2X2ZA

Crystal structure ama1 from toxoplasma gondii
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
411
structure length
407
Chain Sequence
GNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLENSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPHTYPLTSQASWNDWWPLHQSDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNTPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1, PUTATIVE
publication title Structural Characterization of Apical Membrane Antigen 1 (Ama1) from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 101
structure length 407
sequence length 411
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2x2zA03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2x2zA01
1Z40A 2YIOA 1I8NA 5CSQA 2F83A 4Z0DA 3ZLEA 5I25A 2J8LA 5CT3A 3SRJA 2QJ2A 5EODA 5EOKA 3HMTA 3MKPA 2Y8TA 5CT1A 3HMRA 2YILA 2Q8AA 4R1BA 4A5TS 2LL3A 2QJ4A 2YIPA 4APMA 3ZWZA 1GMNA 2J8JA 4R1AA 2LL4M 4Z09A 5CS1A 5CS5A 2Z8WA 4R19A 2Y8SA 4Z0FA 4Z0EA 3HMSA 2X2ZA 4DURA 2Z8VA 1HKYA 2HGFA 4R1CA 4UV6A 1BHTA 1W8KA 1YXEA 4IUAA 5CS3A 2Q8BA 3SRIA 1GMOA 3SP8A 4YIZA 2K13X 4UAOA 5CT2A 2Y8RA 1W81A 3HN4A 5CS9A 5COEA 3ZLDA 1NK1A 1GP9A 5CP9A 4APLA
chains in the Genus database with same CATH superfamily
2CG6A 1I8NA 2JRAA 5I25A 1NWVA 3GOVA 2J8LA 5EODA 2LOJA 3HMTA 1OK1A 2Y8TA 3CALA 5CT1A 3HMRA 4LOSA 4A5TS 2RL0A 1GHQB 1OJYA 1TPMA 2EHFA 4PZ5A 4CSYA 3FGRA 1GMNA 2QJ4A 2LL4M 2YIPA 4Z09A 4AYIA 5CS1A 4BWCA 4ONTD 2QY0A 2Y8SA 4YNXA 4DURA 1FBRA 4UV6A 1BHTA 2RLPA 4K12A 3IU3I 4IUAA 2Q8BA 1U5MA 4B2SA 1GMOA 2YBYA 5CS9A 3KZJA 2XWJI 4MSLA 1H2QP 3EJHA 5CP9A 5FO8C 4ZH1D 2G7IA 1Z40A 4WJG2 2MCZA 3O8EB 3SRJA 2UWNA 2QJ2A 1G4GA 1C1ZA 2RKYA 2RKZA 2XRBA 4R1BA 3INBC 1OK2A 2LL3A 5HZPB 5I0QB 1OJVA 3OEDC 2IZ3A 2ERJA 1RLHA 2O39C 1TPNA 2BZMA 1GPZA 5DN5A 1MD8A 1SS2A 2X2ZA 4LOTA 4KKDA 4PO7A 3WSXA 2A55A 3R62A 2IZ4A 2K13X 1HFHA 4UAOA 3TVJA 3NJAA 5COEA 2W80A 1VVDA 4B2RA 4F4OC 3IX0A 2JGWA 4APLA 3OP8A 5CSQA 1HCCA 1OK3A 3MQLA 4JHSA 2KRIA 2WIIC 3ZD1A 2KL5A 1ELVA 1MD7A 5HYTB 2XQWC 1ZJKA 1CKLA 2Q8AA 2YILA 3RJ3D 2XWBF 4R1AA 1HFIA 5CS5A 2RLQA 5HYUB 4AYEA 4R19A 3FGTA 4A5WB 1QGBA 4Z0EA 1QUBA 2Z8VA 2HGFA 4FXGG 2CG7A 4N7EA 1W8KA 4R1CA 1YXEA 3ERBA 3SRIA 3SP8A 4YIZA 4AYDA 2XRDA 2Y8RA 4IGDA 4DJZA 3F6KA 1LY2A 2ZYCA 1NK1A 1VVCA 3KXVA 2EC3A 4J38B 3SW0X 1H04P 1GP9A 3ZWZA 1Z92B 2CKUA 4YIVA 4APMA 2YIOA 1OK9A 1PPQA 5HYPA 3K3TA 3ZLEA 2F83A 4Z0DA 5CT3A 5DN4A 3WSYA 5EOKA 3MKPA 1O9AA 3ZRZA 3ZD2A 2YRAA 1G4FA 1E5GA 2W81A 2JGXA 4C16A 1TPGA 2J8JA 4MUCA 1H2PP 2MCYA 2Z8WA 2B5ID 4Z0FA 1GKNA 3HMSA 2KMSA 1E88A 3L89M 5JPMG 1HKYA 3NFPI 4AYMA 2I2LA 5CS3A 1SRZA 2V8EA 1UOTP 3T5OA 1E8BA 3VWOA 5CT2A 1W81A 1H03P 1OJWA 3OXUD 1GKGA 3GXEA 3M7PA 3ZLDA 3CI0J 3HN4A 1Q3XA 1QO6A
chains in the Genus database with same CATH topology
1I8NA 5I25A 2J8LA 5EODA 3HMTA 2Y8TA 5CT1A 3HMRA 4A5TS 2QJ4A 2YIPA 4APMA 3FGRA 1GMNA 2LL4M 4Z09A 5CS1A 4BWCA 2Y8SA 4DURA 4UV6A 1BHTA 4IUAA 2Q8BA 1GMOA 5CS9A 4MSLA 5CP9A 1Z40A 3SRJA 2QJ2A 4R1BA 2LL3A 2X2ZA 4PO7A 3WSXA 2K13X 4UAOA 3NJAA 5COEA 4APLA 5CSQA 2KL5A 2YILA 2Q8AA 4R1AA 5CS5A 4R19A 3FGTA 4Z0EA 2Z8VA 2HGFA 4R1CA 4N7EA 1W8KA 1YXEA 3SRIA 3SP8A 4YIZA 2Y8RA 3F6KA 1NK1A 1GP9A 3ZWZA 4YIVA 2YIOA 2F83A 4Z0DA 3ZLEA 5CT3A 3WSYA 5EOKA 3MKPA 2J8JA 2Z8WA 4Z0FA 3HMSA 1HKYA 2I2LA 5CS3A 5CT2A 1W81A 3HN4A 3ZLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z40 A;  2YIO A;  1I8N A;  5CSQ A;  2F83 A;  4Z0D A;  3ZLE A;  5I25 A;  2J8L A;  5CT3 A;  3SRJ A;  2QJ2 A;  5EOD A;  5EOK A;  3HMT A;  3MKP A;  2Y8T A;  5CT1 A;  3HMR A;  2YIL A;  2Q8A A;  4R1B A;  4A5T S;  2LL3 A;  2QJ4 A;  2YIP A;  4APM A;  3ZWZ A;  1GMN A;  2J8J A;  4R1A A;  2LL4 M;  4Z09 A;  5CS1 A;  5CS5 A;  2Z8W A;  4R19 A;  2Y8S A;  4Z0F A;  4Z0E A;  3HMS A;  2X2Z A;  4DUR A;  2Z8V A;  1HKY A;  2HGF A;  4R1C A;  4UV6 A;  1BHT A;  1W8K A;  1YXE A;  4IUA A;  5CS3 A;  2Q8B A;  3SRI A;  1GMO A;  3SP8 A;  4YIZ A;  2K13 X;  4UAO A;  5CT2 A;  2Y8R A;  1W81 A;  3HN4 A;  5CS9 A;  5COE A;  3ZLD A;  1NK1 A;  1GP9 A;  5CP9 A;  4APL A; 
#chains in the Genus database with same CATH topology
 2CG6 A;  1I8N A;  2JRA A;  5I25 A;  1NWV A;  3GOV A;  2J8L A;  5EOD A;  2LOJ A;  3HMT A;  1OK1 A;  2Y8T A;  3CAL A;  5CT1 A;  3HMR A;  4LOS A;  4A5T S;  2RL0 A;  1GHQ B;  1OJY A;  1TPM A;  2EHF A;  4PZ5 A;  4CSY A;  3FGR A;  1GMN A;  2QJ4 A;  2LL4 M;  2YIP A;  4Z09 A;  4AYI A;  5CS1 A;  4BWC A;  4ONT D;  2QY0 A;  2Y8S A;  4YNX A;  4DUR A;  1FBR A;  4UV6 A;  1BHT A;  2RLP A;  4K12 A;  3IU3 I;  4IUA A;  2Q8B A;  1U5M A;  4B2S A;  1GMO A;  2YBY A;  5CS9 A;  3KZJ A;  2XWJ I;  4MSL A;  1H2Q P;  3EJH A;  5CP9 A;  5FO8 C;  4ZH1 D;  2G7I A;  1Z40 A;  4WJG 2;  2MCZ A;  3O8E B;  3SRJ A;  2UWN A;  2QJ2 A;  1G4G A;  1C1Z A;  2RKY A;  2RKZ A;  2XRB A;  4R1B A;  3INB C;  1OK2 A;  2LL3 A;  5HZP B;  5I0Q B;  1OJV A;  3OED C;  2IZ3 A;  2ERJ A;  1RLH A;  2O39 C;  1TPN A;  2BZM A;  1GPZ A;  5DN5 A;  1MD8 A;  1SS2 A;  2X2Z A;  4LOT A;  4KKD A;  4PO7 A;  3WSX A;  2A55 A;  3R62 A;  2IZ4 A;  2K13 X;  1HFH A;  4UAO A;  3TVJ A;  3NJA A;  5COE A;  2W80 A;  1VVD A;  4B2R A;  4F4O C;  3IX0 A;  2JGW A;  4APL A;  3OP8 A;  5CSQ A;  1HCC A;  1OK3 A;  3MQL A;  4JHS A;  2KRI A;  2WII C;  3ZD1 A;  2KL5 A;  1ELV A;  1MD7 A;  5HYT B;  2XQW C;  1ZJK A;  1CKL A;  2Q8A A;  2YIL A;  3RJ3 D;  2XWB F;  4R1A A;  1HFI A;  5CS5 A;  2RLQ A;  5HYU B;  4AYE A;  4R19 A;  3FGT A;  4A5W B;  1QGB A;  4Z0E A;  1QUB A;  2Z8V A;  2HGF A;  4FXG G;  2CG7 A;  4N7E A;  1W8K A;  4R1C A;  1YXE A;  3ERB A;  3SRI A;  3SP8 A;  4YIZ A;  4AYD A;  2XRD A;  2Y8R A;  4IGD A;  4DJZ A;  3F6K A;  1LY2 A;  2ZYC A;  1NK1 A;  1VVC A;  3KXV A;  2EC3 A;  4J38 B;  3SW0 X;  1H04 P;  1GP9 A;  3ZWZ A;  1Z92 B;  2CKU A;  4YIV A;  4APM A;  2YIO A;  1OK9 A;  1PPQ A;  5HYP A;  3K3T A;  3ZLE A;  2F83 A;  4Z0D A;  5CT3 A;  5DN4 A;  3WSY A;  5EOK A;  3MKP A;  1O9A A;  3ZRZ A;  3ZD2 A;  2YRA A;  1G4F A;  1E5G A;  2W81 A;  2JGX A;  4C16 A;  1TPG A;  2J8J A;  4MUC A;  1H2P P;  2MCY A;  2Z8W A;  2B5I D;  4Z0F A;  1GKN A;  3HMS A;  2KMS A;  1E88 A;  3L89 M;  5JPM G;  1HKY A;  3NFP I;  4AYM A;  2I2L A;  5CS3 A;  1SRZ A;  2V8E A;  1UOT P;  3T5O A;  1E8B A;  3VWO A;  5CT2 A;  1W81 A;  1H03 P;  1OJW A;  3OXU D;  1GKG A;  3GXE A;  3M7P A;  3ZLD A;  3CI0 J;  3HN4 A;  1Q3X A;  1QO6 A; 
#chains in the Genus database with same CATH homology
 1I8N A;  5I25 A;  2J8L A;  5EOD A;  3HMT A;  2Y8T A;  5CT1 A;  3HMR A;  4A5T S;  2QJ4 A;  2YIP A;  4APM A;  3FGR A;  1GMN A;  2LL4 M;  4Z09 A;  5CS1 A;  4BWC A;  2Y8S A;  4DUR A;  4UV6 A;  1BHT A;  4IUA A;  2Q8B A;  1GMO A;  5CS9 A;  4MSL A;  5CP9 A;  1Z40 A;  3SRJ A;  2QJ2 A;  4R1B A;  2LL3 A;  2X2Z A;  4PO7 A;  3WSX A;  2K13 X;  4UAO A;  3NJA A;  5COE A;  4APL A;  5CSQ A;  2KL5 A;  2YIL A;  2Q8A A;  4R1A A;  5CS5 A;  4R19 A;  3FGT A;  4Z0E A;  2Z8V A;  2HGF A;  4R1C A;  4N7E A;  1W8K A;  1YXE A;  3SRI A;  3SP8 A;  4YIZ A;  2Y8R A;  3F6K A;  1NK1 A;  1GP9 A;  3ZWZ A;  4YIV A;  2YIO A;  2F83 A;  4Z0D A;  3ZLE A;  5CT3 A;  3WSY A;  5EOK A;  3MKP A;  2J8J A;  2Z8W A;  4Z0F A;  3HMS A;  1HKY A;  2I2L A;  5CS3 A;  5CT2 A;  1W81 A;  3HN4 A;  3ZLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...