR4A 4X1IB 2A1UA 2ZAMA 1BA2A 1Y3AA 1U7UA 3IAUA 4DMLA 3QRWA 3JWJA 2I7CA 1FYFA 4CMGA 3GLHA 4M1TA 1N75A 3EJWA 2O57A 5THKA 5C1OA 1C9EA 1SHKA 3DNFA 3WGHA 4XXHA 4ZVUA 2B1QA 5AM2A 5DYTA 4ARAA 2A5DA 2A3RA 2OBMA 1ZN2A 4DUZB 3WK5A 2JIOA 1KO4A 1XMIA 3NT4A 5BQFA 3UMSA 3ETEA 3H9QA 5K0NA 2QX9A 5A6VA 4LZLA 2JB9A 4RTOA 2IKSA 2XVYA 3CRMA 2R8OA 4DY6A 5LWHA 4R9UC 4DT1B 2PUAA 3DZ8A 3R5KA 8AT1A 4RNDB 2B92A 3MGGA 1ZH8A 3DOIA 1M2VB 3IKMB 3MT9A 4TTQA 4XFDA 1B3BA 1T1SA 4FILA 2WTNA 4UUNA 3SSOA 4F5YA 4UU7A 2HSJA 1IFXA 2CLOB 4PLHA 4OQEA 1DEHA 4TOIA 5IVHA 3DFFA 5A7GA 4E2ZA 1EXWA 3GWGA 1BQ4A 2Q5JA 3QJ5A 4K86A 1CY2A 3FUUA 4A8TA 5HQ3B 2QSJA 3LYLA 1CJBA 6NULA 1YZFA 4G4IA 1H2RS 4HGRA 3HZHA 2IY8A 1C3EA 2EFHB 4UOQA 3KUCA 5D6NA 5DDIP 4D41A 2C5FA 1JHYA 1PU2A 4E1VA 4RVUA 2N46A 2DLDA 4PYIA 2FKAA 2PTHA 4RXUA 1ZG3A 3AR6A 1L5RA 4PLYA 3T54A 5A5FA 4L9SA 1CUFA 3NANA 4DA6A 5HW0A 5K9ZA 5JYDA 2YRXA 5C8ZA 1SKQA 2GS9A 1BDJA 2VYVD 3HJCA 4AXXA 1S1MA 1JEAA 1MB4A 1Y34E 4FQ8A 1EUDB 5AOVA 2ECPA 4D9FA 4CV0A 4YV7A 4XLLA 3ESYA 5IULC 3KJXA 4AIIA 3A14A 4HH1A 3KO8A 3ONVA 5JISA 4PGHA 4BWVA 1HZZC 5F3RA 3HFJA 2P6UA 1MV8A 2D7DA 2OXRA 1Q95A 1TEVA 1M72A 1KIMA 2YJZA 1APBA 5AW7A 1P2BA 2O2JA 1JDZA 5HK8A 2I6UA 3GNQA 3JQDA 2PWBA 2BIFA 2D2XA 2VEOA 3PD7A 4JP3A 2GM3A 4OQZA 4EB6A 2XW6A 1R4NA 1O57A 3VO8A 4CODB 5L7TA 4IHAA 2Z5FA 1L5HA 2MYNA 3OLVA 1T5TA 4TLEA 1I2AA 2YWCA 4XVQA 3HKBA 4WAUA 1X0XA 2UU9B 2BRUA 1SIBE 2X58A 5GIPE 3ZKWB 1ID1A 5E7QA 4WXHA 1DV2A 3OEHD 4OSEA 2UV8A 4JEUA 4IIHA 5E1OA 4HLUA 2VF4X 2PUTA 1PZMA 2PXAA 2FQ1A 3NIGB 1T2NA 4TWJA 2OMEA 3M6AA 3VR0A 4CM6A 1O94D 1RHMA 3DM9B 1XRLA 1U04A 4KR0A 1BU8A 1UBTS 3BHMA 4GPTA 5FTLA 4ANFA 4C04A 2FUEA 1KWKA 1JI3A 4IIUA 1DO8A 3JQCA 3AB7A 3HO1A 3QBVA 4N65A 3OIDA 1WSBA 4P31A 2GOYA 1O96B 1KAMA 4CDGA 4EHAA 1GKKA 3H17A 4GQAA 4XWGA 4UQLA 2ECOA 5TJ9A 4MVJM 2J9GA 1RPNA 1VFPA 3E48A 3PENA 4H16A 4J0DA 2PMBA 5DXJA 3CW9A 3SIXA 1E3JA 5J4HA 2QGZA 3ESDA 1R6DA 2XIJA 3NXSA 3QE4A 2A7XA 3DUFB 4IVPA 5ARBA 5DI9A 3K5WA 2ZJ1A 3TTTA 5C8YA 4P81A 1PV4A 1HG0A 5LM3A 3RRBA 4GL4A 4HUTA 4YP6A 4O25A 2RGXA 4IIXA 5MGBA 4TXJA 3RE1A 3DXFA 4L0QA 5FUWA 3ZBQA 2QZ9A 1CFJA 4LYHA 4TWRA 1P81A 4RKQA 1RBQA 3MWGA 3JQAA 4IRXA 3T5GA 3U13A 421PA 1X7XB 5BORA 1F4LA 5AVYA 1WDKA 1FSZA 2D5AA 2G9UA 1RE0A 1EFCA 5TPZA 1T9BA 3C6QA 1CQIA 4O4HA 4PZ0A 5FRDA 4X3CA 5LP1A 4MVJE 3NAQA 1G8HA 3BCRA 2YMMA 3JX9A 3RT1A 4M0KA 3DLHA 4LF7B 2FB9A 2DBVO 4JP2A 121PA 5AKHA 4GPIB 4S1PA 4AS2A 4MKZA 5JNLA 3AB3A 3QEOA 3ZU2A 3AG6A 5KC9A 2HIMA 1CUUA 3IXLA 4KQMA 1ZMRA 1U2TA 1ZHFA 3L6RA 4OVKA 3E9QA 5FIUA 4OX9B 3AUTA 3PC2A 4FEEA 4AJKA 2G07A 3PC7A 1G7SA 2G25A 4OGKA 5LP6F 2WYUA 4QATA 5K8IA 3D2AA 1MRNA 1T5LA 3AW8A 3GPBA 3E18A 4HQ0A 5JPIA 5A4DA 2UUOA 3KAQA 1KMHA 1T1IA 4NU5A 1Y1LA 1SUFA 2B98A 4FD2A 4Q01A 1QYRA 4TS3A 2VQ6A 4OYYA 1ZJZA 3NC4A 3ESAA 2QAJA 1E89A 3H2HA 2KYRA 1GEGA 4GBJA 4WFQA 3E9CA 3HJAA 4LEIA 1WTAA 2COKA 4MWEA 4NYJQ 3IRVA 2D3WA 1FNDA 4NWIA 2BFAA 4WADA 1M7HA 3W34A 4KFSA 1SD1A 5BYAA 2B2NA 1V11A 4I1IA 2A9VA 3ISJA 1J2RA 2QX7A 4KEAA 4CLRA 3D8SA 2XTZA 1NV9A 2NZYA 3A6DA 1Z6GA 4KMRA 1N2IA 4NBRA 5ALOA 2WRZA 5H4HA 4KDCA 1N2HA 1ECCA 1S5PA 2YHUA 2P4EA 1E6EA 4PLVA 5TPWB 4EVQA 1F0YA 1E6WA 4FGWA 3R7LA 1U7XA 4BP1A 2RHWA 2VQEB 4M8NE 5DO9A 1SB9A 4O1IA 4MLPA 4V3BA 5DOZA 4HDMA 4FQ5A 3BMCA 5BMVB 1Z6AA 2QJFA 3RNOA 1QQTA 4KQ6A 1ZONA 3HJUA 5EJ2A 5EQDA 1WV0A 2XUPA 4YHBA 4QOFA 3PEFA 3REQA 4BNUA 5JZBA 3UGJA 2QR3A 2XZPA 2BY4A 2Q5LA 3FFBA 1XAHA 4UFNA 3BZWA 1FRNA 2HTEA 3F6CA 5CBPA 3K2EA 5D01A 4ZFNA 2DCUA 4MR8A 4RZHA 3RROA 3M5CA 3ZBUA 1AIPA 1FUEA 4RTMA 1ML3A 1A2BA 2XGOA 2PBFA 4RTNA 2ZBEA 5E6RA 2ZJ6A 2BT4A 1YBMA 1HURA 3QMWA 1DQSA 5ADWA 1RYHA 1WEHA 4AJEA 4MW4A 4WK2B 4CV1A 2WIKA 2FPOA 4IFTA 1THTA 3GCZA 4F4IA 2QSZA 1HKHA 1QYWA 4G0MA 4EX7A 2VUTA 1J7JA 3R7WB 1F2UB 3C8HA 3EVBA 3BJRA 3I9FA 5CT5A 1UKCA 4ZU3A 3J81A 1IUOA 1AKMA 1PFWA 3SPXA 5J3JA 1E5VA 1T9GR 1J5EB 2Q2QA 1BG6A 2PZGA 3KQOA 2ID4A 1IN5A 4C3OB 4DXAA 4ETIA 4J1QA 2BZ1A 3I5AA 1YJXA 4NHEA 3I53A 2B1RA 1GOTA 2AKAB 2YCBA 2B4YA 2KQUA 3CX3A 4IRUB 1XJQA 1I0ZA 4GG1A 4LJ4A 3TZHA 1FRQA 5TT1A 1MX9A 5CEFA 3ZG6A 2FX5A 2EYQA 3T3PB 2O2IA 3OCYA 2RHRA 3IH5A 4R05A 4CFZA 4WJLA 3IXQA 3K0FA 1J9EA 1UKZA 2AC4A 1ZGJA 3C6ZA 3WK8A 4LJ5A 2E89A 1Y4ZA 4XM2A 4LCBA 2QTLA 3LVQE 3K6RA 1G5IA 4XCXA 3U48A 3TDMA 2FE4A 2CDRA 2XCQA 2WE7A 3OQHA 4BWFB 4C7OB 1XTRA 1XCOA 4LHXA 5CX4A 2YW9A 5IM5A 1VDMA 2WWFA 3WLIA 2O07A 2OC9A 1G291 4QLAA 1L7MA 2OUIA 3QFRA 5CYOA 5FL7A 4DGSA 1X74A 2G36A 4MV7A 3NIDB 4ERXA 1JYEA 4JJKA 3HFSA 3R40A 1I2DA 1Z8FA 3B5EA 1NUTA 4HEJA 5CYFA 3TIVA 4GOLD 2J7PA 5E6SA 1XWIA 3B8HA 2Z6UA 1WPRA 1ESEA 3INYA 4ICIA 1KY2A 2OM6A 2B1JA 5LKAA 4ZCPA 3KIPA 1BXRB 4OF4A 4WWHA 5I48A 1UC9A 2HMTA 3KYJB 2O8FB 1HFWA 2JVIA 4M0LA 5EIBD 5JXHA 1KSGA 3TL2A 1NKSA 3TOZA 4BKPA 4WCDA 5JO0A 1F20A 2N42A 4RD2A 4BLSA 4CPDA 3DVAA 2IW1A 3EGVA 2CEAA 4BCDA 2COEA 2FPXA 2R8PA 2VZ9A 4PCLA 2GFHA 2AVNA 4QDXA 4IDAA 4QDTA 1CZHA 2GJSA 5DBOA 3Q3IA 3OHSX 1SURA 1JU3A 1ZK2A 4MS1B 4RIFA 2JCVA 2WFMA 2B35A 3EDRA 4E6EA 3Q7IA 1CUGA 1VKJA 2C7VA 3H5VA 3IP6A 4LGMA 4S2EA 5L40A 3E22A 1PJ4A 4P0TA 3ST7A 5A2QA 2LVBA 1NW4A 1A3CA 3NETA 5JPCA 1G4UR 4JL6A 3O6VA 4ZRNA 1X0VA 4F2PA 4UNRA 3GGOA 1AKWA 1GUZA 4IINA 4D4IA 2WD8A 5CFQA 1W85B 1LDYA 4G09A 1DRVA 2LXNA 3KLPX 3QF7A 1CQZA 2R1TB 3A8TA 1BZYA 1GZVA 2YWRA 3CJQA 1E2DA 4IIJA 3FLAA 2X0KA 3IP3A 4QKQA 5A06A 4CM8B 1CC1S 3DR3A 3QVLA 4PFSA 4MB6A 3FCCA 3U9TA 3WRYA 4FDMA 1HL3A 3MWEA 5EJGA 4IQ8A 3LWDA 2I2XB 1I6LA 4YMWA 3JQ9A 4IILA 1UPCA 4FCCA 3SWWA 4DNPA 2PSSA 4QXRA 1II8A 5DEIA 3OECA 1EFTA 2FEMA 5ESRA 3TOSA 1DADA 1CUDA 3JWGA 4DZTA 4ENPA 3AEUA 1EB9A 1N6NA 2GH1A 4TT3D 4HV4A 1KVUA 1ZHOA 5T4BA 2WG2A 3B7PA 4TWIA 2VZ8A 1TM7E 2DQYA 3BXGA 3G68A 2FN8A 3IOBA 5AHRA 3VR5D 1NV8A 4D5GA 4DREA 4MVJH 2B9VA 2AKEA 1ZN8A 3PQ3A 4DSNA 2JZNA 4FWIB 4JHXA 5ER9A 4EEKA 2BMEA 3OZFA 2HCRA 4WFKA 4BATA 3Q3HA 1F1BA 1HWYA 3G8BA 4HEHA 2JIDA 3C3CA 1ONSA 1WW2A 3I6IA 4RK4A 3WAKA 5COBA 3ZLVA 2IF0A 2YC2C 3E0XA 4RS4A 3SXUA 4BV2A 1K7SN 2ZB7A 3FZYA 3CF4A 1BCRA 4Z9FA 1JL3A 5DBGA 3TJRA 3ZXXA 1KRHA 2F1JA 3QXXA 4PSKA 2X2OA 3KEOA 1EFVB 4OHUA 2BBTA 3WNCA 1L1QA 1I3CA 2O2ZA 3WLAA 1GIAA 4NY1A 5LZ5A 1VHQA 3AR8A 4BO6A 2C20A 4TLMB 2VP4A 3A9TA 1LBHA 2UYQA 3AV3A 3Q3GE 5FPYA 4RTQA 4MZDA 4E5SA 2I62A 4Q4AB 1NW8A 2ESRA 5T4EA 4IUBS 4H4DA 4CFSA 1P5ZB 4NPHA 3C5EA 4ZQCB 5AWFC 5BT8A 1EFKA 1KSHA 3L0DA 4IHKA 4P0PB 1CS4C 2R66A 3A4NA 3UGQA 1GGVA 4AZWA 1OKKA 3H11A 3M9LA 4GX2A 4H27A 2HY7A 4IUYA 4WBSA 2M6KA 3D5QA 4DGQA 2QQEA 3RS5A 1Z8NA 2HK9A 2Y0DA 5IUJC 1J0XO 2WSMA 4IEEA 4ZOAA 4ZTZB 4ER5A 3L1KA 5FHRA 3CEHA 4MKGA 5B3LA 2EGHA 2EU8A 4NAUA 1WMDA 4RHCA 2ZEJA 1JLKA 5E38A 5B7QA 1D09A 2YX1A 3E9DA 3W77A 1U98A 5ERXA 3L8MA 4E07A 1NVVQ 3M82A 3RRMA 3H0CA 4PYQA 4ZT5A 1QVWA 2FW9A 2I3AA 2C7OA 2XE6A 2YZKA 5H82A 1X9HA 2PRSA 4RDXA 3C87A 4ZKDA 4EJ2A 1H1LA 2R4QA 3ENKA 5AR1A 2Z6VA 3KLOA 4KMMA 3UTCA 1OBOA 3JQ8B 2IUTA 1OHHA 2QRZA 1PW7A 3G2QA 3NBAA 5B30A 2YXLA 3ACDA 3CLUD 1IHDA 4J76A 2AOXA 2IP4A 1U2RA 1FXWA 3CUUA 1CZLA 2CC2A 4PYMA 5CA0B 1I5RA 1IHXA 4KIFA 4QOGA 1B4DA 1RPJA 1Y1PA 3ZLTA 4QU9A 3MOSA 3JQ7A 1I01A 4JB2A 4PN3A 1XZJA 2ZW9A 3F2VA 1P5HA 4NKRA 4HRXA 2RC5A 2WHYA 3P8ZA 4GKKB 1RWWA 3D5EA 4ZP1A 4HQLA 3LZDA 3BMQB 3AI3A 3E58A 1SJ9A 2R6HA 1G6Q1 3H1PA 3P2OA 4CQLA 3PFNA 4CIAA 4F4FA 3ADCA 2I4LA 4JU8A 1IU9A 2JDID 3QA9A 3IBTA 2IDZA 3DEFA 4QDZA 3TB6A 1T5DX 3B7WA 4WBNA 5L3QA 4UHDA 4FVTA 1LBEA 1A8PA 1N2XA 2JJMA 2QRHA 3OF5A 4QUGA 5JTUA 4K9RA 4WI1A 1I1NA 3WHLA 1SG6A 1ECPA 4ZN6A 1WZEA 4QOIA 4KMOA 1G8GA 4L72A 1C3XA 5D7NA 3UQZA 1XGKA 3RVPA 4C89A 4Z4FA 1W47A 2DWQA 2GEJA 5HDBB 3EIEA 3ONEA 2AQHA 4XD7D 2NYAA 2FV8A 2Z5VA 4L08A 3VZSA 1GZSA 2ZYWX 2CXSA 3AERA 1RPZA 1W34A 2V6FA 3GD5A 4Q1DA 3IAXA 3BT7A 2XTNA 3PI6A 2O7QA 4KC0A 3EVCA 3SJCA 2ZYRA 1FFHA 1YVRA 1I36A 2BEKA 2PO7A 3D3KA 4L4UA 4MI3A 4Q1CA 1EUCB 2IX9A 3QWAA 5ULLA 3W6OA 4BMZA 5C8XA 3CVJA 4JI4B 1ONBA 3FD8A 3LW7A 5DSZA 1FU7A 4EHNA 4AJHA 3GN2A 5CHEA 1K27A 1T43A 1R16A 3GH1A 3KR0A 2YQ5A 4JUAA 1J5PA 2AEMA 4FJ1A 4TS4A 5F2KA 2LZ0A 1VL2A 2VZEA 4BX0A 2FN4A 3SS8A 4AZ0B 1LW7A 5ECGC 2QE7D 3AEZA 4QGBA 2F43A 2WKRA 1E5TA 4LDAA 3AFMA 2VR1A 3E2PA 2WQZA 2EAUA 3CCCA 2GEKA 2X2FA 3JAKA 1U28A 1V3QE 4JGGA 4BQFA 5CCBA 4YWHA 3D6UA 4QDOA 2PT6A 1M2KA 1YKFA 3W2GA 2FZEA 1UMBA 1IVYA 4XW2A 3O3MB 3ZD6A 1YE8A 1I1HA 4S1OA 5JLJA 3HACA 1RWVA 4BKUA 1NNUA 5FR1A 4F38A 1MH1A 2HGSA 5AK3A 4YHHB 2VTBA 2QD5A 4F04A 3FYCA 1BYIA 1IAVA 1D6MA 2PR7A 3OM1A 3AR9A 3M4NA 3R3SA 5IFLA 3K72B 2PL3A 3H87A 4GLFA 3BILA 2LTAA 5IU6A 1UXOA 1YZQA 4EW2A 3LHFA 2AOUB 4P83A 1Y7TA 4W8OA 2V4ZA 4PQGA 2AJBA 1E2UA 1JVBA 2ZJOA 4N5DA 5ERGB 1YJAA 5HXAA 3UKJA 4Y2GA 1AS0A 4DLNA 3KDPA 3C3EA 3DV2A 3WAJA 1RKVA 4TTPA 3VKFA 4RIEA 5A0TA 4U0KA 3RYHA 4EG8A 3KB2A 1XTTA 3AHCA 4G56A 1M1YB 4TSKA 2FR0A 4M0CA 4UAJA 3P7MA 1T2AA 2BGTA 5I6DA 2WTXA 4PAWA 1KFKB 1G21B 1QF9A 3AI2A 3ZWWA 1EAMA 1LRLA 3MB8A 3WGQA 1KSJA 1GPLA 3K71B 5I8WA 3AVTA 4L51A 3F5FA 1QGUB 3WR5A 4FXOA 2E5FA 2GD0A 5DT2A 5F7OA 5JRJA 1YRBA 5BNIA 2GVNA 1NW5A 5ISMA 4A6XA 1FRVA 3A6KA 3HKEA 4R2KA 5DK4A 3OX2A 3IQGX 4PONA 2A94A 1IM8A 3V1LA 3GRCA 1SU8A 1JLHA 3AKDA 4MVYA 4NDAA 5JATA 5JXWA 1RLTA 3ILSA 1Z29A 4MRRA 4QTUB 4KIWA 5J2UB 2A0XA 4BO8A 5C80A 4FMBB 1MPTA 5FF9A 5JNRA 1UJCA 1LPMA 5AK5A 4YAWA 1NW3A 2NPOA 3M6IA 1L1EA 3OICA 4MWDA 4X3PA 5LLTA 1UFKA 4HNAB 4PPFA 2XWJI 1N5OX 2UUCB 1ZLXA 3WRXA 1E7QA 1OH8A 1X38A 3BYZA 3RS9A 1RR6A 2AOWA 1Z4LA 2ZYAA 4BNHA 4O2AB 2ZZKA 1UBNA 4K88A 3L0IB 5EPUA 3SDBA 1LEHA 2ODAA 5F1OA 2BGRA 2GXQA 1SU6A 3GF4A 4YV2A 5JAHA 2GTIA 2PUBA 5DM4A 5FWXB 3CUWA 2PQ2A 1M34A 2DBQA 1WZUA 1Q3HA 1F6DA 2P90A 3IODA 3OJOA 5WRFA 5IEJA 1TAHA 2VXBA 4G26A 2ZM6B 2DX7A 2BZGA 1DJOA 4MUBA 5DWVA 2HBYA 3QPAA 3SF8A 4XYLA 1HNNA 4OXYA 5HEKA 4JI7B 1H69A 5JTTA 4FOOA 2W0SA 1KS9A 1EVEA 2Z0MA 4X6YA 3SYMA 3ZV4A 2XUKA 2IXTA 3HB5X 4QA9A 4IEIA 4HYYA 4O0MA 4Q4LA 4IR7A 4TMTA 2YV1A 3I34X 2CHQA 1L8OA 1R37A 2BCGY 1YR6A 4M3NA 1OGIA 2FW8A 5EA2A 3VOSA 3M6WA 3QSYA 3QXGA 1SBIA 2JANA 5CPBA 3TD2A 1YZ3A 5T6MA 2RK3A 2BYTA 5A3QA 2F3SA 5GV7A 1G2PA 3EBPA 2G5CA 1RMQA 1K63A