2X2ZA

Crystal structure ama1 from toxoplasma gondii
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
411
structure length
407
Chain Sequence
b'GNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLENSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPHTYPLTSQASWNDWWPLHQSDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNTPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1, PUTATIVE
publication title Structural Characterization of Apical Membrane Antigen 1 (Ama1) from Toxoplasma Gondii.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 101
structure length 407
sequence length 411
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2010-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2x2zA03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2x2zA01
5CP9A 4R1BA 1GMOA 2Z8WA 1NK1A 1W8KA 2YIOA 5CT2A 2F83A 2Q8AA 5CS9A 3MKPA 4Z09A 3SP8A 2QJ4A 5CT1A 5I25A 2Q8BA 1HKYA 5CT3A 2YIPA 2HGFA 2Y8RA 3SRIA 4YIZA 1I8NA 4A5TS 3ZLDA 2LL3A 3HMTA 3ZWZA 2QJ2A 4APMA 3HMRA 1Z40A 3HMSA 5COEA 2J8JA 5CS5A 4Z0FA 2Y8SA 4DURA 5CS3A 3ZLEA 4APLA 4IUAA 4R19A 2K13X 1BHTA 4UV6A 5EODA 4Z0DA 2X2ZA 2J8LA 1YXEA 1GP9A 2YILA 5EOKA 5CSQA 2Y8TA 2Z8VA 4Z0EA 2LL4M 4R1AA 4R1CA 3HN4A 1W81A 5CS1A 3SRJA 4UAOA 1GMNA
chains in the Genus database with same CATH superfamily
3WSYA 5CP9A 1W8KA 1HCCA 2KRIA 3NFPI 2Q8AA 3MKPA 2V8EA 3SP8A 5CT1A 3CI0J 3IU3I 1MD7A 1G4FA 2QY0A 4ONTD 3OP8A 1FBRA 2XRBA 2I2LA 4JHSA 3SRIA 2CKUA 2WIIC 2XWJI 3F6KA 4YIZA 4A5TS 4B2RA 4YIVA 1H2QP 3HMTA 2EC3A 1Z40A 3NJAA 1GHQB 1G4GA 1TPNA 2BZMA 2JGWA 4KKDA 4APLA 4PO7A 5EODA 2UWNA 2K13X 1MD8A 2J8LA 2MCZA 3TVJA 1GP9A 1YXEA 2YILA 1OK3A 3M7PA 2MCYA 3MQLA 1VVDA 2KMSA 1TPGA 4R1CA 1W81A 3SRJA 1SRZA 1SS2A 1GKGA 4B2SA 1C1ZA 5CS9A 4Z0FA 3ZRZA 4BWCA 1GMOA 2Z8WA 1NK1A 4Z09A 2F83A 2JRAA 3R62A 1HFHA 3ZD1A 1HKYA 2O39C 5HYTB 3L89M 1I8NA 1GPZA 2RLPA 5HZPB 3ZLDA 2A55A 3ZWZA 2QJ2A 5DN5A 2Y8SA 2EHFA 5CS3A 3ERBA 4IUAA 5HYUB 4R19A 2LOJA 2XRDA 1VVCA 1H2PP 1HFIA 3OEDC 3RJ3D 3KZJA 5HYPA 1Z92B 2Y8TA 1LY2A 4R1AA 2JGXA 2RKZA 3FGTA 2RL0A 1U5MA 5CS1A 3O8EB 4UAOA 1OK9A 1OJWA 5DN4A 1GMNA 3GXEA 3SW0X 1GKNA 1QGBA 1ELVA 4LOTA 2YIOA 5I25A 1H03P 1Q3XA 2YIPA 5FO8C 1ZJKA 2HGFA 1E88A 1QUBA 2XQWC 4DJZA 4FXGG 5JPMG 2W81A 1UOTP 2ZYCA 2CG6A 2IZ4A 1RLHA 2ERJA 5I0QB 3T5OA 2G7IA 4DURA 1OJYA 3ZD2A 4IGDA 3CALA 1BHTA 2RKYA 2KL5A 4Z0DA 4AYDA 4CSYA 2YRAA 5CSQA 4AYMA 4Z0EA 3KXVA 2Z8VA 4MUCA 1OJVA 3WSXA 3OXUD 2W80A 3VWOA 3EJHA 1OK2A 1NWVA 2Q8BA 4AYEA 3GOVA 4R1BA 1TPMA 4WJG2 5CT2A 4N7EA 2QJ4A 4A5WB 4AYIA 2YBYA 1OK1A 5CT3A 4J38B 4ZH1D 4F4OC 2Y8RA 3IX0A 1CKLA 3FGRA 3INBC 2LL3A 1QO6A 4APMA 3HMRA 1O9AA 3HMSA 5COEA 2J8JA 5CS5A 2CG7A 1H04P 4PZ5A 2XWBF 3ZLEA 4YNXA 4C16A 2RLQA 4UV6A 2X2ZA 5EOKA 1E8BA 2IZ3A 3K3TA 4MSLA 1E5GA 2LL4M 3HN4A 1PPQA 2B5ID 4LOSA 4K12A
chains in the Genus database with same CATH topology
3WSYA 5CP9A 1W8KA 3SP8A 2Q8AA 3MKPA 5CT1A 2I2LA 3SRIA 4YIZA 3F6KA 4A5TS 4YIVA 3HMTA 1Z40A 3NJAA 4APLA 4PO7A 5EODA 2K13X 2J8LA 1YXEA 1GP9A 2YILA 4R1CA 1W81A 3SRJA 5CS9A 4Z0FA 1GMOA 4BWCA 2Z8WA 1NK1A 4Z09A 2F83A 1HKYA 1I8NA 3ZLDA 3ZWZA 2QJ2A 2Y8SA 5CS3A 4IUAA 4R19A 2Y8TA 4R1AA 3FGTA 5CS1A 4UAOA 1GMNA 2YIOA 5I25A 2YIPA 2HGFA 4DURA 1BHTA 2KL5A 4Z0DA 5CSQA 4Z0EA 2Z8VA 3WSXA 2Q8BA 4R1BA 5CT2A 4N7EA 2QJ4A 5CT3A 2Y8RA 3FGRA 2LL3A 4APMA 3HMRA 3HMSA 5COEA 2J8JA 5CS5A 3ZLEA 4UV6A 2X2ZA 5EOKA 4MSLA 2LL4M 3HN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP9 A;  4R1B A;  1GMO A;  2Z8W A;  1NK1 A;  1W8K A;  2YIO A;  5CT2 A;  2F83 A;  2Q8A A;  5CS9 A;  3MKP A;  4Z09 A;  3SP8 A;  2QJ4 A;  5CT1 A;  5I25 A;  2Q8B A;  1HKY A;  5CT3 A;  2YIP A;  2HGF A;  2Y8R A;  3SRI A;  4YIZ A;  1I8N A;  4A5T S;  3ZLD A;  2LL3 A;  3HMT A;  3ZWZ A;  2QJ2 A;  4APM A;  3HMR A;  1Z40 A;  3HMS A;  5COE A;  2J8J A;  5CS5 A;  4Z0F A;  2Y8S A;  4DUR A;  5CS3 A;  3ZLE A;  4APL A;  4IUA A;  4R19 A;  2K13 X;  1BHT A;  4UV6 A;  5EOD A;  4Z0D A;  2X2Z A;  2J8L A;  1YXE A;  1GP9 A;  2YIL A;  5EOK A;  5CSQ A;  2Y8T A;  2Z8V A;  4Z0E A;  2LL4 M;  4R1A A;  4R1C A;  3HN4 A;  1W81 A;  5CS1 A;  3SRJ A;  4UAO A;  1GMN A; 
#chains in the Genus database with same CATH topology
 3WSY A;  5CP9 A;  1W8K A;  1HCC A;  2KRI A;  3NFP I;  2Q8A A;  3MKP A;  2V8E A;  3SP8 A;  5CT1 A;  3CI0 J;  3IU3 I;  1MD7 A;  1G4F A;  2QY0 A;  4ONT D;  3OP8 A;  1FBR A;  2XRB A;  2I2L A;  4JHS A;  3SRI A;  2CKU A;  2WII C;  2XWJ I;  3F6K A;  4YIZ A;  4A5T S;  4B2R A;  4YIV A;  1H2Q P;  3HMT A;  2EC3 A;  1Z40 A;  3NJA A;  1GHQ B;  1G4G A;  1TPN A;  2BZM A;  2JGW A;  4KKD A;  4APL A;  4PO7 A;  5EOD A;  2UWN A;  2K13 X;  1MD8 A;  2J8L A;  2MCZ A;  3TVJ A;  1GP9 A;  1YXE A;  2YIL A;  1OK3 A;  3M7P A;  2MCY A;  3MQL A;  1VVD A;  2KMS A;  1TPG A;  4R1C A;  1W81 A;  3SRJ A;  1SRZ A;  1SS2 A;  1GKG A;  4B2S A;  1C1Z A;  5CS9 A;  4Z0F A;  3ZRZ A;  4BWC A;  1GMO A;  2Z8W A;  1NK1 A;  4Z09 A;  2F83 A;  2JRA A;  3R62 A;  1HFH A;  3ZD1 A;  1HKY A;  2O39 C;  5HYT B;  3L89 M;  1I8N A;  1GPZ A;  2RLP A;  5HZP B;  3ZLD A;  2A55 A;  3ZWZ A;  2QJ2 A;  5DN5 A;  2Y8S A;  2EHF A;  5CS3 A;  3ERB A;  4IUA A;  5HYU B;  4R19 A;  2LOJ A;  2XRD A;  1VVC A;  1H2P P;  1HFI A;  3OED C;  3RJ3 D;  3KZJ A;  5HYP A;  1Z92 B;  2Y8T A;  1LY2 A;  4R1A A;  2JGX A;  2RKZ A;  3FGT A;  2RL0 A;  1U5M A;  5CS1 A;  3O8E B;  4UAO A;  1OK9 A;  1OJW A;  5DN4 A;  1GMN A;  3GXE A;  3SW0 X;  1GKN A;  1QGB A;  1ELV A;  4LOT A;  2YIO A;  5I25 A;  1H03 P;  1Q3X A;  2YIP A;  5FO8 C;  1ZJK A;  2HGF A;  1E88 A;  1QUB A;  2XQW C;  4DJZ A;  4FXG G;  5JPM G;  2W81 A;  1UOT P;  2ZYC A;  2CG6 A;  2IZ4 A;  1RLH A;  2ERJ A;  5I0Q B;  3T5O A;  2G7I A;  4DUR A;  1OJY A;  3ZD2 A;  4IGD A;  3CAL A;  1BHT A;  2RKY A;  2KL5 A;  4Z0D A;  4AYD A;  4CSY A;  2YRA A;  5CSQ A;  4AYM A;  4Z0E A;  3KXV A;  2Z8V A;  4MUC A;  1OJV A;  3WSX A;  3OXU D;  2W80 A;  3VWO A;  3EJH A;  1OK2 A;  1NWV A;  2Q8B A;  4AYE A;  3GOV A;  4R1B A;  1TPM A;  4WJG 2;  5CT2 A;  4N7E A;  2QJ4 A;  4A5W B;  4AYI A;  2YBY A;  1OK1 A;  5CT3 A;  4J38 B;  4ZH1 D;  4F4O C;  2Y8R A;  3IX0 A;  1CKL A;  3FGR A;  3INB C;  2LL3 A;  1QO6 A;  4APM A;  3HMR A;  1O9A A;  3HMS A;  5COE A;  2J8J A;  5CS5 A;  2CG7 A;  1H04 P;  4PZ5 A;  2XWB F;  3ZLE A;  4YNX A;  4C16 A;  2RLQ A;  4UV6 A;  2X2Z A;  5EOK A;  1E8B A;  2IZ3 A;  3K3T A;  4MSL A;  1E5G A;  2LL4 M;  3HN4 A;  1PPQ A;  2B5I D;  4LOS A;  4K12 A; 
#chains in the Genus database with same CATH homology
 3WSY A;  5CP9 A;  1W8K A;  3SP8 A;  2Q8A A;  3MKP A;  5CT1 A;  2I2L A;  3SRI A;  4YIZ A;  3F6K A;  4A5T S;  4YIV A;  3HMT A;  1Z40 A;  3NJA A;  4APL A;  4PO7 A;  5EOD A;  2K13 X;  2J8L A;  1YXE A;  1GP9 A;  2YIL A;  4R1C A;  1W81 A;  3SRJ A;  5CS9 A;  4Z0F A;  1GMO A;  4BWC A;  2Z8W A;  1NK1 A;  4Z09 A;  2F83 A;  1HKY A;  1I8N A;  3ZLD A;  3ZWZ A;  2QJ2 A;  2Y8S A;  5CS3 A;  4IUA A;  4R19 A;  2Y8T A;  4R1A A;  3FGT A;  5CS1 A;  4UAO A;  1GMN A;  2YIO A;  5I25 A;  2YIP A;  2HGF A;  4DUR A;  1BHT A;  2KL5 A;  4Z0D A;  5CSQ A;  4Z0E A;  2Z8V A;  3WSX A;  2Q8B A;  4R1B A;  5CT2 A;  4N7E A;  2QJ4 A;  5CT3 A;  2Y8R A;  3FGR A;  2LL3 A;  4APM A;  3HMR A;  3HMS A;  5COE A;  2J8J A;  5CS5 A;  3ZLE A;  4UV6 A;  2X2Z A;  5EOK A;  4MSL A;  2LL4 M;  3HN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...