2X2ZA

Crystal structure ama1 from toxoplasma gondii
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
411
structure length
407
Chain Sequence
GNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLENSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPHTYPLTSQASWNDWWPLHQSDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNTPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1, PUTATIVE
publication title Structural Characterization of Apical Membrane Antigen 1 (Ama1) from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 101
structure length 407
sequence length 411
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2x2zA03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2x2zA01
3HMTA 1NK1A 5EODA 5CT2A 1GP9A 4A5TS 1W8KA 3SRJA 2LL4M 1GMNA 2Y8SA 4R19A 1Z40A 4UV6A 1I8NA 1W81A 5CP9A 5CS1A 3HN4A 2YILA 2Z8VA 3HMSA 4Z0DA 3ZLDA 2J8JA 3SRIA 5COEA 5CSQA 4APMA 4Z09A 4YIZA 2QJ2A 2Q8AA 2YIOA 2X2ZA 1GMOA 3ZLEA 2QJ4A 2YIPA 4UAOA 5CS9A 5CS5A 5CT3A 5EOKA 1YXEA 4IUAA 5CS3A 3SP8A 4DURA 3MKPA 2Z8WA 4R1AA 4R1BA 2K13X 3ZWZA 4R1CA 2F83A 2J8LA 2Y8RA 1BHTA 2Q8BA 5I25A 1HKYA 4APLA 2HGFA 4Z0FA 2Y8TA 5CT1A 2LL3A 4Z0EA 3HMRA
chains in the Genus database with same CATH superfamily
1GPZA 1NK1A 2JRAA 3ZRZA 2XWBF 1GP9A 2CG7A 1W8KA 2JGWA 1LY2A 1Z92B 4MUCA 4CSYA 4PO7A 5HYPA 1GMNA 5CS1A 4LOTA 1H2QP 2QY0A 2RLPA 4F4OC 2YILA 2BZMA 1VVDA 1OK1A 1TPMA 4YIZA 2Q8AA 2X2ZA 1C1ZA 1PPQA 1YXEA 5HYUB 4DURA 1GHQB 3CI0J 2CKUA 1ZJKA 3M7PA 1OJVA 2EC3A 2YBYA 2Q8BA 1HFHA 4K12A 2Y8TA 1TPNA 4B2SA 2LL3A 4ONTD 2O39C 1OJWA 1MD8A 3HMTA 5EODA 5HZPB 2CG6A 1H2PP 4A5TS 1QUBA 4ZH1D 3GOVA 3OEDC 5DN4A 2RLQA 1HCCA 1O9AA 4R19A 3T5OA 1Z40A 4N7EA 3OP8A 2XRBA 1OK2A 1UOTP 4DJZA 2J8JA 3EJHA 2IZ4A 5CSQA 2A55A 4Z09A 1NWVA 3IU3I 4UAOA 3FGTA 2QJ2A 5CS9A 2QJ4A 4LOSA 1TPGA 3WSXA 3MQLA 4AYEA 1OJYA 3KXVA 1QGBA 2YIPA 5EOKA 4IUAA 5CS3A 2LOJA 3SP8A 3MKPA 3F6KA 1QO6A 4R1AA 4AYDA 4AYIA 2Y8RA 1OK3A 1GKGA 2V8EA 4MSLA 3HMRA 5CT2A 3IX0A 1RLHA 1OK9A 1ELVA 5JPMG 2WIIC 1MD7A 3TVJA 2MCYA 3SRJA 1E8BA 2W81A 3INBC 1I8NA 1H03P 1HFIA 1W81A 2YRAA 5CP9A 1SS2A 3O8EB 2Z8VA 3ZLDA 4YIVA 3SRIA 1U5MA 2YIOA 2KRIA 1GMOA 2G7IA 3OXUD 4KKDA 5CS5A 5I0QB 2EHFA 3ZD2A 4R1BA 2W80A 3ZD1A 2KMSA 2ZYCA 3NJAA 4J38B 2RL0A 2J8LA 1HKYA 4APLA 3R62A 1GKNA 2HGFA 1E5GA 1H04P 4Z0FA 1Q3XA 2B5ID 1SRZA 5HYTB 3K3TA 2JGXA 2RKYA 2ERJA 2XRDA 2LL4M 3NFPI 2MCZA 5FO8C 2Y8SA 3GXEA 4UV6A 1G4GA 3HN4A 1VVCA 3HMSA 3FGRA 1E88A 4Z0DA 4WJG2 5COEA 2XQWC 3CALA 4APMA 2RKZA 5DN5A 3ZLEA 4C16A 4AYMA 3RJ3D 5CT3A 3KZJA 4FXGG 2XWJI 3L89M 2Z8WA 2K13X 2UWNA 4A5WB 4R1CA 2F83A 4PZ5A 2KL5A 3SW0X 1BHTA 5I25A 4B2RA 3VWOA 1FBRA 2I2LA 4YNXA 4BWCA 1G4FA 1CKLA 3ERBA 4IGDA 3WSYA 5CT1A 3ZWZA 4Z0EA 2IZ3A 4JHSA
chains in the Genus database with same CATH topology
1NK1A 1GP9A 1W8KA 4PO7A 1GMNA 5CS1A 2YILA 4YIZA 2Q8AA 2X2ZA 4DURA 1YXEA 2Q8BA 2Y8TA 2LL3A 3HMTA 5EODA 4A5TS 4R19A 1Z40A 4N7EA 2J8JA 5CSQA 4Z09A 4UAOA 5CS9A 3FGTA 2QJ2A 2QJ4A 2YIPA 3WSXA 3SP8A 5EOKA 4IUAA 5CS3A 3MKPA 3F6KA 4R1AA 2Y8RA 4MSLA 5CT2A 3HMRA 3SRJA 1I8NA 1W81A 5CP9A 2Z8VA 3ZLDA 4YIVA 3SRIA 2YIOA 1GMOA 5CS5A 4R1BA 3NJAA 2J8LA 1HKYA 4APLA 2HGFA 4Z0FA 2LL4M 2Y8SA 4UV6A 3HN4A 3HMSA 3FGRA 4Z0DA 5COEA 4APMA 3ZLEA 5CT3A 2Z8WA 2K13X 4R1CA 2F83A 2KL5A 1BHTA 5I25A 2I2LA 4BWCA 3WSYA 5CT1A 3ZWZA 4Z0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMT A;  1NK1 A;  5EOD A;  5CT2 A;  1GP9 A;  4A5T S;  1W8K A;  3SRJ A;  2LL4 M;  1GMN A;  2Y8S A;  4R19 A;  1Z40 A;  4UV6 A;  1I8N A;  1W81 A;  5CP9 A;  5CS1 A;  3HN4 A;  2YIL A;  2Z8V A;  3HMS A;  4Z0D A;  3ZLD A;  2J8J A;  3SRI A;  5COE A;  5CSQ A;  4APM A;  4Z09 A;  4YIZ A;  2QJ2 A;  2Q8A A;  2YIO A;  2X2Z A;  1GMO A;  3ZLE A;  2QJ4 A;  2YIP A;  4UAO A;  5CS9 A;  5CS5 A;  5CT3 A;  5EOK A;  1YXE A;  4IUA A;  5CS3 A;  3SP8 A;  4DUR A;  3MKP A;  2Z8W A;  4R1A A;  4R1B A;  2K13 X;  3ZWZ A;  4R1C A;  2F83 A;  2J8L A;  2Y8R A;  1BHT A;  2Q8B A;  5I25 A;  1HKY A;  4APL A;  2HGF A;  4Z0F A;  2Y8T A;  5CT1 A;  2LL3 A;  4Z0E A;  3HMR A; 
#chains in the Genus database with same CATH topology
 1GPZ A;  1NK1 A;  2JRA A;  3ZRZ A;  2XWB F;  1GP9 A;  2CG7 A;  1W8K A;  2JGW A;  1LY2 A;  1Z92 B;  4MUC A;  4CSY A;  4PO7 A;  5HYP A;  1GMN A;  5CS1 A;  4LOT A;  1H2Q P;  2QY0 A;  2RLP A;  4F4O C;  2YIL A;  2BZM A;  1VVD A;  1OK1 A;  1TPM A;  4YIZ A;  2Q8A A;  2X2Z A;  1C1Z A;  1PPQ A;  1YXE A;  5HYU B;  4DUR A;  1GHQ B;  3CI0 J;  2CKU A;  1ZJK A;  3M7P A;  1OJV A;  2EC3 A;  2YBY A;  2Q8B A;  1HFH A;  4K12 A;  2Y8T A;  1TPN A;  4B2S A;  2LL3 A;  4ONT D;  2O39 C;  1OJW A;  1MD8 A;  3HMT A;  5EOD A;  5HZP B;  2CG6 A;  1H2P P;  4A5T S;  1QUB A;  4ZH1 D;  3GOV A;  3OED C;  5DN4 A;  2RLQ A;  1HCC A;  1O9A A;  4R19 A;  3T5O A;  1Z40 A;  4N7E A;  3OP8 A;  2XRB A;  1OK2 A;  1UOT P;  4DJZ A;  2J8J A;  3EJH A;  2IZ4 A;  5CSQ A;  2A55 A;  4Z09 A;  1NWV A;  3IU3 I;  4UAO A;  3FGT A;  2QJ2 A;  5CS9 A;  2QJ4 A;  4LOS A;  1TPG A;  3WSX A;  3MQL A;  4AYE A;  1OJY A;  3KXV A;  1QGB A;  2YIP A;  5EOK A;  4IUA A;  5CS3 A;  2LOJ A;  3SP8 A;  3MKP A;  3F6K A;  1QO6 A;  4R1A A;  4AYD A;  4AYI A;  2Y8R A;  1OK3 A;  1GKG A;  2V8E A;  4MSL A;  3HMR A;  5CT2 A;  3IX0 A;  1RLH A;  1OK9 A;  1ELV A;  5JPM G;  2WII C;  1MD7 A;  3TVJ A;  2MCY A;  3SRJ A;  1E8B A;  2W81 A;  3INB C;  1I8N A;  1H03 P;  1HFI A;  1W81 A;  2YRA A;  5CP9 A;  1SS2 A;  3O8E B;  2Z8V A;  3ZLD A;  4YIV A;  3SRI A;  1U5M A;  2YIO A;  2KRI A;  1GMO A;  2G7I A;  3OXU D;  4KKD A;  5CS5 A;  5I0Q B;  2EHF A;  3ZD2 A;  4R1B A;  2W80 A;  3ZD1 A;  2KMS A;  2ZYC A;  3NJA A;  4J38 B;  2RL0 A;  2J8L A;  1HKY A;  4APL A;  3R62 A;  1GKN A;  2HGF A;  1E5G A;  1H04 P;  4Z0F A;  1Q3X A;  2B5I D;  1SRZ A;  5HYT B;  3K3T A;  2JGX A;  2RKY A;  2ERJ A;  2XRD A;  2LL4 M;  3NFP I;  2MCZ A;  5FO8 C;  2Y8S A;  3GXE A;  4UV6 A;  1G4G A;  3HN4 A;  1VVC A;  3HMS A;  3FGR A;  1E88 A;  4Z0D A;  4WJG 2;  5COE A;  2XQW C;  3CAL A;  4APM A;  2RKZ A;  5DN5 A;  3ZLE A;  4C16 A;  4AYM A;  3RJ3 D;  5CT3 A;  3KZJ A;  4FXG G;  2XWJ I;  3L89 M;  2Z8W A;  2K13 X;  2UWN A;  4A5W B;  4R1C A;  2F83 A;  4PZ5 A;  2KL5 A;  3SW0 X;  1BHT A;  5I25 A;  4B2R A;  3VWO A;  1FBR A;  2I2L A;  4YNX A;  4BWC A;  1G4F A;  1CKL A;  3ERB A;  4IGD A;  3WSY A;  5CT1 A;  3ZWZ A;  4Z0E A;  2IZ3 A;  4JHS A; 
#chains in the Genus database with same CATH homology
 1NK1 A;  1GP9 A;  1W8K A;  4PO7 A;  1GMN A;  5CS1 A;  2YIL A;  4YIZ A;  2Q8A A;  2X2Z A;  4DUR A;  1YXE A;  2Q8B A;  2Y8T A;  2LL3 A;  3HMT A;  5EOD A;  4A5T S;  4R19 A;  1Z40 A;  4N7E A;  2J8J A;  5CSQ A;  4Z09 A;  4UAO A;  5CS9 A;  3FGT A;  2QJ2 A;  2QJ4 A;  2YIP A;  3WSX A;  3SP8 A;  5EOK A;  4IUA A;  5CS3 A;  3MKP A;  3F6K A;  4R1A A;  2Y8R A;  4MSL A;  5CT2 A;  3HMR A;  3SRJ A;  1I8N A;  1W81 A;  5CP9 A;  2Z8V A;  3ZLD A;  4YIV A;  3SRI A;  2YIO A;  1GMO A;  5CS5 A;  4R1B A;  3NJA A;  2J8L A;  1HKY A;  4APL A;  2HGF A;  4Z0F A;  2LL4 M;  2Y8S A;  4UV6 A;  3HN4 A;  3HMS A;  3FGR A;  4Z0D A;  5COE A;  4APM A;  3ZLE A;  5CT3 A;  2Z8W A;  2K13 X;  4R1C A;  2F83 A;  2KL5 A;  1BHT A;  5I25 A;  2I2L A;  4BWC A;  3WSY A;  5CT1 A;  3ZWZ A;  4Z0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...