2X3GA

Crystal structure of the hypothetical protein orf119 from sulfolobus islandicus rod-shaped virus 1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
116
Chain Sequence
b'GDLKKVLNFHFSYIYTYFITITTNYKYGDTEKIFRKFRSYIYNHDKNSHVFSIKETSNGLHYHILVFTNKKLDYSRVHKHMPSHSDIRIELVPKSISDIKNVYKYMLKTKKDIKMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIRV1 HYPOTHETICAL PROTEIN ORF119
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus islandicus rudivirus 1 variant xx
molecule tags Viral protein
total genus 37
structure length 116
sequence length 119
ec nomenclature
pdb deposition date 2010-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1910 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2x3gA00
2X3GA
chains in the Genus database with same CATH superfamily
3FDSA 3OR1A 2HFSA 5CZVA 1HBUB 3N5FA 4HDGA 3MFHA 1YSJA 5MAOA 4B3SF 2WSFC 2NUUG 2FJAB 2PFFB 1LK5A 5A76A 1RBOB 3BS9A 1ZM4A 2RIJA 5U47A 4MAKA 2ALZA 3JYTB 2KVIA 4Y3CA 4PWDA 4DV7F 2BW7A 4DR4F 4CM2A 2DK2A 3H90A 3RAMA 2J6SA 1YK9A 1LWCB 1RT1B 4O44B 4NLPA 2E5GA 3MM9B 1R6YA 3RGIA 1NMEB 4BLGA 3OXLA 1BUXA 2EG2A 1HNWF 1DURA 1KLNA 4F3QA 2AU0A 5L1KA 3CJ3A 1RU1A 1TL1A 4F4YA 5KFWA 3AFGA 1NK5A 2YNHA 5ETOA 3KUGA 2D3OR 2A10A 3TARA 2GVZB 2HGLA 4JB8B 5ETKA 2XTJP 5C25A 3V81B 4QIEA 4U96A 5EWGA 4DCJB 2E5HA 4YR0A 4RNNA 2YX1A 3ZTRA 2WCXA 2DCLA 4KH1B 2XMWA 1RA7A 5A8RB 1KSPA 2V5HG 3Q0AA 2CNKB 2CVEA 3ENVA 3TWZA 1SJQA 1WTBA 2HFNA 1TK8A 4DF8A 5B0BA 4IG3B 1NK4A 3KXDA 2F8EX 2HNZB 1ZAXA 3BPSP 4QU6A 2C2DA 3RBXA 4ZLLA 2VU5A 3CUNA 2G4BA 3PX4A 1ZM3A 4NA3A 1ZZFA 3OPKA 2N3LA 4ECWA 3LA0A 1ZTWA 5L1IA 1PYSB 5BR8J 5KTQA 4F8RA 5HI7A 1QTNB 2J7UA 2DTJA 1EKSA 3R2CJ 3TAQA 3LQVA 4A4JA 1KS2A 2EKYA 2AJ2A 4WE1B 2WZ1A 3MWBA 1LW0A 3EVOA 2HRYA 2F63A 3IBFB 3BO2A 2V4JA 3W9HA 4ED7A 2CA9A 1NHVA 2E44A 1K0TA 5DLGA 1C4AA 3S7RA 3GJTB 3EMTA 5ADZA 4DI6A 2XSFA 2JVRA 4RW4A 1QAIA 1BGXT 2DCUB 3GYGA 3OL6A 4KGZB 1YJ7A 1E6YB 1LQ9A 1BQNA 4NX9A 2WOMA 2KXHA 1PGZA 4A8FA 1FD8A 2EFOA 3OXGA 2HHPA 5CCMA 3IAM9 4OL8A 1HA1A 3C8YA 2M0GB 2ZHAA 4ZVRB 3CCES 3H25A 1R0AB 2M70A 3LH2S 2BXJA 1VFJA 1FK9B 3FVYA 3J81Y 3AD8C 4CTAB 1AZSA 5HMXA 4YN3B 4V1Ak 1WKKA 3PXGa 4GKKJ 2DGUA 2EC0A 2HHXA 4DMZA 4USKA 2BJ7A 2EC2A 1SKWA 4WPAA 2HFVA 2FZGB 3GSDA 3RRGA 2VQEF 4X2BA 1WOSA 1SB6A 1NPPA 3I32A 5G0RA 3VCDA 1XNQJ 3BH6B 4I6AA 3G6XA 5K8NA 1T9VA 3T19A 3D28A 3M8RA 3IRXA 2WVFA 3BR9A 3CC2S 4USWA 4ENOA 2H4YB 1N0UA 1S4FA 3IRWP 1VQSA 1SJ3P 2YKQA 2ZD1B 1MWZA 4FBUA 4DSFA 1SPBP 1FJCA 1HPZA 4YB1P 3DRRB 2OLWA 1RHRB 4NWBA 2ZDPA 1JLGB 3KWMA 1VQ7S 5J1EA 4G65A 1GAOA 2FY8A 2BZ2A 3C16A 4JP8A 4ZJOA 1B0TA 5ETNA 5C2CA 1RU2A 3PM9A 1JLQA 3SV3A 2B7CB 3QIPB 1SKUB 4WWSA 2XS7A 2PMZD 1HW8A 2BQUA 3CCQS 1YJNS 2VC1A 5L38A 2QL5B 1IJFB 1LXNA 1MN7A 5E0OA 3UI3A 2QMUB 3LP2A 1MWYA 4FDFA 2Q79A 4NZ0A 4IO9Q 3J7YU 4ZKAA 3ZTOA 2HAFA 5A0YB 3PW7A 1E6VB 1QAXA 1BQXA 4ZIVA 1RHUB 4B17A 3N0VA 1IM4A 1T02A 4GKJF 2HMIA 3MOZA 1RKIA 3RB4A 2ZJQQ 1YX2A 3IG1B 5A6WA 2Z2MA 1LWEB 2EFVA 1JLAA 4K4XA 3QIDA 4I2QB 2YNFA 1LNQA 2CPXA 1N34F 4ZPVR 1WC6A 1Y5NB 4ECTA 2ZH1A 1WC4A 3PIOQ 3PZPA 3FCWA 4OI3A 4DS4A 8ATCB 4NA1A 1M0SA 2XHCA 3R97A 1LW2B 2ERRA 2WB1D 1KN6A 2NYIA 5C42A 1U25A 4NMLA 2N4CA 3JXOA 1A9NB 4OX7A 1WG4A 1FX2A 1HR0F 4KRWA 5KT2A 4KHPJ 3OL7A 4DR1J 4AT1B 3QLHB 2DNZA 3EVWA 1NH8A 1M5KC 1U0HA 2D3ZA 2HVZA 3JS9A 2KL8A 4MIWA 1PJ7A 1AFIA 4JI0F 3I0SA 2H9ZA 1KFDA 4J9PA 4ZJQA 3CTRA 2KJWA 2JLFA 4IKAA 2RU3A 1L3SA 4Y2MA 4ELTA 4ZK7M 2IM0A 2AT1B 3PRVA 1FE4A 3A13A 1IKWA 2LVWA 4M5MA 4F7VA 4NXNJ 1VRTB 4UTGA 1B7YB 3UW1A 2UUBJ 2GMHA 5I3UB 2OH2A 5A8WA 2HHVA 2VFSA 1P6TA 2WVDA 4OX9J 4OZJA 3OFFA 5L9NA 1SC6A 2HURA 2L9WA 2JLGA 3M9NB 1S1WA 2MXYA 2QA2A 4DR7J 2E1AA 1VBKA 1RTDB 3MEGB 1P1TA 3M2RA 3GFZA 1X4GA 2UXCF 1XMOF 5F8NA 1S99A 2BANA 1TL4A 2KDOA 2LU1A 3QSIA 2HQ3A 3HT0A 3BQ2A 3UNGC 4DLEA 4LIRA 1S9EB 3HFVA 2ZZMA 2ZJRQ 3WIVA 4KE5A 4OYOA 3MMCA 2VHGA 2CQ2A 4X4RA 4Y2CA 1X9SA 3HD1A 1M5PC 4ID8A 3DNCA 4DQQA 2VG6B 2VBWA 4ZS6A 7AT1B 3V6DA 1NSKL 1Y00A 1GXUA 5L39A 3GILA 1R0CB 1VYAA 1U09A 2EKNA 2GZOA 5K14A 3CB4A 3E2EA 4AL5A 3OTOF 1WOPA 3FEXB 3NGSA 2AYGA 3U02A 1XWLA 1HI1A 4FXDA 3GV8B 1WHVA 3DRPB 1EETA 3QFHA 1VQMS 5JMNA 2YNGA 3G6ES 1KVKA 2HNDB 3DLKB 1YJUA 2NR0A 3DLBA 2VDHA 4Y28C 1JIHA 4B9LA 1JLFA 2FVSA 3QRPA 2QLJB 4YHHF 3KLIA 4WP3A 1UVNA 2YKNA 1V3RA 4ZCKA 4KGMA 5JVGQ 1S59A 3NY0A 4TU8A 1IR1A 2J9DE 2UV8A 3MAAA 4DR2F 2VBZA 4N77A 3ZC4A 3EGWB 3MZIA 2FJVA 2Z8QA 1YZ6A 3M7VA 2CJAA 4L3KA 1KTQA 1U49A 1NXIA 3ZNJ1 1O8BA 2DVIA 1SJ1A 4IFVA 3GV5B 1TKDA 4U67Q 1OPIA 5LT5A 3CJTA 1F5CA 1FWKA 1NU4A 2GJ2A 5AJ3J 4IRKA 3NOGA 4ITSA 1NCLA 1FRJA 1OYDA 1RP5A 1J5OA 3OTEA 3EGZA 5KFXA 5ETTA 4OYXA 1MROB 3SIPB 4EGLA 2UXDF 3DN9A 4IOCQ 5HL7Q 5DZ7A 2KHDA 1SL1A 4JV1A 3OLBA 5LJ3Y 1GH8A 5DZ6A 4RR5A 3DLEB 4WKRA 3R8YA 4DSIA 4KB7A 2GS8A 3Q8SB 1KLMB 3LP1A 4F4AA 1S1VB 3KK1A 2J7WA 1EX8A 2R42A 3GCWP 1VC5A 2J0WA 4OZNA 1MNEA 4N8OA 1FD2A 3CCSS 4LF1A 2C3MA 4A47A 2B56A 3Q8UA 4ECRA 3C66A 1DJ0A 1YKWA 3PW5A 4P7VA 4WFAQ 2MKSA 3QWPA 4RL1A 2J8AA 2BV3A 4WCEQ 2B51A 2JX2A 2OFGX 4B08A 2JFKA 3Q8YA 1IBKF 3VAHA 3AXKA 4F2RA 4CO4A 1C1BA 1IBMF 3UCGA 3OUYB 2GIRA 2C2MB 5D0RA 4NLSA 5IQ6A 3HJVA 3BJYA 4ES2A 1UW9A 1NAQA 5KFEA 1U48A 2HG4A 4ECZA 1HL6A 5B0GA 1SH0A 2DKOB 4QYZK 2DEJA 3M8YA 3PYEA 5IT4A 3CC7S 3RU0A 4HHHA 2J76E 4ZLJA 4PXCA 1UAWA 2MQQA 4ZPWR 2VG5B 4A46A 5AXMA 3HPOA 2HPUA 2AYEA 1CJKB 4ILMA 4DPUA 1L3TA 1IWGA 4ZPTR 4IDKA 4X4TA 1JJ4A 2J6TA 1KWMA 2HQFA 3MTKA 4C97A 3HF5A 3NKYA 2CPZA 1VQKS 4K4UA 2UU9F 4CZCA 3FCHA 1DFDA 2WRMA 2IYIA 1V3SA 4X4OA 3J7A1 2PA8D 4M5DA 1TK5A 4C8YA 2R7WA 1OPZA 2C2RA 4CI0B 1JLEB 9RUBA 2BX6A 1S6PB 2WW8A 3DFEA 2LDYA 4WXWA 1XR6A 5HMWA 3MF5A 1T9TA 5E33A 1YBTA 4ZVQB 2AW0A 3MAQA 3OXFA 5H9EJ 4OJ1A 4ZP7A 1I1GA 3TRGA 5HLFB 5A2QU 2KXNB 2OPRB 3HX9A 4AD6A 1U1LA 2MJNA 1NSAA 4ZPCA 1WF1A 2EBGA 4DV0F 2ZWPA 4P71A 3LP0A 4DCOB 1VBYA 3TA0A 1NB2A 3BZQA 4PUOB 1T95A 4KHRA 1FNOA 1RJJA 1F5AA 4YB6A 3PFEA 2PSZA 5F41A 3QWUA 1R43A 1NHUA 2MLXA 2E5LF 3MEEB 1PC5A 4ZMMA 2R7TA 2DH9A 4OJGA 3JB9k 3U27A 3GQCA 4LSLB 1L3UA 1N6QB 4YFUA 2E1PA 2XYPB 2CG4A 1QTMA 3LANA 1XERA 3UO0A 1Q53A 4DG1A 3N01A 4ID5B 1NJYA 1FKPA 1GMUA 1N54B 5HSPA 1F3VA 1GMWD 4ZN1A 2QN6B 3ILLA 3ZZUA 3KLHA 4ICLB 3UN5A 2UUAJ 4O3QA 4M8LA 1DTTA 1FRMA 2QFIA 3H2LA 4ECSA 1TKXB 4KHMA 1SH3A 4F2SA 4KPCA 1HHQA 2GX8A 1IJEB 1DLOB 3OW2R 2ZDOA 3NCQA 5T7LB 3KHHA 1FJGF 1FNMA 3W3SA 5IC6B 1RAGB 3KHRA 2AYBA 4K4ZA 4Q8EA 2OUGA 4B3MJ 5HJXA 2HVEA 4K4YA 2YKMA 1HBMB 2DR6A 3CCVS 2YWEA 2ZH6A 4WZMA 2CZ9A 1EP4B 4FYDA 1UWBB 4NLVA 3TJ9A 1IKXB 1FNXH 4LFBF 5F9NA 4DV4J 3NMRA 5F8MA 2X51A 3MEKA 4ES1A 2L9DA 2FHMA 5LM7E 2AD9A 1ZA1B 4UW2A 1YJVA 2HIYA 5J2MB 4WFZA 1NJXA 4PYAA 2MGZB 3SXLA 2CQBA 2ZWOA 3AQPA 2P9GA 3AD9C 4BC7A 3UDVA 3FGVA 2HNYB 4QW9A 3TR5A 2K3KA 2DNNA 1TVRA 3LPYA 4K0KJ 3WHIA 3K89A 5F3ZA 2Z2ZA 1MSWD 3G87A 3O5TB 3M8QA 3MPVA 3PDNA 2ZD1A 2C42A 2IA6A 2AYMA 1GTEA 3FUYA 2XMVA 2FLOA 2BQ3A 5AXNA 4A8OA 1N32F 4HTIA 3VZIA 2RS8A 1A6LA 3P4UB 1SUQB 3GR1A 4CIOA 2HQGA 4KQZA 1SQEA 4RKUC 3QFWA 1EKRA 5ETMA 4NLTA 2RT3A 3RUBL 2WTFA 1FFGB 2LQ9A 3PCOB 4OYAA 3T1HF 4LFAF 3H5XA 3QRQA 1CJTB 4NYOA 1S0OA 2DNYA 4JYAJ 3KJFB 2FVRA 3PFOA 3IR7B 3HP6A 1Q78A 1R3NA 3W63A 3PEHA 2HFUA 1H2TZ 4Q44A 1QUPA 2DGVA 3V6JA 4TVAB 1WNEA 3M2VB 1VIOA 2JL9A 3AOBA 3E8OA 3THPA 3IAS9 4GVBB 3DDNA 4OQJA 4TY9A 1F0XA 1S6QB 2H65B 4JV2A 2UXBF 3CCUS 3RG6A 1V3ZA 3KK3A 4RNFA 3D0GE 3GU0A 3GTYX 2QZ8A 4H4MB 5LSLA 3C14A 2IBKA 4ZLPA 3D0IE 3GG1A 1YBUA 2NZ4A 1BY9A 1SC3B 4LMZA 3BN7A 2B0GA 3IGNA 3LUYA 2YXLA 2BUNA 3QAEA 1ACMB 1L3VA 2PO4A 3VAJA 4F26A 4HT7A 5F0UA 1SKSA 3NBPB 1S1TB 1RYSA 3KLEB 1U1MA 1WC5A 4HLBA 3BF4A 1DHMA 3CXCR 1N36F 4LSNB 3HHLB 1FESA 4QZVB 2QSWA 2GGPA 5ETVA 5HVFA 4C11A 3ZZYA 1JXVA 1RT2A 1CJUB 2OPPB 3PVXA 4DV6J 4HI2A 2AHOB 1HLWA 2BM0A 2IVMA 4F0HA 2BYCA 2N4DA 2EXUA 2FPHX 3UVJB 2CNLB 3LPEA 5KT7A 2XZTB 4HACB 1U1RA 4YR3A 4OYPA 3G9CA 4EI2A 2OSRA 3HSZA 1RT3A 4UOGA 2IBOA 4DBQA 1FF2A 3W2VA 4WYWA 2OMLA 1JJHA 1KR4A 2HRTA 3DI6A 3AT1B 2RQMA 3NWRA 1RDRA 3I31A 1UMJA 1WOOA 2CQ0A 4JV5J 3TI0A 4CH7A 3KK2A 1B7FA 2CQ4A 2DHSA 3CC4S 4PG4A 3TUZC 3R6GB 2AEJA 1MLAA 3OR2B 3U1NA 3HVWA 2VF3A 1U0SA 2B4UA 5E3AA 3IGVA 1LWXA 1NO8A 5T14A 3T1YF 3DRSB 3PV8A 3RRHA 3S8SA 3NAHA 2UUBF 1YIJS 3KLGA 4DR6J 2ZKTA 4LF8F 3MPWA 4USTA 5B08A 4L75A 2PE8A 3EX7B 3BGFA 4O3RA 1RTJB 3KFWX 1G4CA 2IIHA 1KKHA 5D4LA 1H6KX 1SH2A 1NUEA 1VK8A 2CQCA 3FSIA 2W9CB 2CQHA 2HWTA 3DOKA 4O4GA 2L41A 3CPWR 3TZXA 2YNIA 1V9OA 4O0IA 2OIHA 2DO4A 3LTOA 1FFSB 4BCAA 2GC8A 1KBRA 4LVOP 3I6PA 4H4KA 4EZ6A 4DL2A 2ASYA 3M8ZA 3BEGB 5CYQB 3I82A 3AB2B 1IN0A 5IFMA 3DLJA 3NRBA 4C8ZA 1N5SA 3HVTB 4ERDA 1WEXA 2A18A 2G2YA 1Q1KA 2QYGA 3QZ8A 2RVJA 2NXNA 5KFDA 4BWMA 3L95X 2MZRA 1LFWA 2ALYB 2P9CA 4ECVA 2PEHA 3CVKA 1X0PA 4I6WA 3G82B 3OVAA 3ENWA 1RE1B 1XQIA 3GFYA 2K7JA 2BBEA 5AE2A 1APSA 1HD1A 3RB6A 3TEHB 3J7AN 2J7KA 4OZ0A 4WKYA 3CDEA 2ROPA 4UQGA 1MROA 1PSDA 5GAHU 1CG2A 3FSXA 2DXEA 1VIXA 5D6GA 5KFZA 3R5DA 1N5YB 3OTCA 1N5QA 2G0CA 1X5SA 1SJRA 2HVDA 2EWHA 1C0UB 5KFUA 4XDCA 1MMNA 2RMLA 4IFYB 1BXNA 2HGMA 1HBOA 5B0AA 4L73A 1M1HA 4PRFA 2WONB 1WORA 2EFPA 2FVPA 2HKEA 2IRYA 2O3DA 2ACYA 2U1AA 4Y65A 3H0PA 2VFUA 1M5HA 3E01A 4V19J 3D0HE 2Z56B 4DZ6A 1CEZA 2UVRA 2E5IA 1BWEA 5KG3A 5EUHA 2MQMA 5IT0A 4QOTA 1QUVA 3V4IA 4TY8A 1HWUA 2F1FA 4X64J 4R5PB 4FYWB 1KQKA 1HYSA 4DPOA 2X1BA 4LF5J 1UVLA 3DDKA 1H73A 4KYZA 2VG7B 3DYAA 2RUGA 4TYBA 2IY5B 3GJSB 1NJIT 1XNRJ 2YY3A 2HHHF 1IKVB 1JKHB 4F4WA 4JBCA 4A8MP 3PG9A 4OJHA 3ZNUA 3KDNA 1A7GE 3V6HA 5HBMB 1ZAVA 5KG7A 2OHDA 5J2QB 3NS5A 2KRRA 1UW4A 4WTOB 4K2JA 2LA4A 2N82B 3EGNA 3HT3A 3GIRA 1B0PA 3F0NA 2QA4G 2ZH3A 3G8TA 2VJUA 2C2KB 4RU2A 4RPFA 3K0JA 4PWUA 1G3OA 2J0QD 4JI1F 2LECA 5C24B 1U1KA 1C0TB 3MR6A 4BHQA 1AXQA 1OQ6A 4ILRA 1EHWA 5HP1B 4J91A 5EGYA 2RF2B 2G1HA 1Y5LB 1HNVB 4CQ1A 1WUUA 4A8XA 2DEIA 3FQKA 2QJ3A 1FKOA 2B4OA 3Q2SC 2XY6A 4ED5A 1MN9A 4NXMJ 4MIBA 3KLVA 4XPEA 5DG8A 2B8QA 2QE5A 3FBEA 1HBNA 1UPMB 2I5JB 4M5KA 3SSQA 3J7Z5 1X0FA 1Q8BA 2YBVA 4P2XA 1X60A 2UUCJ 5KFVA 1RWKB 3OR1B 3M8WA 2CQIA 1J27A 2I0XA 2FJEB 4M1KA 2XLJA 1VR6A 3TYTA 2XM3A 5FDLA 1RZMA 1I94J 4OI6A 1NH7A 2B6AA 2ZBPA 5K8OA 3BV8A 3Q2TC 3D2WA 3MM8B 1TAUA 4Y34A 2F4FA 2R7UA 4U6PA 2HHTA 3KTQA 2HRUA 2A6OA 4KBIA 4DPTA 2OEJA 3Q8RB 2UUWA 4OZ2A 3O2IA 4E8UA 1U7LA 2FZCB 1UJ5A 4YUDA 3SCLE 5AE1A 1HI8A 3DRYA 2MQNA 5ETSA 1TL1B 3I87A 4P52A 3AD7C 4G6VB 2YNHB 1U26A 4CO0A 4FVCA 4ALZA 3I56S 3W65A 1U6BA 1TV6A 1K1QA 5C25B 4LBHA 3D6HB 1TQLA 1JMTA 4MJKA 1C1CB 5ETLA 1CQNA 4ANCA 4YB5A 3N6LA 2OMOA 4L3NA 3IWXA 3RBDA 2OD4A 2HHWA 3V2UC 4CLFA 5D0HA 4YDDB 2GAGC 1H38A 2UUTA 2CZ4A 4XO0A 2IVFB 4WFXA 2VB6A 3I55S 4V19X 3A3OB 4XPCA 5C2GA 4ZCMA 4RU9A 1UFKA 1HQEA 5HVGA 5J2MA 4F67A 2CPEA 4C9DA 1D1UA 3EGVA 1EQ0A 4CO5A 2R3VA 3UCZP 3SFGA 4OYZA 2R7QA 4YMEA 5F9LA 1RCXB 1UVIA 4WFYA 2X1FA 3GFXA 3ZTSA 1OSCA 1PJ6A 1ZAWA 4OI2A 1V6HA 2YKPA 3B54A 2MHEA 3M6WA 3BGOP 1LW0B 3SYZA 2G0JA 2V67A 4EO8A 4DR3J 5DRKA 1RAOA 2V4JB 3QNWB 1K9MT 5KG5A 4FP9A 2VL1A 5AXKA 2XY7A 2N7CA 2ZC3A 3IM9A 4WF9Q 4F3MA 3HJFA 4WZQA 1CJTA 5KFMA 1HI0P 4RW4B 5GAGI 1X8DA 3O3LA 3GR0A 3GMGA 4AQYJ 4PCQA 3M9OB 5F8GA 3SMZA 7FD1A 2HHQA 3MAHA 1BQNB 1YJRA 1YRTA 2WOMB 1RSCA 5F3TA 4EMDA 1QSYA 1R8HA 3C19A 5ETQA 2H54B 4NLWA 5IV3A 1VI7A 2CQGA 1UEUA 1QD1A 4WYLA 4NRTA 1X4CA 2QA4S 2YKOA 3MHYA 2W7OA 1AB8A 4PG8A 2EEYA 2QG9B 1S7IA 2AGQA 5D4OA 4J9RA 1RYRA 1U24A 2DGQA 3OD2A 1AZSB 2HVHA 3HHLC 4FZVA 3H5YA 1NDPA 3IXQA 3NGDA 5LXRA 2HBYB 1G1XA 3DOMA 5KG6A 1SI9A 4Q7AA 4C3LA 5GMEA 3TAPA 2CPJA 4CLKA 1KEKA 3LALA 2CZVC 1G6BA 4D3GA 2R9LA 2HWHA 2BMBA 2Q66A 1JLCA 2AEMA 4M5GA 5G0RB 4TYAA 1SIWB 4QPXA 4OI0A 1RT6A 4RW6A 3QPIA 4HH0A 3KJQB 2H5IB 4C3KA 1VJQA 3IRXB 4M5NA 3OHAA 2NXJA 2E29A 4FS1A 1U1OA 3M8PA 1LWFA 2KRBA 1GT8A 3ITHA 3KUHA 4OZ1A 3UVJA 2XMJA 1XC9A 1U47A 5J1EB 4C3MA 2GHVC 5E3PA 2A3JA 4B9MA 2GQCA 2DH7A 2X1GA 4KV8A 2M9KA 3C16B 1RHQB 1S76D 2FD2A 2MLYA 5D78A 3LAKA 4HYKA 5DGAA 2G0IA 1HARA 3BR8A 3EDQB 2EVZA 2CNNB 1JLQB 1Q81T 1XMQF 2Y3YA 3FK4A 3ZFVA 4DQPA 3MUVP 4ZITA 4USVA 2XMAA 1X9WA 1B64A 5IWAJ 5D0EA 4DV1F 3PO5A 3JSMA 2PA3A 1H0HB 4NASA 4DL4A 2YKAA 1OYEA 3UCUP 1Y9OA 3OR2A 3LP2B 2FJDB 3B82A 1RWPB 4LFCJ 2H5JB 5LMNF 3C6TA 3OL9A 4X62F 2M52A 1TUWA 4U8VA 1S72S 1VDHA 3MR2A 2LQ5A 2JFDA 5KFFA 2AWZA 3X1LB 2XO6A 1VOMA 5CD4H 2OELA 1JXEA 3A8KA 2ZHOA 3K5LA 2E9RX 1JLAB 3CO0P 2YNFB 3QT7A 1RTJA 3W7BA 4C8KA 4B3OA 1WWHA 2HBQB 4P7TA 3CD0A 5LXYA 2OSQA 2ZM6F 2RUSA 1RWVB 1VQOS 1SBRA 2P2CB 1UA1A 1QJHA 4NEYA 4NRUA 2OKQA 3CWJA 2P5VA 4I69A 4Q2MA 4ZDNA 1H2UX 3KKFA 1SQGA 3SBMA 3T5JA 3ZZOA 1X4FA 4IUFA 1KFSA 5C42B 3J81j 1K44A 5IT9U 3PO4A 3J80Y 2ZJPQ 4LF4J 1P9QC 3D54A 3NGTA 4MK8A 2GJFA 4TN2A 3N28A 3HHLD 4RBTA 3IS9A 5A8KA 1R8BA 2XQCA 2CNOB 3N5BA 2HK2A 3UE2A 1U0HB 3K5OA 5HROA 4DV5J 1YRUA 4DUZJ 2M8HA 4F0MA 4NEZA 4ANDA 2CQ1A 3I0SB 3HVAA 5BJRA 4WJBA 2QV6A 4KPYA 4BDPA 2F8MA 3GCXP 1U1NA 1NDLA 2W2QP 2XI2A 2QSFA 4DHVA 3QT5A 2XYHB 4HDHA 2DT9A 1IKWB 3DRXA 4PYDA 4JI5J 4GC7A 4RNOA 2MQOA 2IM3A 3RW6A 1IR2A 5A8WB 3RYLA 3HK2A 2FHJD 2I1RA 3PX6A 4ELUA 4IH5A 3H8YA 4FF3A 2NS1B 2BKOA 2Z2YB 1FDBA 3BO4A 1S1WB 2FTRA 2Q6BA 2EI5A 4B3TF 5F8LA 5KG1A 1OQ3A 2M5YA 1HWJA 3M2RB 3RTVA 1CPZA 2BANB 3AOAA 4JI3F 3U1MA 3UD3P 4G1QA 1AT1B 2OJ3A 1HNZF 3EICA 4NLUA 5F8JA 4KKOA 3MMCB 3A8JA 1WC0A 4OYBA 2Z0GA 2FQQB 2ZH2A 1IBCB 2A2DA 2D9PA 4TLQA 2C2OB 4UZBA 5LL6d 2K1RA 2IPOB 1KVIA 3V6DB 4ZHRB 3QO9A 2LXFA 4YY3J 5J2NA 4PG5A 5GADI 4Y2IA 1CSJA 5K14B 3CEDA 3MMAA 4B9UA 3SSRA 4FXWA 3A8EA 2DY9A 2PI4A 2ZNYA 2WAQD 2YNGB 4OI4A 4DPXA 4AUKA 2DPJA 4C0BA 2JWNA 3GIMA 4QPTA 1HNIA 4EYIB 1JLFB 4FKYA 5IV4A 1S48A 3KLIB 3L3CA 2YKNB 4RWWA 1H74A 1NSPA 2LEAA 3FSYA 1TL3A 1OJ4A 4O4RA 3MAAB 5KFLA 5KFPA 2CDRB 1VQ6S 5K8MA 2WW4A 2VQFJ 2V94A 4F25A 1HHSA 1HQ2A 2VPWB 1FI4A 3QQCD 4RUHA 1FDAA 1F9EB 2XMUA 4IFVB 5K20B 3R9LA 4LQ3A 1UVMA 3L4BC 4DV3F 2GNKA 4UOHA 4O3OA 4USMA 3D66A 2AX1A 1J5OB 2CJXB 1T05A 3AY0A 2CAJA 2WVBA 2I8EA 3DLLQ 2WVEA 3CJ2A 6AT1B 1GTHA 3MCOA 4OV6A 2BDPA 3BDPA 4EK2A 1GEHA 3BQ1A 2VFRA 3C3LA 3PYDA 2IMWP 3WDOA 3KMQA 2J6UA 2QMXA 1X9MA 3ICLA 3LP1B 1UFWA 2GCFA 2R8JA 4LF7F 2AGPA 3T1AA 3K8WA 3PNIA 4G1PA 3EXYA 7FDRA 5CYMA 2K06A 2DNGA 2ZC4A 1YI2S 3R5GA 1YITS 3BO3A 4DX7A 3DGPA 3R3TA 2KM8B 2O5DA 2B9XA 2ROGA 2P8IA 5F0WA 3CJKA 2M4MA 2I5JA 3H5SA 3VWSA 3KJVA 1FO1A 4IO1A 1JQGA 2O67A 5HJYA 2WB4A 2DXDA 1C1BB 1N33F 5DQIA 3FZ2A 3OTDA 4CP5A 5L1LA 1IQZA 3JSBA 1XTZA 2DNHA 3NLCA 2F65A 4Y0FA 4DOZA 2F4VF 4EUVA 3I0RA 3MM8A 3BM7A 3NGRA 3M2UA 2CJBA 3G6VA 4K8RA 3IBCB 2RDIA 2V63A 5H9EK 2M3DA 4L6V3 1QVFR 4CWBA 2JNJA 1ZETA 4CRJA 1TFWA 4L76A 1REVA 1Q86T 2LXIA 4QYRA 4N41A 2VIHA 1KDNA 5DDPC 4NLQA 4YS2A 1BQMA 1RBAA 2F8HA 3M05A 4ZPBA 1TP7A 3NS7B 3NGUA 3DCAA 4IDKB 4ZVSB 4HHJA 1S1XA 1NDCA 1WDTA 3J7YI 2FC9A 1U45A 4A48A 3ZZ0A 3DDIA 1C1CA 1G2EA 4IRDA 3HLUA 5SZTA 3D1HA 4M5DB 3NP5A 4NLRA 1FTRA 4X4QA 4YP3A 5DS7A 5HQLA 2E7WA 3D9BA 3H2VE 2V2QA 2NSBA 2OO4A 5KOXA 2RDJA 2MMYA 3FBFA 5A2QY 4DX5A 3TZYA 1GNKA 4QU7A 5JUMA 3FFIA 2G13A 2BOPA 2B8PA 3CD7A 4TKTA 1VHIA 1RKJA 3RRKA 1ZZNA 1UP1A 4J37A 2BABA 4LRDA 2FLPA 3LP0B 1S5ZA 1Y7PA 1K0VA 4JI7J 3SEOA 2RKIA 2YWWA 2QTWA 4X66J 1WI8A 3QGGA 5BYRA 3NXZA 2BA9A 3R7SB 2MKHA 1RTZA 1KNZA 1UKUA 2WBRA 2FVCA 3BYPA 4QIFA 1WKLA 4CLYA 3R5JB 4F04B 2OD6A 1QE1A 3TZWA 3MM6A 1JNZB 1J5EF 4B3SJ 2JJ4D 4DG1B 3I5CA 1FKPB 3ZTQA 1TUGB 2LU2A 3PTWA 3QAUA 2ASLA 2FHKA 3KLHB 1AUSL 2B4VA 3C15A 4K2XA 2RB7A 3L9ZA 1DTTB 4DV7J 1VC6A 4DR4J 4CLTA 1ZOTA 2DHGA 2EK1A 4WBFA 4DUYF 1S4EA 1LEOA 3R7NB 1HNWJ 2EBEA 2UV8G 2UVWA 1ZM2A 2K2PA 3GIIA 1FWLA 4C98A 3HHDA 2OPSA 1U1QA 3BSAA 3AJ1A 2YKMB 4TQRA 3S1TA 1DRZA 1DARA 1YJTA 2MQ8A 2DGTA 4J7CA 4RX6A 3H4BA 2CJYB 4MKVA 4PWWA 3MD3A 3POTA 2V34A 4FYYB 1FFWB 3IO1A 4MKAA 2R8HA 3M32A 1X4EA 2ZH7A 3R27A 2FB0A 4RJVA 1AW0A 1X7VA 1HMVA 5D4PA 4BWJA 2KO1A 1TVRB 1CBKA 1S7HA 1J2VA 1LOUA 4ZVHA 4BBYA 2JRSA 4X65F 1TZ0A 3AH6A 2QA1A 2H4WB 1RT7A 3M8QB 3BSNA 2QO3A 1RUSA 3VAMA 4H4OA 4OX8A 5J1NA 1N0VC 2YQ0A 4MT1A 3MCMA 3KG1A 2W7AA 4NI2A 2V2ZA 3K58A 1ZBTA 1PYOB 1K47A 3NG8A 4P72A 5HK4A 3AOCA 1N56A 3CDUA 3UDEA 3MMBA 3OT9A 4DX8H 4JI2F 3QJLA 4U95A 1IBLF 3HO1A 4DFKA 1F6TA 5KG0A 4F02A 4GC6A 1RBLA 3W2WA 1NPRA 2YWGA 2DD8S 1PAUB 5KAKA 8AT1B 1UFLA 2XBPA 4ZVUB 2RRNA 5HVHA 1B70B 1KHVA 4K59A 1S0NA 3AA9A 1RA6A 2P6TA 2E5JA 2V4RA 3KK3B 3BDEA 4DL6A 3C14B 2ZOGA 1H98A 2D1CA 3CJRA 1RT5A 1RWNB 1HNXF 2A1BA 2HQIA 4J9LA 2W01A 2VJVA 4NCGA 1LK7A 4QWDA 2XZDB 4IQXA 1JLBA 2MKKA 4FPIA 4RW9A 3ZZTA 3IFEA 1RAJA 1JX4A 4YQWA 2Z2LA 4PZVA 4NLOA 4NLGA 2PEBA 2VH7A 4JI6F 1B4SA 2VQEJ 3HD2A 1P8GA 2GO9A 4ETZA 1UEVA 1W7WA 3CIMA 3L09A 2KB2A 5LMUF 1RHKB 3PIPQ 4DR5F 1BC6A 1KOHA 2GGPB 2BM1A 3M6VA 3VF0B 4C11B 1RT2B 1I3OB 5A6PA 2P9EA 3W1YC 1N4LA 3CIZA 2I9SA 1VBZA 4QBUA 3SQOP 3HSJA 4QWBA 2Y1RI 1IR0A 2H3EB 1XIQA 3M6UA 1VS3A 2QYCA 4P75A 5GMKa 2Y8YA 2DGWA 4FNIA 4K7QA 3BB5A 3DHXA 3T3FA 1RT3B 3BGUA 4L72B 3W2VB 1RWWB 5J1PA 1GXLA 3KHGA 2A2CA 1W2BR 3ILOA 4MKBA 1ULRA 3DI6B 3Q8QB 1U4BA 1UEKA 3PHTA 3RBEA 2CPIA 3MM7A 3HVRA 2XNRA 2F9DA 2AJ0A 3SDEB 2RILA 3KK2B 4BS2A 2G9OA 4P73A 2B9YA 1VGYA 2CQ3A 3NNCA 3A12A 2BRKA 3BSOA 3MMJA 4IQMA 2QRRA 8RUCA 3E51A 2L9NA 3AAWB 4I6YA 2ZUAA 2MPUA 5B0CA 1RWMB 2RE1A 3KLGB 4I68A 2FHJA 3MECB 1S6OA 2ZOFA 1WHWA 3CJ0A 4GKJJ 1F2GA 2CG8A 4KY3A 2ZBRA 1XJWB 2GHWA 1O5JA 5D0GA 5HO4A 3HSGA 2V8PA 1TKZB 4YEAA 4LSZB 1N34J 1RXOB 4N5SA 4ZHRA 3DOKB 4O4GB 4AFFA 2ZE2A 3N79A 2YNIB 2HZCA 2IM1A 1S97A 1PJ5A 1N48A 4O3NA 1YLXA 1VQPS 3JAMU 1TL7A 4UY85 5I42A 3D1OA 3QYYA 3PW2A 5CXTA 3RR8A 1RTHA 1HR0J 1PBUA 1AFJA 2MZJA 3PX0A 3EM1A 2VZ9A 2EFQA 3CSKA 1D9DA 1WHYA 5HANA 1R0BG 2ABYA 4ZP8A 3IBWA 3TAMA 1VQ4S 3GWCA 2NLWA 1S1UA 1T94A 4EBDA 3H5UA 3FEZA 2GJIA 3R5AA 4JI0J 1VC0A 4ZPDA 1RHJB 2BJDA 3M9MB 4KGKA 4CCHA 4KGXB 5BYSA 3ZZZA 1FXLA 2C3YA 2E9ZA 2H48B 3BSCA 3GG0A 1SXLA 1RAAB 2AKWB 1W2IA 1FRLA 2X7IA 4WK3A 4Q5VA 3T9ZA 4HHUA 1QVGR 1RAFB 2KM8C 4Y2KA 1NZ8A 2VPXB 4QQBA 2DNRA 1HBOB 2OAUA 5IZHA 2FVQA 2KJVA 2BKPA 4PXEA 4CLPA 2UXCJ 1XMOJ 1Z2ZA 3EXCX 5I3QA 1HWLA 1PCAA 2CYYA 1VRUA 3FMWA 3UNYA 4DSLA 2MSSA 1TMJA 3UDCA 2C3OA 3E01B 3BKFA 3J7ZT 4Z2XA 4RLEA 4J9SA 2XGQA 4N8NA 2RQCA 3MUTP 2E66A 1TUVA 2E1CA 4KFBA 2Q6CA 5JXSA 2XWXA 3VZHA 3T5HA 1URNA 4F50A 1RGVA 3V4IB 4TY8B 2D3O1 2HS4A 4Z37A 3OTOJ 2W9AA 4B3RF 5HAOA 4LF6F 3US5A 2LKZA 1HYSB 5H9FJ 1LV5A 2VOOA 4ZVGA 3OSNA 1VHFA 4DQRA 4F4KA 4JI8F 3DYAB 2V2VA 1FRHA 2VPYB 4YHHJ 1IUJA 1T0TV 3SSSA 4CNYA 1Z2LA 3HFKA 4C8OA 5CAAA 4B9SA 5HQ8A 2VV5A 1JXLA 2JH3A 3VAIA 3MCNA 4DR2J 5T41A 4OZ5A 1ZPWX 3B6BA 3ONQA 2CWKA 2NSCA 1RWXB 2MSTA 3F41A 4DPWA 3MPYA 2PMHA 1S49A 3DMJA 2IVYA 3PACA 4N76A 4MMOA 3EWGA 3TEGA 3DU5A 4RW7A 2QL7B 4DL3A 4QWAA 1FE0A 2DY1A 2C1EB 3HI9A 4DPYA 1Q0NA 3BYRA 4C8MA 2XMKA 1NDKA 3OSPA 2XG8A 2XMMA 2Z4PA 3UN3A 2UXDJ 4PPZA 2HQDA 2FHOB 1CULA 3K2YA 1Q95G 4I7FA 4MIAA 5C7PA 2H51B 3H40A 3G96A 4I64A 3QT8A 5LSOA 1Y4ZB 5CQGA 1MG7A 3MR5A 3H59A 4FNHA 5IS2A 4P2MA 2XLKA 1F1BB 1FKOB 3HKZD 1YZ7A 2RAQA 4CLWA 2GA7A 4USJC 1HBNB 2WVCA 1KRPA 3R5CA 2Y9HA 4DZDA 1HIYA 1VRQC 1B0VA 3CF5Q 3BGRA 2FYXA 2BW2A 2QIFA 3JQJA 3IWLA 3MTJA 3X3UA 9ATCB 4DL5A 1IBKJ 3JTPA 5HMZA 2DNOA 2VA3A 1CS4B 5FDLB 5BR8F 1IBMJ 2WSCC 3D68A 3DM2A 1Q5YA 1MU2A 1RISA 2B6AB 2HAIA 3CCMS 2XGPA 1CVJA 3W5ZA 1S12A 4EO6A 2O66A 2VC0A 1WEZA 3EYZA 1ZPVA 4EBEA 1Y3KA 1NK0A 2HHSA 5JJBA 1XR5A 2RRBA 5KFIA 4J9QA 1T9UA 4HTJA 3DOLA 4X4VA 1YHQS 4DSKA 4RBVA 2K3IA 1MWQA 4FXVA 5E3CA 2FIUA 3C6UA 1GFWB 4P2FA 4KR0B 3UQSA 1GK8A 2FZKB 5CA5A 4FBTA 2KZMA 2DNMA 2PN6A 4NZ6A 5IM0A 3FBBA 1TV6B 3MPUB 4LRAA 3A1YG 2CIMA 5KFTA 1VJWA 3CD6S 1RTIA 2UU9J 4XK8C 2R2TA 1NPKA 1ZS6A 3OJUA 3K7RA 2MJUA 3A3NB 3B4DA 2VKZG 4OZ3A 2KN4A 3LOUA 2DISA 1HQEB 2XSJA 2WBMA 2D69A 4ETXA 5RUBA 1SJ4P 1YRXA 2ZH4A 2OGUA 3F44A 3FRYA 2DR9A 1EJ7L 4GKKF 3UR3C 3I4HX 5FLXY 2BE2A 4LQ9A 4DV0J 5M2PA 4Y6IA 3G6YA 2J9EA 4DFPA 4PXDA 3PEJA 3HHEA 2HW3A 3HM9A 2MY8A 2R2RA 3FRZA 1P1LA 2D9OA 5KFSA 5KFGA 1SKRA 4KH0B 1XNQF 2APOA 1FJEB 2BEFA 2FJWA 3G2XA 4CO2A 2RDDA 3JTOA 2E5LJ 2V9KA 4DL0C 5D77A 4CYUA 2KG1A 1HW9A 1U1PA 5GADU 3VAKA 4KAIA 1CJVA 1ZA2B 4O3SA 3PJ9A 4B02A 2IDEA 1CC8A 3OFEA 4WP8A 4CO1A 2W4CA 4DN0A 4EYHB 3QGHA 1QM9A 3FQLA 4WXOA 4FYXB 4DL7A 1QAJA 1PILA 3ETOA 1L5UA 4FF4A 2E1RA 2IAJA 2CJKA 4WFBQ 4ECQA 3NOCA 3QSYB 3WQPA 5GVQA 2KHCA 5GAHI 1I6JA 3SQGA 1WSRA 2LMIA 1FTCA 2GO8A 5CCLA 1FJGJ 2LCWA 1SC4B 3EDRB 6FD1A 4DU7A 5HATA 2MQLA 2ZZTA 4CH0S 2W25A 4USIA 2V0NA 5KFQA 3FNNA 3DLGA 1HKAA 2BOAA 4E98A 4OHZA 3DOMB 4LFBJ 4IOBA 2BR0A 3HULA 4F36A 3MM5A 1GMVA 4ECXA 1LXJA 1ZH5A 4F4ZA 1JLCB 3IA0A 3GSIA 3PRBA 2E7VA 4DWIA 2ADBA 2PI5A 5LJ5Y 3TNVA 1RT6B 4RW6B 4ZP6A 4C0HA 2DBBA 3JQKA 2Y1LB 3GE9A 3M8PB 4GO5X 1LWFB 5DQGA 1FCAA 1ZTTA 3ITHB 4WTYA 2D74B 1PIEA 4MYTA 5B0FA 3GJRB 4YR2A 3RBZA 3EZ5A 1T9WA 3Q86A 4KV8B 1N32J 4KHPF 4DR1F 1CLFA 2C28A 3UDLA 3NCPA 3BGLA 4OZLA 1EARA 2AV5A 2LDIA 1RWOB 3MPDA 3T1HJ 1X4HA 2BKNA 4LFAJ 3GLJA 2XI3A 3JSMB 3SDEA 2NXUA 2W8LA 2F40A 4FF2A 3FMBA 4PAAA 1X4BA 3P5TL 1WEYA 3EE3A 4P2SA 3C6TB 2YPYA 1Z4UA 3LAMA 4MFBA 1Y10A 4NXNF 2NQPA 4Q45A 2ZH8A 3TOQA 3QATA 5AT1B 4X4NA 3MECA 3CT9A 4OX9F 2UXBJ 3TA1A 2W24A 1HQUA 2L48A 2KI2A 4RNMA 2RS2A 4RW8A 3ZTPA 4Q0BA 1S9FA 4DR7F 1RT4A 2MZQA 4H4KC 4QIGA 3ISZA 1TKZA 3RAXA 3CCRS 4B3OB 1S10A 1EZZB 2AJFE 3GB0A 3I5AA 1GX5A 5D15A 3L7PA 3PW0A 1WHXA 2RHQB 3HZGA 1YWXA 1T7PA 3U1LA 1JWWA 4MK7A 2HQCA 4NL5A 1PYTA 4IG0A 3TUIC 5IT9Y 2DNQA 1FT8A 1FDNA 2LQ8A 2VBXA 5KFNA 3QBCA 4DQSA 3CMAS 1D9AA 1FWPA 4QR2A 1N36J 4FF1A 3Q8PB 3IS9B 5A8KB 3TO8A 4Z7CA 2JSXA 5LOQA 2MLZA 4OYMA 5HROB 4N47A 2JC1A 4R8UA 2LEBA 5IC4B 3LO3A 1AA1B 3PYFA 2J5AA 2KYZA 2KFZA 4AE5A 4JOUA 1U02A 2ZBCA 3J80U 2KXFA 1U2FA 4AYBD 1D09B 2W9BA 4X84A 2HBZB 3TX0A 2B5JA 1EQMA 2DIUA 3ADAC 2U2FA 3THTA 4NYZA 4W98A 4I2PA 5I4MA 4F3OA 2M7SA 1OY8A 5B7WA 1D9FA 2JOQA 4OLPA 3BKUA 3W64A 3TJ8A 2MZ1A 5AJ3F 2ATCB 5GAEI 5SUHA 5B0EA 2MDAA 1Y3JA 2M2BA 3RW7A 1H3DA 1H7WA 3ET6A 4ZCIA 2X1AA 2R7RA 3T1YJ 4AL7A 4ZPAA 4G1QB 3I4PA 1N88A 1KTVA 3ZO7A 5KT3A 1O0PA 3TJAA 2QEXS 4KKOB 1X4DA 4LF8J 3D7SB 4CLSA 3KLFA 3KDOA 3EPGA 3K5PA 1ZM9A 2O1PA 4ZVPB 3LGMA 1OO0B 5DLFA 2GQQA 2RQ4A 1CQMA 2K1RB 2IC3A 3QO9B 4ZP9A 2ZEJA 5J2NB 3MMAB 1KC8T 3CD5A 2V8HA 4UOCA 4NYPA 3KOAA 5KT6A 4PQUA 2PGCA 1NKCA 3M30A 4YOEA 4U7CA 2G2OA 2DRAA 1HNIB 4NLYA 2KH9A 4ELVA 4LBIA 3TW0A 4Q43A 3QGPA 5F8IA 1NK8A 3T9NA 3H4DA 2FDNA 1TL3B 2DGSA 4J5OA 3H2UB 4CNZA 2VDIA 1PBAA 1TFYA 2ZBIA 2DR8A 4KC5A 2MKIA 1P27B 2DR5A 2R2SA 2YQ1A 4ED1A 4EFAC 3AB4B 4PKDB 4R0EA 5M2UA 2V6AA 1G7CB 2OI2A 2CUYA 5KFJA 1T05B 4C8NA 1O51A 3Q24A 3EPIA 4G3IA 4FPRA 2AX0A 1H7XA 3I9V9 2YWKA 1WDDA 1IM6A 1UCNA 4ED8A 1EB0A 3QJPA 4P6QA 2IJRA 1NKBA 4LRCA 1UETA 2Y0SD 1DTQB 4OMFG 3OFGA 1KVJA 2QLFB 4KTQA 3GV7B 1BE4A 4KO0A 4RUBA 1FXRA 1U6ZA 3D3CJ 5CYMB 2ZOMA 4OYWA 3IM8A 2Z57B 4DLGA 3M1VA 2HYIB 3AJDA 1SIZA 2NREA 4DU8A 3NCRA 3DGPB 1TL5A 1IKYA 3CCJS 3HCXA 3NNAA 3CJKB 2JC0A 1Q79A 1HFEL 2QC3A 2OPQA 3KJVB 1TKTA 4FVMA 1NK7A 4EU0A 2Z58B 4O3PA 1YBAA 5B0DA 2JEJA 1MMLA 2W7PA 1NKEA 4FKXA 2CPYA 4UT4A 1HD0A 4IOAQ 1CS4A 1FDDA 4ZCLA 3PR5B 4CM0A 2JLEA 4DFJA 3I0RB 3M2UB 1F60B 5J2PA 1C0TA 5HN0A 4J9UE 2OP5A 1HBUA 3FEYB 2AGOA 1R7IA 1REVB 2HHHJ 1L3KA 5EN1A 2QT7A 2DHXA 3KJNB 1BQMB 1DBDA 1GMWA 3PR4A 1OSDA 4JI4J 5GMDA 4ZVEA 4OHWA 5CYJA 4USHA 3JYTA 3D1QA 2UUAF 1S1XB 1JJ2R 4M5LA 2R8IA 2XC9A 3SZ2A 2P6SA 3OVBA 1KQSR 1N52B 2GMJA 2HLTA 3UFCX 3GP9A 1UL3A 1LWCA 1RT1A 1K1SA 4FS2A 4URQU 4O44A 3MM9A 2ILYA 1U6FA 2ZUGA 1S6UA 1D3WA 2K7KA 3LGHA 2AP6A 3THVA 1NBEB 1OS5A 3P5BP 1QSSA 2QLWA 4ZOSA 4B3MF 5DG9A 2OFHX 5DM6Q 2GVZA 3GYXB 3UD4P 3V81A 4M5JA 4JI1J 2HGNA 3AA8A 4UOFA 2AJ1A 3FFIB 4DCPB 4M5HA 3MOJB 4MH8A 3A3PB 2V68A 1TELA 4U9RA 2EPIA 2KYXA 4J9OA 5A8RA 2QLXA 4DV4F 3R2DJ 3BREA 2JVOA 4DUTA 2HFOA 2ILZA 3HKWA 3WC2A 2WK4A 3QT6A 3TZZA 1Y11A 1GXTA 1FEEA 2DB1A 4ED4A 2FY1A 2RKIB 4QCLA 1RI7A 4DN9A 3PJXA 3NMAA 4IG3A 3FC9A 1DZ5A 3MI7X 1S9GB 2HNZA 2HZVA 3W9IA 1BHNA 3SFUA 2YTCA 1UZHA 4K0KF 4DV2J 2DNPA 4P9SA 1QE1B 1IVZA 2BJ1A 3EVMA 3PKMA 3MM6B 1R31A 2XCPA 3G8QA 4N56A 2RHSB 2ZVIA 2PC6A 4X4SA 5FIIA 2FLNA 2DHAA 3TA2A 2V50A 1NM2A 4MYUA 4WE1A 2W4DA 4HEA9 1PG5B 3C15B 1NEEA 5CHCB 3WX8A 3W9JA 1T8EA 3KG4A 1X5OA 3MUMP 2EG1A 3OVSA 3D67A 4LF9J 1SQFA 1SL2A 4I1TA 4E0DA 4RNHA 2CFXA 1UTAA 5K8PA 3KMSA 1LFPA 2OPSB 4JYAF 3CMES 4TLRA 2NPFA 2UVUA 2C3PA 1E6YA 1YDLA 1WC1A 3PYGA 2IRUA 3QZ7A 2NZCA 1HHTP 1U8SA 2FGOA 2XNQA 2ZKUA 4M94A 2W2NP 1FA0A 5E3QA 1REGX 3POTB 3KNGA 3DXBA 3GONA 1A0OB 3TVKA 2VUGA 2HLUA 2AQ4A 4X4UA 1R0AA 1NK6A 2OTLS 4EBCA 3M32B 3RB3A 5D8HB 5H1SV 3GYNA 3MEDB 3H42A 3CO9A 3WBZA 1FK9A 3VAFA 5ETPA 1HWKA 5MLCV 2PD1A 1HMVB 3LWMA 1FRIA 2G2ZA 4CTAA 1RABB 2DO0A 3J81U 3GIKA 1RADB 3AJ2A 3IR6B 2RU9A 2QMWA 2D41A 3PKYA 3K59A 1RT7B 2I2YA 1OIAA 2HWIA 5KFKA 2EW9A 3TVYA 2W8KA 1K73T 4H4OB 1NJWA 1UZDA 4DSJA 1EIYB 2EFGA 4C8LA 2KTQA 2AMCB 4IRCA 3TX8A 4NI2B 4HT5A 2L08A 2RQKA 4DV6F 4KIAA 2XYGB 3NL0A 1X5TA 5DQHA 4HR2A 2BE9B 2GIFA 3MMBB 1DAXA 2ZH5A 4DF4A 3UD5A 3VVUA 3SI8A 3DRRA 1ROFA 1HWIA 2NYHA 2C22A 1JLGA 3V6KA 2VD3A 4C2MA 3V4MA 4MTPA 3W2WB 1B3TA 5KG4A 4ED3A 1FRXA 2MZTA 1VQLS 2MY7A 2F5GA 3ENAA 1FEHA 3NWGA 4DEZA 4QIWD 3T5KA 2RD5C 3HHKA 4PABA 2GQ2A 3DXSX 3QIPA 3SV4A 4J9NA 2V69A 3T6BA 2YVSA 2AJ4A 4JV5F 4NPOA 4U7UK 1QAYA 3G4SS 1PKUA 3P45B 1QY7A 2JEGA 3R7BB 3DHWC 3FCVA 1R8AA 1EAYC 2I38A 3V5RA 1RT5B 4Z7YA 3I5BA 2ATLA 4NCGB 2BJ8A 5A0YA 2I6WA 1E6VA 1JLBB 2R7VA 1VLOA 1FXDA 3O6QA 2AJQA 2A6MA 4RW9B 2JEFA 3CNQP 4DR6F 2CPDA 1JB0C 5K5MA 3VGVA 3CMQA 3W62A 3K5NA 4A8WA 2GHPA 3EJMA 2YX7A 3IG1A 3S01A 1LWEA 1WF0A 3FJ2A 4I2QA 1T03B 4UY8T 2HK3A 4I56A 2JEIA 1T3OA 2DIVA 1TMMA 1NK9A 1U2CA 2IJNA 4I0WA 1FVSA 1OY9A 2HHUA 2ZITA 1VQ5S 3OHBA 3K5MA 4XIUA 5KFYA 2SXLA 4ZLNA 3NAIA 3CULA 2LLZA 3H98A 4LF2A 1LW2A 4RUCA 4YB7A 1RLCL 4NCAA 2QGFB 4OYIA 4LREA 5BYQA 2DJWA 2LYVA 2PDAA 3BPDA 3F73A 3QLHA 3AODA 4LUBA 2Y8WA 1XR7A 1NZAA 3LWLA 3DGVA 1XMQJ 4ILLA 2VA2A 3MM7B 3PJWA 4AXJA 1WG5A 1WSVA 5DG7A 3BBBA 4C7QA 2D3UA 4DV1J 2B9EA 3HZEA 4WU3A 3SCIE 4C6AA 3TQ1A 3GPAA 3W8PA 1LKZA 3LF0A 5KFBA 4U8YA 3ZZRA 2AF6A 5LMNJ 2DHHA 2XHWA 1V5IB 1Y0HA 5D3GB 4X62J 2C2ZB 1VRTA 1SV5B 3S6EA 5I3UA 3E3XA 5DDQC 5B09A 2R8GA 5DETA 1RK8A 2BJ9A 1SL0A 1BLUA 4I67A 3SCKE 4AXIA 2CJ9A 3TUJC 1RTDA 1JJCB 3MEGA 3VGTA 2UZAA 3Q89A 4ANEA 2ZM6J 2ZE2B 1UVJA 3K57A 1D0EA 1S9EA 1TAQA 2NUHA 2QL9B 1SC1B 4OFZA 3JAMY 3CDWA 3TUPA 5L1JA 4P10A 2H5EA 3D3BJ 4XTTA 5K9FA 4S0MA 1RAEB 4RBUA 1TL7B 5I42B 5KT4A 2VG6A 4NLXA 2EFNA 4EWTA 4J9VA 2XWYA 3ISNC 2UVVA 4MKYA 1RTHB 2R4FA 2J0SD 2KFNA 3WIUA 4X64F 3IC1A 2RNEA 2YQ3A 2IRXA 5C5JA 4QJVA 3DRPA 5DM7Q 3TAMB 3C2PA 3OTBA 4LF5F 3PW4A 2HNDA 3DLKA 1S1UB 1RAHB 2CWXA 3M4XA 5M2RA 2VKRA 4USUA 1XNRF 3G8SA 1XEZA 4LT6A 2DPIA 5DDOC 1FERA 2FJBB 1FKAF 2VONA 2RRAA 1AYEA 1Q8IA 3OL8A 2VODA 3TANA 5F8HA 3CJ8A 3HFZB 4OI1A 2A0FB 1DTQA 4LBPA 5H9FK 3T6JA 1TK0A 1WD6A 3ENQA 3OBIA 1IXKA 3OQ2A 3P3DA 4LVNP 2DRBA 4TU7A 3G86A 1T9YA 4B3TJ 2R2UA 2XS2A 2DR7A 1M1GA 2B43A 3HDSA 4FYVB 3CE8A 4JI3J 3PY8A 1QLNA 2FC8A 1VRUB 3JSRA 1HNZJ 1QDUB 3CJQA 2MB0B 3DC2A 4CLZA 3DLEA 1RLDA 3VR1A 4LRFA 1BMQB 1NHKL 3I9ZA 2XMTA 1KLMA 1SCJB 2Q43A 2V8VA 1S1VA 4HVZA 3BN4A 2V2KA 3D5MA 1WJ9A 4KFBB 3MGJA 4W92B 3PRDA 1VQ9S 5IQQA 1NRKA 1WI6A 2ZFHA 2GVDB 3LGNA 4DJBA 4NXMF 2DGXA 4ED0A 4HI1A 1GX6A 4C0OC 1YTYA 4A8SA 3HHNB 4OHXA 4ED2A 5L9XA 4NLDA 2EK6A 5DO2A 2HIQA 4OV1A 5KFOA 2JHEA 2UUCF 5AE3A 3BH7B 3RZAA 4ED6A 1R89A 3MFIA 1PAEX 2QLBB 4PG7A 5EDWA 1F2HA 2XCAA 3ETMA 2IM2A 3OUYA 3VAGA 1I94F 1W26A 1Q82T 3DLHA 2J8SA 4M63A 1R6VA 1KQFB 1MW7A 3RR7A 2FUG9 1TU0B 4IYQA 3KYLA 1NJZA 2BQRA 3D6TB 4LR7A 1NSQA 4GO7X 4UF4A 4QR0A 1RQ0A 4OJ3A 3HSDA 1D8YA 3R1LA 2IJFA 2CDQA 3DMJB 2PFDA 3T41A 1URRA 4ZVFA 2CRLA 2IFXA 3M8SA 3ISND 2YPZA 4ZJLA 4RW7B 4DV3J 2Z30B 3SCJE 4B9VA 2E7XA 2VG5A 2W4PA 2F7VA 3GZ7A 4QW8A 1C4CA 1ITPA 1CC7A 4JI4F 3MCSA 1VQYA 1CJKA 2DNLA 5EWFA 2CKWA 1CULB 2FLLA 4M5IA 1RAIB 4I7FB 2ASJA 3R5BA 4R0JA 1R8PA 1W25A 3MD1A 1WG1A 2VASA 3QGIA 3MXHP 4LF7J 4K4SA 4EEYA 4CO3A 4A8YA 1RWUA 1JLEA 1OMSA 3UPFA 1S6PA 2KKHA 2B9WA 4LR8A 4ATNA 3GJQB 5CH7B 2OEMA 1UVKA 1RACB 2N7YA 5IXUA 1C2PA 4QYZJ 2PIIA 4DXLA 1X4AA 1S9GA 4NMXA 1DQ9A 3OFHA 2VFTA 3BGRB 1WKJA 5HLFA 2E9TA 1S57A 2OPRA 4EZ9A 1UPPA 4KSEB 3ILJA 5AXLA 2ROEA 1Q16B 4Y00A 1N33J 4TQSA 5HMYA 4A8QA 2DGOA 3DM2B 1MU2B 2HFZA 2CJQA 3BQ0A 4PUOA 2D7SA 1VBXA 2J0XA 2MHNA 1FJ7A 1JNRB 2M8DB 4C4WA 2F4VJ 1UJ4A 3C46A 4DV2F 4DR3F 3MEEA 2Q3PA 3U7JA 3IN5A 2KT5A 3DOLB 4NZ7A 4LSLA 1X31C 1F9HA 1N6QA 3EUNA 3R1HA 5EX0A 3KUEA 4D3HA 2W2OP 3C6UB 1YGYA 2M88A 4TNOA 2B4PA 1Z1ZA 2VFVA 3JTNA 4ID5A 4K5SA 2ZBQA 1FRKA 4AQYF 2KT3A 5IM0B 3MR7A 4ICLA 4PWDB 4W90B 1RTIB 2FGCA 1TKXA 2Y1JA 4LF9F 4OHVA 2YH0A 1XN9A 3JSYA 1DLOA 2NCKL 2VPZB 5T7LA 4ZN3A 3A4TA 4RZRA 3UR0A 1PC4A 1BWVA 2GW8A 3NGKA 3TQEA 2COLA 2KU7A 2LEPA 2IYGA 2XSJB 3VV2B 5LSRA 3RAQA 1YJ9S 4J90A 3QRRA 3MEDA 3H7HB 2HVIA 1HBMA 2LA6A 2ASDA 3KNAA 2BJEA 4QWCA 2UP1A 4GRSA 2POKA 3F56A 2GV1A 2YWHA 1EP4A 5GAEU 1UWBA 2CQDA 1IKXA 3EZUA 2BE2B 3CJ4A 3CW2C 5THWA 3Q22A 4UUWA 4LR9A 4F4XA 2C2EA 4DSEA 1YJWS 4WIIA 1IQTA 2Q1LA 3VVTA 4O0NA 1TR0A 2MGZA 1RB0A 4K4VA 4ECUA 3B78A 2PT0A 2HNYA 3WC0A 4NOHA 3BBFA 2ZHBA 4BC9A 4TXSA 1XK8A 1OY6A 4CYUB 3P49B 3I96A 2V9WA 3MR3A 1NNDA 5FLXU 1CJVB 3EZOA 2G1DA 1J5EJ 3Q83A 4KT0C 2MQPA 2LQJA 2MKJA 3BKTA 2LP4A 4R25A 3RJMB 1U8WA 4ES3A 2IA0A 4GMKA 2AIRB 5KFHA 2BVZA 1S0MA 4O23A 2N3OA 4QIVA 2NXEA 3KHLA 4IR9A 2IAJB 1SUQA 1M5SA 3OJSA 5EHHA 4NCBA 3WZ0A 4RO0A 1BD6A 3SQGB 2XS5A 4QWEA 4DUYJ 1RHMB 1Q4RA 2B7BB 5KFCA 4K4WA 2IDLA 5IWAF 3A8IA 3BBCA 1U2RA 2BACA 5CD4A 4LFCF 3CDAA 3GIJA 4IH7A 1FHTA 4IR1A 2QX0A 2HSEB 3UWTA 4E2FB 2MKCA 2R7XA 3M2VA 3DLGB 1S0VA 2R7OA 1VLYA 4GVBA 1Q7LB 3IWNC 2XB2D 1Q8LA 2LQBA 4ZVOB 1S6QA 1F3FA 2KVQE 1X5PA 2O01C 4HKQA 4H54A 3MM5B 3W60A 2OEKA 4H4MA 3GFHA 1GQEA 1T03A 1FX4A 1F9FA 5E5NA 3L7UA 3P8BB 1B99A 1Q8KA 1H72C 2LFVA 1S79A 3N6MA 2CPHA 3K8VA 4WP9A 1UJ6A 3AQOA 3B4MA 1OWXA 3HXMA 3CGIA 1SJFA 4X65J 4CLUA 4WIQA 3NBPA 1S1TA 3NEKA 4OIXA 4J9MA 3KLEA 3W61A 1N5TA 2YX4A 3FBCA 2R7SA 3NS6A 2H1YA 4CT9A 2YWFA 1VQ8S 3WX4A 4LF4F 2VBYA 1M5OC 4RUAA 4LSNA 3HHLA 2RH3A 1CJUA 1AUDA 2OPPA 1WC3A 4KJIA 3FZBA 1IWAA 4DV5F 4DUZF 4TU9A 1HPZB 4U7UD 1DQ8A 5ITHA 1Q7YT 1D8ZA 6FDRA 4JI2J 4HACA 5DJBA 4GVLA 3CDBA 2NPIA 1IBLJ 1WELA 5IOLA 5ETRA 2E1MC 3G71S 1MMDA 3ZXWA 4LIWA 3D4JA 4JI5F 4MFBB 5G4DA 4PQAA 4A8KA 1WTFA 2CADA 5D3GA 5DGBA 5DDRC 4CLLA 1SV5A 4PR6A 1V5VA 5KOWA 1HQUB 5I3PA 2KFYA 4RW8B 2RSQA 4Q0BB 1N5VA 2MTLA 4B9TA 1RT4B 5EX3A 2VOPA 2DYAA 4ZIWA 1VCTA 1HNXJ 4UUXA 4FN5A 4NE9C 2X3DA 3TP2A 3DRSA 4LRBA 4XDDA 3HMJG 4HL9A 2W2MP 4DS5A 3IMQJ 3PHEA 2HMIB 1I5OB 4IG0B 4I4BA 5E41A 1R27B 3CCZA 1M5VC 1O6XA 4JI6J 2V8GA 3VTIA 4KGVB 3QJJA 2MZSA 1UA0A 5FJ4A 4IH6A 5LMUJ 4YY3F 4DR5J 4DX6A 2KG0A 2W9CA 2DH8A 4WK1A 4JV0A 3CJSA 2Y1IA 3DKDA 1TTHB 3O8WA 2CQPA 1YQHA 1FVQA 4CDIA 4R8UB 1Y5IB 2Y0BB 2L3MA 2MEWA 2NXCA 4OLOA 2HS0A 3ILIA 3O44A 2CVIA 5CYQA 3KG0A 3ELHA 3IR5B 3VGUA 4X4PA 3HVTA 4PEOA 5KFRA 4Q8FA 2W9BB 2AZ3A 4MK9A 4W4MA 1AROP 3VHQA 2J9DA 2VQFF 2AEFA 2B5JB 5KFAA 1ZYQA 1YG0A 2W2PP 1T11A 1T3NA 4I2PB 4UQTA 1XBWA 2XLIA 2WSEC 1K8AT 1KOOA 3G82A 1NB7A 5GAGU 1F5BA 5HQMA 1P9YA 1UWAA 2BRLA 1SVDA 3ET6B 3MDFA 3FKBA 3MURP 2DXFA 2MYFA 1KP6A 4QR1A 1NLKL 5KG2A 4URGA 2GFFA 3RB0A 3KLFB 4XAKA 3ULHA 1N5YA 3D6FB 3K17A 2AZ1A 2ZNZA 2ACMA 2CXEA 5JVHQ 3QMQA 5D4NA 1KD1T 1C0UA 4YDXA 1QSLA 3W5XA 4URSA 3D6MB 1WACA 1XMBA 4CT8A 4IFYA 2IC3B 5EWEA 3W8GA 4PPDA 1VQNS 2WHOA 2LXUA 2F3JA 2GVDA 3VQSA 2ZVSA 4ZVTB 2V8DA 4AL6A 2WONA 2IHR1 2C2NA 2ZZNA 3L7OA 4PQUB 3R6LB 2XULA 3ZZPA 4DQIA 4G1IA 3M30B 1DY3A 1PO6A 4RWXA 2RJZA 2GMLA 1N8RT 2BE7D 2HS3A 3OV7A 5KT5A 4UZCA 3NNHA 2J9CA 1YVFA 5L8RC 3IP0A 2PMWA 2B3TB 1H2VZ 2CPFA 3JQMA 5BXIA 2DRDA 2HEKA 2OTJS 2MKYA 2W1BA 4R5PA 2JDJA 3Q23A 1EETB 5FD1A 4CH1A 2YH1A 1M1KT 2HBRB 4WFNQ 2XEXA 2XY5A 3OLAA 2X3GA 3P6YC 1KONA 4ER8A 2VG7A 4M95A 4N7TA 3N6NA 4OX6A 1VK3A 3CCTA 2QFJA 3CCLS 2JZ5A 1R8CA 2GAHC 2GIQA 1IKVA 1JKHA 1DQAA 5E7OB 4P74A 1VMBA 4K5RA 3AXMA 2XZWA 5HBMA 4DFMA 3W5YA 4L74A 5E3RA 4J9KA 1ICEB 2F9JA 5J2QA 3VGSA 3B8HA 4K4TA 3N9UC 4PXBA 1Q5VA 4DDFA 1T9XA 2DITA 4C48A 4NA2A 5E2QA 3TVZA 4OHYA 3T5LA 4F0KA 2DNKA 3LW5C 1S77D 2FJXA 4PG6A 5CABA 4LJMA 4KO0B 1JK9B 2KT2A 4ZA1A 4Q2LA 2BJ3A 2HZAA 2IMOA 3CCWA 1ELOA 4Y2AA 1KHWA 3M1VB 2V4QA 2VICA 3H20A 1IKYB 4WU2A 4HH1A 4JUZA 2OPQB 5C24A 3VQTA 1I51B 2ZH9A 1TKTB 3VALA 3O1LA 2XO7A 2C3UA 1VISA 3KK1B 1RCOB 2KZZA 2ADCA 5HP1A 3DU6A 4K50A 3CJ5A 2RF2A 3W66A 5L46A 1HNVA 1KQGB 3UN2A 4JI7F 2R8KA 4B9NA 4B3RJ 3M6XA 3P96A 1WF2A 4LF6J 4X66F 3N4WA 1M90T 5CZXA 3Q8VA 4ECYA 2K8GA 5J2PB 3AHPA 4JI8J
chains in the Genus database with same CATH topology
1N5YB 3FDSA 1U8SA 2FGOA 2XNQA 2Y1RI 2ZKUA 3OTCA 1N5QA 2G0CA 3OR1A 4M94A 1FA0A 1X5SA 5CZVA 1SJRA 1IR0A 5E3QA 1HBUB 3M6UA 3N5FA 1VS3A 2EWHA 3POTB 3KNGA 1C0UB 3DXBA 5KFUA 2QYCA 4HDGA 3MFHA 3TVKA 2VUGA 5GMKa 1YSJA 4XDCA 1MMNA 2DGWA 2RMLA 2HLUA 4FNIA 4IFYB 5MAOA 2AQ4A 4B3SF 1R0AA 2WSFC 2NUUG 1NK6A 2HGMA 4X4UA 2OTLS 1HBOA 5B0AA 3BB5A 4EBCA 3DHXA 3T3FA 2FJAB 1RT3B 3M32B 3RB3A 5D8HB 3BGUA 5H1SV 3GYNA 2PFFB 3MEDB 1LK5A 4L72B 3BS9A 3CO9A 3W2VB 1ZM4A 2RIJA 5U47A 4MAKA 3WBZA 1FK9A 3VAFA 5J1PA 2ALZA 1GXLA 3KHGA 1HWKA 3JYTB 2A2CA 2KVIA 5MLCV 2PD1A 1W2BR 4PRFA 1HMVB 2WONB 3LWMA 1FRIA 2EFPA 4CTAA 4MKBA 1ULRA 3DI6B 4Y3CA 4BDPA 2FVPA 4PWDA 2IRYA 3Q8QB 4DV7F 1U4BA 2DO0A 2O3DA 2ACYA 2U1AA 4Y65A 4DR4F 2DK2A 3GIKA 2VFUA 3RBEA 3AJ2A 3RAMA 2J6SA 1M5HA 2RU9A 3E01A 3IR6B 4V19J 2QMWA 3D0HE 2CPIA 3MM7A 1LWCB 1RT1B 2D41A 1CEZA 3HVRA 2UVRA 3PKYA 2E5IA 4O44B 4NLPA 2XNRA 2E5GA 2F9DA 3MM9B 2AJ0A 3K59A 1R6YA 5KG3A 1RT7B 1OIAA 2HWIA 2RILA 5EUHA 3SDEB 3KK2B 5KFKA 2I2YA 2EW9A 2G9OA 3OXLA 3TVYA 2W8KA 4BS2A 2EG2A 2MQMA 1K73T 1HNWF 1DURA 5IT0A 2B9YA 4H4OB 4QOTA 1VGYA 1NJWA 2CQ3A 1KLNA 3NNCA 1QUVA 4F3QA 2AU0A 2BRKA 3BSOA 5L1KA 3CJ3A 4DSJA 1TL1A 4F4YA 5KFWA 3MMJA 4IQMA 3V4IA 2QRRA 4TY8A 1NK5A 3E51A 2EFGA 2YNHA 1HWUA 2F1FA 4R5PB 4C8LA 2KTQA 2L9NA 3AAWB 1KQKA 2A10A 4I6YA 3TARA 2D3OR 4IRCA 3TX8A 2MPUA 4HT5A 2HGLA 2L08A 5B0CA 2RE1A 3KLGB 1HYSA 3V81B 4I68A 5C25A 2FHJA 2RQKA 4QIEA 4DV6F 4KIAA 4DPOA 5EWGA 2X1BA 3MECB 1UVLA 1S6OA 3DDKA 3NL0A 2E5HA 2ZOFA 1WHWA 1X5TA 5DQHA 4RNNA 3CJ0A 4YR0A 2YX1A 2VG7B 1F2GA 3DYAA 3MMBB 2WCXA 2DCLA 2RUGA 2XMWA 1DAXA 1RA7A 4TYBA 5A8RB 2GHWA 2ZH5A 4DF4A 1KSPA 1O5JA 5HO4A 1NJIT 2V5HG 3Q0AA 2YY3A 3SI8A 2HHHF 3DRRA 1TKZB 1IKVB 1JKHB 4YEAA 2CVEA 4F4WA 4JBCA 1ROFA 1HWIA 4A8MP 2C22A 3ENVA 4OJHA 1JLGA 3V6KA 2VD3A 1SJQA 4C2MA 3V4MA 1WTBA 1A7GE 4MTPA 3W2WB 2HFNA 5KG4A 3V6HA 5HBMB 1TK8A 4N5SA 1ZAVA 4ED3A 4DF8A 4ZHRA 5B0BA 1FRXA 2MZTA 5KG7A 1VQLS 4IG3B 1NK4A 2MY7A 3DOKB 2F8EX 5J2QB 1FEHA 2HNZB 4O4GB 4AFFA 1ZAXA 3NWGA 3NS5A 4DEZA 2ZE2A 4QIWD 2KRRA 3T5KA 3N79A 4QU6A 2YNIB 2RD5C 1UW4A 2C2DA 3HHKA 2GQ2A 3DXSX 2HZCA 3CUNA 2IM1A 3QIPA 3SV4A 1S97A 2G4BA 2LA4A 2N82B 1N48A 3PX4A 1ZM3A 4J9NA 4NA3A 3T6BA 1ZZFA 4O3NA 2YVSA 2AJ4A 3EGNA 3HT3A 4NPOA 4JV5F 4U7UK 3OPKA 2N3LA 4ECWA 1VQPS 1QAYA 3G4SS 1ZTWA 1B0PA 5L1IA 4UY85 5I42A 2QA4G 1QY7A 2ZH3A 3D1OA 5KTQA 2JEGA 3DHWC 3G8TA 3QYYA 3PW2A 4F8RA 5HI7A 1R8AA 5CXTA 2J7UA 3RR8A 2I38A 1RTHA 3V5RA 1RT5B 2DTJA 3I5BA 1AFJA 2MZJA 2ATLA 3TAQA 3LQVA 4A4JA 1KS2A 4RU2A 3PX0A 2EKYA 2VZ9A 2EFQA 4WE1B 4NCGB 5A0YA 3K0JA 1E6VA 1JLBB 4PWUA 3CSKA 2R7VA 1D9DA 1FXDA 1WHYA 1G3OA 3MWBA 3O6QA 2AJQA 2ABYA 2J0QD 1LW0A 4RW9B 4ZP8A 2JEFA 4JI1F 2HRYA 2LECA 3IBWA 3BO2A 5C24B 1U1KA 3TAMA 1VQ4S 3GWCA 4DR6F 2CPDA 2V4JA 3MR6A 2NLWA 1S1UA 1T94A 4EBDA 4ED7A 3H5UA 1JB0C 5K5MA 1NHVA 4BHQA 1AXQA 2E44A 3FEZA 1K0TA 2GJIA 3R5AA 1OQ6A 4ILRA 3K5NA 4A8WA 2GHPA 5DLGA 5HP1B 4A8FA 1C4AA 1VC0A 4ZPDA 2YX7A 5EGYA 3IG1A 2BJDA 3S01A 2RF2B 3S7RA 5ADZA 1LWEA 3M9MB 1WF0A 4KGKA 1Y5LB 1HNVB 4CQ1A 4CCHA 5BYSA 2XSFA 3FJ2A 4I2QA 4A8XA 3ZZZA 2JVRA 1T03B 1FXLA 3FQKA 4RW4A 1QAIA 2C3YA 1BGXT 2E9ZA 4UY8T 2DCUB 1FKOA 2B4OA 3Q2SC 4I56A 2XY6A 4ED5A 2JEIA 4MIBA 3KLVA 4XPEA 3OL6A 5DG8A 1T3OA 2DIVA 2QE5A 3BSCA 1E6YB 1NK9A 3GG0A 1HBNA 1BQNA 1LQ9A 1SXLA 2IJNA 4I0WA 4NX9A 2I5JB 1FVSA 2WOMA 2HHUA 2KXHA 1W2IA 1FRLA 2ZITA 3SSQA 3J7Z5 1VQ5S 4WK3A 1X0FA 4Q5VA 3T9ZA 3OHBA 1FD8A 1Q8BA 2EFOA 3OXGA 4XIUA 5KFYA 3K5MA 1PGZA 2HHPA 2SXLA 1QVGR 5CCMA 5KFVA 2KM8C 3OR1B 4Y2KA 3IAM9 3NAIA 3CULA 2LLZA 4OL8A 2CQIA 2VPXB 1HA1A 3C8YA 3H98A 1LW2A 4RUCA 4QQBA 4YB7A 2I0XA 2M0GB 2FJEB 4M1KA 2XLJA 2ZHAA 4NCAA 3CCES 3H25A 3TYTA 1R0AB 2DNRA 5FDLA 2M70A 1HBOB 2OAUA 3LH2S 5IZHA 2BXJA 5BYQA 2DJWA 2FVQA 1VFJA 2KJVA 4OI6A 1NH7A 2B6AA 2LYVA 5K8OA 4PXEA 1FK9B 3FVYA 2PDAA 3Q2TC 1Z2ZA 3D2WA 3EXCX 5I3QA 3F73A 3J81Y 3QLHA 3MM8B 1HWLA 4LUBA 1TAUA 4Y34A 4CTAB 2CYYA 2R7UA 1VRUA 3FMWA 4U6PA 1XR7A 5HMXA 4DSLA 2HHTA 1NZAA 2MSSA 3KTQA 2HRUA 3LWLA 4ILLA 3UDCA 3PXGa 2C3OA 4KBIA 3E01B 2VA2A 2DGUA 2EC0A 3MM7B 3J7ZT 4Z2XA 4RLEA 3PJWA 4J9SA 2HHXA 4DMZA 2XGQA 4N8NA 4AXJA 1WG5A 2RQCA 3Q8RB 1SKWA 2UUWA 3MUTP 5DG7A 2E66A 1TUVA 4C7QA 3O2IA 2D3UA 2E1CA 4KFBA 1U7LA 2Q6CA 4E8UA 5JXSA 3GSDA 3RRGA 3HZEA 4WU3A 2XWXA 1UJ5A 4YUDA 3SCLE 3SCIE 3VZHA 2VQEF 3T5HA 5AE1A 3TQ1A 4X2BA 1URNA 1HI8A 4F50A 3DRYA 2MQNA 1RGVA 1LKZA 1TL1B 1SB6A 3LF0A 4TY8B 3I87A 5KFBA 3V4IB 3ZZRA 2HS4A 4G6VB 2AF6A 2YNHB 4Z37A 2W9AA 3I32A 4B3RF 1U26A 4CO0A 5G0RA 3VCDA 4FVCA 2XHWA 4ALZA 3I56S 4LF6F 1Y0HA 3US5A 2LKZA 4I6AA 5D3GB 1U6BA 3G6XA 1HYSB 5K8NA 1TV6A 1K1QA 5C25B 5H9FJ 1VRTA 1LV5A 4ZVGA 1SV5B 2VOOA 3T19A 1TQLA 3D28A 3IRXA 3S6EA 3M8RA 1JMTA 3E3XA 4MJKA 5DDQC 1C1CB 3OSNA 1VHFA 4DQRA 5I3UA 4F4KA 3BR9A 3CC2S 4JI8F 1CQNA 3DYAB 1N0UA 3N6LA 4YB5A 1S4FA 2OMOA 4L3NA 1FRHA 3IWXA 2VPYB 3IRWP 3RBDA 1VQSA 2OD4A 1SJ3P 2HHWA 2YKQA 5B09A 2R8GA 2ZD1B 3V2UC 1MWZA 5DETA 4DSFA 1IUJA 1RK8A 4FBUA 1FJCA 3SSSA 4CNYA 1HPZA 4YB1P 3DRRB 1Z2LA 4YDDB 2OLWA 3HFKA 1H38A 1SL0A 1BLUA 4NWBA 4B9SA 2UUTA 4C8OA 5HQ8A 2ZDPA 2CZ4A 4I67A 1JLGB 2IVFB 4XO0A 3SCKE 2VV5A 4WFXA 3KWMA 2JH3A 2VB6A 4AXIA 5J1EA 3I55S 3VAIA 2CJ9A 1VQ7S 3TUJC 1GAOA 4V19X 2BZ2A 4XPCA 1RTDA 3MEGA 5T41A 4ZCMA 4OZ5A 4RU9A 2UZAA 1HQEA 1ZPWX 3ONQA 5J2MA 4F67A 1B0TA 2CPEA 2NSCA 2ZE2B 1UVJA 2MSTA 3K57A 4C9DA 1D1UA 1D0EA 3F41A 3PM9A 3MPYA 1S9EA 1TAQA 1JLQA 3SV3A 2B7CB 2NUHA 3QIPB 2PMHA 1S49A 3DMJA 2IVYA 3PACA 4CO5A 4OFZA 3UCZP 3JAMY 3SFGA 2XS7A 4N76A 4MMOA 2PMZD 3CDWA 1HW8A 5L1JA 3DU5A 2H5EA 2BQUA 5K9FA 2R7QA 3CCQS 4RW7A 4YMEA 1YJNS 5F9LA 2VC1A 4DL3A 4RBUA 5L38A 1UVIA 4WFYA 2X1FA 4QWAA 5I42B 1IJFB 3GFXA 5KT4A 1FE0A 1LXNA 2VG6A 4NLXA 2EFNA 4EWTA 1OSCA 1ZAWA 2XWYA 3HI9A 3ISNC 5E0OA 4OI2A 3UI3A 2UVVA 4MKYA 1RTHB 1V6HA 2YKPA 4C8MA 2XMKA 2R4FA 3OSPA 3LP2A 2XG8A 2J0SD 2XMMA 2Z4PA 1MWYA 2KFNA 2Q79A 4NZ0A 4PPZA 4X64F 4IO9Q 3J7YU 3IC1A 4ZKAA 2MHEA 3M6WA 5A0YB 2RNEA 2YQ3A 2IRXA 3PW7A 1E6VB 1QAXA 2FHOB 1BQXA 1LW0B 5C5JA 3K2YA 4QJVA 3DRPA 3SYZA 4EO8A 4I7FA 5DM7Q 3TAMB 3C2PA 3OTBA 5DRKA 3PW4A 4LF5F 4B17A 2HNDA 2V4JB 3DLKA 3N0VA 4MIAA 1K9MT 5KG5A 1S1UB 3H40A 1IM4A 1T02A 4GKJF 3G96A 2HMIA 3MOZA 4I64A 1RKIA 5LSOA 4FP9A 3M4XA 2VL1A 5AXKA 3RB4A 1Y4ZB 2XY7A 5CQGA 5M2RA 2ZJQQ 2N7CA 3IG1B 5A6WA 2VKRA 2Z2MA 2ZC3A 1XNRF 3MR5A 1LWEB 3H59A 2EFVA 1JLAA 3G8SA 4K4XA 4WF9Q 3QIDA 4F3MA 1XEZA 4FNHA 3HJFA 5IS2A 4I2QB 2YNFA 4LT6A 4WZQA 2CPXA 1HI0P 5KFMA 4RW4B 2DPIA 1N34F 5GAGI 2XLKA 1X8DA 5DDOC 1FKOB 4ZPVR 1FERA 3HKZD 2FJBB 1Y5NB 3O3LA 4ECTA 3GR0A 3GMGA 4PCQA 1FKAF 3M9OB 2ZH1A 2GA7A 4USJC 5F8GA 3PIOQ 3SMZA 7FD1A 3PZPA 2HHQA 1HBNB 1BQNB 3MAHA 4OI3A 1YJRA 1KRPA 4DS4A 3R5CA 4NA1A 2VONA 1YRTA 2RRAA 2WOMB 1M0SA 1Q8IA 3OL8A 5F3TA 2VODA 3TANA 1QSYA 1R8HA 1B0VA 3CF5Q 5F8HA 3BGRA 2BW2A 2QIFA 4OI1A 1DTQA 4NLWA 3IWLA 3MTJA 3X3UA 1VI7A 2CQGA 1UEUA 3T6JA 1LW2B 4DL5A 4WYLA 4NRTA 1TK0A 1X4CA 2QA4S 2ERRA 2WB1D 3JTPA 1KN6A 1WD6A 2NYIA 5C42A 1U25A 3ENQA 1IXKA 3OBIA 3OQ2A 3P3DA 4LVNP 2YKOA 2DNOA 2N4CA 4NMLA 5HMZA 4TU7A 2DRBA 2VA3A 3MHYA 3G86A 1A9NB 5FDLB 5BR8F 4OX7A 2R2UA 2W7OA 2WSCC 1WG4A 4PG8A 3DM2A 1MU2A 1RISA 1HR0F 2B6AB 4KRWA 2XS2A 2DR7A 2HAIA 5KT2A 3CCMS 3OL7A 2XGPA 1CVJA 2AGQA 5D4OA 2B43A 4J9RA 1RYRA 3HDSA 4EO6A 2O66A 1U24A 3QLHB 3CE8A 2DGQA 2VC0A 1WEZA 3PY8A 2DNZA 1QLNA 3EYZA 1NH8A 1ZPVA 2FC8A 1VRUB 4EBEA 3JSRA 1Y3KA 2HVHA 3HHLC 1NK0A 4FZVA 1M5KC 3H5YA 2MB0B 2HHSA 3DC2A 2D3ZA 1BWEA 3IXQA 5JJBA 5LXRA 3NGDA 1XR5A 2HVZA 3DLEA 1G1XA 2RRBA 5KFIA 3VR1A 4MIWA 3DOMA 4J9QA 5KG6A 4HTJA 1SI9A 4Q7AA 3I9ZA 3DOLA 2XMTA 1AFIA 4X4VA 1KLMA 4JI0F 2Q43A 3I0SA 1YHQS 4DSKA 2H9ZA 4RBVA 2K3IA 2V8VA 1S1VA 1KFDA 4HVZA 3BN4A 2V2KA 3D5MA 4C3LA 4FXVA 4KFBB 4J9PA 3MGJA 4W92B 3TAPA 5E3CA 3PRDA 2CPJA 2FIUA 1VQ9S 5IQQA 3C6UA 1NRKA 1KEKA 3CTRA 4KR0B 3UQSA 3LALA 2KJWA 2JLFA 1WI6A 4IKAA 2RU3A 1L3SA 2CZVC 2ZFHA 1G6BA 5CA5A 4D3GA 4Y2MA 2HWHA 2R9LA 4ELTA 4ZK7M 2Q66A 2IM0A 1JLCA 3LGNA 4FBTA 4DJBA 1FE4A 2KZMA 5G0RB 4NXMF 4TYAA 2DGXA 1SIWB 2DNMA 2PN6A 4ED0A 4HI1A 4NZ6A 1IKWA 5IM0A 4QPXA 4OI0A 1GX6A 4C0OC 2LVWA 1YTYA 1RT6A 1TV6B 4A8SA 4RW6A 3HHNB 1VRTB 3QPIA 4OHXA 4HH0A 4ED2A 3A1YG 4NLDA 2CIMA 2EK6A 5L9XA 4C3KA 3UW1A 3IRXB 2GMHA 5I3UB 5KFTA 5DO2A 1VJWA 2HIQA 5A8WA 4OV1A 2OH2A 5KFOA 2VFSA 3CD6S 1RTIA 2HHVA 3OHAA 2JHEA 1P6TA 4XK8C 2R2TA 2UUCF 4OZJA 3OFFA 5L9NA 3OJUA 1SC6A 5AE3A 2L9WA 2E29A 4FS1A 1U1OA 3K7RA 2JLGA 3RZAA 3M8PA 1R89A 4ED6A 1LWFA 3MFIA 4PG7A 2MJUA 3M9NB 2KRBA 5EDWA 1GT8A 1S1WA 2XCAA 2MXYA 2QA2A 3ITHA 3B4DA 2VKZG 4OZ1A 2E1AA 2XMJA 1XC9A 1U47A 5J1EB 2IM2A 4C3MA 2GHVC 5E3PA 2KN4A 3OUYA 3VAGA 1RTDB 2A3JA 3LOUA 4B9MA 3MEGB 1I94F 1P1TA 2GQCA 2DH7A 2X1GA 2DISA 4KV8A 3M2RA 1HQEB 2M9KA 3GFZA 2XSJA 2WBMA 1Q82T 1X4GA 2UXCF 3DLHA 1S76D 1XMOF 2FD2A