2X3XD

Structure of mouse syndapin i (crystal form 1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
VRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 8
structure length 56
sequence length 56
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2x3xD00
2X3XD 3TSWA 2HBWA 4ESRA 2DJQA 4FSSA 2KT1A 1GRIA 1JEGA 4K11A 5IH2A 1M30A 1K76A 4RTZA 2K79A 2DL8A 1AZGB 4LE9A 1VYUA 1UDLA 2DNUA 4A63B 2EYZA 2RPNA 2VVKA 2FPFA 3PVLA 1FMKA 1X2KA 3LH5A 2YSQA 1N5ZA 2CSQA 4F17A 1KFZA 1WYXA 1SHGA 3UA6A 2FG0A 2O31A 3I35A 1RLPC 4RTWA 5FW9A 1A0NB 2O9VA 4OMPA 2MCNA 1SHFA 1ZUUA 2ED1A 4RUGA 3NGPA 2YT6A 2CH4A 2SEMA 2DBMA 1BB9A 2EQIA 4M4ZA 1NEGA 3REBB 4RTVA 2OI3A 5EC7A 1Z9ZA 2HDAA 3M0TA 4LN2A 5FWBA 2ED0A 1NLPC 2QDLA 5IXBA 2DL7A 2DLPA 2ESWA 1AVZC 1NG2A 1J3TA 2RQRA 1NYGA 3U23A 4CC2A 3M0PA 3NHNA 2EKHA 2FEIA 1UJ0A 2A08A 2MIOA 1X27A 1K0SA 2YUQA 2LQWA 2YUOA 2O9SA 2EGCA 2ROLA 2AZVA 1BU1A 1WXUA 2BZXA 4ORZA 2KYBA 2IIMA 1TUCA 1PRMC 1UE9A 2LJ0A 1YCSB 1Y0MA 3M0RA 2DBKA 2LX7A 1E6GA 3EHQA 1OV3A 2DM1A 5IHKA 4WCIA 1OPKA 5I11A 1OOTA 1M27C 4X1VA 2BZYA 2DILA 1KIKA 2B86A 2GQIA 1QWEA 2RQVA 4OMQA 1T3LA 2L3PA 2RQTA 2DL3A 4D8KA 3UA7A 2VWFA 4AFUC 2KROA 3VRYA 1U3OA 4AFZC 2JT4A 2J05A 4D8DA 1HD3A 1U06A 1H3HA 1X6GA 1FYNA 5GJWB 3QWYA 2CDTA 4AG2C 1QKWA 2GBQA 4IIOA 1SRLA 2JMCA 3THKA 3H0IA 3RBBB 5GJVB 4HCKA 1ZUKA 2DMOA 4ZNXA 2L3SA 1VYVA 1SEMA 2JXBA 4CC4B 2J6KA 3C0CA 1HSQA 1XOVA 2LJ1A 1ARKA 5HCKA 2JMAA 1AOJA 1JXMA 1JO8A 1GCQA 1TG0A 1K0XA 2L3QA 1JQQA 1WFWA 2LMJA 2M0YA 3GBQA 1K9AA 1RUWA 1T3SA 4AG1C 1RI9A 1UGVA 2KYMA 1W1FA 3I5RA 2K6DA 4DEXA 4J9EA 2K3BA 1U5SA 1X69A 2EYYA 1X6BA 2PZ1A 2RQUA 3RNJA 1TUDA 3VS1A 1UTIA 1CKBA 1AD5A 2F2XA 2M51A 1UHCA 1NEBA 2CT3A 2YUNA 5IXFA 2GGRA 1X43A 2EGAA 1UECA 2AK5A 1UJYA 2SRCA 2EGEA 1PNJA 1YWPA 1GBQA 5I22A 2D8JA 2G6FX 2V1QA 2AKKA 1YN8A 4JZ4A 2C0OA 1LCKA 2LZ6B 4RTYA 1W70A 2EYXA 1WDXA 1GFDA 3VS3A 1Y57A 2L0AA 1PRLC 3ZL7C 4Z8AA 1K1ZA 4Z88A 2P4RA 1G83A 2EVRA 1SSHA 3TSZA 2CREA 4AFSC 4GLMA 3FJ5A 2L2PA 2DYBA 2C0IA 3EG0A 1CSKA 1GL5A 4IIMA 2ENMA 4Z89A 1B07A 4CC3A 3M0UA 1M8MA 1I1JA 2A28A 2CSIA 3VS5A 2KXDA 1NM7A 1GCPA 3CQTA 2J06A 2LP5A 4HVWA 4AFQC 2D8HA 1H92A 2JW4A 2A37A 2NWMA 1E6HA 2JS0A 3H0HA 3IQLA 2JM9A 1AZEA 3M0SA 1HJDA 2DRMA 1PKSA 1PHTA 2CT4A 4J9FA 1UFFA 1QWFA 2DRKA 2JTEA 1VYTA 2O88A 4J9GA 1AWJA 2I0NA 1H8KA 2EW3A 2GNCA 2RQWA 4J9DA 1JU5C 2KE9A 1ZLMA 1QLYA 1MV0B 2NUZA 2GTOA 4LNPA 4RTTA 1GFCA 1WXBA 2KT8A 2W0ZA 4R0KA 1UHFA 4OMOA 2LNHB 2RMOA 1BBZA 4J9CA 1WIEA 2YDLA 2HSPA 2HCKA 2DE0X 1YP5A 2KGTA 1CKAA 1M3BA 2A36A 1WX6A 2C0TA 2X3WD 3REAB 3VS2A 1EFNA 2FPDA 3EG3A 2KNBB 2MOXA 4JJBA 1RLQC 4KRTA 2RNAA 1I0CA 2J7IA 5L23A 1GCQC 1AWOA 2LJ3A 2FO0A 2OJ2A 4F16A 4JZ3A 5IHNA 1ABOA 4CC7A 1X2QA 2AKLA 4OMNA 3TVTA 1K4US 2HEQA 1VA7A 3VRZA 1KJWA 4E6RA 3VS0A 1G2BA 1OEBA 2AZSA 2FRWA 1ZBJA 2EYWA 1YNZA 2K9GA 1QCFA 2DL4A 2DL5A 2F2VA 1B3QA 3EG2A 3EGUA 1UG1A 2KRNA 4HVUA 1S1NA 1ZUYA 3R6NA 1ABQA 1I07A 2DVJA 1T0JA 2DF6A 4J9IA 2KEAA 3O5ZA 3UATA 2YUPA 3KFVA 2CH4W 3VS7A 1KSWA 1WXTA 1SRMA 3VS6A 2ABLA 2JM8A 4JPBW 1AWXA 2EBPA 2J6OA 1YWOA 2OAWA 2ECZA 1Z9QA 1SPKA 4LUEA 4OMLA 2KBTA 3I9QA 1M3AA 1PWTA 3EHRA 2FRYA 5IHIA 1WLPB 1WI7A 1M3CA 2CUBA 2ROTA 1W6XA 4DEYA 4JJDA 3ULRB 2XMFA 1T0HA 3A98A 1NYFA 3PVQA 1MUZA 2RN8A 3JV3A 4HXJA 2K7AA 1MV3A 2F2WA 1NLOC 4QT7A 3UF4A 2V1RA 3VS4A 2LQNA 1WA7A 4HVVA 2PTKA 2DX1A 3SEMA 2O2OA 1AEYA 1QKXA 2KR3A 2VKNA 3H41A 2KXCA 1BK2A 1IO6A 1ZSGA 4JJCA 2FPEA 2W10A 1E7OA 2EPDA 1OPLA 5FWCA 4RTXA 2JS2A 2KRSA 2E5KA 2D0NA 4LUDA 2PNIA 2BTTA 3EG1A 4OMMA 2RF0A 1JXOA 2D1XA 3SHWA 1ZX6A 1UUEA 5ECAA 4EIKA 3QWXX 2LCSA 3NMZC 2K2MA 4J9HA 4Y92A 2DA9A 3I5SA 2KRMA 3H0FA 4F14A 3NPFA 1AWWA 2J6FA 2H8HA 4GBQA 1PKTA 1V1CA 2BZ8A 2GTJA 2CUDA 4J9BA 1GBRA 4RTUA 3PE0A 3M0QA
chains in the Genus database with same CATH superfamily
4M7DG 2X3XD 2HBWA 5M9OA 1YBYA 4E7JA 2FZGB 2O4XA 1K8AU 1VQKQ 2KT1A 4ZGEB 5IH2A 4KGZB 2K79A 5GMKj 4B9XA 3PIPA 4M7AF 5GAN4 2FB7A 4BE2A 3INZA 4LE9A 5D6XA 2XHCA 1WHHA 2E10A 3PVLA 3LH5A 3E9GA 3RDVA 3HFOA 2CSQA 1TSFA 3QDFA 3KBGA 1K73U 4II1A 1VQ6A 1WYXA 1SHGA 2CP6A 2EFIA 1W2BP 3CCQQ 2D9TA 1RLPC 2JUFA 3CMAT 4RTWA 3CMET 7AT1B 2O9VA 2MCNA 2COWA 3NGPA 1VQ5T 2YT6A 1EX4A 3SB2A 2ZCFB 2AIRB 2SEMA 3LH0A 4M75G 5CIUA 2GF7A 2L8DA 5HK3A 5A2QE 1YHQA 3CCJT 3CC2Q 2RO0A 5FWBA 4IUTA 2E6NA 3NHNA 3JCMP 3FRNA 1UJ0A 5IT9E 1K8AR 2LQWA 2ROLA 1IB8A 1RACB 1QCNA 2DEQA 2BZXA 2KYBA 1UE9A 2RJDA 1OX8A 3OMCA 2ZPBB 1E6GA 2RHUA 3EFSA 1K73R 1OOTA 4X1VA 1PM3A 1KK7A 5GAMg 2Y4XA 4OMQA 1MNDA 2L3PA 4C8QF 5KCOA 4O6JA 4PJOB 4FYVB 3HL8A 3OW2S 4V2SA 3BDLA 2CP3A 2PU9B 1U3OA 4XU1A 1BCMA 3EFOA 5CQXA 1VQ7T 2CYZB 5GAOm 1HD3A 1X6GA 4KGXB 4Z02A 1YIJA 3AT1B 4IIOA 3L2QA 3CMAQ 1VOMA 1XTDA 3THKA 3RBBB 2E6ZA 4PJLA 4OP0A 4HCKA 5GJVB 5GAOr 4ZNXA 5FU6C 1VQ5Q 1YJNQ 5GAN5 2JXBA 3M5AA 2BE7D 1U1TA 5LJ3j 2LJ1A 1ARKA 2H3EB 2QAZA 3RKXA 2OTJT 1JO8A 1GCQA 4UC4A 3PT9A 5FRNA 2RI2A 5A0LA 3CCJQ 1JQQA 4M77D 5GANf 3CC7T 1SF9A 2XK0A 1RUWA 3OS2A 1FXXA 5FU6B 3JSCA 3CCQA 4M7AA 1U5SA 1X6BA 2RQUA 4B9WA 4QW2A 1AD5A 2MWPA 2F2XA 1UHCA 2ZAEA 4AT1B 1VQOT 2GGRA 1AT1B 1X43A 2EGAA 5D7UA 2AK5A 2VXFA 2SRCA 2CKKA 1YWPA 2D8JA 3CC2A 5GMKh 1I5OB 5KE3A 1ZA1B 4JZ4A 2C0OA 4EMGA 2LZ6B 1JRIA 1WDXA 1GFDA 3S6WA 2EQKA 2E3HA 1QVGP 1PRLC 1QCOA 4Z88A 3RKYA 1VQ7Q 1WHKA 1G83A 4ELZC 2EVRA 4PJMA 2QEXT 3TSZA 5GANj 2PVDB 5I2MA 4GLMA 2C0IA 2HMAA 1D1BA 3QHSA 2YWWA 4IIMA 5HKCA 4Z89A 1M8MA 1KD1C 2A28A 3CCET 2KXDA 1W2BS 3V8LA 2GFAA 1KQSS 5LJ5d 2LP5A 4OF1A 2NUPA 3H9NA 4OB3B 3J80E 3HFNA 4PJJA 2OTJQ 1TXQA 1EZZB 1YJ9T 1E6HA 2JS0A 2LCCA 2DRMA 2CT4A 2O88A 3CC7Q 1AWJA 2I0NA 1H8KA 1VQPA 2XDPA 3X24B 1QLYA 5FU7C 1VQLT 2E4HA 3HKSA 4FYWB 2DK3A 1PD0A 1GFCA 2K5IA 2W0ZA 4R0KA 5L8RE 1RAIB 2LNHB 3JCMW 1FMVA 4J8OA 2RMOA 4C8QA 1YJNA 1WIEA 3A8MB 1VQOQ 4LD9K 2YLBA 4PJOD 2RI5A 2BKDN 3DKMA 3GIBA 5FU7B 3REAB 2FPDA 3CXCA 2KNBB 2K57A 1VQ4T 4M78G 1UGRB 2RNAA 3OS0A 4Q5WA 1JJ2A 4OB1B 1D0XA 2LJ3A 2EWNA 4FU6A 3GP8A 3G4ST 4F16A 5CAIA 3MO8A 1K9MU 4F04B 3SWNB 1ZSZC 3E9FA 4X9CA 3X25B 5GMKe 3HRSA 1K4US 4N0AC 2HEQA 1VA7A 2DJZA 3L1AA 1IZ6A 3I56T 3OS1A 1OEBA 3CCMA 4M7AG 1O75A 4FT4A 2EYWA 4HCBA 5GAOq 1ZQ1A 3LGLA 5LJ3h 1ZA2B 3CCEQ 4FW1A 2PUOB 1ZSZB 1ZUYA 1ABQA 3M57A 4F7UE 4C5HA 4NL3A 1YJWT 1G3WA 1R0BG 3CCST 2M0OA 3S3OA 1YJ9Q 3UATA 4O5VA 1LOJA 1WJSA 4C92E 3KFVA 2CH4W 1WXTA 5DM7R 5HY6A 3CPWP 3VUBA 1WGSA 2J6OA 1YWOA 4MZMA 4MDXA 1N8RR 3TEEA 3L2UA 5GAN6 2CZ0B 2COYA 1I81A 1PSEA 1R0CB 3I9QA 1PWTA 2FRYA 1K9MR 2QXFA 2F5TX 2VGNA 2ROTA 1W6XA 4DEYA 2DZ9A 2WSCE 2QDYB 3RERA 3A98A 2LDMA 2RN8A 1Q7YC 4C0ZA 4HXJA 3QO3A 4HKEA 4OGCA 4VUBA 2ZPGB 2HQXA 3CC7A 1MV3A 2F2WA 3SD4A 1YIJQ 4QT7A 3UF4A 3G4SQ 3CPWA 3VS4A 2LQNA 3ZFJA 4GY5A 2V8JA 4PJOA 1VQ8A 3R6OA 3V7SA 4ZN3A 1QKXA 2DTOA 1Q82U 2VKNA 4JJCA 3M59A 2FPEA 5GANh 1E7OA 5J26A 5GANd 1VQOA 3I56Q 4DQ2A 1WJQA 2D0NA 4OVAA 1VQ9A 4OMMA 1JXOA 4C8QG 3LWHA 4J6YA 3G6EA 3A8HB 2LCSA 4EIKA 8ATCB 1YHQT 2K2MA 3I5SA 2KRMA 2Z0WA 3VUZA 4IUQA 1AWWA 4JS5A 1QP2A 4BI3A 1YJWQ 1RADB 4XTZA 4XU0A 5J39A 4M78E 1NPRA 2BZ8A 2GTJA 1WHJA 3MEVA 4C5GA 5LJ3e 3EFRA 2HBPA 2HQHA 4RTUA 4HCCA 1GXIE 4PFPA 3FIFA 2VASA 3CEYA 2DJQA 4FSSA 3WVEB 1M1FA 3QUIA 3V7RA 2CGHA 3CCEA 2KQWA 1AZGB 2QQRA 5GMKl 1UDLA 1VIEA 3GPLA 2EYZA 3TCJA 2E12A 2VVKA 1BI3A 4BB7A 4F17A 5CQYA 1Q82R 3OYHA 1X6OA 4FIBA 5CVIA 3MEWA 4DBRA 2DVEA 3EH1A 3SFMA 4DOVA 4BDZA 5FW9A 1IHVA 3A5ZB 4IUVA 3QG1A 4ZGJB 4JS4A 4NL2A 1WQWA 4B6MA 2DBMA 4J6XA 2EQIA 2GCXA 3OBYA 3CCLA 1NEGA 1X01A 3REBB 4RTVA 2OI3A 2DXBA 4XK8E 3CCUT 3UWNA 1Q81C 2HDAA 3M0TA 4WF2A 1RAEB 3JCMX 1OU9A 2QDLA 4JRKA 5IXBA 1D1AA 2RJCA 1AVZC 1J3TA 2RK2A 1NYGA 4CC2A 3M0PA 3D7SB 4GLKA 1OU8A 5GANe 3QZ9B 2A08A 4EMHA 1X27A 1VQMA 1S72Q 1MMGA 2E41A 2O9SA 2MWOA 3HP9A 2E1HA 4A4HA 4KH0B 2EQMA 5CKFA 4ORZA 2IIMA 1TUCA 1PRMC 3I56A 3M0RA 3RKWA 5KYWB 3CC4Q 1IHWA 1IXDA 4J5YA 5C0MA 4C92D 2DM1A 2DIGA 4ME7A 2G3RA 5KYXB 2BZYA 1KG1A 1QWEA 2RQVA 4M77C 3PMTA 1T3LA 2DL3A 3QSUA 3OW2A 6AT1B 2KROA 3VU3C 4LDUA 2JT4A 2MK5A 4BACA 3OYLA 2HKNA 1H3HA 2QGGA 5GJWB 3QWYA 2CDTA 1R8OB 4DBHA 5A0GA 2K2VA 3M4YA 4M77B 3SWNA 2DMOA 2M9UA 2KSSA 1SEMA 2AT1B 2MYSA 3QYGB 2ZPHB 3C0CA 3TU4K 1XOVA 3L42A 3OSVA 5FROA 1K0XA 3CCUQ 2M0YA 1K9AA 1ZSZA 4BI8B 2YHTA 3HRTA 4N0AA 4DEXA 3FDRA 1X69A 1N27A 1TUDA 3VS1A 1VQPT 3ZBDA 3OQ5A 3S3NA 2VV5A 2F1LA 4X34A 5DLOA 1YJNT 3C95A 5GAN3 1D3BB 2FL7A 3LX7A 1PNJA 1GBQA 5I22A 2ATCB 1RAAB 4LXCA 4KH1B 2AKKA 1RI0A 4BE0A 1LCKA 3UDCA 2KAFA 2RD1A 2EYXA 3J7AF 4L59A 1Y57A 4BY6C 2I2LA 2L0AA 1S72A 3BDUA 4Z8AA 5DY9A 5KYUB 1YI2A 2P4RA 1G8XA 2CZ6B 2E5QA 2CREA 5LJ3f 2VGMA 4PL6A 3CC4A 1H3ZA 3GF5A 4PJOC 4BY6B 3CCMT 2FYKA 1I1JA 1WZOA 3QPHA 1KQSA 3OYYA 1GCPA 3JCMb 2J06A 4HVWA 1M8VA 4AFQC 1KC8C 2A0FB 2A37A 2JN0A 1C0MA 1VIFA 3H0HA 1AZEA 1HJDA 1PKSA 1PHTA 4J9FA 1UFFA 2DRKA 2JTEA 2RQWA 2EW3A 2DD5A 4J9DA 4M77F 2KE9A 3BY7A 2HL5C 2NUZA 4ZTJA 2GTOA 3L2VA 2X35A 1UHFA 4N4GA 1VQPQ 3MP8A 3H6ZA 1NE8A 2NYSA 2LTOA 2E3IA 2WACA 4QVZA 3OYFA 2HSPA 3RMSA 2E70A 5CKEA 3MEUA 5D6YA 1D1CA 1CKAA 4NOYA 1M3BA 1WX6A 3CCUA 4M7DE 3VS2A 1EFNA 2MAMA 3NTIA 4TVRA 5CKDA 3PTAA 5GANg 1I0CA 1G5VA 3JB9D 1AWOA 2FO0A 3N5BB 1KD1U 2PQWA 4XTWA 4JZ3A 2KVQG 3OS5A 4CC7A 2VXEA 3URGA 4E7KA 3NFCA 2WSEE 2IG0A 3ER0A 2P0KA 2LRQA 2K3YA 1VQ8T 3ME9A 5CKHA 3MKDA 4J7FA 2NUTB 3QXEB 2O01E 4FYXB 1ZBJA 4FYYB 2K9GA 2R58A 1BI2A 2DL5A 2F2VA 1B3QA 3CCMQ 4D6WA 1VQ9T 3UPUA 4HVUA 1S1NA 4IUUA 2MPXC 2XD0A 2BIVA 3G6ET 2DF6A 2X4JA 1NPPA 2XICA 4M75E 4J9IA 2KEAA 4A53A 4E7IA 3CBPA 1UB4A 3PIOA 4XTVA 1SRMA 1QVFP 4JPBW 3E19A 1Q95G 2OAWA 8AT1B 5J3BA 2QYZA 2QG9B 4LUEA 2L5QA 1Y07A 3VV0A 1KD1R 1M3AA 1WHMA 3EHRA 5I2SA 3LW5E 5EG2A 3GOXA 5KYWA 3QIIA 2CUBA 5KYYB 3EGXB 4RMOA 2LT1A 4PJOF 3ULRB 1NYFA 2XKOC 3JV3A 2C06A 5KYXA 4BD3A 2K7AA 3CXCP 5GAN8 1QVFA 1WA7A 2PTKA 2DX1A 4XTXA 5AT1B 3MCAB 1JJ2P 3JCMf 2YRDA 3L2ZA 3WVDB 1IO6A 1VQ8Q 2EPDA 5AYFA 4QQ6A 4LUDA 1M9SA 4M77A 2X4YA 3EG1A 3CCLT 1Y7XA 2RF0A 2Y4YA 2D1XA 3SWNC 4FT2A 4LDVA 4J9HA 3E1SA 3ASKA 1VQ9Q 3H0FA 1PD1A 1OZ2A 4F14A 2CS7A 3RUXA 3G6EQ 4AMCA 1V1CA 1M90C 2RA2A 4A4KA 9ATCB 3P8DA 1GBRA 2YXYA 1VQMT 2EJGA 2EQUA 3NTHA 4E7HA 3DLMA 4QQDA 1Q7YU 1DJ7B 4R56A 1XJWB 3TSWA 4ESRA 3M55A 3X28B 1GRIA 1Q86C 2COZA 2V8KA 1M30A 1K76A 4RTZA 2XG8D 4BE1A 1F1BB 4A63B 2JOYA 4PFZA 2RPNA 2FPFA 5LJ3d 3T9NA 2V8IA 1BIBA 1N5ZA 1D3BA 3VYGA 3DLLA 5FRMA 3OYNA 1P92A 1I5LA 2QI2A 2IPOB 3I35A 2L3RA 4L6V5 4QKUA 4OMPA 1ZUUA 2ED1A 4RUGA 2VYTA 5KYUA 1UGQB 3JB9H 4C92C 2M1HA 2CP7A 4JRQA 4YTLA 2B8AA 2CP0A 1Z9ZA 4C5EA 1XQHA 4LN2A 3CCLQ 4F7UB 2DL7A 2ESWA 1NG2A 4RCCA 3RR6A 1Q7YR 3NTKA 4C92B 1SG5A 4PNOA 4E7LA 1X75C 2DEUA 3CBMA 2AZVA 1WXUA 1VQMQ 1G3YA 3JB9J 2P0QA 2LX9A 2LJ0A 1YCSB 4M75D 2DBKA 3KXTA 1OV3A 4DBQA 1LVKA 4JLIA 4WCIA 3OA6A 4J7IA 1M27C 3FB9A 4HT8A 2DILA 1OULA 5CCAA 1LPLA 3LLRA 2B86A 1QVGS 4BUGA 4PKCC 3M53A 3RMQA 2QQSA 2RQTA 1RL2A 4D8KA 2VWFA 1I8FA 2QTXA 1BKBA 1M2OA 5HK0A 2ZGWA 4AFUC 4M77G 4PJNA 1C1AA 2X51A 5CK9A 1Q81U 5KCHA 4D8DA 4BDYA 1S72T 4EMKB 3M56A 1FYNA 4A4EA 1YI2T 1TS9A 1QKWA 2RJFA 3H0IA 2EYQA 1KQ1A 4FSXA 1RABB 1VYVA 3CC4T 4CC4B 4XU2A 3L2WA 3QYHB 3I55A 3CXCS 2DO3A 2QTVA 3FEOA 1JXMA 2NUTA 2K5LA 2RJEA 2XI9A 3OY9A 2XU8A 2CZ1B 1WFWA 4M7AE 3OYMA 1ACMB 4FL6A 4JDSA 2DXUA 3OYIA 1T3SA 4M78B 1UGVA 2KYMA 3I5RA 4P5NA 2DYIA 2X4XA 2K3BA 2DPPB 1I4K1 2PZ1A 2EYYA 2KI7A 3RNJA 4E47A 2RHYA 1UTIA 1CKBA 2RHXA 2M51A 1VQNA 1IREB 3BFMA 4ANJA 1NEBA 2IVWA 3X20B 2YUNA 3M9QA 5IXFA 3CD6A 2DERA 4R55A 3V7CA 1UECA 2HNIA 2PVGB 4WTOB 2RM4A 4F7UF 2KDSA 4A4FA 1Y96B 2XDDA 1Q81R 4PFOA 3JCMh 3JCMd 1NJIU 1YN8A 4C92F 2FZKB 4E7ZA 4RTYA 1W70A 1M1KC 2YRCA 2Y90A 1IRXA 1K1ZA 3EGXA 2DKGA 4OMFB 2P4TA 3OW2P 2RB6A 3QZ5B 1SSHA 2QA4Q 1YI2Q 1BCOA 3FJ5A 2L2PA 4KULA 3EG0A 2ENMA 1V76A 4ATOA 1B07A 3VYHB 1IGQA 4HA8A 2CP5A 4PJOG 4FM4B 3WXMB 2LQKA 2D8HA 1H92A 2JW4A 1HK9A 1M5Q1 2JM9A 3CPWS 3M0SA 3V8KA 1KHIA 1NBEB 1QWFA 3BE3A 4J9GA 4C8QE 1JU5C 2EQJA 1ZLMA 2OTLA 5GMKi 1MV0B 4MMLA 2FVUA 2QGFB 3SDZA 1TTHB 3A8LB 4RTTA 1WXBA 2KT8A 4OMOA 4RG8A 1BBZA 2EJFA 4PLIA 1U1SA 4J9CA 2FHDA 1B34B 1ZHIA 3M58A 2HCKA 1NJIC 1OI1A 3L2RA 1OZ3A 2RH2A 2A36A 2C0TA 3TQ7P 4JRPA 2MOXA 3JB9I 2HQEA 4KRTA 3FJPA 2J7IA 3QBYA 2BUDA 3ZEHA 4XU3A 1ABOA 1XNIA 1X2QA 1KC8U 4J6WA 2JZ2A 4OMNA 3TVTA 3S3MA 3VKIA 5DLQE 3JCMe 1D0YA 1MMAA 3VRZA 4E6RA 3VS0A 1G2BA 3EAEA 3A8GB 2LVMA 2HL3A 4BI4A 1PSFA 3GNGA 1RAHB 3HTRA 4M78D 1UG1A 1AHJB 2KRNA 4KT0E 2K5FA 3OYAA 1RAFB 3E2UA 2DVJA 4RKUE 3RESA 1KQSP 3O5ZA 4RG2A 2DTIA 2DXTA 4LDXA 2YUPA 4F7UA 2YLCA 4MZPA 3RIRA 3TREA 3HSBA 2ABLA 2QA4A 5LJ3g 4C92A 2EBPA 4HT9A 4M7AD 1WQ7A 5LJ5j 2ECZA 1Z9QA 1SPKA 2KBTA 2VB6A 2CZ7B 2HD0A 2DAQA 3FC3A 5KE2A 5GMKm 5KYNA 2DIQA 4QVCA 4XQ3A 1W2BA 1WI7A 1M3CA 1KC8R 4JJDA 2X4WA 2XMFA 3X26B 3CCVA 4PK4A 1TU0B 4PJOE 2OAUA 3QKJA 1NLOC 1K8AC 2K4YA 2KMTA 1W4SA 3JB9F 4QQGA 4FW2A 4FCYA 3G71Q 2O2OA 2PUKB 2ZPEB 1AEYA 2CP2A 2KR3A 1TUGB 3H41A 1BK2A 1WHGA 1ZSGA 2LC4A 2W10A 1M4ZA 4EMKA 4RTXA 2JS2A 3CCRT 2LQ8A 2PNIA 3LGFA 1K73C 1O9SA 3PFSA 3G1JA 5GAMf 3NMZC 1V29B 4KUDK 4Y92A 5CO7A 1G3SA 3NPFA 1N9SA 4LD6A 2H8HA 1WHLA 4OB2B 3HRUA 2V26A 3CMEQ 4M7DC 2VC8A 2HKQB 2KY9A 3PE0A 3M0QA 1VQKA 4M78A 3BW1A 2FZCB 4JUVA 2HZYA 1UGSB 1JB0E 2MI6A 2QQ9A 1JEGA 4K11A 2VUBA 1WPYA 2DL8A 4C8QD 3OYCA 4X9DA 1VYUA 4M7DB 2DNUA 4EPCA 3A1PA 3JCMc 1FMKA 1X2KA 1Y71A 2YSQA 2QK0A 1Y96A 1KFZA 3GNFB 1VUBA 5LL6S 3UA6A 2FG0A 5CKBA 1NZ9A 2O31A 4RCBA 3JCMV 4DOWA 5GAMj 3PGGA 1D0ZA 3PMIA 1A0NB 2NLUA 5I21A 1SHFA 2F69A 3DB4A 4M75C 1M2VB 2CH4A 4JRIA 4DBFA 5C6SA 4C5IA 4F7UG 1M90U 1BYMA 1BB9A 4M4ZA 2EAYA 1UEBA 2ZPIB 5EC7A 4N4IA 3CCRQ 4C92G 2ZZDA 4CRIA 3I55T 1U8RA 4C0FA 2ED0A 1NLPC 2DLPA 1Q86U 2RQRA 1N6AA 4M75B 3U23A 2EKHA 2FEIA 2MIOA 1K0SA 2YUQA 3UT1A 2YUOA 2EGCA 3G71A 3JCMg 2BE9B 4MZTA 1BU1A 3MP1A 5KH6A 3JCMJ 1VQNT 3MEAA 1Y0MA 3HHTB 5CR2A 3M4GA 1R77A 2LX7A 3CD6T 5LJ5h 3EHQA 1YITT 5IHKA 3OSSC 1OPKA 5I11A 2RK1A 1QVGA 2RHIA 1B34A 1KIKA 2DXCA 2GQIA 4NS5A 2HAXA 4OB0B 1UGPB 3EG9B 3UA7A 3OYEA 3O8VA 2R57A 2OX7A 5FLXE 3VRYA 1M1GA 2DD4A 4J83A 4AFZC 3OYBA 3CMAA 2J05A 1M90R 3CMEA 4OGEA 1U06A 3JRZA 1VQ5A 4MMKA 4AG2C 2GBQA 1SRLA 2KK4A 2JMCA 3CBOA 3LWIA 1ZUKA 2L3SA 2DZCA 4M7DF 1Q86R 4XTUA 1FX7A 2J6KA 4MDWA 1HSQA 3CCJA 5HCKA 1N8RU 2XDBA 2JMAA 3HPWA 1AOJA 1IGUA 2QASA 3EGDB 1TG0A 2L3QA 3I55Q 3META 4KGVB 4E7SA 2LMJA 3GBQA 5IAYA 4LDYA 4Y28E 4AG1C 1RI9A 3MHXA 4A54A 4JLGA 3C94A 1W1FA 2K6DA 3P8BB 4J9EA 4ZTFA 2H3JA 2O4XB 2QQAA 2QEXQ 1WNLA 2OTLT 2HSEB 3C12A 5D6WA 4M7DD 1RAGB 2CT3A 3MP6A 3OB9A 3QJ6A 1VQNQ 3M54A 1UJYA 3CCRA 2M16A 2EGEA 3CD6Q 1YITQ 1QVPA 4M75F 1BI1A 2G6FX 2JVVA 2V1QA 2M02A 4XTYA 2D0QB 3VS3A 1VQ7A 1JBMA 1QMCA 2K3XA 4CI0C 3CPFA 3ZL7C 5LJ5e 1MNEA 2MMPA 2AHJB 1VQLQ 2E65A 5GAMh 5GAMd 2A7YA 4AFSC 1SSFA 1N8RC 2DYBA 3QJYA 1YCYA 1CSKA 1GL5A 5A0DA 4CC3A 3M0UA 1BIAA 2CSIA 3VS5A 2OTJA 1NM7A 2EIFA 1K9MC 3CQTA 1VQ4Q 1QW1A 4EMKC 2GFUA 4JJNK 4DA4A 2R5AA 2NWMA 4ZN1A 3IQLA 2P84A 1QVFS 1VQ6T 1G3TA 3JB9G 1MHNA 4C0DC 1VYTA 1TWBA 3A8OB 2GNCA 2EJ9A 3P8HA 4LNPA 1LNXA 1OQKA 4KBMB 1M1KU 2DTHA 2QA4T 2OTLQ 1PG5B 4IKFA 3OYGA 2YDLA 2LT4A 4C0DB 2DE0X 4M78C 1YP5A 5GAN7 2KGTA 2X3WD 2GQVA 3EFOB 3EG3A 4JJBA 1RLQC 3OYJA 3AHUA 1B7TA 5L23A 2DETA 1GCQC 3CCSQ 3MPUB 1JJ2S 1MGQA 2JTFA 1TOVA 2OJ2A 4M7DA 2YRVA 3CCVT 1QP3A 5IHNA 5GAOp 2AKLA 3GLXA 2QEXA 4PLLA 2X9HA 2JTMA 1FWZA 3EH2A 1PCXA 1BI0A 4M7AC 4ELYC 2L89A 1KJWA 3H8ZA 2PVOB 3VJPA 1N9RA 2AZSA 2FRWA 4QVDA 1YNZA 1QCFA 1YITA 3QDRB 2DL4A 2RHZA 1HXDA 2LNVA 3DB3A 1M2VA 3EG2A 3EGUA 1D09B 2A3LA 5GAMe 1YJ9A 3R6NA 1I07A 5IN1A 4M7AB 1T0JA 1WJRA 1M1KR 1Q82C 5GAOn 1TH7A 2RI3A 2E64A 2LCLA 3F70A 1VQLA 1VQ6Q 4KUIA 3VS7A 1KSWA 1OX9A 3VS6A 5GAN2 4M75A 1YIJT 5KYYA 2JM8A 5GAOl 1AWXA 4N4HA 4C0GA 1VQKT 4Y91A 1KQ2A 2F5KA 2ZPFB 1HYOA 1LJOA 1OYXA 2P0PA 2EKOA 4OMLA 4E2FB 2WSFE 1VQ4A 2JJ9A 1YHQQ 5IHIA 1WLPB 1QQJA 1PC0A 1T0HA 3G4SA 4A4GA 3PVQA 1MUZA 3J81E 2D6FA 4EDUA 3CCQT 3OYDA 3JAME 1H641 2QQBA 3Q1JA 2DFUA 2V1RA 3CCVQ 2R5MA 3EG9A 4HVVA 3C4SA 4IUPA 3KUFA 3SEMA 2MF2A 3PNWC 4XAXB 4ZGDB 1ZBXA 4M77E 2KXCA 1MMNA 2NUPB 1OPLA 5FWCA 3OBWA 2KRSA 4C8QC 2E5KA 4HCZA 3FLGA 1YFNA 1NJIR 1FMWA 3G7ZA 2BTTA 3CC2T 4IURA 3SHWA 1ZX6A 1YJWA 1UUEA 5ECAA 2JNGA 3QWXX 2XIDA 2DA9A 3JCMQ 3CCSA 4M78F 3V8JA 3MJXA 5LJ5g 2J6FA 3OMGA 4LDWA 4GBQA 1PKTA 3EGDA 3LYIA 4C8QB 2CUDA 4J9BA 1EIFA 1KHCA 4L5GA 5LJ5f 3OYKA 1SKUB 3G71T 1C6VX 1MMDA
chains in the Genus database with same CATH topology
2X3XD 3TSWA 2HBWA 4ESRA 2DJQA 4FSSA 2KT1A 1GRIA 1JEGA 4K11A 5IH2A 1M30A 1K76A 4RTZA 2K79A 2DL8A 1AZGB 4LE9A 1VYUA 1UDLA 2DNUA 4A63B 2EYZA 2RPNA 2VVKA 2FPFA 3PVLA 1FMKA 1X2KA 3LH5A 2YSQA 1N5ZA 2CSQA 4F17A 1KFZA 1WYXA 1SHGA 3UA6A 2FG0A 2O31A 3I35A 1RLPC 4RTWA 5FW9A 1A0NB 2O9VA 4OMPA 2MCNA 1SHFA 1ZUUA 2ED1A 4RUGA 3NGPA 2YT6A 2CH4A 2SEMA 2DBMA 1BB9A 2EQIA 4M4ZA 1NEGA 3REBB 4RTVA 2OI3A 5EC7A 1Z9ZA 2HDAA 3M0TA 4LN2A 5FWBA 2ED0A 1NLPC 2QDLA 5IXBA 2DL7A 2DLPA 2ESWA 1AVZC 1NG2A 1J3TA 2RQRA 1NYGA 3U23A 4CC2A 3M0PA 3NHNA 2EKHA 2FEIA 1UJ0A 2A08A 2MIOA 1X27A 1K0SA 2YUQA 2LQWA 2YUOA 2O9SA 2EGCA 2ROLA 2AZVA 1BU1A 1WXUA 2BZXA 4ORZA 2KYBA 2IIMA 1TUCA 1PRMC 1UE9A 2LJ0A 1YCSB 1Y0MA 3M0RA 2DBKA 2LX7A 1E6GA 3EHQA 1OV3A 2DM1A 5IHKA 4WCIA 1OPKA 5I11A 1OOTA 1M27C 4X1VA 2BZYA 2DILA 1KIKA 2B86A 2GQIA 1QWEA 2RQVA 4OMQA 1T3LA 2L3PA 2RQTA 2DL3A 4D8KA 3UA7A 2VWFA 4AFUC 2KROA 3VRYA 1U3OA 4AFZC 2JT4A 2J05A 4D8DA 1HD3A 1U06A 1H3HA 1X6GA 1FYNA 5GJWB 3QWYA 2CDTA 4AG2C 1QKWA 2GBQA 4IIOA 1SRLA 2JMCA 3THKA 3H0IA 3RBBB 5GJVB 4HCKA 1ZUKA 2DMOA 4ZNXA 2L3SA 1VYVA 1SEMA 2JXBA 4CC4B 2J6KA 3C0CA 1HSQA 1XOVA 2LJ1A 1ARKA 5HCKA 2JMAA 1AOJA 1JXMA 1JO8A 1GCQA 1TG0A 1K0XA 2L3QA 1JQQA 1WFWA 2LMJA 2M0YA 3GBQA 1K9AA 1RUWA 1T3SA 4AG1C 1RI9A 1UGVA 2KYMA 1W1FA 3I5RA 2K6DA 4DEXA 4J9EA 2K3BA 1U5SA 1X69A 2EYYA 1X6BA 2PZ1A 2RQUA 3RNJA 1TUDA 3VS1A 1UTIA 1CKBA 1AD5A 2F2XA 2M51A 1UHCA 1NEBA 2CT3A 2YUNA 5IXFA 2GGRA 1X43A 2EGAA 1UECA 2AK5A 1UJYA 2SRCA 2EGEA 1PNJA 1YWPA 1GBQA 5I22A 2D8JA 2G6FX 2V1QA 2AKKA 1YN8A 4JZ4A 2C0OA 1LCKA 2LZ6B 4RTYA 1W70A 2EYXA 1WDXA 1GFDA 3VS3A 1Y57A 2L0AA 1PRLC 3ZL7C 4Z8AA 1K1ZA 4Z88A 2P4RA 1G83A 2EVRA 1SSHA 3TSZA 2CREA 4AFSC 4GLMA 3FJ5A 2L2PA 2DYBA 2C0IA 3EG0A 1CSKA 1GL5A 4IIMA 2ENMA 4Z89A 1B07A 4CC3A 3M0UA 1M8MA 1I1JA 2A28A 2CSIA 3VS5A 2KXDA 1NM7A 1GCPA 3CQTA 2J06A 2LP5A 4HVWA 4AFQC 2D8HA 1H92A 2JW4A 2A37A 2NWMA 1E6HA 2JS0A 3H0HA 3IQLA 2JM9A 1AZEA 3M0SA 1HJDA 2DRMA 1PKSA 1PHTA 2CT4A 4J9FA 1UFFA 1QWFA 2DRKA 2JTEA 1VYTA 2O88A 4J9GA 1AWJA 2I0NA 1H8KA 2EW3A 2GNCA 2RQWA 4J9DA 1JU5C 2KE9A 1ZLMA 1QLYA 1MV0B 2NUZA 2GTOA 4LNPA 4RTTA 1GFCA 1WXBA 2KT8A 2W0ZA 4R0KA 1UHFA 4OMOA 2LNHB 2RMOA 1BBZA 4J9CA 1WIEA 2YDLA 2HSPA 2HCKA 2DE0X 1YP5A 2KGTA 1CKAA 1M3BA 2A36A 1WX6A 2C0TA 2X3WD 3REAB 3VS2A 1EFNA 2FPDA 3EG3A 2KNBB 2MOXA 4JJBA 1RLQC 4KRTA 2RNAA 1I0CA 2J7IA 5L23A 1GCQC 1AWOA 2LJ3A 2FO0A 2OJ2A 4F16A 4JZ3A 5IHNA 1ABOA 4CC7A 1X2QA 2AKLA 4OMNA 3TVTA 1K4US 2HEQA 1VA7A 3VRZA 1KJWA 4E6RA 3VS0A 1G2BA 1OEBA 2AZSA 2FRWA 1ZBJA 2EYWA 1YNZA 2K9GA 1QCFA 2DL4A 2DL5A 2F2VA 1B3QA 3EG2A 3EGUA 1UG1A 2KRNA 4HVUA 1S1NA 1ZUYA 3R6NA 1ABQA 1I07A 2DVJA 1T0JA 2DF6A 4J9IA 2KEAA 3O5ZA 3UATA 2YUPA 3KFVA 2CH4W 3VS7A 1KSWA 1WXTA 1SRMA 3VS6A 2ABLA 2JM8A 4JPBW 1AWXA 2EBPA 2J6OA 1YWOA 2OAWA 2ECZA 1Z9QA 1SPKA 4LUEA 4OMLA 2KBTA 3I9QA 1M3AA 1PWTA 3EHRA 2FRYA 5IHIA 1WLPB 1WI7A 1M3CA 2CUBA 2ROTA 1W6XA 4DEYA 4JJDA 3ULRB 2XMFA 1T0HA 3A98A 1NYFA 3PVQA 1MUZA 2RN8A 3JV3A 4HXJA 2K7AA 1MV3A 2F2WA 1NLOC 4QT7A 3UF4A 2V1RA 3VS4A 2LQNA 1WA7A 4HVVA 2PTKA 2DX1A 3SEMA 2O2OA 1AEYA 1QKXA 2KR3A 2VKNA 3H41A 2KXCA 1BK2A 1IO6A 1ZSGA 4JJCA 2FPEA 2W10A 1E7OA 2EPDA 1OPLA 5FWCA 4RTXA 2JS2A 2KRSA 2E5KA 2D0NA 4LUDA 2PNIA 2BTTA 3EG1A 4OMMA 2RF0A 1JXOA 2D1XA 3SHWA 1ZX6A 1UUEA 5ECAA 4EIKA 3QWXX 2LCSA 3NMZC 2K2MA 4J9HA 4Y92A 2DA9A 3I5SA 2KRMA 3H0FA 4F14A 3NPFA 1AWWA 2J6FA 2H8HA 4GBQA 1PKTA 1V1CA 2BZ8A 2GTJA 2CUDA 4J9BA 1GBRA 4RTUA 3PE0A 3M0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3X D;  3TSW A;  2HBW A;  4ESR A;  2DJQ A;  4FSS A;  2KT1 A;  1GRI A;  1JEG A;  4K11 A;  5IH2 A;  1M30 A;  1K76 A;  4RTZ A;  2K79 A;  2DL8 A;  1AZG B;  4LE9 A;  1VYU A;  1UDL A;  2DNU A;  4A63 B;  2EYZ A;  2RPN A;  2VVK A;  2FPF A;  3PVL A;  1FMK A;  1X2K A;  3LH5 A;  2YSQ A;  1N5Z A;  2CSQ A;  4F17 A;  1KFZ A;  1WYX A;  1SHG A;  3UA6 A;  2FG0 A;  2O31 A;  3I35 A;  1RLP C;  4RTW A;  5FW9 A;  1A0N B;  2O9V A;  4OMP A;  2MCN A;  1SHF A;  1ZUU A;  2ED1 A;  4RUG A;  3NGP A;  2YT6 A;  2CH4 A;  2SEM A;  2DBM A;  1BB9 A;  2EQI A;  4M4Z A;  1NEG A;  3REB B;  4RTV A;  2OI3 A;  5EC7 A;  1Z9Z A;  2HDA A;  3M0T A;  4LN2 A;  5FWB A;  2ED0 A;  1NLP C;  2QDL A;  5IXB A;  2DL7 A;  2DLP A;  2ESW A;  1AVZ C;  1NG2 A;  1J3T A;  2RQR A;  1NYG A;  3U23 A;  4CC2 A;  3M0P A;  3NHN A;  2EKH A;  2FEI A;  1UJ0 A;  2A08 A;  2MIO A;  1X27 A;  1K0S A;  2YUQ A;  2LQW A;  2YUO A;  2O9S A;  2EGC A;  2ROL A;  2AZV A;  1BU1 A;  1WXU A;  2BZX A;  4ORZ A;  2KYB A;  2IIM A;  1TUC A;  1PRM C;  1UE9 A;  2LJ0 A;  1YCS B;  1Y0M A;  3M0R A;  2DBK A;  2LX7 A;  1E6G A;  3EHQ A;  1OV3 A;  2DM1 A;  5IHK A;  4WCI A;  1OPK A;  5I11 A;  1OOT A;  1M27 C;  4X1V A;  2BZY A;  2DIL A;  1KIK A;  2B86 A;  2GQI A;  1QWE A;  2RQV A;  4OMQ A;  1T3L A;  2L3P A;  2RQT A;  2DL3 A;  4D8K A;  3UA7 A;  2VWF A;  4AFU C;  2KRO A;  3VRY A;  1U3O A;  4AFZ C;  2JT4 A;  2J05 A;  4D8D A;  1HD3 A;  1U06 A;  1H3H A;  1X6G A;  1FYN A;  5GJW B;  3QWY A;  2CDT A;  4AG2 C;  1QKW A;  2GBQ A;  4IIO A;  1SRL A;  2JMC A;  3THK A;  3H0I A;  3RBB B;  5GJV B;  4HCK A;  1ZUK A;  2DMO A;  4ZNX A;  2L3S A;  1VYV A;  1SEM A;  2JXB A;  4CC4 B;  2J6K A;  3C0C A;  1HSQ A;  1XOV A;  2LJ1 A;  1ARK A;  5HCK A;  2JMA A;  1AOJ A;  1JXM A;  1JO8 A;  1GCQ A;  1TG0 A;  1K0X A;  2L3Q A;  1JQQ A;  1WFW A;  2LMJ A;  2M0Y A;  3GBQ A;  1K9A A;  1RUW A;  1T3S A;  4AG1 C;  1RI9 A;  1UGV A;  2KYM A;  1W1F A;  3I5R A;  2K6D A;  4DEX A;  4J9E A;  2K3B A;  1U5S A;  1X69 A;  2EYY A;  1X6B A;  2PZ1 A;  2RQU A;  3RNJ A;  1TUD A;  3VS1 A;  1UTI A;  1CKB A;  1AD5 A;  2F2X A;  2M51 A;  1UHC A;  1NEB A;  2CT3 A;  2YUN A;  5IXF A;  2GGR A;  1X43 A;  2EGA A;  1UEC A;  2AK5 A;  1UJY A;  2SRC A;  2EGE A;  1PNJ A;  1YWP A;  1GBQ A;  5I22 A;  2D8J A;  2G6F X;  2V1Q A;  2AKK A;  1YN8 A;  4JZ4 A;  2C0O A;  1LCK A;  2LZ6 B;  4RTY A;  1W70 A;  2EYX A;  1WDX A;  1GFD A;  3VS3 A;  1Y57 A;  2L0A A;  1PRL C;  3ZL7 C;  4Z8A A;  1K1Z A;  4Z88 A;  2P4R A;  1G83 A;  2EVR A;  1SSH A;  3TSZ A;  2CRE A;  4AFS C;  4GLM A;  3FJ5 A;  2L2P A;  2DYB A;  2C0I A;  3EG0 A;  1CSK A;  1GL5 A;  4IIM A;  2ENM A;  4Z89 A;  1B07 A;  4CC3 A;  3M0U A;  1M8M A;  1I1J A;  2A28 A;  2CSI A;  3VS5 A;  2KXD A;  1NM7 A;  1GCP A;  3CQT A;  2J06 A;  2LP5 A;  4HVW A;  4AFQ C;  2D8H A;  1H92 A;  2JW4 A;  2A37 A;  2NWM A;  1E6H A;  2JS0 A;  3H0H A;  3IQL A;  2JM9 A;  1AZE A;  3M0S A;  1HJD A;  2DRM A;  1PKS A;  1PHT A;  2CT4 A;  4J9F A;  1UFF A;  1QWF A;  2DRK A;  2JTE A;  1VYT A;  2O88 A;  4J9G A;  1AWJ A;  2I0N A;  1H8K A;  2EW3 A;  2GNC A;  2RQW A;  4J9D A;  1JU5 C;  2KE9 A;  1ZLM A;  1QLY A;  1MV0 B;  2NUZ A;  2GTO A;  4LNP A;  4RTT A;  1GFC A;  1WXB A;  2KT8 A;  2W0Z A;  4R0K A;  1UHF A;  4OMO A;  2LNH B;  2RMO A;  1BBZ A;  4J9C A;  1WIE A;  2YDL A;  2HSP A;  2HCK A;  2DE0 X;  1YP5 A;  2KGT A;  1CKA A;  1M3B A;  2A36 A;  1WX6 A;  2C0T A;  2X3W D;  3REA B;  3VS2 A;  1EFN A;  2FPD A;  3EG3 A;  2KNB B;  2MOX A;  4JJB A;  1RLQ C;  4KRT A;  2RNA A;  1I0C A;  2J7I A;  5L23 A;  1GCQ C;  1AWO A;  2LJ3 A;  2FO0 A;  2OJ2 A;  4F16 A;  4JZ3 A;  5IHN A;  1ABO A;  4CC7 A;  1X2Q A;  2AKL A;  4OMN A;  3TVT A;  1K4U S;  2HEQ A;  1VA7 A;  3VRZ A;  1KJW A;  4E6R A;  3VS0 A;  1G2B A;  1OEB A;  2AZS A;  2FRW A;  1ZBJ A;  2EYW A;  1YNZ A;  2K9G A;  1QCF A;  2DL4 A;  2DL5 A;  2F2V A;  1B3Q A;  3EG2 A;  3EGU A;  1UG1 A;  2KRN A;  4HVU A;  1S1N A;  1ZUY A;  3R6N A;  1ABQ A;  1I07 A;  2DVJ A;  1T0J A;  2DF6 A;  4J9I A;  2KEA A;  3O5Z A;  3UAT A;  2YUP A;  3KFV A;  2CH4 W;  3VS7 A;  1KSW A;  1WXT A;  1SRM A;  3VS6 A;  2ABL A;  2JM8 A;  4JPB W;  1AWX A;  2EBP A;  2J6O A;  1YWO A;  2OAW A;  2ECZ A;  1Z9Q A;  1SPK A;  4LUE A;  4OML A;  2KBT A;  3I9Q A;  1M3A A;  1PWT A;  3EHR A;  2FRY A;  5IHI A;  1WLP B;  1WI7 A;  1M3C A;  2CUB A;  2ROT A;  1W6X A;  4DEY A;  4JJD A;  3ULR B;  2XMF A;  1T0H A;  3A98 A;  1NYF A;  3PVQ A;  1MUZ A;  2RN8 A;  3JV3 A;  4HXJ A;  2K7A A;  1MV3 A;  2F2W A;  1NLO C;  4QT7 A;  3UF4 A;  2V1R A;  3VS4 A;  2LQN A;  1WA7 A;  4HVV A;  2PTK A;  2DX1 A;  3SEM A;  2O2O A;  1AEY A;  1QKX A;  2KR3 A;  2VKN A;  3H41 A;  2KXC A;  1BK2 A;  1IO6 A;  1ZSG A;  4JJC A;  2FPE A;  2W10 A;  1E7O A;  2EPD A;  1OPL A;  5FWC A;  4RTX A;  2JS2 A;  2KRS A;  2E5K A;  2D0N A;  4LUD A;  2PNI A;  2BTT A;  3EG1 A;  4OMM A;  2RF0 A;  1JXO A;  2D1X A;  3SHW A;  1ZX6 A;  1UUE A;  5ECA A;  4EIK A;  3QWX X;  2LCS A;  3NMZ C;  2K2M A;  4J9H A;  4Y92 A;  2DA9 A;  3I5S A;  2KRM A;  3H0F A;  4F14 A;  3NPF A;  1AWW A;  2J6F A;  2H8H A;  4GBQ A;  1PKT A;  1V1C A;  2BZ8 A;  2GTJ A;  2CUD A;  4J9B A;  1GBR A;  4RTU A;  3PE0 A;  3M0Q A; 
#chains in the Genus database with same CATH topology
 4M7D G;  2X3X D;  2HBW A;  5M9O A;  1YBY A;  4E7J A;  2FZG B;  2O4X A;  1K8A U;  1VQK Q;  2KT1 A;  4ZGE B;  5IH2 A;  4KGZ B;  2K79 A;  5GMK j;  4B9X A;  3PIP A;  4M7A F;  5GAN 4;  2FB7 A;  4BE2 A;  3INZ A;  4LE9 A;  5D6X A;  2XHC A;  1WHH A;  2E10 A;  3PVL A;  3LH5 A;  3E9G A;  3RDV A;  3HFO A;  2CSQ A;  1TSF A;  3QDF A;  3KBG A;  1K73 U;  4II1 A;  1VQ6 A;  1WYX A;  1SHG A;  2CP6 A;  2EFI A;  1W2B P;  3CCQ Q;  2D9T A;  1RLP C;  2JUF A;  3CMA T;  4RTW A;  3CME T;  7AT1 B;  2O9V A;  2MCN A;  2COW A;  3NGP A;  1VQ5 T;  2YT6 A;  1EX4 A;  3SB2 A;  2ZCF B;  2AIR B;  2SEM A;  3LH0 A;  4M75 G;  5CIU A;  2GF7 A;  2L8D A;  5HK3 A;  5A2Q E;  1YHQ A;  3CCJ T;  3CC2 Q;  2RO0 A;  5FWB A;  4IUT A;  2E6N A;  3NHN A;  3JCM P;  3FRN A;  1UJ0 A;  5IT9 E;  1K8A R;  2LQW A;  2ROL A;  1IB8 A;  1RAC B;  1QCN A;  2DEQ A;  2BZX A;  2KYB A;  1UE9 A;  2RJD A;  1OX8 A;  3OMC A;  2ZPB B;  1E6G A;  2RHU A;  3EFS A;  1K73 R;  1OOT A;  4X1V A;  1PM3 A;  1KK7 A;  5GAM g;  2Y4X A;  4OMQ A;  1MND A;  2L3P A;  4C8Q F;  5KCO A;  4O6J A;  4PJO B;  4FYV B;  3HL8 A;  3OW2 S;  4V2S A;  3BDL A;  2CP3 A;  2PU9 B;  1U3O A;  4XU1 A;  1BCM A;  3EFO A;  5CQX A;  1VQ7 T;  2CYZ B;  5GAO m;  1HD3 A;  1X6G A;  4KGX B;  4Z02 A;  1YIJ A;  3AT1 B;  4IIO A;  3L2Q A;  3CMA Q;  1VOM A;  1XTD A;  3THK A;  3RBB B;  2E6Z A;  4PJL A;  4OP0 A;  4HCK A;  5GJV B;  5GAO r;  4ZNX A;  5FU6 C;  1VQ5 Q;  1YJN Q;  5GAN 5;  2JXB A;  3M5A A;  2BE7 D;  1U1T A;  5LJ3 j;  2LJ1 A;  1ARK A;  2H3E B;  2QAZ A;  3RKX A;  2OTJ T;  1JO8 A;  1GCQ A;  4UC4 A;  3PT9 A;  5FRN A;  2RI2 A;  5A0L A;  3CCJ Q;  1JQQ A;  4M77 D;  5GAN f;  3CC7 T;  1SF9 A;  2XK0 A;  1RUW A;  3OS2 A;  1FXX A;  5FU6 B;  3JSC A;  3CCQ A;  4M7A A;  1U5S A;  1X6B A;  2RQU A;  4B9W A;  4QW2 A;  1AD5 A;  2MWP A;  2F2X A;  1UHC A;  2ZAE A;  4AT1 B;  1VQO T;  2GGR A;  1AT1 B;  1X43 A;  2EGA A;  5D7U A;  2AK5 A;  2VXF A;  2SRC A;  2CKK A;  1YWP A;  2D8J A;  3CC2 A;  5GMK h;  1I5O B;  5KE3 A;  1ZA1 B;  4JZ4 A;  2C0O A;  4EMG A;  2LZ6 B;  1JRI A;  1WDX A;  1GFD A;  3S6W A;  2EQK A;  2E3H A;  1QVG P;  1PRL C;  1QCO A;  4Z88 A;  3RKY A;  1VQ7 Q;  1WHK A;  1G83 A;  4ELZ C;  2EVR A;  4PJM A;  2QEX T;  3TSZ A;  5GAN j;  2PVD B;  5I2M A;  4GLM A;  2C0I A;  2HMA A;  1D1B A;  3QHS A;  2YWW A;  4IIM A;  5HKC A;  4Z89 A;  1M8M A;  1KD1 C;  2A28 A;  3CCE T;  2KXD A;  1W2B S;  3V8L A;  2GFA A;  1KQS S;  5LJ5 d;  2LP5 A;  4OF1 A;  2NUP A;  3H9N A;  4OB3 B;  3J80 E;  3HFN A;  4PJJ A;  2OTJ Q;  1TXQ A;  1EZZ B;  1YJ9 T;  1E6H A;  2JS0 A;  2LCC A;  2DRM A;  2CT4 A;  2O88 A;  3CC7 Q;  1AWJ A;  2I0N A;  1H8K A;  1VQP A;  2XDP A;  3X24 B;  1QLY A;  5FU7 C;  1VQL T;  2E4H A;  3HKS A;  4FYW B;  2DK3 A;  1PD0 A;  1GFC A;  2K5I A;  2W0Z A;  4R0K A;  5L8R E;  1RAI B;  2LNH B;  3JCM W;  1FMV A;  4J8O A;  2RMO A;  4C8Q A;  1YJN A;  1WIE A;  3A8M B;  1VQO Q;  4LD9 K;  2YLB A;  4PJO D;  2RI5 A;  2BKD N;  3DKM A;  3GIB A;  5FU7 B;  3REA B;  2FPD A;  3CXC A;  2KNB B;  2K57 A;  1VQ4 T;  4M78 G;  1UGR B;  2RNA A;  3OS0 A;  4Q5W A;  1JJ2 A;  4OB1 B;  1D0X A;  2LJ3 A;  2EWN A;  4FU6 A;  3GP8 A;  3G4S T;  4F16 A;  5CAI A;  3MO8 A;  1K9M U;  4F04 B;  3SWN B;  1ZSZ C;  3E9F A;  4X9C A;  3X25 B;  5GMK e;  3HRS A;  1K4U S;  4N0A C;  2HEQ A;  1VA7 A;  2DJZ A;  3L1A A;  1IZ6 A;  3I56 T;  3OS1 A;  1OEB A;  3CCM A;  4M7A G;  1O75 A;  4FT4 A;  2EYW A;  4HCB A;  5GAO q;  1ZQ1 A;  3LGL A;  5LJ3 h;  1ZA2 B;  3CCE Q;  4FW1 A;  2PUO B;  1ZSZ B;  1ZUY A;  1ABQ A;  3M57 A;  4F7U E;  4C5H A;  4NL3 A;  1YJW T;  1G3W A;  1R0B G;  3CCS T;  2M0O A;  3S3O A;  1YJ9 Q;  3UAT A;  4O5V A;  1LOJ A;  1WJS A;  4C92 E;  3KFV A;  2CH4 W;  1WXT A;  5DM7 R;  5HY6 A;  3CPW P;  3VUB A;  1WGS A;  2J6O A;  1YWO A;  4MZM A;  4MDX A;  1N8R R;  3TEE A;  3L2U A;  5GAN 6;  2CZ0 B;  2COY A;  1I81 A;  1PSE A;  1R0C B;  3I9Q A;  1PWT A;  2FRY A;  1K9M R;  2QXF A;  2F5T X;  2VGN A;  2ROT A;  1W6X A;  4DEY A;  2DZ9 A;  2WSC E;  2QDY B;  3RER A;  3A98 A;  2LDM A;  2RN8 A;  1Q7Y C;  4C0Z A;  4HXJ A;  3QO3 A;  4HKE A;  4OGC A;  4VUB A;  2ZPG B;  2HQX A;  3CC7 A;  1MV3 A;  2F2W A;  3SD4 A;  1YIJ Q;  4QT7 A;  3UF4 A;  3G4S Q;  3CPW A;  3VS4 A;  2LQN A;  3ZFJ A;  4GY5 A;  2V8J A;  4PJO A;  1VQ8 A;  3R6O A;  3V7S A;  4ZN3 A;  1QKX A;  2DTO A;  1Q82 U;  2VKN A;  4JJC A;  3M59 A;  2FPE A;  5GAN h;  1E7O A;  5J26 A;  5GAN d;  1VQO A;  3I56 Q;  4DQ2 A;  1WJQ A;  2D0N A;  4OVA A;  1VQ9 A;  4OMM A;  1JXO A;  4C8Q G;  3LWH A;  4J6Y A;  3G6E A;  3A8H B;  2LCS A;  4EIK A;  8ATC B;  1YHQ T;  2K2M A;  3I5S A;  2KRM A;  2Z0W A;  3VUZ A;  4IUQ A;  1AWW A;  4JS5 A;  1QP2 A;  4BI3 A;  1YJW Q;  1RAD B;  4XTZ A;  4XU0 A;  5J39 A;  4M78 E;  1NPR A;  2BZ8 A;  2GTJ A;  1WHJ A;  3MEV A;  4C5G A;  5LJ3 e;  3EFR A;  2HBP A;  2HQH A;  4RTU A;  4HCC A;  1GXI E;  4PFP A;  3FIF A;  2VAS A;  3CEY A;  2DJQ A;  4FSS A;  3WVE B;  1M1F A;  3QUI A;  3V7R A;  2CGH A;  3CCE A;  2KQW A;  1AZG B;  2QQR A;  5GMK l;  1UDL A;  1VIE A;  3GPL A;  2EYZ A;  3TCJ A;  2E12 A;  2VVK A;  1BI3 A;  4BB7 A;  4F17 A;  5CQY A;  1Q82 R;  3OYH A;  1X6O A;  4FIB A;  5CVI A;  3MEW A;  4DBR A;  2DVE A;  3EH1 A;  3SFM A;  4DOV A;  4BDZ A;  5FW9 A;  1IHV A;  3A5Z B;  4IUV A;  3QG1 A;  4ZGJ B;  4JS4 A;  4NL2 A;  1WQW A;  4B6M A;  2DBM A;  4J6X A;  2EQI A;  2GCX A;  3OBY A;  3CCL A;  1NEG A;  1X01 A;  3REB B;  4RTV A;  2OI3 A;  2DXB A;  4XK8 E;  3CCU T;  3UWN A;  1Q81 C;  2HDA A;  3M0T A;  4WF2 A;  1RAE B;  3JCM X;  1OU9 A;  2QDL A;  4JRK A;  5IXB A;  1D1A A;  2RJC A;  1AVZ C;  1J3T A;  2RK2 A;  1NYG A;  4CC2 A;  3M0P A;  3D7S B;  4GLK A;  1OU8 A;  5GAN e;  3QZ9 B;  2A08 A;  4EMH A;  1X27 A;  1VQM A;  1S72 Q;  1MMG A;  2E41 A;  2O9S A;  2MWO A;  3HP9 A;  2E1H A;  4A4H A;  4KH0 B;  2EQM A;  5CKF A;  4ORZ A;  2IIM A;  1TUC A;  1PRM C;  3I56 A;  3M0R A;  3RKW A;  5KYW B;  3CC4 Q;  1IHW A;  1IXD A;  4J5Y A;  5C0M A;  4C92 D;  2DM1 A;  2DIG A;  4ME7 A;  2G3R A;  5KYX B;  2BZY A;  1KG1 A;  1QWE A;  2RQV A;  4M77 C;  3PMT A;  1T3L A;  2DL3 A;  3QSU A;  3OW2 A;  6AT1 B;  2KRO A;  3VU3 C;  4LDU A;  2JT4 A;  2MK5 A;  4BAC A;  3OYL A;  2HKN A;  1H3H A;  2QGG A;  5GJW B;  3QWY A;  2CDT A;  1R8O B;  4DBH A;  5A0G A;  2K2V A;  3M4Y A;  4M77 B;  3SWN A;  2DMO A;  2M9U A;  2KSS A;  1SEM A;  2AT1 B;  2MYS A;  3QYG B;  2ZPH B;  3C0C A;  3TU4 K;  1XOV A;  3L42 A;  3OSV A;  5FRO A;  1K0X A;  3CCU Q;  2M0Y A;  1K9A A;  1ZSZ A;  4BI8 B;  2YHT A;  3HRT A;  4N0A A;  4DEX A;  3FDR A;  1X69 A;  1N27 A;  1TUD A;  3VS1 A;  1VQP T;  3ZBD A;  3OQ5 A;  3S3N A;  2VV5 A;  2F1L A;  4X34 A;  5DLO A;  1YJN T;  3C95 A;  5GAN 3;  1D3B B;  2FL7 A;  3LX7 A;  1PNJ A;  1GBQ A;  5I22 A;  2ATC B;  1RAA B;  4LXC A;  4KH1 B;  2AKK A;  1RI0 A;  4BE0 A;  1LCK A;  3UDC A;  2KAF A;  2RD1 A;  2EYX A;  3J7A F;  4L59 A;  1Y57 A;  4BY6 C;  2I2L A;  2L0A A;  1S72 A;  3BDU A;  4Z8A A;  5DY9 A;  5KYU B;  1YI2 A;  2P4R A;  1G8X A;  2CZ6 B;  2E5Q A;  2CRE A;  5LJ3 f;  2VGM A;  4PL6 A;  3CC4 A;  1H3Z A;  3GF5 A;  4PJO C;  4BY6 B;  3CCM T;  2FYK A;  1I1J A;  1WZO A;  3QPH A;  1KQS A;  3OYY A;  1GCP A;  3JCM b;  2J06 A;  4HVW A;  1M8V A;  4AFQ C;  1KC8 C;  2A0F B;  2A37 A;  2JN0 A;  1C0M A;  1VIF A;  3H0H A;  1AZE A;  1HJD A;  1PKS A;  1PHT A;  4J9F A;  1UFF A;  2DRK A;  2JTE A;  2RQW A;  2EW3 A;  2DD5 A;  4J9D A;  4M77 F;  2KE9 A;  3BY7 A;  2HL5 C;  2NUZ A;  4ZTJ A;  2GTO A;  3L2V A;  2X35 A;  1UHF A;  4N4G A;  1VQP Q;  3MP8 A;  3H6Z A;  1NE8 A;  2NYS A;  2LTO A;  2E3I A;  2WAC A;  4QVZ A;  3OYF A;  2HSP A;  3RMS A;  2E70 A;  5CKE A;  3MEU A;  5D6Y A;  1D1C A;  1CKA A;  4NOY A;  1M3B A;  1WX6 A;  3CCU A;  4M7D E;  3VS2 A;  1EFN A;  2MAM A;  3NTI A;  4TVR A;  5CKD A;  3PTA A;  5GAN g;  1I0C A;  1G5V A;  3JB9 D;  1AWO A;  2FO0 A;  3N5B B;  1KD1 U;  2PQW A;  4XTW A;  4JZ3 A;  2KVQ G;  3OS5 A;  4CC7 A;  2VXE A;  3URG A;  4E7K A;  3NFC A;  2WSE E;  2IG0 A;  3ER0 A;  2P0K A;  2LRQ A;  2K3Y A;  1VQ8 T;  3ME9 A;  5CKH A;  3MKD A;  4J7F A;  2NUT B;  3QXE B;  2O01 E;  4FYX B;  1ZBJ A;  4FYY B;  2K9G A;  2R58 A;  1BI2 A;  2DL5 A;  2F2V A;  1B3Q A;  3CCM Q;  4D6W A;  1VQ9 T;  3UPU A;  4HVU A;  1S1N A;  4IUU A;  2MPX C;  2XD0 A;  2BIV A;  3G6E T;  2DF6 A;  2X4J A;  1NPP A;  2XIC A;  4M75 E;  4J9I A;  2KEA A;  4A53 A;  4E7I A;  3CBP A;  1UB4 A;  3PIO A;  4XTV A;  1SRM A;  1QVF P;  4JPB W;  3E19 A;  1Q95 G;  2OAW A;  8AT1 B;  5J3B A;  2QYZ A;  2QG9 B;  4LUE A;  2L5Q A;  1Y07 A;  3VV0 A;  1KD1 R;  1M3A A;  1WHM A;  3EHR A;  5I2S A;  3LW5 E;  5EG2 A;  3GOX A;  5KYW A;  3QII A;  2CUB A;  5KYY B;  3EGX B;  4RMO A;  2LT1 A;  4PJO F;  3ULR B;  1NYF A;  2XKO C;  3JV3 A;  2C06 A;  5KYX A;  4BD3 A;  2K7A A;  3CXC P;  5GAN 8;  1QVF A;  1WA7 A;  2PTK A;  2DX1 A;  4XTX A;  5AT1 B;  3MCA B;  1JJ2 P;  3JCM f;  2YRD A;  3L2Z A;  3WVD B;  1IO6 A;  1VQ8 Q;  2EPD A;  5AYF A;  4QQ6 A;  4LUD A;  1M9S A;  4M77 A;  2X4Y A;  3EG1 A;  3CCL T;  1Y7X A;  2RF0 A;  2Y4Y A;  2D1X A;  3SWN C;  4FT2 A;  4LDV A;  4J9H A;  3E1S A;  3ASK A;  1VQ9 Q;  3H0F A;  1PD1 A;  1OZ2 A;  4F14 A;  2CS7 A;  3RUX A;  3G6E Q;  4AMC A;  1V1C A;  1M90 C;  2RA2 A;  4A4K A;  9ATC B;  3P8D A;  1GBR A;  2YXY A;  1VQM T;  2EJG A;  2EQU A;  3NTH A;  4E7H A;  3DLM A;  4QQD A;  1Q7Y U;  1DJ7 B;  4R56 A;  1XJW B;  3TSW A;  4ESR A;  3M55 A;  3X28 B;  1GRI A;  1Q86 C;  2COZ A;  2V8K A;  1M30 A;  1K76 A;  4RTZ A;  2XG8 D;  4BE1 A;  1F1B B;  4A63 B;  2JOY A;  4PFZ A;  2RPN A;  2FPF A;  5LJ3 d;  3T9N A;  2V8I A;  1BIB A;  1N5Z A;  1D3B A;  3VYG A;  3DLL A;  5FRM A;  3OYN A;  1P92 A;  1I5L A;  2QI2 A;  2IPO B;  3I35 A;  2L3R A;  4L6V 5;  4QKU A;  4OMP A;  1ZUU A;  2ED1 A;  4RUG A;  2VYT A;  5KYU A;  1UGQ B;  3JB9 H;  4C92 C;  2M1H A;  2CP7 A;  4JRQ A;  4YTL A;  2B8A A;  2CP0 A;  1Z9Z A;  4C5E A;  1XQH A;  4LN2 A;  3CCL Q;  4F7U B;  2DL7 A;  2ESW A;  1NG2 A;  4RCC A;  3RR6 A;  1Q7Y R;  3NTK A;  4C92 B;  1SG5 A;  4PNO A;  4E7L A;  1X75 C;  2DEU A;  3CBM A;  2AZV A;  1WXU A;  1VQM Q;  1G3Y A;  3JB9 J;  2P0Q A;  2LX9 A;  2LJ0 A;  1YCS B;  4M75 D;  2DBK A;  3KXT A;  1OV3 A;  4DBQ A;  1LVK A;  4JLI A;  4WCI A;  3OA6 A;  4J7I A;  1M27 C;  3FB9 A;  4HT8 A;  2DIL A;  1OUL A;  5CCA A;  1LPL A;  3LLR A;  2B86 A;  1QVG S;  4BUG A;  4PKC C;  3M53 A;  3RMQ A;  2QQS A;  2RQT A;  1RL2 A;  4D8K A;  2VWF A;  1I8F A;  2QTX A;  1BKB A;  1M2O A;  5HK0 A;  2ZGW A;  4AFU C;  4M77 G;  4PJN A;  1C1A A;  2X51 A;  5CK9 A;  1Q81 U;  5KCH A;  4D8D A;  4BDY A;  1S72 T;  4EMK B;  3M56 A;  1FYN A;  4A4E A;  1YI2 T;  1TS9 A;  1QKW A;  2RJF A;  3H0I A;  2EYQ A;  1KQ1 A;  4FSX A;  1RAB B;  1VYV A;  3CC4 T;  4CC4 B;  4XU2 A;  3L2W A;  3QYH B;  3I55 A;  3CXC S;  2DO3 A;  2QTV A;  3FEO A;  1JXM A;  2NUT A;  2K5L A;  2RJE A;  2XI9 A;  3OY9 A;  2XU8 A;  2CZ1 B;  1WFW A;  4M7A E;  3OYM A;  1ACM B;  4FL6 A;  4JDS A;  2DXU A;  3OYI A;  1T3S A;  4M78 B;  1UGV A;  2KYM A;  3I5R A;  4P5N A;  2DYI A;  2X4X A;  2K3B A;  2DPP B;  1I4K 1;  2PZ1 A;  2EYY A;  2KI7 A;  3RNJ A;  4E47 A;  2RHY A;  1UTI A;  1CKB A;  2RHX A;  2M51 A;  1VQN A;  1IRE B;  3BFM A;  4ANJ A;  1NEB A;  2IVW A;  3X20 B;  2YUN A;  3M9Q A;  5IXF A;  3CD6 A;  2DER A;  4R55 A;  3V7C A;  1UEC A;  2HNI A;  2PVG B;  4WTO B;  2RM4 A;  4F7U F;  2KDS A;  4A4F A;  1Y96 B;  2XDD A;  1Q81 R;  4PFO A;  3JCM h;  3JCM d;  1NJI U;  1YN8 A;  4C92 F;  2FZK B;  4E7Z A;  4RTY A;  1W70 A;  1M1K C;  2YRC A;  2Y90 A;  1IRX A;  1K1Z A;  3EGX A;  2DKG A;  4OMF B;  2P4T A;  3OW2 P;  2RB6 A;  3QZ5 B;  1SSH A;  2QA4 Q;  1YI2 Q;  1BCO A;  3FJ5 A;  2L2P A;  4KUL A;  3EG0 A;  2ENM A;  1V76 A;  4ATO A;  1B07 A;  3VYH B;  1IGQ A;  4HA8 A;  2CP5 A;  4PJO G;  4FM4 B;  3WXM B;  2LQK A;  2D8H A;  1H92 A;  2JW4 A;  1HK9 A;  1M5Q 1;  2JM9 A;  3CPW S;  3M0S A;  3V8K A;  1KHI A;  1NBE B;  1QWF A;  3BE3 A;  4J9G A;  4C8Q E;  1JU5 C;  2EQJ A;  1ZLM A;  2OTL A;  5GMK i;  1MV0 B;  4MML A;  2FVU A;  2QGF B;  3SDZ A;  1TTH B;  3A8L B;  4RTT A;  1WXB A;  2KT8 A;  4OMO A;  4RG8 A;  1BBZ A;  2EJF A;  4PLI A;  1U1S A;  4J9C A;  2FHD A;  1B34 B;  1ZHI A;  3M58 A;  2HCK A;  1NJI C;  1OI1 A;  3L2R A;  1OZ3 A;  2RH2 A;  2A36 A;  2C0T A;  3TQ7 P;  4JRP A;  2MOX A;  3JB9 I;  2HQE A;  4KRT A;  3FJP A;  2J7I A;  3QBY A;  2BUD A;  3ZEH A;  4XU3 A;  1ABO A;  1XNI A;  1X2Q A;  1KC8 U;  4J6W A;  2JZ2 A;  4OMN A;  3TVT A;  3S3M A;  3VKI A;  5DLQ E;  3JCM e;  1D0Y A;  1MMA A;  3VRZ A;  4E6R A;  3VS0 A;  1G2B A;  3EAE A;  3A8G B;  2LVM A;  2HL3 A;  4BI4 A;  1PSF A;  3GNG A;  1RAH B;  3HTR A;  4M78 D;  1UG1 A;  1AHJ B;  2KRN A;  4KT0 E;  2K5F A;  3OYA A;  1RAF B;  3E2U A;  2DVJ A;  4RKU E;  3RES A;  1KQS P;  3O5Z A;  4RG2 A;  2DTI A;  2DXT A;  4LDX A;  2YUP A;  4F7U A;  2YLC A;  4MZP A;  3RIR A;  3TRE A;  3HSB A;  2ABL A;  2QA4 A;  5LJ3 g;  4C92 A;  2EBP A;  4HT9 A;  4M7A D;  1WQ7 A;  5LJ5 j;  2ECZ A;  1Z9Q A;  1SPK A;  2KBT A;  2VB6 A;  2CZ7 B;  2HD0 A;  2DAQ A;  3FC3 A;  5KE2 A;  5GMK m;  5KYN A;  2DIQ A;  4QVC A;  4XQ3 A;  1W2B A;  1WI7 A;  1M3C A;  1KC8 R;  4JJD A;  2X4W A;  2XMF A;  3X26 B;  3CCV A;  4PK4 A;  1TU0 B;  4PJO E;  2OAU A;  3QKJ A;  1NLO C;  1K8A C;  2K4Y A;  2KMT A;  1W4S A;  3JB9 F;  4QQG A;  4FW2 A;  4FCY A;  3G71 Q;  2O2O A;  2PUK B;  2ZPE B;  1AEY A;  2CP2 A;  2KR3 A;  1TUG B;  3H41 A;  1BK2 A;  1WHG A;  1ZSG A;  2LC4 A;  2W10 A;  1M4Z A;  4EMK A;  4RTX A;  2JS2 A;  3CCR T;  2LQ8 A;  2PNI A;  3LGF A;  1K73 C;  1O9S A;  3PFS A;  3G1J A;  5GAM f;  3NMZ C;  1V29 B;  4KUD K;  4Y92 A;  5CO7 A;  1G3S A;  3NPF A;  1N9S A;  4LD6 A;  2H8H A;  1WHL A;  4OB2 B;  3HRU A;  2V26 A;  3CME Q;  4M7D C;  2VC8 A;  2HKQ B;  2KY9 A;  3PE0 A;  3M0Q A;  1VQK A;  4M78 A;  3BW1 A;  2FZC B;  4JUV A;  2HZY A;  1UGS B;  1JB0 E;  2MI6 A;  2QQ9 A;  1JEG A;  4K11 A;  2VUB A;  1WPY A;  2DL8 A;  4C8Q D;  3OYC A;  4X9D A;  1VYU A;  4M7D B;  2DNU A;  4EPC A;  3A1P A;  3JCM c;  1FMK A;  1X2K A;  1Y71 A;  2YSQ A;  2QK0 A;  1Y96 A;  1KFZ A;  3GNF B;  1VUB A;  5LL6 S;  3UA6 A;  2FG0 A;  5CKB A;  1NZ9 A;  2O31 A;  4RCB A;  3JCM V;  4DOW A;  5GAM j;  3PGG A;  1D0Z A;  3PMI A;  1A0N B;  2NLU A;  5I21 A;  1SHF A;  2F69 A;  3DB4 A;  4M75 C;  1M2V B;  2CH4 A;  4JRI A;  4DBF A;  5C6S A;  4C5I A;  4F7U G;  1M90 U;  1BYM A;  1BB9 A;  4M4Z A;  2EAY A;  1UEB A;  2ZPI B;  5EC7 A;  4N4I A;  3CCR Q;  4C92 G;  2ZZD A;  4CRI A;  3I55 T;  1U8R A;  4C0F A;  2ED0 A;  1NLP C;  2DLP A;  1Q86 U;  2RQR A;  1N6A A;  4M75 B;  3U23 A;  2EKH A;  2FEI A;  2MIO A;  1K0S A;  2YUQ A;  3UT1 A;  2YUO A;  2EGC A;  3G71 A;  3JCM g;  2BE9 B;  4MZT A;  1BU1 A;  3MP1 A;  5KH6 A;  3JCM J;  1VQN T;  3MEA A;  1Y0M A;  3HHT B;  5CR2 A;  3M4G A;  1R77 A;  2LX7 A;  3CD6 T;  5LJ5 h;  3EHQ A;  1YIT T;  5IHK A;  3OSS C;  1OPK A;  5I11 A;  2RK1 A;  1QVG A;  2RHI A;  1B34 A;  1KIK A;  2DXC A;  2GQI A;  4NS5 A;  2HAX A;  4OB0 B;  1UGP B;  3EG9 B;  3UA7 A;  3OYE A;  3O8V A;  2R57 A;  2OX7 A;  5FLX E;  3VRY A;  1M1G A;  2DD4 A;  4J83 A;  4AFZ C;  3OYB A;  3CMA A;  2J05 A;  1M90 R;  3CME A;  4OGE A;  1U06 A;  3JRZ A;  1VQ5 A;  4MMK A;  4AG2 C;  2GBQ A;  1SRL A;  2KK4 A;  2JMC A;  3CBO A;  3LWI A;  1ZUK A;  2L3S A;  2DZC A;  4M7D F;  1Q86 R;  4XTU A;  1FX7 A;  2J6K A;  4MDW A;  1HSQ A;  3CCJ A;  5HCK A;  1N8R U;  2XDB A;  2JMA A;  3HPW A;  1AOJ A;  1IGU A;  2QAS A;  3EGD B;  1TG0 A;  2L3Q A;  3I55 Q;  3MET A;  4KGV B;  4E7S A;  2LMJ A;  3GBQ A;  5IAY A;  4LDY A;  4Y28 E;  4AG1 C;  1RI9 A;  3MHX A;  4A54 A;  4JLG A;  3C94 A;  1W1F A;  2K6D A;  3P8B B;  4J9E A;  4ZTF A;  2H3J A;  2O4X B;  2QQA A;  2QEX Q;  1WNL A;  2OTL T;  2HSE B;  3C12 A;  5D6W A;  4M7D D;  1RAG B;  2CT3 A;  3MP6 A;  3OB9 A;  3QJ6 A;  1VQN Q;  3M54 A;  1UJY A;  3CCR A;  2M16 A;  2EGE A;  3CD6 Q;  1YIT Q;  1QVP A;  4M75 F;  1BI1 A;  2G6F X;  2JVV A;  2V1Q A;  2M02 A;  4XTY A;  2D0Q B;  3VS3 A;  1VQ7 A;  1JBM A;  1QMC A;  2K3X A;  4CI0 C;  3CPF A;  3ZL7 C;  5LJ5 e;  1MNE A;  2MMP A;  2AHJ B;  1VQL Q;  2E65 A;  5GAM h;  5GAM d;  2A7Y A;  4AFS C;  1SSF A;  1N8R C;  2DYB A;  3QJY A;  1YCY A;  1CSK A;  1GL5 A;  5A0D A;  4CC3 A;  3M0U A;  1BIA A;  2CSI A;  3VS5 A;  2OTJ A;  1NM7 A;  2EIF A;  1K9M C;  3CQT A;  1VQ4 Q;  1QW1 A;  4EMK C;  2GFU A;  4JJN K;  4DA4 A;  2R5A A;  2NWM A;  4ZN1 A;  3IQL A;  2P84 A;  1QVF S;  1VQ6 T;  1G3T A;  3JB9 G;  1MHN A;  4C0D C;  1VYT A;  1TWB A;  3A8O B;  2GNC A;  2EJ9 A;  3P8H A;  4LNP A;  1LNX A;  1OQK A;  4KBM B;  1M1K U;  2DTH A;  2QA4 T;  2OTL Q;  1PG5 B;  4IKF A;  3OYG A;  2YDL A;  2LT4 A;  4C0D B;  2DE0 X;  4M78 C;  1YP5 A;  5GAN 7;  2KGT A;  2X3W D;  2GQV A;  3EFO B;  3EG3 A;  4JJB A;  1RLQ C;  3OYJ A;  3AHU A;  1B7T A;  5L23 A;  2DET A;  1GCQ C;  3CCS Q;  3MPU B;  1JJ2 S;  1MGQ A;  2JTF A;  1TOV A;  2OJ2 A;  4M7D A;  2YRV A;  3CCV T;  1QP3 A;  5IHN A;  5GAO p;  2AKL A;  3GLX A;  2QEX A;  4PLL A;  2X9H A;  2JTM A;  1FWZ A;  3EH2 A;  1PCX A;  1BI0 A;  4M7A C;  4ELY C;  2L89 A;  1KJW A;  3H8Z A;  2PVO B;  3VJP A;  1N9R A;  2AZS A;  2FRW A;  4QVD A;  1YNZ A;  1QCF A;  1YIT A;  3QDR B;  2DL4 A;  2RHZ A;  1HXD A;  2LNV A;  3DB3 A;  1M2V A;  3EG2 A;  3EGU A;  1D09 B;  2A3L A;  5GAM e;  1YJ9 A;  3R6N A;  1I07 A;  5IN1 A;  4M7A B;  1T0J A;  1WJR A;  1M1K R;  1Q82 C;  5GAO n;  1TH7 A;  2RI3 A;  2E64 A;  2LCL A;  3F70 A;  1VQL A;  1VQ6 Q;  4KUI A;  3VS7 A;  1KSW A;  1OX9 A;  3VS6 A;  5GAN 2;  4M75 A;  1YIJ T;  5KYY A;  2JM8 A;  5GAO l;  1AWX A;  4N4H A;  4C0G A;  1VQK T;  4Y91 A;  1KQ2 A;  2F5K A;  2ZPF B;  1HYO A;  1LJO A;  1OYX A;  2P0P A;  2EKO A;  4OML A;  4E2F B;  2WSF E;  1VQ4 A;  2JJ9 A;  1YHQ Q;  5IHI A;  1WLP B;  1QQJ A;  1PC0 A;  1T0H A;  3G4S A;  4A4G A;  3PVQ A;  1MUZ A;  3J81 E;  2D6F A;  4EDU A;  3CCQ T;  3OYD A;  3JAM E;  1H64 1;  2QQB A;  3Q1J A;  2DFU A;  2V1R A;  3CCV Q;  2R5M A;  3EG9 A;  4HVV A;  3C4S A;  4IUP A;  3KUF A;  3SEM A;  2MF2 A;  3PNW C;  4XAX B;  4ZGD B;  1ZBX A;  4M77 E;  2KXC A;  1MMN A;  2NUP B;  1OPL A;  5FWC A;  3OBW A;  2KRS A;  4C8Q C;  2E5K A;  4HCZ A;  3FLG A;  1YFN A;  1NJI R;  1FMW A;  3G7Z A;  2BTT A;  3CC2 T;  4IUR A;  3SHW A;  1ZX6 A;  1YJW A;  1UUE A;  5ECA A;  2JNG A;  3QWX X;  2XID A;  2DA9 A;  3JCM Q;  3CCS A;  4M78 F;  3V8J A;  3MJX A;  5LJ5 g;  2J6F A;  3OMG A;  4LDW A;  4GBQ A;  1PKT A;  3EGD A;  3LYI A;  4C8Q B;  2CUD A;  4J9B A;  1EIF A;  1KHC A;  4L5G A;  5LJ5 f;  3OYK A;  1SKU B;  3G71 T;  1C6V X;  1MMD A; 
#chains in the Genus database with same CATH homology
 2X3X D;  3TSW A;  2HBW A;  4ESR A;  2DJQ A;  4FSS A;  2KT1 A;  1GRI A;  1JEG A;  4K11 A;  5IH2 A;  1M30 A;  1K76 A;  4RTZ A;  2K79 A;  2DL8 A;  1AZG B;  4LE9 A;  1VYU A;  1UDL A;  2DNU A;  4A63 B;  2EYZ A;  2RPN A;  2VVK A;  2FPF A;  3PVL A;  1FMK A;  1X2K A;  3LH5 A;  2YSQ A;  1N5Z A;  2CSQ A;  4F17 A;  1KFZ A;  1WYX A;  1SHG A;  3UA6 A;  2FG0 A;  2O31 A;  3I35 A;  1RLP C;  4RTW A;  5FW9 A;  1A0N B;  2O9V A;  4OMP A;  2MCN A;  1SHF A;  1ZUU A;  2ED1 A;  4RUG A;  3NGP A;  2YT6 A;  2CH4 A;  2SEM A;  2DBM A;  1BB9 A;  2EQI A;  4M4Z A;  1NEG A;  3REB B;  4RTV A;  2OI3 A;  5EC7 A;  1Z9Z A;  2HDA A;  3M0T A;  4LN2 A;  5FWB A;  2ED0 A;  1NLP C;  2QDL A;  5IXB A;  2DL7 A;  2DLP A;  2ESW A;  1AVZ C;  1NG2 A;  1J3T A;  2RQR A;  1NYG A;  3U23 A;  4CC2 A;  3M0P A;  3NHN A;  2EKH A;  2FEI A;  1UJ0 A;  2A08 A;  2MIO A;  1X27 A;  1K0S A;  2YUQ A;  2LQW A;  2YUO A;  2O9S A;  2EGC A;  2ROL A;  2AZV A;  1BU1 A;  1WXU A;  2BZX A;  4ORZ A;  2KYB A;  2IIM A;  1TUC A;  1PRM C;  1UE9 A;  2LJ0 A;  1YCS B;  1Y0M A;  3M0R A;  2DBK A;  2LX7 A;  1E6G A;  3EHQ A;  1OV3 A;  2DM1 A;  5IHK A;  4WCI A;  1OPK A;  5I11 A;  1OOT A;  1M27 C;  4X1V A;  2BZY A;  2DIL A;  1KIK A;  2B86 A;  2GQI A;  1QWE A;  2RQV A;  4OMQ A;  1T3L A;  2L3P A;  2RQT A;  2DL3 A;  4D8K A;  3UA7 A;  2VWF A;  4AFU C;  2KRO A;  3VRY A;  1U3O A;  4AFZ C;  2JT4 A;  2J05 A;  4D8D A;  1HD3 A;  1U06 A;  1H3H A;  1X6G A;  1FYN A;  5GJW B;  3QWY A;  2CDT A;  4AG2 C;  1QKW A;  2GBQ A;  4IIO A;  1SRL A;  2JMC A;  3THK A;  3H0I A;  3RBB B;  5GJV B;  4HCK A;  1ZUK A;  2DMO A;  4ZNX A;  2L3S A;  1VYV A;  1SEM A;  2JXB A;  4CC4 B;  2J6K A;  3C0C A;  1HSQ A;  1XOV A;  2LJ1 A;  1ARK A;  5HCK A;  2JMA A;  1AOJ A;  1JXM A;  1JO8 A;  1GCQ A;  1TG0 A;  1K0X A;  2L3Q A;  1JQQ A;  1WFW A;  2LMJ A;  2M0Y A;  3GBQ A;  1K9A A;  1RUW A;  1T3S A;  4AG1 C;  1RI9 A;  1UGV A;  2KYM A;  1W1F A;  3I5R A;  2K6D A;  4DEX A;  4J9E A;  2K3B A;  1U5S A;  1X69 A;  2EYY A;  1X6B A;  2PZ1 A;  2RQU A;  3RNJ A;  1TUD A;  3VS1 A;  1UTI A;  1CKB A;  1AD5 A;  2F2X A;  2M51 A;  1UHC A;  1NEB A;  2CT3 A;  2YUN A;  5IXF A;  2GGR A;  1X43 A;  2EGA A;  1UEC A;  2AK5 A;  1UJY A;  2SRC A;  2EGE A;  1PNJ A;  1YWP A;  1GBQ A;  5I22 A;  2D8J A;  2G6F X;  2V1Q A;  2AKK A;  1YN8 A;  4JZ4 A;  2C0O A;  1LCK A;  2LZ6 B;  4RTY A;  1W70 A;  2EYX A;  1WDX A;  1GFD A;  3VS3 A;  1Y57 A;  2L0A A;  1PRL C;  3ZL7 C;  4Z8A A;  1K1Z A;  4Z88 A;  2P4R A;  1G83 A;  2EVR A;  1SSH A;  3TSZ A;  2CRE A;  4AFS C;  4GLM A;  3FJ5 A;  2L2P A;  2DYB A;  2C0I A;  3EG0 A;  1CSK A;  1GL5 A;  4IIM A;  2ENM A;  4Z89 A;  1B07 A;  4CC3 A;  3M0U A;  1M8M A;  1I1J A;  2A28 A;  2CSI A;  3VS5 A;  2KXD A;  1NM7 A;  1GCP A;  3CQT A;  2J06 A;  2LP5 A;  4HVW A;  4AFQ C;  2D8H A;  1H92 A;  2JW4 A;  2A37 A;  2NWM A;  1E6H A;  2JS0 A;  3H0H A;  3IQL A;  2JM9 A;  1AZE A;  3M0S A;  1HJD A;  2DRM A;  1PKS A;  1PHT A;  2CT4 A;  4J9F A;  1UFF A;  1QWF A;  2DRK A;  2JTE A;  1VYT A;  2O88 A;  4J9G A;  1AWJ A;  2I0N A;  1H8K A;  2EW3 A;  2GNC A;  2RQW A;  4J9D A;  1JU5 C;  2KE9 A;  1ZLM A;  1QLY A;  1MV0 B;  2NUZ A;  2GTO A;  4LNP A;  4RTT A;  1GFC A;  1WXB A;  2KT8 A;  2W0Z A;  4R0K A;  1UHF A;  4OMO A;  2LNH B;  2RMO A;  1BBZ A;  4J9C A;  1WIE A;  2YDL A;  2HSP A;  2HCK A;  2DE0 X;  1YP5 A;  2KGT A;  1CKA A;  1M3B A;  2A36 A;  1WX6 A;  2C0T A;  2X3W D;  3REA B;  3VS2 A;  1EFN A;  2FPD A;  3EG3 A;  2KNB B;  2MOX A;  4JJB A;  1RLQ C;  4KRT A;  2RNA A;  1I0C A;  2J7I A;  5L23 A;  1GCQ C;  1AWO A;  2LJ3 A;  2FO0 A;  2OJ2 A;  4F16 A;  4JZ3 A;  5IHN A;  1ABO A;  4CC7 A;  1X2Q A;  2AKL A;  4OMN A;  3TVT A;  1K4U S;  2HEQ A;  1VA7 A;  3VRZ A;  1KJW A;  4E6R A;  3VS0 A;  1G2B A;  1OEB A;  2AZS A;  2FRW A;  1ZBJ A;  2EYW A;  1YNZ A;  2K9G A;  1QCF A;  2DL4 A;  2DL5 A;  2F2V A;  1B3Q A;  3EG2 A;  3EGU A;  1UG1 A;  2KRN A;  4HVU A;  1S1N A;  1ZUY A;  3R6N A;  1ABQ A;  1I07 A;  2DVJ A;  1T0J A;  2DF6 A;  4J9I A;  2KEA A;  3O5Z A;  3UAT A;  2YUP A;  3KFV A;  2CH4 W;  3VS7 A;  1KSW A;  1WXT A;  1SRM A;  3VS6 A;  2ABL A;  2JM8 A;  4JPB W;  1AWX A;  2EBP A;  2J6O A;  1YWO A;  2OAW A;  2ECZ A;  1Z9Q A;  1SPK A;  4LUE A;  4OML A;  2KBT A;  3I9Q A;  1M3A A;  1PWT A;  3EHR A;  2FRY A;  5IHI A;  1WLP B;  1WI7 A;  1M3C A;  2CUB A;  2ROT A;  1W6X A;  4DEY A;  4JJD A;  3ULR B;  2XMF A;  1T0H A;  3A98 A;  1NYF A;  3PVQ A;  1MUZ A;  2RN8 A;  3JV3 A;  4HXJ A;  2K7A A;  1MV3 A;  2F2W A;  1NLO C;  4QT7 A;  3UF4 A;  2V1R A;  3VS4 A;  2LQN A;  1WA7 A;  4HVV A;  2PTK A;  2DX1 A;  3SEM A;  2O2O A;  1AEY A;  1QKX A;  2KR3 A;  2VKN A;  3H41 A;  2KXC A;  1BK2 A;  1IO6 A;  1ZSG A;  4JJC A;  2FPE A;  2W10 A;  1E7O A;  2EPD A;  1OPL A;  5FWC A;  4RTX A;  2JS2 A;  2KRS A;  2E5K A;  2D0N A;  4LUD A;  2PNI A;  2BTT A;  3EG1 A;  4OMM A;  2RF0 A;  1JXO A;  2D1X A;  3SHW A;  1ZX6 A;  1UUE A;  5ECA A;  4EIK A;  3QWX X;  2LCS A;  3NMZ C;  2K2M A;  4J9H A;  4Y92 A;  2DA9 A;  3I5S A;  2KRM A;  3H0F A;  4F14 A;  3NPF A;  1AWW A;  2J6F A;  2H8H A;  4GBQ A;  1PKT A;  1V1C A;  2BZ8 A;  2GTJ A;  2CUD A;  4J9B A;  1GBR A;  4RTU A;  3PE0 A;  3M0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...