2X2OA

The flavoprotein nrdi from bacillus cereus with the initially oxidized fmn cofactor in an intermediate radiation reduced state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking Flavin Conformations in Protein Crystal Structures with Raman Spectroscopy and Qm/Mm Calculations
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Flavoprotein
molecule keywords NRDI PROTEIN
total genus 41
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x2oA00
3NHJA 3O73A 4J8PA 1J9EA 4OXXA 5FX2A 4GQIA 2GSWA 4DILA 2KLBA 1E5DA 2QWXA 3TZBA 4ESEA 1V4BA 1C7FA 4BMOB 3W78A 1FTGA 6NULA 2BZSA 3QFCA 3F6SA 2M6SA 2Z9DA 1KBOA 1CZKA 2QMZA 1H69A 2XODA 4PU0A 2FCRA 4ZVLA 1QHEA 3U7RA 3W79A 1YCGA 3K1YA 1D04A 2D5IA 3L9XA 4DIKA 1CZNA 1VMEA 4ZVMA 1AMOA 4U7FA 2FDXA 3FX2A 3G5MA 2FAXA 4YAOA 5EMNA 5B3KA 3B6JA 2OHIA 1RCFA 1RTTA 2WC1A 3NHUA 5TGZA 5B3LA 4ICIA 3JSXA 1AZLA 2FZVA 4ZVNA 3ES9A 4H6PA 4FGJA 3TE7A 3OWHA 1JA0A 4GI5A 3RPEA 1J8QA 1XYVA 4FGLA 3LCMA 4HS4A 2XOEA 3ESZA 2R96A 4Y9UA 2ARKA 2MOKA 1AKQA 1KBQA 2BF4A 2OYSA 2FZ5A 2V9CA 3F6RA 1QR2A 2QR2A 4H2DA 4Y7CA 1CZOA 1RLJA 3NHLA 3OJXA 4LAFA 4ZVKA 4YQEA 1OBVA 2A5LA 1AKTA 3NHPA 3OX1A 1X77A 3LT5A 1TLLA 5FA6A 3S2YA 4QOFA 3UXEA 4BMPB 4C76A 2RG1A 3GFRA 2HPVA 5F12A 4R81A 4YAUA 3B6KA 1FLDA 4NULA 2M6RA 3R6WA 4QOHA 1ZWLA 3QFRA 4YAFA 3HA2A 3N3AC 3O2NA 3GAMA 5ULLA 2MT9A 3F90A 3NLLA 1DXQA 2FVXA 2BPOA 4M0CA 1OFVA 3B6MA 4Y9RA 4NLLA 4YALA 1FX1A 2KQUA 2FOXA 4FX2A 2ZKIA 3P0RA 2QX6A 3NHSA 1J9GA 1T5BA 3EDOA 1B1CA 1XT6A 2MTBA 3KAPA 5EA2A 1YDGA 1J9ZA 1QBGA 3NHFA 2Z9BA 2FLVA 2OHJA 5JROA 5BUCA 1RLIA 4C0WA 1FUEA 3OX3A 5LMCA 5NULA 2QX4A 4C0XA 4QOEA 2FX2A 3NHYA 1H66A 2Z9CA 3FW1A 3NHKA 3B6IA 3HLYA 3FJOA 2V5UA 4U7HA 4U7GA 3ESYA 2MWMA 1YKGA 4HEQA 4QOJA 3EYWA 1XI2A 2Q9UA 3ZHOA 1ZX1A 2HNAA 4N82A 1QRDA 1NNI1 1BU5A 1SG0A 1FLAA 1T0IA 2BMVA 1C7EA 1F4PA 3K20A 4LTMA 4S24A 2X2OA 4F8YA 4QOGA 3KAQA 1OBOA 4QOIA 4PTYA 1AKWA 1D4AA 2Q62A 3KLBA 1SQSA 3W7AA 1TIKA 4LA4A 1CZRA 1YRHA 4FGKA 4DY4A 3NFRA 1AHNA 1FLVA 3GFQA 1AKUA 1JA1A 1XYYA 1DX9A 3F2VA 1YOBA 4LTNA 5FUQA 5LVAA 2R97A 5A4KA 1D03A 3OJWA 3UXHA 4CETA 3OWXA 5LJIA 5LJLA 1DXOA 1CZHA 2QX8A 3FVWA 4C14A 4PTZA 3GFSA 5LBUA 1AKVA 1CZLA 3D7NA 2V5VA 3KEGA 4QODA 1AKRA 3U7IA 1AG9A 2F1OA 1YCFA 2AMJA 1WSWA 1FLNA 2QMYA 3N3BC 4D02A 1YCHA 4LTDA 1BVYF 3NHWA 4YAWA 2BN4A 1ZWKA 5LLDA 2N1MA 3L9WA 2QX9A 2OHHA 2W5UA 5NLLA 3ESXA 3W77A 3TEMA 1CZUA 5F4BA 3HR4A 4XDHA 3NHRA 5EAIA 3N39C 3OVMA 2X2PA 3QE2A 5F51A 4N9QA 5LBTA 3FNIA 1I1OA 4N65A 1FVXA 1WSBA 4GR9A 4XDGA 3SVLA 4CF6A 3OX2A 1GG5A 2Z98A 2HNBA 2B3DA
chains in the Genus database with same CATH superfamily
1KOLA 4I1RA 1FC0A 1WXHA 1QLHA 2NUBA 2YVQA 4Q82A 3RIGA 2ZIGA 1G42A 1ZBQA 1E6LA 3L7MA 4HI0E 5B6PA 2F43B 2C4NA 2RI0A 3ZKWB 3LGAA 2WICA 4HUJA 3SZOA 4IQ4A 5ALLA 3I42A 4M7RA 4JHXA 4X63A 3FFWA 2VJOA 3KQWA 4KK4A 2QN1A 4NZNA 1ZHFA 3LLMA 2HK8A 3FR8A 1C8LA 2JAHA 3G2LA 5HZHA 1H4SA 5CBPA 3KSMA 1WCYA 3KJNA 2EQBA 1KO1A 5ALFA 5FLKA 1L4YA 1SHUX 1M8KA 1ZD1A 4NMWA 4YRLA 5FBKA 3EBOA 4R7ZA 4D2IA 2JLWA 3TAXA 3ILYA 1OT3A 2GGSA 3A4LA 5HE8A 4LI0A 3T1OA 5DW0A 3WIUA 1QONA 5JZOA 1G17A 2NXWA 1JE0A 5K0GA 1CJUC 2ZS8A 1EWQA 1ETUA 3HCBA 4OHPA 2VJCA 1JGTA 1ZW1A 1VMKA 1XZQA 3FYHA 4PZ0A 5KVQA 3R7SA 2C5HA 1T9BA 3DT9A 4F6LA 5JZBA 4L6CA 5CJJA 1U0OC 5MN6A 1JXAA 2X23A 2XA1A 4AQYB 1K2VN 3LVBA 1ORWA 2XD4A 2YVAA 3PF9A 1E1YA 1QCCA 3UY4A 3FSJX 2OFOA 1HK7A 4HDOB 1PZMA 1V9LA 2WKQA 3PC6A 4HCJA 4LJKA 4R68A 3V8QA 1VB3A 2YQ4A 2WKSA 3BH0A 3T5CA 3TRIA 1KEEA 2H08A 3QJYA 3IRVA 1UFVA 3EVTA 4YPOA 1T1GA 4KQJA 3PE3A 1BKYA 1K0FA 1NVMB 2GDJA 4PYLA 3WYGA 4ALIA 1NF2A 4ZYWA 5KSYA 5E3HA 2VHYA 1N75A 3FBGA 2IH2A 3OM1A 2TECE 4HLUA 3V7UA 4FGSA 1EVJA 1F4VA 3GWZA 3PGMA 2EBHX 3A6KA 4JJ7A 2HBZA 5EJIA 2E4ZA 5DM2A 2O0JA 2WHPB 3LLUA 4RQBA 2QRMA 4OI1A 4TMKA 4M0DA 5LIRA 2Q9UA 4MQMA 2VYVA 3Q3JB 4NYJR 2PR2A 4MRMA 4MRAA 4KVZA 3NWBA 2O20A 4H0FA 4ML3A 1GAQA 1VA4A 3STTA 1N6OA 3V8PA 3VV3A 1U4OA 5DH9A 1KRXA 4R16A 3IJPA 4HEA1 4DMRA 1QHGA 4YAIA 1UKZA 3RUIA 3RO7A 5K0LA 5K3SA 5LB2A 1CQJB 2XWJI 3MUOA 1P5ZB 1V8OA 1AH2A 1LLCA 2J5QA 5AJWA 3F2VA 3H2ZA 5E2BA 1Q0LA 1JG4A 2JI9A 4XJXA 3SIRA 2GXQA 5GINE 3H0KA 3CKLA 4G97A 2C04A 2HJWA 3L7NA 4M9SA 3BWBA 4LYEA 3EUWA 3HBNA 4GVPA 4KPUA 4MPJA 5A0VA 4P1ZA 3PSAA 1HETA 1KQOA 5LQKA 3EJWA 2BFMA 1SXQA 1JMYA 2ZJYA 3REGA 3VBEA 4BAUA 2BZ1A 3A1WA 4HAOA 3OCZA 2DVMA 1IOLA 2B2CA 3S8MA 3KVOA 2F8LA 1XRSB 3DTYA 3ROZA 3VVBA 3KSAC 3R5TA 2R47A 4I08A 3TEMA 2G0AA 4B2LA 3QE2A 1U2ZA 2BM1A 2RBKA 2GEVA 4ZOBA 2A33A 2TMKA 1G9TA 4LPKA 5EZQA 3WIVA 2IZZA 3KLOA 2Z58A 2VDMB 5DWQA 4MLZA 4GIBA 4DV4B 3TQTA 1N0WA 2UAGA 3CNHA 3QU7A 2O8BB 1ZM2A 1W35A 1H22A 4TZ0A 1NU8A 1E99A 3LX8A 2NNLD 4IIHA 4ZOLB 3KSUA 1YRWA 2BMEA 2YTZA 4U02A 4QUGA 3TJZA 4ZOLA 1MNQA 4RVOA 1YWGO 1M8PA 2V8BA 2YH2A 4RD2A 4S1OA 5FAKA 3HCFA 1JYFA 3GT0A 3C3AA 5GJBA 2ATXA 2FWIA 2PH3A 1MCZA 4JLSA 3EXHA 4C2AA 1N2IA 2RK4A 4PLHA 3GHYA 3MWDB 2ID7A 4U3JA 2VK4A 3SZ3A 1SBIA 3ILSA 4D81A 4EDHA 1XDBA 3ONNA 4R1QA 3GJ3A 4AF8A 4A5SA 1CIJA 1LGYA 2G9RA 1UXOA 4JFRA 1U81A 1A2QA 5IJ0A 3B60A 4E5YA 1BN6A 3UUFA 2ZJOA 3TBFA 2FPOA 3MJTA 4YQEA 2SICE 1NATA 1NKVA 3AKYA 3WWZA 2FPRA 2JHGA 3AO0B 1JLLA 2O3UA 3K5HA 4J1NA 4P36A 5DNUA 1RQNA 3D54D 3EFOB 5BSTA 4YV1A 1X19A 1CUIA 4CMKA 1Q0TA 1J2EA 3DWIA 4M37A 2HCRA 2P77A 1X87A 2X5KO 1XNJA 1DBSA 4HXFB 1KPGA 2AFHB 4O63O 3VNSA 4PNEA 1IM8A 1ILEA 4WKPA 1MRNA 3ZWOA 3GGCA 4UZSA 3H8JA 3FWNA 2C92A 1N5JA 4EAQA 5IZ4A 5ITVA 2FHSA 1D5CA 1RM5A 3R9WA 4RUKA 3T1HB 2V4UA 1S7CA 4KO2S 1LPPA 3KAPA 2KB0A 4NC9A 1QBGA 4A2WA 4IICA 1CF2O 2SCUA 2G9QA 2Q9CA 5IJAA 3PR3A 2OY0A 6ADHA 4KR3A 3N7AA 3G5LA 2P9JA 1MORA 1A7AA 1OZFA 4BN0A 2PD6A 4YASA 5LU9A 2C3OA 5DO9A 3L1HA 3K20A 1Z36A 2P4EA 4L4YA 3V33A 4BU0A 2G28A 4KP7A 2GPYA 5BVGA 2ZRKA 4OF4A 4QOGA 2D7CA 5J40A 2R751 3AHFA 1SMKA 2DWUA 3QFFA 2O5CA 2G77B 1FA9A 2J4DA 4KR7A 2JLVA 2I65A 2VR1A 4ZAYA 4A23A 4RK7A 4D74A 2MSDB 2RAPA 1E9DA 1MEEA 1X9GA 3BBPA 3RLFA 2RGCA 4OHMA 1CYEA 2Q1SA 5FNVF 3COSA 4A7PA 4L0QA 3NIGB 4MGZR 4B79A 4KR2A 2WZQA 1NXQA 1O54A 1IL0A 3E8XA 4B74A 1T4CB 1C14A 1GVHA 4Q1CA 4M1ZA 3SFZA 3DOOA 4NYMR 3D2CA 4DE5A 1KE2A 3X2FA 1VCNA 4LYFA 1HE4A 5AKIA 1X1EA 5AIBA 4NTZA 4QD3A 3ZJTA 4AZ0B 3EQZA 3U80A 5KOJB 2Q3EA 2ONCA 1V8BA 2Y6VA 5BWMA 5IM4F 3GQVA 4CM1A 1GTZA 1NIPA 2FUEA 4IDNA 2WYOA 1DCFA 4IJ6A 4WINA 5MGNA 4F4HA 1TEZA 1NUSA 3B2QA 3FLBA 5J2TB 2RHWA 5J4HA 1G59A 5F23A 1ULUA 2IDZA 4UFOA 2ZPTX 3FKQA 2LNDA 1U3DA 4XVCA 1E66A 3N8GA 4I6GA 3QFCA 1PGJA 2V6MA 2VTBA 3VZRA 5LZ8A 4MUJA 2P7HA 3KKMA 4RKRA 1JDNA 2ORWA 3TYXA 3LDGA 4UFNA 1XZAA 4E30A 5IRCD 4EGJA 3WKAA 3Q5GA 5HIAA 2I6QA 1CY0A 1II0A 2UUPA 4CKCA 1SUWA 3ZWAA 1IOVA 1Q7BA 4V0ME 3GGOA 1CQZA 1G7TA 3O6VA 5J2TF 3T95A 3LI2A 1ZN8A 1IG3A 5BPFA 2BEJA 3HFJA 1N4DA 3DEHA 4LSZA 1M8JA 4AS1A 1AKQA 1DWUA 2XUFA 3N07A 3ET5A 3GUVA 5PGMA 1CZOA 3JVVA 1NI5A 2WF5A 3S5UA 3KKKA 1DKMA 1MKYA 1IIBA 5DEOA 4K2AA 4MTCA 1GPDG 1M34E 5I45A 4IGKA 3WFJA 4YRJA 4KIJA 3VSDA 1G5RA 2CLMB 1JAHA 2YVUA 3QBVA 2PUBA 4R2XA 4JC5A 3OTQA 4W5RA 1IHOA 1ATIA 4N0PA 1UK6A 3G2OA 3B36A 4MQUA 2C1EA 1JNXX 4DUZB 4DA6A 3AX6A 2QR3A 5M34A 1TK9A 1AA9A 6REQB 5KVCA 4R1MA 5HS6A 4KKVA 1PLKA 3REOA 1K8ZB 1N0UA 5HTKA 5EG5A 1BEUB 2PZLA 3EGOA 3GLGB 4FYYA 5CFPA 3EXFB 1KJQA 3HHEA 3KTAB 1X94A 2YASA 1LTHR 4BNWA 5JD3A 4DRYA 4M99A 1ZCBA 3B85A 2OO5C 2ORVA 2WWHA 3L6BA 2PAFA 4EHJA 2XCIA 1SKBA 1R27A 3WMRA 3NPMA 3IAS6 4C01A 4DLPA 4HQRA 3D9QX 3X0DA 4YWJA 1PR5A 1CDEA 1DBIA 1P7CA 4H1HA 5I7RA 1XDWA 1VL0A 4CU5A 1J2RA 5DGTA 2A6PA 3Q3GE 3AB3A 5BSRA 2GILA 3VUEA 4D3XA 5ABPA 4NV3A 5C8YB 2VJMA 1LC0A 3HO6A 4EMTA 3K3PA 1DAHA 4DLWA 1R0KA 3LU1A 3BAZA 2C4UA 3Q2KA 2D5CA 3PP8A 4RKQA 4H08A 1EE9A 3LQ1A 1NT4A 3KC2A 3P0FA 4NCHA 2ZTMA 3VC2A 3ZDDA 1T9KA 5T3YA 1C2TA 3A4MA 4JT4A 1XCOA 1IUKA 4NONA 4JYPA 1DG3A 3MIZA 1AXRA 4HDAA 4RSRA 3T7EA 1KEUA 3DGFC 4N5NA 3BXZA 4M7PA 4MTLA 4FIZA 4OO3A 1L5SA 4L8WB 2GJ9A 4O2LA 4BU1A 2YMPA 1U0TA 1QQTA 4F7DA 1X1CA 4ZO8A 2GQ0A 2X0RA 5KJEA 2LP4Y 1R10A 3N0XA 1I3OA 2G88A 2IQIA 3HB1A 4JLJA 5LDDC 1NQXA 2XUAA 5BXQC 4AY3A 4GBED 3OPNA 3UT5A 1NOIA 3JARA 4YTEA 2ENWA 1VI2A 4JUIA 1F2VA 1PTJA 1XN1A 1ZD4A 3L6OO 4DSZA 1O97D 5FNVA 5A9RA 2BAGA 5DTMA 3TSYA 3RTAA 3P2KA 3W0LB 3CX3A 1KYXA 1NXVA 3TCXB 5CYOA 5FWAA 3R6GA 1JMKC 1K7YA 2C7PA 3W4KA 3ZXYA 3K32A 3FGZA 5DIZA 1K3UB 4JJ4A 4HN4B 4PFKA 4YBRA 3WGYA 5EYPB 3EMDA 3P9CA 5IFKA 4PGHA 1OGIA 1ZGCA 2HSEA 1JEOA 3HYCA 3GEPA 2JIQA 3AIKA 2WKRA 3H1EA 4MCAA 1I4OA 3BILA 3DDNA 4OU4A 1WW3A 2Q5QA 2XRZA 2OG2A 3O95A 3OQHA 3QEMA 1KYWA 5EIBD 4R8VA 5FO1A 4HNTA 3B1YA 2QG4A 3E61A 2H0RA 4JDPA 1DAMA 2PO7A 4GLBA 4IVNA 4O1HA 1NVEA 3C6QA 5C35A 3L8CA 3X1ZA 1ETHA 1TL7C 3U40A 3RSOA 3B9QA 1QVWA 4PO3X 4OCZA 4TV8B 2ZB7A 2V9CA 1Z5GA 4M49A 3AM4A 4WH0A 4KBFA 2MYUA 1PO7A 4ZZIA 3JAKB 4YDQA 1Y1LA 5C1DA 2AJDA 3GUCA 4GPEA 2XCRB 3WA7A 2Q6TA 4FQ5A 4BAZA 4R1PA 1UPXA 5A2QA 2PRJA 3U26A 4V0OA 1YE5A 1W96A 4R2JA 3DDOA 3FKJA 2C96A 1J20A 1H9AA 4GXQA 1TUBA 4IMRA 2DSNA 4EBFA 4OHOA 9GPBA 2XWBF 1T2AA 2OORA 3PYXA 4G8JA 3TTWA 2R0QC 1QP4A 4N5HX 4KB5A 1WUHS 2FRDA 4LFBB 3K0AB 3VI4B 1RMTA 4EI2A 2C83A 1KIMA 2ZKIA 3PIDA 4OFBA 1FTYA 5LR6A 4MWOA 1RWPA 4TV9B 2G1JA 1J25A 3BFJA 3BSSA 4ZYVA 4C7MA 4BGDA 3EASA 1I80A 3AY0A 1E1MA 1USVA 4XQ9A 4CG0A 2DX7A 4YR7A 1URPA 4DMUB 4HGYA 4EQ6A 1SZJG 4YHHB 2H48A 3DDSA 4K8RB 4DARA 2QUJA 2HU7A 1FOEB 3W9SA 5LWHA 2HSJA 2VUHB 2I34A 4CDNA 4WKGA 1D5WA 2R60A 1RPNA 1P1JA 4RK1A 5HJ5A 5JW6A 1JLRA 1FX0B 3F74A 5EIOA 2IYOA 3EVBA 4YMUA 1JTEA 1ODIA 1L7XA 1ZXBA 3B7GA 3N53A 3ZJ4A 1U7ZA 3BGDA 2H07A 4F72A 1VB5A 4JP2A 4M0MA 4WEQA 4CN8A 1XZMA 4PTYA 2PSDA 1PR4A 2QK4A 3S2ZA 5JH7B 2PRIA 3TVTA 4L78A 2Q6OA 2PWYA 3U1TA 4B6QA 1BJRE 4BWFB 2R00A 5I7HA 3EGIA 5KNCH 1E3MA 4JWTA 2XCOA 1TE2A 3RHFA 3F6CA 1TO2E 4KPFC 3OQOA 1HOTA 3HUTA 3BXFA 5KTRA 1JHXA 4KN9S 3DUFA 3MAAC 3R2JA 3AZPA 3KB8A 3V1YA 1T9GR 1E1DA 4UQPA 1L7BA 1UK8A 3V4RA 2WU4A 4YXWA 4I3HA 1H0KA 1Q2XA 1SUPA 3DHWC 2V0CA 5FHQA 4E6EA 2EHJA 3IBSA 3L8YA 4JUCA 4LHSA 1IQ0A 2DUUA 4XCXA 1G16A 3CISA 4K0KB 4JVMA 3JVDA 4C7VA 5KYWA 3IPCA 2HHCA 2BN4A 3TUZC 3HVRA 3KYCA 4M53A 4I9FA 4G0VA 2R1VB 3FMIA 5IH3A 4D9FA 4BRZA 5ISMA 1V3UA 3MB5A 3IBGA 1VYTA 4HPXB 1IPFA 4L4XA 1YR6A 1E2EA 1GV1A 4KMMA 1XTZA 2IZ6A 1DFIA 3IJRA 1D9XA 2HY7A 3PXAA 3PHCA 4KYIB 4GX5A 1UEXC 2Q3CA 4WLUA 2RHRA 3U4QA 4WCVA 2JCGA 4ZTZB 3VO8A 3LXMA 1ONPA 2GARA 2CNBA 1HQCA 1LDYA 1OWLA 3SXUB 2G6TA 1V5FA 1CNEA 4L7QA 5FP0A 3BB4A 1N2ZA 3T3MB 2CW5A 3WGQA 5HRAA 1O58A 3ZTWA 4MYDA 4ZEWA 3L46A 5L7TA 2CLDX 3BGVA 2XVYA 3HCDA 3LBAA 2CV1A 2VN8A 1EDZA 3DEKA 2VQ3A 5JWOA 2IWHA 5IX8A 2IYLD 5IAKA 1Z6TA 2I2FA 3EY9A 3KOYA 1KSGA 3THXB 5B12A 2P6MA 2FFJA 3FUUA 3PFCA 5FPTA 1HDYA 4RF2A 3WLFA 3E3AA 3WTBA 2EATA 2RHTA 3HA7A 4QIHA 4BNDB 1Y98A 5DGXA 1A8PA 2W2OA 2V74B 3I2KA 2NZWA 3TDNA 4DCNA 2ZRCA 2OENG 3DFUA 4Q7EA 3CLSD 5LQAA 1FDTA 5HR5A 1YFJA 1JEEA 2X8JA 3RYTC 3KKEA 4W1QA 3IP8A 4GQAA 5KWIA 3UHOA 3Q85A 2EWVA 2GMWA 3TQQA 5DYYA 4W8HA 5HFNA 1JTFA 1HLDA 3Q6NA 4A5OA 4LG1A 4V38A 1JF8A 1GGMA 3DOJA 4RZIA 1H8HD 3E3NA 1CUBA 4G9GA 2NO1A 4QM7A 3LSTA 4Q7QA 4ZCPA 1QGUA 1LCIA 1ZA1A 3EF3A 1XK7A 2DR2A 3TXAA 4B6PA 4ZC1A 1HYQA 3HHPA 2A9FA 2RGYA 5K3FB 1UBOS 3BOSA 4FE3A 5DHPA 2X40A 2ZI3A 3ROFA 3DBVO 3CNLA 1ZCJA 2W2MA 3ONFA 4QLAA 4UC0A 1QYCA 3LPNA 4UBLA 3VGJA 4BKUA 5GVRA 1IHUA 2PT5A 2EVWX 2P1DA 1P5RA 2KM1A 4YRQA 3T7CA 3THWA 1W48A 1N2HA 2H1SA 3LSYA 3RV4A 2Y99A 3ZJVA 4G0XA 2YZGA 4OI2A 1TFRA 1C7IA 3A0RB 4UAUA 5KCMA 3TNJA 4BEBA 5J2UF 3N05A 3PVCA 3THWB 1XNRB 5EP4A 4J6FA 4OP1A 2OVFA 4H7PA 4R83A 4UREA 4YRRA 4EEKA 2NM0A 2PKQO 2Q6LA 3STUA 4J3NA 5HYVA 4AJNA 3SC3A 1ML3A 5B3JA 4PFQA 2C9OA 3IAM1 4FDMA 3ZD7A 1V25A 4GD3Q 1VJ5A 3L6EA 3DFMA 2BWJA 4FMDB 5HXAA 2NVUA 2IEYA 4LECA 2XJ4A 2DF8A 4G0NA 5BVHB 3MJ4A 4Y0VA 4PX3A 3N7TA 2HPHA 3ZG6A 1CF4A 2V03A 1U7TA 3OH8A 1F5NA 5AP9A 5AHKA 2EGGA 4X0EA 4JEHA 3KOMA 5K0CA 5KOHA 4CQMB 2K7FA 2YXDA 4CM6A 2MMGA 3EBPA 3H11A 3QLUC 2EWMA 1ZM9A 2XT6A 4DPKA 1TAUA 4BP8A 2F1JA 2GBCA 4HH1A 9LDBA 4FMDF 1WO8A 2RC5A 3R23A 1J99A 1QZZA 3ZLBA 4LJ9A 4G67A 2IUTA 3E53A 1R0YA 3UTDA 1BCSA 4GX0A 3Q7PA 1TOAA 1TYBE 2PN1A 3ACBA 5K4HA 2NPIA 2UVPA 3KFLA 1Y6JA 1JUDA 1SA0B 3D6AA 4Q19A 5LP1A 1ZPDA 2FK8A 3CWCA 1UPBA 2WINI 4RL4A 4YB8A 4B2IA 5HIKA 2FRDC 2BEVB 1IAVA 2R1TB 3IP6A 4FGWA 2NP6A 2JANA 3OZTA 4U9IS 4C7JA 4WLVA 2YINC 4MS1A 3NKLA 3PQ6A 1U80A 1E8NA 5KX5F 2QZ9A 2HMTA 4L5BA 4OYRA 3UYLA 4WIAA 1TTPB 5AH0A 2H06A 3MT7A 2Y2VA 4H7HA 1CJTC 3I6MA 3ENWA 2HQRA 4TYMA 4EQZA 2WMOB 4WQMA 2BI8A 3HB0A 2A14A 1XNHA 3NW9A 4ERNA 5DNYB 2IDMA 4CUJA 1XF9A 3OMXA 2OKGA 4V3CA 1O1YA 1P0IA 4D9EA 4NESA 2V1UA 3IE2A 5ALVA 4CEHA 2R87A 2GCEA 3H84A 3IKVA 1L1EA 4I8IA 1U2GC 4M8KA 2CXRA 2PR7A 1I6MA 3AEUA 4R6XA 3IEPA 1IE3A 2ARKA 4DW8A 2YX1A 2ZZMA 1GAXA 4FNOA 1U9YA 4HX9A 2ES4A 1VPEA 3IUYA 4TKLA 4GEKA 3ZV3A 4NE2A 2QQ5A 3G5AA 3M3HA 1EU1A 2VRCA 2BUAA 2ORIA 2FFQA 4L02A 2WHEA 5DW3A 2J0SA 2C3UA 4R2HA 2CYCA 1XQYA 5ADVA 3WGIA 2BHSA 4C88A 1PHRA 3IBTA 4YY3B 4C0JA 5K0SA 3WZLA 4N1AA 2MT9A 4R31A 3CKYA 4Y7DA 1E3SA 3JQGA 1YZHA 3IDZA 1GGVA 3E4CA 1OZ0A 2QT9A 3GJZA 3K9WA 1DC8A 3BD9A 3KWJA 5KI6A 1KEWA 2ECKA 3E18A 3RU3A 4MW4A 3AC0A 2NX2A 4OG2A 2G7ZA 4IMPA 3SHFA 2HCTA 1EDOA 3RSSA 3PQ5A 3SLRA 1CHDA 3TLBA 3HYSA 1WOMA 2X7XA 3NIWA 1E2PA 1JR3D 4CLDA 1H94A 4TN1A 1HFKA 4A1FA 3CWZA 1E7RA 1KC3A 3ZBQA 5KNDH 3VR4A 1G7CA 2H59A 1IULA 3ASYA 4FMPA 2YZKA 1G3MA 1ZM3A 3ICPA 4JMPA 4YV2A 2AL7A 1XAHA 1XMPA 4CKWA 5EJ6A 2QMQA 1N6RA 1T2CA 1I2DA 3WB1A 3R3HA 1X42A 2BFWA 3JQRA 4NMLA 3AP1A 3PTAA 4A91A 3PUWA 3N8HA 3W9YA 1Y4UA 2UZ0A 2AZTA 2EKDA 2W2XA 2B82A 3H0CA 1P5JA 1AF7A 4HWRA 1T9DA 1IB6A 5DYGA 8MHTA 4F9GA 3U3XA 2XTZA 3KDSE 2ZSAA 4MH0R 4XQEA 2ZQZA 3B1XA 1V96A 4LV6A 1H9CA 1TUBB 3IKLA 4YN3A 2Q4OA 1LZKA 1OLOA 3PXCX 5AW4A 5JHHB 2H31A 1DFHA 1TF5A 3H3XA 5DN9A 1AGXA 5FADA 2DH5A 3SHVA 4CF4A 1KI6A 3QBEA 1L8XA 5HKAA 3P94A 3IKTA 2G07A 4P98A 5KTYA 3DE5X 1UAGA 1ZG3A 2YFHA 2HSWA 1V8ZA 4I4NA 3TEFA 2R9VA 2AFVA 4HWKA 4R3NA 3TX2A 3GLFA 3JR7A 3VPSA 3NNNA 5DNWA 4EO7A 4UZEA 3IAFA 4GRAA 5EJGA 2TMGA 2MCFA 2BFDA 3O94A 3WB0A 1WMAA 4FDTA 4DLAA 1UBFA 1JDVA 1RXSA 4WZAA 4QE3A 1ISFA 5K6AA 3WNZA 2PJUA 3OP1A 5JEEA 3BL5A 1K6JA 1C5KA 1HL3A 1SOMA 4M9ZA 1T5HX 2X3FA 3STYA 4CV3A 4WZAB 1U0EA 3CE6A 3BEDA 4FHDA 2VF4X 1EVIA 2ZR0A 1CU1A 2X1MA 3VMFA 1H69A 1R0ZA 3PUJA 2QGZA 1XCPA 2WSBA 1PJAA 3ND7A 4UNQA 4KITB 2ANCA 5KVAA 4D4KA 3LTNC 3C15C 3H97A 1A7JA 2VQSA 3O8OB 4G4IA 4ZC8A 4KXNA 2NUTB 2HU5A 3DMTA 3ER9A 1S9HA 2H1RA 4E08A 4DEYA 2HBRA 4LEIA 1U7UA 2OCBA 3PFGA 4RD3A 5H9WA 3DLIA 1I6LA 4B3TB 2W22A 1KOFA 2PZFA 1EUCA 4DLSA 1EIWA 2CFIA 2NZYA 2DWCA 3GXOA 1DWPA 4I9GA 3G9TA 3K9GA 1XMSA 2PSEA 4F3TA 1RAEA 3VPCA 4QXPA 2BFEA 3REFA 3MS7A 4CCSA 1TJPB 2XMBA 1IHPA 3FNQA 5CB4B 1HNWB 2P69A 1F0YA 1SO8A 4HZIA 3IX7A 3OKFA 4KQ2A 3RLIA 3AKCA 3PWTA 3NBYC 2BH9A 4IWNA 2YMQA 3PQCA 4FOLA 1UF9A 2O2XA 2V7VA 5JJCA 3RADC 1NMYA 2H00A 1BGWA 4MPDA 4F92B 3NJ8A 2FWAA 4WK2B 1KERA 3NM5A 4E2XA 3I5AA 3ZD9A 4B83A 4UOEA 4HL6A 4WECA 4LX8A 2ZRIA 3P19A 4G26A 4HNAB 4NFYA 1Z8FA 3FHJA 4FHEA 5JY6A 5CB4F 1FFBA 4OHFA 1IHYA 3DYVA 3W5DA 2YWXA 1IU9A 2HDNB 2Q99A 1QOQB 3MRXA 2VEOA 1PR6A 2QD2A 4NK5A 3TTSA 3CR8A 1ZQ9A 2VJKA 4EKIA 3O3NB 1Z0JA 2A0FA 3VR2A 4QOJA 3HA5A 2HB6A 4RZ2A 3ZTYA 1LQTA 3A9VA 4CKEA 1ICEA 2Q8NA 1AKEA 5JJ5A 4IXWA 2ETXA 4FINA 3QX3A 2BJHA 3FOAA 1FSFA 3CVUA 5AFSA 2BH2A 4HT3B 1JPVA 4IZOA 1R0BA 3LNCA 4IV0A 3PNOA 1XZIA 4K46A 2G8NA 1CUCA 5C8VA 4QT4A 1I5OA 3E7DA 1EB8A 2F8MA 3O1IC 1YDHA 1GYPA 1W6UA 5KKAA 1Q77A 1QV6A 4N3AA 4Y6OA 2AEEA 4KTVE 4B2YA 2HTFA 4O59O 4E03A 3OQMA 3AVXA 1L8QA 4ZFNA 4ZDIA 4RPCA 2P4QA 1UC8A 4MPPA 4G9EA 4RESA 3TPCA 2WHPA 2ZDHA 1ZKMA 4JJGA 3H3FA 4KQGA 4V24A 4TZTA 1C29B 3I39X 1BVYF 1ML4A 2AI2A 2JVKA 5FL7D 1YBHA 1Z39A 2O2JA 2X42A 3BJZA 2A0YA 4BNJA 1C7JA 2P6UA 3TOXA 3V9PA 3JVUA 3RIHA 4WA7A 4YRIA 3LT2A 2DY1A 2P6PA 3G8AA 4N9QA 3WGOA 3OJLA 1O94C 3IDOA 1NVAA 5BN5B 3G0CA 3PNYA 1PX2A 2P9BA 2VHQA 3I2IA 2Q0SA 3JALA 4D9JA 4XDGA 1XZJA 4ZHQA 1H4QA 4X1KB 3ZWYA 2FMTA 1I0LA 3QPAA 2HNBA 4N0QA 1MQSA 3ZE0B 4Y9SA 4RKEA 2AKAB 4P82A 4J2TA 4MS3A 2W42A 2NW6A 2D8AA 1G6Q1 1VLHA 4KVFA 1CJCA 1NLYA 1NVWQ 1NZJA 1P33A 4PIMA 4Q15A 1EM8A 2I87A 1N5DA 1XELA 5H5JA 2FGKA 2WTEA 4P84A 2H3EA 2GVNA 3QFSA 4TS9A 1WCV1 2Y77A 3RBAA 4ASUA 4C0BA 5EHXA 2EX1A 2P27A 3QG1A 2Z3WA 4KAFA 4YROA 1UWKA 4L9SA 2ZVQX 4FGJA 1N6KA 2I9KA 3OOYA 4J9UE 3GLGE 2I62A 3D7KA 4CQMA 5JO9A 2XOEA 2R84A 4HMQA 3RTBA 3BREA 4UVGA 4NWIA 3TL6A 3G2KA 2BD0A 4GS5A 3MRTA 3Q0EA 3V4OA 3KE8A 5COQA 3I6QA 3FWPA 3FZQA 3OC0A 3VBCA 3ABRB 1PVVA 4L2IA 2VSXA 1U63A 3AUSA 1EFCA 3VKFA 1RYZA 2GWRA 3HUDA 3NCTA 4OMDA 1FNBA 2OGTA 4MKFA 4Y6SA 4AROA 1YL6A 4FHZA 3H2KA 2BTEA 2BFPA 4ZOQI 4DRXA 5IH7A 2QD1A 2PT6A 5M29A 3WYEA 3B6EA 5C4MA 4TVSA 1NBME 4X8MA 3V2HA 4D79A 2GCNA 1OX5A 2P9CA 3BE8A 3NDJA 4KNVA 3WRXA 4DYDA 4DCCA 3IFSA 2H7YA 1KNQA 1FDUA 3FR7A 4S1WA 1RABA 4LMRA 5DHSA 1GG8A 2GAAA 4XFJA 1U8EA 2W43A 3MOSA 5F7ZA 3CPHA 1KMQA 3GV0A 1ECJA 4LRQA 3WHLA 1T5SA 1Y9JA 1YDGA 3MGKA 5TGTA 4NMHA 5LQJA 1QCYA 2HJHA 2J7KA 4BO8A 2WHXA 3VPHA 3AV0B 3TBKA 2C5BA 2JLSA 3PNKA 5AHRA 1RZRD 4ROTA 2E4UA 3H2YA 4ZT5A 4U7GA 1T4GA 2YV1A 2NSHA 3DE2X 4RE5A 4WBSA 5CGZA 2EBUA 4FSHA 2J9YB 5CTJA 1R4AA 2XVZA 4P0PB 1MOQA 1UEIA 3AY3A 4TYQA 5P8WA 3QVSA 3PXXA 4P4SB 4BZPA 4FIDA 3GPLA 1M7BA 2CUZA 2PANA 5LLTA 1NWHA 5FQOA 1OBHA 3NWJA 2CF5A 2VS1A 3W3AH 3OA0A 2V45A 4CV0A 3JATA 4D5EA 1ZGBA 1VHTA 1OQAA 5C5DA 4C4SA 4WE3A 4OA8A 1A95A 4LYGA 4TL6A 1V7CA 2PG3A 4DCSA 4HTFA 3EFBA 3FYUA 3NGLA 3E03A 4DLKA 4MEAA 4JI2B 3KSDO 4HAWA 4WBXC 4YV0A 1EFTA 2WF9A 3IUEA 5IN4A 3GP8A 3Q10A 4CMIA 3A3PA 1CUEA 4XUCA 4C4PA 4E3WA 4QSMA 4EX6A 2RSLA 2IOQA 2D5BA 3SF0A 1CF9A 3WKDA 2A86A 2EZ9A 4KXMA 4A0FA 4WWHA 3T6KA 3M6IA 2ID4A 4DDVA 5MFPA 1WEHA 2YUIA 3DL4A 4NG5A 1HORA 3PX3A 1XTSA 2HYDA 1WXGA 3ZKAA 1A82A 2MMCA 3VSCA 1GLNA 2CLSA 1VSUA 1SUIA 4YJKA 2FPWA 5T57A 2Y92A 1F8UA 4B3SB 1TQ8A 4CQMD 3BXGA 3LWNA 2J3MA 2P0AA 3ZI4A 5AK3A 4D26A 4XGNA 2V5AA 4OLJA 4PU0A 3OICA 1PD0A 1W5EA 5CFZA 3QEKA 5CK5A 1IY2A 1T5DX 2LIVA 4OK5A 4R7TA 3KU4A 1VA5A 5C1IA 1R15A 1QFJA 2H1LA 2XYRA 2Q46A 3PQ2A 1MG5A 5D6NA 4ZEOA 4F85A 3RVSA 5TY0A 3QLVC 5AYVA 3M34A 4FFMA 3A6JA 2H16A 4GI5A 3I6BA 1J8QA 1LFAA 5DX8A 1WW8A 5CA0B 1R5JA 3QX9A 4AO7A 4PAWA 1VHLA 3ANTA 4ZV7A 4CQLB 5DOVA 1BXGB 4R41A 1DIGA 3HJAA 2REQB 4MQLA 1QGDA 2QMUA 3T3NA 5BW6B 5CD9A 2XGOA 4RHTA 3H7AA 3CX8A 4INPA 4RMNA 2Q7OE 1E7SA 3R4VA 4X6YA 4MKIA 4OYHA 3WGLA 1ITZA 3IPAA 5CEFA 4WNYA 2WIAA 4EO4A 4ETIA 3GX1A 5TNXA 5KPDA 2VZ0A 5KTNA 3CRQA 3PFNA 2M32A 2VJDA 1QAMA 5BNFA 3HCOA 3S2EA 1HDIA 3I9LA 4OB8A 1LBTA 3QWBA 5FPSA 1XHLA 4MR8A 4F2PA 4CM9A 5LMNB 2GM4A 2XHEA 2PUAA 4FC7A 5A3RA 1ZAYA 4FHCA 2HRQA 3R3ZA 1XU7A 1WMFA 5I6DA 1HM5A 4GM0A 3HFSA 4HO1X 3UHJA 5AOAA 5G3YA 3K8OE 1L3IA 4M1QA 1PL6A 3I3SR 3D1VA 3TW8A 4IEFB 3A36A 4PQGA 5H3CA 1Q6ZA 3U62A 4E15A 4K1LA 5C9ZA 2OFPA 4QBFA 1YZTA 3A04A 3A1NA 1Y3CE 3DG9A 3KEFA 4M6WA 4UU7A 4KRGA 3ZS9A 4A36A 4LJSA 1W4CA 3V1TC 4EHNA 1MBZA 1NHGA 3D3WB 4GX2A 3A7EA 3GOHA 1AS3A 1D7AA 1NNI1 2YN4A 1BFKA 1OVGA 2XYVA 3DV2A 3OQPA 5EEGA 4GL2A 4MVJH 3WAJA 4J0FA 1UPFA 4Q7LA 3R7AA 1K5HA 3DS8A 1UJ5A 4LPSA 1LA2A 4XDZA 2P67A 4YRDA 5AJZA 4M2LA 4Q4AB 3WB9A 1VE1A 2X6TA 1R4ZA 1O6ZA 3BE5A 5K09A 4A73A 4U8HA 3V1UA 2J3EA 3BQ9A 2I3BA 4RJKA 3T5TA 5CB8A 5IBPA 4EUNA 3SYLA 4UBKA 1O5OA 3TKLA 1DINA 4C2TA 3KQKA 1M2VA 2JFNA 1NJ6A 4M8SA 2J31A 2P2NA 4EATA 2XVAA 1BXRA 5REQA 4MQEA 3B3AA 1AIPA 1RDFA 3CEPB 2OXTA 3V4ZA 1ORDA 3K70C 4DEXA 2XB4A 4P7JA 1EVYA 3OJEA 3RSLA 2FG5A 2G9NA 1WEKA 4UTVA 1BMTA 1G2PA 2XCUA 3SY8A 1RQ7A 1M1XB 1ESZA 3N2LA 1Z6GA 2CXHA 2RHJA 3D4IA 2QRVA 4GI2A 4H0NA 3EZFA 1JQ3A 3G8YA 2FPXA 4JBWA 2AVDA 5EAIA 3THSA 3VTZA 4EYOA 4YT4A 4YMLA 3F7OA 4ZAGA 1Y63A 4PIPA 4XLLA 3PNVA 1Y8RB 5FTLA 1ECFA 1ENYA 1L6RA 2JARA 2ZUDA 3H42B 1RT9A 4PXSA 2PKQP 3LIPA 4Y2JA 5B1IA 4F97A 4KI7A 4A0HA 3N8IA 1FFCA 2WJ3A 2KJQA 4DR4B 4UVIA 2IU6A 1C7FA 1D4ZA 1N2XA 5EKSA 4DUYB 1G5IA 4NOLA 1FVHA 3G1UA 3SU8A 4DXAA 1L5KA 1N0VC 1RXVA 2VL7A 2OBYA 1CP3A 1KTVA 5LYJA 3NV7A 4ZPJA 5I7EA 2WNSA 1EUQA 2ONYA 2WUFA 4IMIB 3ADBA 2BTOA 3JSXA 1B4DA 1R6BX 2OVBA 2HX1A 2VSQA 4HEA6 2FN9A 2BMFA 3ES9A 4FD2A 4O2BF 3WDLA 1QYRA 1U8FO 2FMKA 1ZHHA 2B98A 2FH5B 4CIBA 1HLFA 4OFZA 3TS1A 1OASA 3UV6A 2CL5A 1CR1A 3ANXA 1TZBA 2LE0A 3KHUA 2QKYA 1UOOA 3LQKA 4W5JA 4Z2YA 4F4JA 2GM9A 2JCSA 1SH7A 4F91B 1L4NA 3P9PA 4AK9A 3UXEA 2W6QA 3LT4A 4FW8A 4O2BA 1XHFA 2ZSKA 3ADCA 4FGUA 4CQJA 3RRJA 4KV9A 3M1YA 4YPFA 1DCKA 1KFCB 2ZPUA 4O2BB 2NV2B 2BT4A 4JBIA 4IUYA 3F8SA 1J2JA 2IEGA 2NYUA 1J7KA 4MS3B 4ND1A 4OI4A 1UZUA 1HEIA 3KQMA 4FSXA 1TUGA 4PFSA 1CJSA 4AJPA 5KJFA 1CEEA 3AOEC 3KZOA 3DF7A 4FNGA 3LUCA 3NRBA 1E3EA 5ALUA 2R6DA 3DJFA 4PRZA 5LKAA 1U5BA 1KH3A 2R5WA 3K15A 3N5CA 2GN8A 4DQDA 4HNQA 2ZVPX 4Q16A 3V55A 3IUNA 1KZYC 2CMGA 1UC5B 3EQ2A 3FA2A 4HZGA 5BNTA 4HB2A 3TG2A 2HMVA 3OQNA 1E6MA 2BGNA 1IONA 2Q3LA 4ZDKA 3WV4A 3VR6D 2WB2A 2QD5A 3FGPA 3OZXA 4ENUA 5F9FA 3WLPA 2C97A 1K7FB 1ZK0A 5CDYA 3VAZA 1Y9DA 1BU5A 2YMMA 3ORFA 3SLGA 2D1FA 3K8QA 1DL5A 5KQGA 4J03A 1MHPA 3IQZA 4J3FA 2YHSA 4DYVA 1P9LA 2F3RA 3OCYA 4EG6A 1VGVA 2O3QA 1UWCA 2AN4A 3MHPA 3MN1A 2Q3DA 4MQFB 3BF7A 4IGIA 2ODNA 4EDFA 1TQHA 4DJDC 3T1NA 2VQEB 3ZY4A 1ZLYA 2UYYA 1JIIA 2GB4A 2ROQA 3JQAB 2GK4A 5L51A 2MSLA 3CXUA 3N75A 5MN4A 1WY7A 4GWKA 3PICA 4A03A 3KWLA 3QVGA 1USIA 4EPRA 5HQ3A 3DE1X 2WJJA 1PWYE 5HCIA 1FX0A 4OFWA 4Z0TA 1QFXA 5H3HA 4MYCA 1B16A 1E3WA 4MWDA 4NECA 3LW8A 3TSWA 2B8JA 3UTCA 3WGNA 4YMTA 5D5PA 5JXJA 1CB7A 2BOVA 5B2EA 2MR6A 3CBGA 3COWA 4QYSA 4ER0A 5IUNC 3U6KA 1DRJA 1NVDA 3A28A 3AWIA 4R2IA 1YVPA 5AKZA 2O5VA 5KX5A 4TTPA 2VNJA 5CU7A 1RIIA 4RY8A 4J3JA 3CEMA 1E4OA 3RDPA 2AJBA 2I0FA 3L4SO 4B8YA 2VP3A 2FXIA 1HXHA 4J8PA 2YV4A 2X0EA 4OXXA 5G4KA 2RAUA 3S5JA 4YUXA 1PQYA 2HK6A 4DGSA 1V4BA 3NT5A 3WYNA 3ZD8A 4EL5A 7YASA 1Q7RA 1YC2A 1QC5A 3LBIA 4Q5IA 2OUIA 3N5KA 2FX5A 1W5FA 4FK8A 4ZU3A 1Z6XA 2R2GA 5EMMA 4OAPA 4QRIA 3KCQA 4QXMA 5G53C 5HKOA 3VVLA 1R2QA 2CJYA 1GZ4A 2B0JA 2PYDA 2G9VA 2QTHA 4YECA 3ZZMA 2WC1A 3IKMB 3VNUA 4NICA 3FLEA 3AESA 3VPDA 2W2LA 1YAJA 2DFPA 3PKIA 2PUGA 4E7OA 2XQFA 3T7JA 1TGYA 1YI8A 4OIMA 3TFOA 1PVOA 1VDMA 2QD4A 5LQNA 3ST7A 1KYIA 3GGJA 1RKBA 3S7ZA 2R1ZA 1Z06A 2GZ2A 1IHXA 1NNLA 1SZCA 2I55A 3GFPA 5AQ1A 6GPBA 2AOWA 2IOFK 2PGAA 3CM0A 4W9NC 1A2BA 1Q20A 3KUKA 1SBHA 1XK6A 1NVKA 1A97A 1KFBB 4BFZA 4MRVA 1TMYA 5TSDA 4C43A 4DDUA 1BS2A 2R48A 3IXLA 1MAHA 4Q1DA 5F12A 1FXWF 2X4LA 1IZYA 4V2UA 5G0SA 1KKUA 1L1FA 3SJAA 3RK1A 3ZDEA 1OFUA 3L0YA 5EJFA 4Q1FA 3EZLA 3RB8A 3S3TA 4HV4A 3F4BA 5LLSA 3VU1A 2JGJA 1MQAA 5DCWA 4WXEA 3H16A 1M8FA 4U2BA 2VJLA 1FRQA 5C80A 3W8DA 1XOIA 2Y9PB 4XRRA 5E9AA 6Q21A 3D4OA 4ASUD 2ZI5A 4Y9DA 5IEBA 4FSDA 4PYMA 4DV6B 1G1MA 5LYJF 3PK0A 2QW8A 3TIGA 2DJIA 4CZ2A 4F4CA 3SSMA 2GD0A 1W5BA 2IYWA 1NBMD 5EXDA 4DLXA 2ILVA 1KY3A 2BTQA 4IR7A 3M83A 3PJFA 3TECE 2BBOA 3CRW1 1G8PA 2ZJ4A 1KGSA 3ESYA 2QRUA 2RMKA 3GJ8A 1H8HA 3E9RA 3KJXA 4J6EA 4X61A 3WISA 4EJ6A 4XARA 5DHQA 4U00A 2JIZA 3KRTA 4O4JA 3ZIDA 2ZYIA 1EE2A 2KE5A 4R8KA 2ZK7A 2YV3A 2AJCA 3VC7A 3PEEA 4ANFA 4LY3A 3BHIA 1M33A 5HIJA 2SBTA 2FF5A 4JJFA 3Q12A 1N0HA 4FGKA 2BDEA 4PLVA 4JOSA 3GFQA 1W76A 4BO7A 4JI6B 4A8TA 4G1UC 4U0KA 3AF2A 3HKDB 1X9IA 5FTMA 1I1QB 1C3LA 1GZHB 3GCZA 4QEZA 4C3UA 2L82A 4GLJA 3NGMA 3P71T 4CWAA 2ZM5A 5HM6A 2WSSA 4G8DA 1CUAA 1RWOA 3EA0A 3ZIUA 2WB4A 1G7RA 4KQEA 4D3YA 2H2FA 1R0XA 1ZUNB 1ZXLA 2CLHB 2QUKA 4L7VA 4EJ0A 3R8FA 3CUKA 3BL8A 2Y1EA 3U61B 1RXUA 4B46A 5SY4A 1L7RA 1BWRA 5GADl 2PWPA 1ZGAA 2F17A 1BE0A 2R7NA 1FYDA 5KQSA 1NNSA 2Q0HA 4UEJA 4DOMA 1MPXA 3H9QA 4TUYB 5IZCA 3K0SA 3VR2D 2QS9A 1HF3A 1TA9A 3KS9A 4K05A 2QVXX 3U1BA 1OKKD 3FVVA 3GELA 1FFXB 3ADOA 1KZ4A 2PZJA 1DBRA 5H9VA 3T7IA 4BLUA 4KREA 4DKJA 2HO4A 4OHXA 4DABA 1GAEO 1E0DA 1EHYA 4MIOA 3IAS1 2ZJ0A 1YIDA 2MIIA 4MYUA 3CGWA 5HF9A 1IEVA 3K1YA 3VR6H 1KJ8A 4ZIRB 5I4KA 4QL3A 4ARSA 4NV0A 2YQ5A 2EV9A 5HTOA 4UM7A 5ADWA 2OV8A 1TRKA 4RTMA 2XR1A 2CE2X 3WK8A 4HEJA 5JBIA 1BOOA 3FDZB 1X7HA 3UCXA 3OY2A 2PKEA 4MB0A 4ZXFA 1SA0A 2ZLBA 4ER5A 2QN3A 4NAUA 3EZ7A 5E3IA 4HAVA 5HJ7A 4OHVA 2O7VA 3GEEA 1XYGA 3IMEA 1K7EB 1ODLA 4YDSA 2E4WA 2C4WA 1S8OA 3KSZO 4MOWA 4ZKEA 3WYDA 4AY5A 4D8TA 3RGWS 5ESDA 1XO1A 2BFBA 2EDCA 1L7DA 1UJ2A 1Y37A 2QZPA 4JELA 4DG5A 1A96A 3DXFA 4MW9A 3KBBA 4Q3EA 4RYDA 1AGRA 1WTAA 1FF9A 1PYGA 1F2UA 3SEZA 3ZZUA 5K7SA 1T9ZA 2ILTA 4JI8B 2C7GA 4PQRA 3BK7A 1RWXA 2B7CA 1AE1A 2AFIA 2X14A 3HA2A 4XAQA 5A05A 3G8CA 5B53A 2FPGA 5L7YA 3ZGLA 4C07A 4XSGA 1R74A 1C0IA 4PBTA 1K75A 1U3WA 4L27A 1XMXA 4YALA 4WI1A 4DNFA 4WKBA 3FH0A 3ZGXA 3FAZA 2EFDB 2QLMA 2ETVA 3ELDA 2Q4DA 1RQXA 3DNFA 2VP6A 4WUVA 3IO3A 5I7WA 4NCBA 2NUPB 3GMDA 4Z9YA 3GMSA 1RHKA 3WBKA 3WK7A 1NY6A 1TLTA 4JZYA 1XEWY 1RCUA 4L72A 2QPAA 4FJ0A 2XE8A 5KNBD 3EMBA 2KHZA 4KRYA 1EESA 2EKZA 1NN5A 1TUEA 4PPQA 3R9IA 2O9JA 3BMNB 1PIWA 3DC7A 5JC8A 5AM2A 2AC4A 2X3UA 5DYWA 2C0CA 4LF7B 3BCUA 4X54A 4NBTA 1XXHE 2P30A 2WJVA 3WMGA 1Y6QA 3K05A 1VJDA 4L3VA 3B1VA 1PJRA 1B43A 2O0LA 4RFVA 4RIIA 3N2KA 1QXSA 4CKZA 4LXIA 4IDDA 5BV2P 4EW1A 5C5EA 1K6MA 1K4MA 4LZOA 4JEUA 2XNJA 2G5GX 2JA2A 5BSGA 1XG5A 1M2HA 4WESA 1CHNA 3INTA 4KYVA 2A84A 1D6SA 1NBOA 3KQHA 3LO5A 1JYEA 3HZRA 1P4AA 1SY7A 1L3CA 2VA8A 2AK3A 4BN5A 1NVVQ 1SULA 2IX9A 4MINA 4FOPA 3KHKA 2X2FA 2XQIA 1NMQA 3MOIA 1SXJB 4JT9A 3PDWA 1U2TA 2DQZA 3PC8A 2ZJ6A 1TFUA 2BEWA 2PBRA 1KI4A 3GJTA 2H1OA 4YJFB 1KAEA 1BHQ1 3VFDA 2FEPA 2NYVA 2Q1YA 4H3KB 3RJZA 2SHKA 1Y9EA 3NR2A 1WZUA 4NP6A 2G1PA 1ZJ6A 4G5SA 2ZRAA 1W25A 2JEOA 3BRSA 1OFTA 3GWGA 3RSHA 2IYAA 4DV1B 3H13A 1O3YA 4BLRA 2QZZA 3C3JA 5HNKA 1GHTA 2YY7A 1B74A 3K4QA 4P58A 4CI0B 4MDYA 4DMHA 1QE3A 1OZAA 1YT5A 2Q6IA 1G9XA 2E9SA 4JSRA 1UQTA 3UK0A 4A15A 2C7OA 2IYFA 4PG8A 3EWIA 5E9JA 4RAQA 5GM1A 1K8YB 2HIGA 4EHHA 2FDCA 1EFVB 1EK0A 1K98A 1U02A 2JGIA 4EA6A 5LU8A 1E96A 3WLJA 4H7IA 1R3UA 1PNQA 2J08A 3RVJA 4WX2B 5FBVB 4LMAA 1UWVA 1C80A 2J6BA 4PX5A 3P1JA 1W34A 1NZDA 2B4TO 4ZI3A 1NULA 2C7VA 4KXXA 1T8YA 3AM5A 1M2NA 3C7KA 4U7DA 3PI6A 3H6KA 3ZCUA 5CX4A 4TLAA 1RWWA 2VOJA 3EHEA 1X7DA 3PXEA 4DREA 2YJTD 4I46A 3SZMA 2X7JA 4OBBA 2PWZA 3K0BA 5DHUA 3H4IA 1BKDR 1HZJA 4GOMD 4CU2A 2OV2A 4RVSA 2IHJA 4KHPB 1J2YA 2JGNA 5ER9A 1X70A 2P2SA 2GASA 3NHMA 5EJ2A 5IC5A 1YBVA 2ZCJA 4KCGA 2WJHA 3PLNA 1CQWA 4KG7A 4NSNA 4UUMA 3H6GA 2GUWA 4QOHA 4U8GA 5ECYA 4YRNA 1UKVY 2OHOA 3I58A 4IAOA 4H3HB 4V1CA 4X84A 1PF7E 3AJRA 5C8YA 3MMXA 2WJAA 5BRAA 2QAGB 2BEKA 5EY5B 1ZK2A 3KX2A 4KLZA 1XC7A 1H6BA 4BEVA 4XCQA 4BE9A 1EAMA 4M1TA 3QKSA 3RAFC 1HBJA 4EHAA 2QAGA 5CB6A 2O6LA 1XL0A 3QOWA 1UBTS 3DDCA 3H9EO 5G1PA 3U9SA 3VR4H 4WCFB 1M1YE 4BVGA 4EBBA 3HSSA 4C7XA 1SVNA 3JZMA 4I9NA 4W8GA 4UTXA 4D97A 5KYWB 1BD4A 1OD6A 5CNIA 4TMXA 3DE3X 3OPYA 1YR2A 3V2UA 4F86A 1HPLA 3EUAA 5JVDF 4ND6A 2UYHA 1MA3A 2QAIA 2C29D 3GY0A 4EEXA 1FJHA 1EGHA 1QRDA 3EMVA 3OE1A 5HIIA 2QP9X 4EJMA 4BOYA 2PX5A 3S1AA 4KGVA 2NV6A 3URMA 1AUXA 3OMLA 3EVEA 1S8AA 3KB2A 1JAYA 3QUQA 3GJQA 3OPVA 5SZKB 3K94A 2HHAA 1CFZA 2H2DA 3E9NA 4O4LB 3D7LA 1JA1A 1XQVA 3AHDA 2I76A 3JQQA 4AY4A 1U99A 2WNIA 1KIAA 3KVYA 4D0RA 2HXGA 3A6FA 2O6HA 3EEBA 5CLQA 4P34A 2CDNA 2JD0A 3UJHA 2YHIA 2CNLA 3DVAA 3JRWA 4C14A 3AFIA 3DMNA 3A6HA 3DAGA 1AHHA 1ZN2A 4ZA2A 1KSFX 4AWAA 3PS9A 3EN0A 5JDIC 3GBSA 1YONA 2QMYA 2YHIB 1XCBA 3HP7A 2WM9B 3L84A 1T3TA 4UM5A 2JLXA 3H5IA 3R7LA 2OFFA 4QTYA 1I0IA 3G5UA 4GKBA 2JEYA 4XPIA 5C7LO 1TVKB 1ZN9A 1QVZA 4KL8S 1LW6E 1P2FA 2WI8A 4EY5A 4GUAA 3TZLA 3TZCA 4MWCA 1WDKA 3SS8A 5IHXA 3IQIX 4KVGA 1VFPA 2O1WA 1DOZA 3EZXA 2HI0A 2AUMA 3URKA 1EH5A 3AUYA 1E5TA 5KWEA 4F21A 5IEJA 2FMXA 1LJUA 3K5WA 4KBYA 4GW3A 4BJHB 4H7EA 2PVSA 3O3OB 2V97A 3IVCA 1U11A 3DT6A 1A76A 1UMDA 4P08A 4R2WA 2X0KA 5B1HA 1BVUA 4ABTA 4GQBA 5DRTA 3FVTA 1JALA 1JFSA 2QRJA 2B1JA 2FEMA 2X5XA 2VCHA 3GJSA 2WTXA 4EABA 3D7SA 2D2IA 3KQSA 4JOBA 3B5EA 4FMBB 5EJ7A 4UE6A 1F1BA 3MTEA 4G5YA 1YA4A 1ZICA 2Q50A 3QQPA 1KPHA 3OPYI 4CGYA 5EC8A 2XUHA 2ZJ1A 1IXSB 2GNOA 2VAWA 2C2GA 4QXAA 5DBGA 5FUXA 3TRHA 5CR9A 3LY8A 2Q4RA 1PZEA 4MGEA 4PANA 4TKVB 5MFZA 3OOHA 1K8XB 4ZOLF 4XD7A 3LWDA 4TRMA 3VA7A 1XTVA 3O1LA 5EL0A 1Q6YA 1XZCA 1EYZA 2O4CA 1C3OA 1FMTA 1S02A 3ESCA 2FTKE 2YVKA 1YVEI 1EXNA 1X1AA 2NT3A 1S96A 4OL9A 3F2IA 4KHZA 1R0LA 3CZ4A 3R24A 4MW1A 4QTZA 2A4MA 2P5SA 2Q3HA 3IA7A 4R9SA 3EDQA 2CT8A 1RI4A 4JC4A 4U3JB 2B34A 2GJ8A 4L5IA 5ULLA 5ADHA 5EFZA 5JBNA 3A1UA 3NVKI 1RZVA 4DYHA 3WLTA 1H2YA 2RJNA 4GECA 1AKMA 4J0GA 1R18A 5EE0A 5FCDA 2H11A 4F06A 2FEKA 5DN6A 3RNOA 5T4HA 1A69A 1TF2A 2DCMA 2H7VA 3QKRA 3DZGA 3ZK8A 3BB3A 3L92A 4IXTA 2I78A 1N2CB 2V7QA 2ZJZA 5KOHB 1CR6A 1JLLB 2WABA 5JSKA 4EA7A 2RH4A 4P4LA 3BJRA 3W1EA 2WDPA 2XVMA 1F51E 2OP1A 2PWAA 3IJEB 4JL6A 3N59A 5AJXA 3OZVA 2FOLA 3LKBA 4ZMSA 3IAEA 1AO0A 1FNNA 3B1JA 2CJWA 1KE1A 3UG7A 2B5VA 3A3YA 3PWSA 1U8YA 5L3QB 1BCSB 2PZAA 3KJQA 1RYBA 3G9QA 4U2DA 3KKZA 3R3SA 3DQQA 4H9GA 4D46A 5KNCA 3COZA 3C3KA 4UULA 4WN3A 2UUCB 4OMUA 5IKEA 2ZWOA 5JNTA 1OBOA 5JMOA 1G19A 1UBMS 4IUCS 4Y1RA 2AVNA 5KVSA 2OM6A 5A4FS 1I7LA 1PTJC 1GTJ1 3PZRA 3IVMA 5DTRA 2AEMA 1L4MA 5J5VA 4YNBA 4QUDA 2A58A 1S89A 2E5WA 4QRHA 1CUGA 1CC1S 3OT1B 4YJ2B 2O06A 3DAFA 2YR0A 3I73A 4HGZA 3SICE 1Z6AA 4TYYA 3M3PA 3SGLA 5BUQA 2A92A 1EMDA 2K2QB 3SR3A 3UKOA 4CMGA 4KLNA 2CBZA 3MJSA 1KDRA 4YAJA 7GPBA 3H2HA 1CY4A 3TAHA 1E89A 2OSBA 3KT6A 5E4JA 5AI8A 3ED1A 3E4DA 3RS5A 4ARCA 1J39A 4LYAA 4TTQA 3TZEA 3T1QA 4HQFA 2MYNA 1TT5A 3EZGA 1G63A 2K87A 3GT7A 3DEIA 2QYTA 3FD8A 3PQ3A 3BWCA 3FWHA 1Q17A 1WXWA 2I2WA 4CCYA 4DIFA 1S3IA 3GDFA 2DCUA 2N42A 1LVUA 2AH5A 3CO0S 3F47A 3PTZA 5FNVB 1LSJA 3CZPA 4XIGS 3NHJA 4TLEA 3RJ9A 1UZLA 3M6AA 1RP1A 2PDAA 3CHYA 4L5YA 3HKBB 3NNSA 3T3OA 1MDBA 1BEZA 4G24A 1UXGA 3AEQA 4R0VA 3E8SA 3KR9A 4PYRA 1PJCA 3LUGA 1NUAA 5MGBA 2F4NA 2VHZA 4FXOA 2X1LA 5TF4A 2HF8A 1EHIA 1AHPA 1EUDA 1KYQA 4MVJA 3AJAA 1A27A 3EC7A 2Q6VA 4RPIA 5E0OA 2W70A 1TYZA 1VDZA 4JKIA 1FEZA 2Z2XA 4MKRA 1P31A 4EPVA 1P3JA 1HTBA 1NNUA 2WVJA 1G8GA 3QW4B 4E33A 1U0HC 3C1OA 5B30A 1TT7A 1U6IA 3D8UA 4ZVNA 5JSYA 3FN4A 4X8HA 2Z4RA 3K9QO 2ZYTX 4CR7A 5KQPA 1A8IA 4K9KA 4RDHA 1KGDA 3IA2A 3RUPA 5B4UA 4BN4A 1VL5A 4AJKA 1PSDA 2BR4A 5IPFA 4CCWA 3LS2A 1L8OA 1XVIA 1T3ZA 2HMUA 3OF5A 2GJ4A 4XWTA 4CKWB 3GFOA 1XZBA 1N2JA 4V02A 1A77A 4B34A 3IUBA 4NJOA 3IIEA 5DT9A 3H05A 4UTPA 2WK1A 2WD8A 3W05A 5ADUS 2IEIA 3ETJA 1KJWA 4DQ0A 4G3XA 3DZDA 3W7VA 2GJAA 1KJYA 4WK6A 1BCRA 2QE6A 3TW0A 4LZLA 4IO1A 4DWOA 2G67A 1DJPA 2X0IA 1UQUA 5IVHA 4C2UA 1R8QA 4GXRA 3VXKA 4JBNA 1N7JA 2J32A 5I01A 3DAOA 3RIYA 2PD4A 3JD2A 3OFKA 1SCIA 3VYUB 2I6TA 3GFGA 1XKXA 4CIYA 4NABA 2GBLC 2XADA 3Q0TA 5KKCA 4TRJA 1TRHA 1XLTC 4P33A 3F7NA 3KZ1E 4URHA 2PL5A 2HEGA 4KUHA 5A6SA 1BJTA 1HYEA 4IL5A 4KGXA 2Q8PA 1ACJA 4UNIA 3SG0A 1L4HA 1Y9AA 4B0PA 3K1AA 4CF5A 2XF2A 5BT9A 2KWIA 5KREA 1PCXA 1H2EA 4UOQA 4D9KA 2VPTA 3GRFA 1M6VB 1CUDA 4RHXA 1RWKA 2ZB3A 3M5DA 1N77A 4LTNA 3HSYA 1WQ4A 5EP3A 1RJDA 3CEAA 4CETA 3KWFA 1Z8HA 2V1XA 4MUBA 1MRZA 2L18A 2DBVO 1ZQ1A 2VWHA 2Z83A 5G1NA 2B5OA 2HRCA 3R3WA 3D7NA 3U7IA 4AJOA 4JLNA 2ZXUA 2B1RA 2Y0EA 4NJEA 2HXSA 3LFTA 1IATA 1BVRA 1R4NB 1S7GA 1YSCA 2X9VA 3AJEA 3INYA 1UAYA 4UNSA 4WOPA 3VRHA 3WGHA 3FXAA 3WDMA 2P65A 4RZXA 3U3OA 1OCEA 2H63A 3TJRA 3LECA 3LCUA 2JRCA 3DH0A 4NCJA 4UCXA 4W5HA 4LRWA 1QTIA 1Y3AA 5A7GA 4AXXA 3VZPA 3ZNOA 3OT5A 5ICMA 2CCJA 2IGBA 4GL4A 5FKJA 3UBTA 4ALNA 4NFSA 4JQZA 3OIVA 1MR3F 3OM0A 5FBLB 3RRBA 1VKHA 1ZBDA 1SPXA 3SJCA 3ZQJA 4X1IA 2P9EA 2YWCA 1HT0A 4RD6A 4B47A 4NXNB 3NDPA 1NN0A 1I7NA 1MJGM 3U9LA 3H9CA 5FEUA 5A71A 1KYTA 2R65A 2W2KA 1QH8A 4B3FX 4O2AB 1GPBA 2VDWB 1JI3A 3Q9UA 4K6KA 5G41A 3QF4A 4PCLA 3MNFA 4DLYA 4PBSA 3EQ6A 4ER7A 1YJXA 1K0UA 1W0KD 1BDJA 4PLGA 4WHMA 4TKUA 1TZJA 4EARA 3L7JA 1G20A 3RAPR 3IR6A 2NO6A 4L8YA 1NSTA 1T4MA 2X86A 2P4SA 3ZE6A 5L7WA 3COPA 3IQXA 1K88A 3LYHA 4MRNA 1Q1QA 3GT4A 3CX7A 3QF7A 1NC1A 4FZ5A 1RLMA 3U4GA 1WUYA 3F0TA 2A9VA 2FZ5A 1JEQB 2DHCA 2DH6A 1QB8A 4H7FA 2AB0A 2WF6A 1SVKA 2GI4A 4M60A 2XB8A 1MABA 4O2AF 4RVFA 4XUEA 5DSZA 3AETB 3K6RA 4UCQA 5FA6A 1VZ2A 3CCCA 2AOVA 1VBMA 2AMYA 3HBMA 3H18A 5CDHA 2OYCA 1PJZA 1C1DA 5T41A 2OMKA 1QS0B 4MV0A 5HDBB 3C48A 4R1NA 3FCCA 4JA0A 4V0NA 1Z7BA 3GZJA 1CB0A 1ZH6A 1L5ZA 1TA0A 4PX2A 4XYGA 5KU1A 3B6MA 4CEIA 1P18A 5FWNA 4JNCA 3SDSA 3VKHA 3OIUA 1Z6PA 4IQFA 3EG9B 4NENA 2IEAA 2VPXA 3AEZA 4HQLA 1TCVA 4PWZA 1XA4A 5JR3A 1T2EA 1QRTA 2A1UB 1RM3A 4ZU1X 4XB1A 4C0AC 4ECEA 4Q02A 3FSGA 1D7OA 1H2XA 4UKDA 4FB5A 3SC6A 2QI9F 5FA8A 2DG2A 2WUWE 2J4CA 1E20A 4FC6A 2XI4A 1GCGA 3AR8A 5ANRB 1SBZA 4W8OA 2P79A 2BFCB 4C0KA 3U3JA 1CK4A 1G5HA 1UQRA 2J6CA 3FFBA 3ORQA 4IGAA 4S24A 1JIQA 1KRHA 1M1YA 4TV9F 4XM1A 3TE6A 3WVNA 3DB1A 2NYAA 2XIQA 2ZBPA 3U49A 3ZU6A 4ZHQB 4BNUA 5GOZA 1Z34A 1JXQA 1OAKA 3TIVA 4BL5A 2R8YA 3WJAA 3HDTA 1SJ9A 3NBUA 5T4EA 3SNKA 1A8HA 5J4KA 1NW5A 1E4VA 2IODA 3GDHA 1E61A 2ECPA 1E1QA 3OE5A 3JVEA 1D4OA 2Y1KA 1P7ZA 3GW8A 2GFQA 3S27A 4R71A 1J5PA 1EVZA 1TM4E 3LBNA 7MDHA 1HYGA 3GVHA 3E0QA 5J1SB 1NI3A 4GXTA 4PC7A 3WK5A 4C3VA 5K4GA 4WNCA 2J85A 4BX2A 4Y2VA 2KLHA 4YJGA 1QYVA 3GJXC 2QA5A 2HEIA 4NHEA 1TJ4A 1IBMB 4EYQA 1B00A 2ZIAA 5JH7F 1NSFA 2OO3A 4BNVA 3RRZA 4DCJA 2HNKA 3RYIA 1YQWA 1C9EA 3MFYA 4COOA 3TCNA 5JC1A 4PM4A 4GDFA 4WERA 4DHEA 2Y3IA 4ZEVA 1PJQA 4REQA 3NHRA 3KEOA 4BNLA 5ALTA 3H9UA 3LFHA 1QBKC 2OQRA 3I3OA 1H4VB 2XUDA 4PZAA 3SHWA 4TTVA 1GG5A 2Z57A 1U3UA 2POQX 3EZ6A 1J33A 3OIDA 4PSVA 1EFDN 1RCTE 1RVV1 1Z5WA 3KZMA 4BNKA 821PA 3II6X 3ZW9A 5GZ1A 6NULA 1OR8A 1FU4A 4PV7A 4UMEA 2ZE8A 4UXIA 5LQRA 3I4LA 1IPHA 1E2MA 4EFMA 2NO9A 1EBFA 2JK1A 4OU5A 4FYHA 4QGHA 1Z6ZA 4ZJUA 3L1JA 2YWBA 3I8SA 3GIWA 1SR8A 1EFAA 3QMMA 1QHXA 2XPCA 4NMMA 4POOA 1WUJS 2C4MA 3G49A 4Q3AA 2BJWA 2WIGA 3SBXA 4TRRA 5C5CA 5DNCA 4YYEA 2PLNA 4DV7B 2RGBA 1FRNA 4KLRA 5KWSA 2ZUUA 1YK0A 2GPNA 3C74A 3DM5A 3MQFA 4HDMA 1PT7A 1Y3FE 5E2IA 3C2QA 2WWVD 1QH0A 1BA3A 2F3QA 4PSUA 4UPDA 2Q29A 4QBKA 2XXJA 3V34A 3BD6A 4DSUA 5KHLB 5TIIA 5GV8A 1OC2A 3REQB 5EJEA 2DM6A 4BO4A 5EIXA 1V45E 2REXB 4ND8B 3WV5A 2VUSA 1EI9A 2YDXA 3KPYA 1MQ8B 1AGPA 3E9ZA 1S2GA 2B1QA 3I9MA 4W5TA 2GYYA 1ND6A 1P8JA 4W6ZA 3FYCA 2VDLB 1GN9A 1JS1X 1T2NA 4DLZA 4JWKA 5ECWA 3IGFA 3V8EA 4XW2A 3GU3A 4BQSA 5JPCA 4HXGA 1QDLB 1DXQA 5I4IA 4CKBA 2WT8A 1V6SA 4D9NA 2B9EA 3IIKA 1GUZA 3HN7A 4RADA 2C61A 4X97A 5KAMA 3ONWA 5KAPA 5DISB 1J00A 2B8EA 5BYBA 2FSFA 3NRJA 2UU9B 4LJLA 2CD9A 1OIWA 2H9IA 1FTQA 2IZ0A 4BO3A 2WLTA 4G86A 1EVQA 1NOJA 3EPHA 2X8JB 5TMEA 3DMRA 1H5NA 4DMFA 1Q50A 2HV9A 2G5CA 5EUQB 1SG9A 4HK4A 5JD6A 2HQSA 3DMDA 2CGEA 3B48A 5FOUA 2DQYA 3DV0B 2HFJA 4I4IA 1B73A 1YKGA 4RF4A 4FYVA 3ZWPA 3ZWWA 4PNZA 1ZX1A 4HAYA 1Y89A 2QB5A 4UHEA 4NZ9A 2IYEA 3AILA 4LBZA 2KYRA 4EB6A 3DHEA 4OKIA 4EI9A 3E7PA 1PWHA 2O8VA 2QV0A 3ILVA 3JSAA 3T5GA 1Y5RA 3E35A 1Z4OA 2XE6A 2O1SA 1NJFA 3MCAA 1LJ8A 2VHVA 2R68A 4XPZA 4NOMA 1SEPA 3DKIA 5D51S 1U1GA 2HT1A 3CA8A 1OTXA 4LXUA 5AI4A 1F4LA 1XEXB 4FVTA 4B5KA 4B8WA 1L4KA 1GA1A 4ESEA 5JADA 1A88A 1GKLA 5LIPA 3GJYA 4CGZA 3VTFA 3A2KA 3LYLA 2I33A 5DLYA 4E0BA 1OI4A 2GHIA 3CN7A 1EGVB 2JAUA 1EFHA 1Z5VA 2IHYA 2PBLA 5EHIA 4LTDA 2XB2A 1ZNWA 3WLHA 2UUAB 1SOVA 2IP4A 5FBQB 2BGRA 3ITDA 2IPMA 3HCNA 3HR4A 1DEHA 3OVMA 2GK3A 3UGJA 4LY6A 3E22A 4OQNA 1N8NA 1RI1A 4RZSA 5LZ9A 3OI7A 3PC7A 4YJHB 1HC7A 1W47A 1E7MA 5CIQA 3RRYA 1BDMA 2CC2A 3FNBA 4UNNA 2NNWB 2F1HA 2ZBQA 2NPFA 1OTHA 1IN4A 2BI7A 3PR1A 1HFWA 2C5SA 1MVOA 1IDOA 1ORTA 2GESA 3WP0A 4EVQA 4EX7A 2UXDB 2A5DA 4KE6A 1NA5A 2RI1A 3GARA 2ZEJA 1CZKA 1KETA 1U1CA 1GA4A 2JNWA 2PKCA 1YCGA 2Z5VA 1D04A 4GOJA 4KIUA 4X9XA 2WWXA 5FD8A 4BC1A 5TPWA 3LW7A 1JKFA 2XZPA 1WRBA 2FB9A 2V96A 5B3LA 1OBFO 4LMBA 3PJDA 4HMPA 3EG5A 1N2GA 2DFTA 1DHTA 3P2EA 5BYKA 1J8VA 1QMGA 1M54A 1JA0A 3HY6A 4DNQA 1ZGHA 4J0HA 4TZKA 3GCGA 4GMXA 4MVXA 1S3SA 3S2UA 1AV7A 1MRSA 2HKIA 3CLTC 5BYJA 4RGYA 3U81A 1JPUA 2IY9A 2M2IA 5LOVA 3TIIA 2PFKA 1KYVA 3CT6A 4Y30A 3UPDA 2QG9A 1SC6A 2AG8A 3W2HA 1RFLA 4N3GA 3SE0A 2G4CA 4MCIA 3NAGA 1KQPA 3IAHA 4G0MA 5AIAA 3FOCA 3KT0A 3W90A 1P39A 1KY4A 5CB4A 1BO6A 1E9FA 2Q07A 2FPLA 1GQOA 4WOBA 2J59A 5C46F 3SC2A 1MD9A 4F93B 1EBUA 3LV8A 3HVKA 4OQDA 4RK6A 3DWGA 5ES4B 3MG9A 4Q12A 4BVFA 1ZRSA 2PV0A 2VP5A 2W2KB 3DHVA 3FJ1A 4DA9A 2GYUA 3PNSA 1J9ZA 1D6JA 1DBPA 1LVGA 2OMEA 3AUFA 1BC5A 1XZGA 5REQB 2O8CA 4HATA 2FPUA 3DOEA 2Z43A 4R3WA 4HDSB 2XNKA 3PC2A 4EENA 3CW9A 2QENA 3M82A 1D2RA 1C9DB 3L8MA 3AXTA 3VPXA 4QUEA 1Y4SA 1KDYA 4GKAA 1PL7A 4UOZA 5JSQA 3UC5A 1FPMA 4G41A 3FTQA 3HG7A 3BGIA 4KDRA 4TMTA 1KI1A 1SG0A 3JQ8A 5JVDA 2HRRA 1FJXA 3A10A 3RKRA 1VFNA 2H7CA 2OP0A 1J2UA 4RA6A 4I5DA 1YIAA 2RHCA 1R5BA 2AX4A 1DQZA 2X3YA 3C3MA 3HJRA 4LA4A 3VTKA 1G6KA 2PY6A 2P1RA 2JG3A 3HXOA 2QBYB 4RZUA 4JB0A 2VYCA 3HKCA 1RWNA 5IVDA 1OH5A 1TB4A 5K05A 4B73A 2R79A 2YOHA 3GJRA 4HJRA 5TEVA 5DYNA 3L79A 1BMFD 1Z0KA 1K5PA 1W4RA 2V55B 3QLUA 4OQEA 5EN4A 3DLTA 5LJIA 5LP6F 1YRAA 3DTNA 3HUEA 1H6DA 4DCVA 2Q4EA 5CFLA 2HA5A 4D0GA 1M67A 1ZSNA 2DULA 3SIWA 3TLCA 3ZWBA 4DT1B 3LAWA 2AMJA 5KWVA 2YWDA 5C7OO 5KBYA 2C07A 2XZOA 1YRLA 3PQFA 3T7KA 3ROGA 4OQQA 4ZTUB 2OV6A 2YS6A 1Z62A 2GBIA 5BW5A 2W37A 5EKTA 3UMMA 3L4EA 3W77A 4YMVA 3DDWA 5ARCA 2F67A 5BNIA 5CXQA 3R5KA 3K2IA 3D1LA 5EWLB 4C7KA 1I1OA 2CBGA 4MHOA 4WESB 5LP6B 4D82A 3MAJA 4FFVA 4LJAA 3WYAA 2GEJA 3NFYA 4BTEA 1TQDA 3HBJA 2MYTA 1Z25A 1UM9A 1VXOA 3I0ZA 3W5HA 5AM4A 3FY4A 5C3UA 4E7PA 1YFLA 2E37A 3P52A 3BZBA 1KBOA 4IGEA 4BUJA 4BLVA 4ROSA 5JASA 1K8RA 1E0AA 4FI3C 1JFFA 4MQ6A 4QYIB 5D2CA 4NZZA 4Q3CA 1DDOA 4D0SA 1ZJYA 3E6AA 4JU9A 3VUFA 3WWYA 4MEBA 1AN9A 1U2GA 2AZDA 4QYXA 1FY2A 2OA0A 3RKUA 2RGRA 1UT6A 4I6EA 4ZRMA 3E3LA 2PS0A 3VH3A 3ZQUA 1P1FA 2YJNA 1MT0A 3HM2A 1MFZA 2DHEA 1Z47A 1IJFA 1R00A 1ZJZA 4F4FA 3SWWA 2C2ZA 1YBAA 3DZFA 3EZ9A 2PX0A 4O4JF 5EJ9A 3U3DA 3RK4A 5EJMA 3RTGA 5G2OA 3TB6A 5JAPA 3KBOA 3MCZA 4QYTA 1A8UA 4QU8A 4RHYA 1DE0A 2YW2A 3H5RA 3TW8B 1NQ5A 3OTGA 2QY6A 1WQ1R 1XPRA 1YL7A 4IJUA 4M86A 4MV7A 4NDNE 1DXHA 4RPGA 1U1IA 3WDKA 3KXPA 3TQHA 3MLAA 3D8SA 4M0PA 2ZUSA 4CLRA 3AM3A 3P4XA 1NPTO 1SXJC 1XN4A 1FP4A 3AHHA 3D6VA 1U8UA 5U1PA 1L4GA 4L8FA 1SCDA 5D5HA 5BMVB 3PNMA 1TM1E 5AW1A 1RBYA 1EDBA 4D4IA 1GU7A 3AU9A 1L4LA 1NM5C 3PXBA 5AWFC 1V8DA 1O96B 2ZJ7A 2ZDGA 3DEJA 3LCRA 4JLPA 1U4SA 4Q3BA 5DLDA 2NQTA 5AKXA 1E32A 2MDTA 3BEOA 1DIRA 1HV8A 2NGRA 4ER3A 3GFFA 5NULA 3C1AA 1E3WB 1R6AA 4LWQA 4Y67A 4ES6A 4YGXB 4D6YA 4HNUA 4GKVA 3E5HA 2L2QA 3FKSA 1E3QA 1F8GA 1WP9A 2HW8A 5EMJA 2GXSA 5A5EA 3ZIAA 2AV6A 5JEDA 2ZATA 3OURA 2IS4A 4PNPA 3JQCA 1FMCA 1L7MA 1SVSA 2F1RA 2O2SA 3KDPA 3U4DA 4N18A 4M0EA 2PXCA 3ZK9A 3QPVA 4ND3A 2C2OA 3FBTA 2EOAA 3M89A 3NHAA 4CYMA 4D99A 3NTLA 4H18A 2WAOA 1UODA 3AR3A 1DTWA 3IULA 5IF9A 2CNWD 3T99A 4FEYA 4EPTA 1ORIA 1RYEA 2BFOA 3ENKA 3T54A 3WJ1A 3K1JA 1TO6A 5A02A 2PGLA 5CDSA 4E88A 1O6GA 3KU1A 4B4WA 4AY2A 2PGOA 2I29A 4LYJA 1WS6A 1WKBA 2F1OA 3G2JA 4WLFA 5HKKA 5JZ9A 1RXYA 1MOSA 2QTCA 1SQ5A 2W7TA 3RC8A 4HQNA 1UKCA 1HDRA 3ZW7A 1QHYA 4AL4A 2JKYA 3AT1A 4MJXA 1KSHA 1R5NA 1FYVA 2G76A 2PU5A 2QLJA 1Q2UA 3ESXA 4E31A 1A04A 5K45A 5K6AC 4PC2A 2XOKA 5J3JA 1UZNA 4I1YA 4DR7B 5F5XA 4P9NA 3TZKA 2VK8A 1N2OA 1I7SB 1UJMA 1G9SA 1CUUA 1XAIA 4HH4A 4P6VF 5B37A 4DMLA 4P3XA 5CH3A 3WXBA 1YRQA 3F6YA 1SCJA 1C2YA 5EPUA 4Y18A 1HURA 1QKIA 1T4BA 4PVCA 2KLBA 4QGAA 3B89A 5ESRA 1A2KC 2GRJA 4NR0A 4DM3A 4AZVA 3R41A 1A9PA 5AXBA 3WRVA 4KQHA 2IJGX 2YHAA 5I4BA 1EEHA 1I1HA 2ZREA 5GAJA 3X2SA 3MINA 3Q3VA 4M1SA 4M0KA 2HSDA 4JLOA 4XPIB 2BGLA 1RTTA 5DOZA 1B42A 4WNIA 1XEXA 5IBQA 4AB1A 4HNRA 2ZSBA 5IM5A 3GVPA 3Q1LA 4HGPA 3VU9A 5I7OA 3HEAA 4KFRA 3I4CA 2ZM6B 2FW7A 4R05A 3WMWA 2WG1A 2PX3A 5HOEA 1JR2A 5IDWA 3Q8KA 3QVOA 2V3CC 2XTMA 1L7PA 4OXRA 4MP3A 3E7FA 2BTQB 3FWKA 1EUZA 2OL4A 2ID9A 3K9LA 1LQUA 4FDLA 5ER6A 1SQ6A 3U44A 4DA7A 2V6GA 3WWOA 1T1EA 2K2WA 3AGPA 4Z0HO 1A1VA 5BN3B 1JLHA 3THOA 1P1CA 2LVBA 4TV8F 4XX1A 3KZNA 1V1RA 3ZX4A 1QDUA 2EIXA 2R4QA 1Z83A 3BFKA 1O5TA 4FDAA 5FAXA 4CDRA 4PWYA 2Q41A 3PC3A 4FW9A 4RGBA 3L6RA 3QXJA 4DLNA 3GEHA 4HPWA 2P7IA 1V2GA 1N5RA 2XHZA 3FGNA 4HB0A 1NBIA 3ZGNA 1FNCA 2OGUA 3GUHA 4UVDA 4D57A 1GZUA 3BT7A 2GETA 1UKYA 3EVZA 3P0RA 4OQMA 5ES3A 1YA8A 3I52A 2J45A 2ZWVA 4BJ1A 2FW1A 1DZ3A 3TLAA 5TS3A 4M7WA 1A5BB 5K0ZA 2FP4B 1F12A 1G5TA 4KJXA 1ZONA 3BIXA 1JH9A 1THZA 3C6MA 4K6OA 3CJRA 3P7MA 3MT9A 4YLEA 1WSDA 3RUHA 1RC0A 3U13A 5JZMA 4NYIR 2QX4A 3JD3A 4C0XA 2N9UA 1GIAA 2XOXA 3D8NA 4GRDA 4FHFA 1LDGA 2VYNA 1ODTC 3DOHA 4HYQA 2CEAA 5JDCC 1TVEA 3MS4A 2E87A 4H4DA 4Y6GB 3SMVA 4GZ6A 5D1NA 4DR1B 4TQUS 2I7VA 2R00C 3D31A 1Q7EA 3V7NA 3EXHB 3MJVA 2UZIR 3ZY2A 3FDXA 1JNYA 4MS4A 1MUUA 5E6UB 3K35A 4UW9A 3I28A 1GLGA 4MYSA 4JGBA 2H3HA 2XH8A 3U7EB 1KBZA 4NH0A 3G82C 3QKRB 4L4SA 2VF2A 1OZHA 3IBCA 2OCAA 4GMKA 4BLQA 1NGSA 1U98A 5LMZA 4DCMA 1ESEA 2BGGA 3PUKA 4MVCA 1QZUA 3RK0A 4R7GA 1SUDA 1DUSA 4RHFA 1QG6A 2WKPA 4NBSA 3F71A 4LHEA 5FL3A 1PQUA 3BIOA 4JEIA 1LI5A 3DOCA 5F1KA 3S1LA 4YP1A 4QDOA 1AKRA 3TSCA 1PI3A 3VYVA 3AI3A 2ODEA 1JW9B 4YC7A 1BXRB 1RRGA 1TEHA 4EF6A 4U39A 1PWEA 3PNBA 3ZE9A 1OOEA 3HBAA 5M04A 3D2LA 3HI4A 1NW6A 4LGMA 3KDAA 3H5NA 3LVQE 4QELA 1WOYA 5K03A 1SFRA 3ACDA 3DP9A 2BF7A 3MGGA 5EQDA 4YO8A 5KYUB 4LF6B 3DXYA 3NMUF 2GBFA 3CSSA 1HZZA 4UHHA 1R4MA 2ZIXB 3OFJA 4D8XA 3M9XA 3T3GA 4D8UA 5FOQA 5CIYA 2EP7A 2JGFA 4YT5A 2BBWA 1MO5A 3CLKA 5P21A 2WWFA 4RF5A 2FSIA 4G65A 4K40A 1JHOA 4B3HA 3L4KA 4G36A 4TS3