2X3XD

Structure of mouse syndapin i (crystal form 1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'VRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
molecule tags Endocytosis
source organism Mus musculus
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2x3xD00
1YP5A 2AK5A 4ORZA 1MV0B 2L3QA 4RTYA 2CUBA 1GBQA 2FO0A 3KFVA 1K9AA 3ULRB 1H8KA 4DEXA 2F2XA 3EHRA 2SRCA 3M0SA 4QT7A 2JXBA 2EYYA 2B86A 4Z89A 2ENMA 1K76A 1NYFA 1OOTA 2EPDA 1SHGA 5GJWB 4OMMA 2ABLA 1PNJA 1Y0MA 2RQWA 2IIMA 5IH2A 2RQVA 3JV3A 2FPDA 1KJWA 3M0RA 5GJVB 2CDTA 2BZYA 2EGEA 2LMJA 2FEIA 1MV3A 2CSIA 1V1CA 3M0UA 1K0XA 2GNCA 1UJ0A 2J05A 1J3TA 1WLPB 2C0IA 2FRYA 3ZL7C 1YWOA 4WCIA 2JW4A 1K0SA 4EIKA 1SHFA 2LZ6B 1X2QA 1M8MA 5FWCA 1PKTA 1VYUA 3M0PA 3H0HA 4J9GA 1QKXA 2V1RA 1NEGA 2VVKA 4M4ZA 1SSHA 2K7AA 4FSSA 1SEMA 3VS0A 2M51A 1UUEA 2F2WA 1OPKA 1FMKA 1YNZA 4RTUA 2HCKA 2YUPA 2A37A 1ABQA 2RMOA 1UECA 1GL5A 1X2KA 3C0CA 4AG1C 4D8KA 4HVWA 2PNIA 2AZVA 4AFQC 1NEBA 1I07A 2V1QA 2DBKA 1VYVA 2JT4A 2GTJA 3RBBB 4J9DA 1SRMA 2DYBA 3VS7A 4AG2C 1Y57A 1PHTA 2ESWA 3PVLA 5IHNA 3QWYA 1T0HA 2K9GA 2KT1A 2RQTA 3U23A 1WA7A 3TSZA 2PTKA 2J6KA 1PKSA 3VS4A 4AFUC 2M0YA 2EGAA 2OI3A 4J9HA 1JQQA 2GTOA 2K3BA 1K4US 4RTXA 2LQWA 1UFFA 1TG0A 2FRWA 3SHWA 1XOVA 2EVRA 2BZXA 1ZBJA 2O88A 1OPLA 1YN8A 3LH5A 2DF6A 2DA9A 2H8HA 3RNJA 3VS6A 2J6FA 4K11A 1UDLA 4OMPA 2X3WD 1AZGB 4J9EA 1U06A 2CT4A 2DL7A 1CSKA 1EFNA 2W0ZA 2G6FX 2LNHB 4RTZA 1WXTA 1ZUYA 1WIEA 2MOXA 2O2OA 1Z9ZA 2RF0A 2K79A 1E6HA 5IXFA 2KRMA 2KGTA 3UA6A 3NGPA 2EYWA 4HCKA 2C0TA 2J7IA 2EYXA 2KXCA 5IHIA 2O9SA 1M3BA 1RI9A 3EG3A 1S1NA 4F14A 1X6BA 1YCSB 2GBQA 1JO8A 2DX1A 2KT8A 3UF4A 3VRZA 1NLPC 4Z88A 1JEGA 3I5RA 2MCNA 2D0NA 2SEMA 2KEAA 4IIMA 3SEMA 2KRSA 2DL4A 2X3XD 1H3HA 1PRLC 1UHFA 1AWXA 1UJYA 2JMAA 2EBPA 4KRTA 1M27C 3EG0A 2C0OA 1ZUKA 2BTTA 1JXMA 1BB9A 1SRLA 2D8HA 5IXBA 1AWOA 1AEYA 1OEBA 2EQIA 1UHCA 2AKKA 1UG1A 2LJ0A 3EG2A 2YDLA 4F17A 1GFDA 4JPBW 3PVQA 2HEQA 3VS5A 2CT3A 1KFZA 1RLPC 1PRMC 4J9FA 1Z9QA 5IHKA 2EKHA 2LX7A 1KSWA 1ABOA 4D8DA 2NUZA 2BZ8A 4LN2A 3THKA 2O9VA 2CREA 3UA7A 2DMOA 2QDLA 4CC4B 1AD5A 3H0FA 1WXUA 1BBZA 2O31A 4DEYA 1M3AA 4LE9A 1QCFA 2DL8A 3EHQA 1B07A 2CH4W 2JTEA 2RPNA 1X69A 2XMFA 3GBQA 1X27A 2ECZA 1KIKA 1HSQA 2HSPA 4HVVA 3VS2A 1GCQC 1UTIA 4F16A 1NYGA 4J9BA 3R6NA 5L23A 2DILA 2F2VA 3I9QA 5FW9A 4OMNA 4Y92A 1YWPA 2KNBB 1NLOC 2CUDA 4AFSC 2DVJA 4Z8AA 3PE0A 1QWEA 1UGVA 2E5KA 3CQTA 2A08A 5FWBA 1GBRA 4JZ4A 2YUOA 2LCSA 1W70A 3A98A 1X43A 4GBQA 2AZSA 1G83A 2L3PA 2PZ1A 3NHNA 4ESRA 2YT6A 2KRNA 4RTWA 1M30A 1HJDA 4HVUA 3UATA 3FJ5A 4OMQA 2A36A 2KYMA 2RNAA 2D8JA 4RTVA 2FPFA 2OJ2A 5HCKA 1I0CA 4CC3A 1G2BA 3I35A 1I1JA 1TUCA 2DM1A 1AZEA 2DE0X 1QLYA 5I22A 2LJ1A 4RTTA 2YSQA 2I0NA 1WYXA 4CC2A 2CH4A 1GCQA 2J06A 3QWXX 2DJQA 4CC7A 4OMOA 1OV3A 2JS0A 1JU5C 1AWJA 1GFCA 1RUWA 1H92A 4JJCA 2RQUA 1NG2A 1ZLMA 4J9IA 2ED0A 2KE9A 2CSQA 2DLPA 3TSWA 2RQRA 1E6GA 2JM9A 1SPKA 2W10A 2DL3A 1NM7A 2JMCA 4J9CA 4GLMA 3M0QA 4JZ3A 1K1ZA 2HBWA 1QWFA 3M0TA 2OAWA 3O5ZA 2DL5A 2FG0A 2YUNA 1VYTA 3REAB 5EC7A 4HXJA 1ZX6A 5ECAA 2FPEA 4LUEA 2GQIA 2GGRA 4AFZC 2EGCA 1WX6A 1A0NB 4R0KA 1BK2A 2RN8A 3VS3A 1WXBA 4OMLA 2HDAA 1AOJA 1AVZC 1HD3A 1GRIA 2KYBA 2KR3A 2EYZA 1E7OA 1X6GA 2KBTA 1N5ZA 3NPFA 4ZNXA 3IQLA 3H41A 4RUGA 2DNUA 3VRYA 1PWTA 1T3SA 1M3CA 4E6RA 2AKLA 1WDXA 2MIOA 4X1VA 3H0IA 2P4RA 1JXOA 2ED1A 2K2MA 1FYNA 2JS2A 5I11A 4LNPA 2JM8A 1RLQC 2D1XA 3TVTA 1ZSGA 2KROA 1W6XA 3VS1A 2J6OA 2DBMA 1B3QA 4IIOA 1WFWA 1VA7A 2LP5A 3EG1A 1ARKA 4A63B 2DRKA 1UE9A 2K6DA 4LUDA 3I5SA 2ROLA 3NMZC 1T3LA 1CKAA 1U5SA 1AWWA 1IO6A 3EGUA 1W1FA 2LJ3A 2ROTA 2A28A 1QKWA 1WI7A 2YUQA 2LQNA 1MUZA 1LCKA 2NWMA 2DRMA 2VKNA 1GCPA 2KXDA 2VWFA 1U3OA 1ZUUA 2L2PA 1TUDA 1T0JA 2L3SA 4JJDA 1BU1A 2L0AA 4JJBA 1CKBA 3REBB 2EW3A
chains in the Genus database with same CATH superfamily
2AK5A 3EFOA 3FB9A 3GOXA 4E7IA 4ZN1A 1GBQA 1K9AA 2O01E 3A5ZB 1YJWA 1H8KA 1BI3A 1I8FA 1VQ6T 1Q86R 2SRCA 4Z89A 1ZSZA 4M7DF 4M7AD 2F69A 1P92A 1NYFA 1OOTA 1WHMA 1SHGA 5GJWB 3I56Q 5IH2A 1YIJQ 2RQVA 3JV3A 2FPDA 1KJWA 1JJ2S 5IAYA 4N0AA 2OTLA 4M7AB 1Q81U 5LL6S 1UJ0A 3CC2A 2BUDA 1VQMA 1VQKT 4OVAA 3CXCA 2FRYA 4JS4A 3ZL7C 4ZTJA 4RG8A 2XU8A 4KT0E 4WCIA 2JW4A 1K0SA 2XDPA 2VB6A 5GAMf 3SB2A 1D0ZA 3CD6T 2DTHA 2LZ6B 4MZTA 5FWCA 2DEQA 4OB1B 2RHZA 3JCMf 1YJNA 4L59A 1VQ4Q 3C95A 1HXDA 4XTVA 4F7UG 1NEGA 3EFRA 3AT1B 2VVKA 4M4ZA 2ZPGB 2K7AA 3QJ6A 5KE3A 4FYYB 3UT1A 1NE8A 3VS0A 2DAQA 3FEOA 2M51A 1UUEA 1FMKA 1Q86U 3HP9A 1QCOA 2LRQA 3C0CA 4J7IA 1QVGP 1W2BS 4HVWA 4NS5A 1NEBA 4J5YA 2V1QA 1VYVA 1QVFS 2JT4A 1H641 3V8KA 2JVVA 3JRZA 1MMGA 1FX7A 4TVRA 3VS7A 1FWZA 1PHTA 3PVLA 3GIBA 5DLQE 2L89A 1N8RU 5FU6C 3CC7T 2FHDA 4OGCA 2OTLT 2RQTA 2HD0A 3TSZA 4E7HA 5GAOn 2J6KA 1D09B 1PKSA 2M0YA 2OI3A 1VQNQ 4WF2A 3CCLT 2K3BA 4RTXA 3JCMV 1UFFA 4XU0A 3G71Q 3G71A 1QVPA 1YN8A 1YJNT 1AT1B 2DA9A 3SD4A 3CMAA 3M55A 3VS6A 3M53A 2J6FA 3TU4K 3LLRA 3P8BB 4E7ZA 1KQSA 1CSKA 1EFNA 2W0ZA 4QW2A 2G6FX 4RTZA 1ZUYA 1Z9ZA 2RF0A 4E7LA 1YJWQ 2YLCA 3UA6A 1FMVA 4HCKA 2RHUA 4AMCA 1VQ5Q 2E65A 1M3BA 3OSSC 5GMKe 3CCRT 2CYZB 1RI9A 3EG3A 4F14A 5KYUB 1X6BA 1NLPC 3I5RA 2MCNA 2WSCE 4LXCA 4MMKA 2K3YA 3ZBDA 2DL4A 1PRLC 4JRKA 3BY7A 3MEAA 4PKCC 2XHCA 2EBPA 1M5Q1 1M27C 1NJIC 1D1AA 1VQ9T 3M54A 1ZUKA 4GLKA 3RUXA 2BTTA 8ATCB 3OYHA 4JUVA 2COYA 3PIOA 2D8HA 4M7AF 3JCMe 1AWOA 2QASA 1OU8A 3TCJA 1VQLQ 4R55A 2HKQB 2EQIA 1YFNA 4FIBA 2QGFB 2QYZA 2LT1A 2QGGA 4J83A 2HL3A 3JAME 3CBPA 3OSVA 3VS5A 1YI2Q 3CCRQ 3CCUQ 3J7AF 4J9FA 5IHKA 1ABOA 3ZEHA 2VGMA 4N4GA 4NL2A 4D8DA 1YJWT 2BZ8A 3THKA 3HFNA 3BDUA 2EQKA 2DMOA 4CC4B 5GAMh 1G5VA 4RKUE 3VYHB 2HBPA 3P8DA 3PMIA 1WXUA 3QYHB 1YJ9A 4QVZA 3OA6A 2IVWA 3GBQA 5KCOA 1UB4A 2Z0WA 1RAIB 1R0BG 3GNGA 2K57A 1GCQC 2DEUA 2WACA 5FW9A 4Y92A 1VQOA 3QSUA 1NLOC 2CUDA 1OZ2A 4AFSC 1TS9A 3WVDB 3QZ5B 2RH2A 1VQKA 3OYGA 3HL8A 1UGVA 2E5KA 2PUOB 3JCMX 4M78F 2VXEA 3L1AA 3META 4PJOG 4BE2A 1W70A 1X43A 4GBQA 4N4IA 2Y4YA 5LJ3e 1QW1A 5M9OA 5DM7R 3JB9G 2EJFA 4ANJA 1IXDA 1C1AA 4BI4A 4C5GA 2CZ0B 2CZ7B 3FJ5A 5FRMA 3OS0A 2KYMA 2RNAA 1XJWB 4B6MA 4CC3A 1I1JA 2DE0X 3TQ7P 1QLYA 4Y91A 3CC4T 3CCUT 3NTKA 1YI2T 1WYXA 3CBMA 4JRIA 2J06A 3CXCS 2DJQA 4CC7A 1AHJB 1M1GA 3VU3C 2R5MA 1JU5C 2E6ZA 4E47A 1VQ9A 3EFSA 5CKBA 1VOMA 3QBYA 2QG9B 1K9MR 2MI6A 5CAIA 1H3ZA 3RERA 4JJCA 2RQUA 3M9QA 3S3OA 1YJ9T 3JCMg 3DB3A 1VQ9Q 2CP5A 4KH0B 3SWNA 2JJ9A 4ELZC 1OZ3A 2XG8D 4M77B 4M7AA 2HBWA 1SSFA 3L2QA 1EIFA 2K2VA 2K5IA 2FG0A 2OX7A 1VYTA 4N4HA 5EC7A 4HXJA 1ZX6A 2RI3A 1OX8A 5ECAA 4DBFA 2NUPA 3EG9A 1M1KC 2XDBA 1N8RR 3GPLA 3RKXA 4MZMA 1VQ5T 1A0NB 4M77C 3VS3A 2HDAA 1M4ZA 1AOJA 1AVZC 2KR3A 2EYZA 3URGA 3GP8A 4M75E 1KC8C 2KI7A 1RABB 2NYSA 5FRNA 1TU0B 3M4YA 4ZNXA 2WSEE 1Y07A 1IREB 3QO3A 3MP6A 1VQ6Q 2M16A 2QQRA 4FM4B 4DA4A 2CP7A 3ZFJA 1R0CB 1FMWA 3CCUA 2AKLA 4X1VA 5IT9E 4XTXA 1JXOA 3MP1A 1K8AR 4LNPA 1M1FA 3G4SQ 2JM8A 3SWNB 2HNIA 4FL6A 4EMKC 1HK9A 4MDXA 1MMNA 4DQ2A 1B3QA 2X4YA 3EH2A 3L2VA 2A0FB 3NTIA 4X34A 4IUVA 3I5SA 3M59A 5KYWA 1IO6A 1M2OA 4PFZA 4OGEA 1JB0E 2YUQA 1ZQ1A 2DK3A 2RI5A 4JLIA 1MNEA 4DBRA 2P0KA 2VKNA 5GAOl 2L3SA 4B9WA 1UGQB 3REBB 4ORZA 1MV0B 2M02A 4RTYA 2KY9A 1PD0A 3KFVA 2FZGB 3ULRB 4DEXA 4QT7A 1BI1A 3J81E 2EYYA 2B86A 4C92A 1YITQ 2LT4A 3HRUA 2DD4A 4LDUA 3M4GA 1YHQA 2ABLA 5FU7C 1PNJA 2IIMA 1Q81C 3PT9A 1QCNA 2Y90A 3OS2A 1D1BA 1OQKA 2E3HA 2EGEA 2LMJA 4J7FA 3RDVA 3CCMA 3G7ZA 2LCCA 1WJQA 5GAOp 4Z02A 1ZA2B 2GFAA 1VQKQ 4EMGA 1YITT 2J05A 1J3TA 2E41A 3I55Q 1YWOA 1TOVA 4M7DE 3A8GB 1WHLA 4M78D 3OYFA 3HFOA 2M0OA 1VYUA 3H0HA 2V8JA 3EGDB 1U1TA 2CKKA 4FW1A 5C6SA 1SSHA 3L2UA 4JJNK 1Q86C 1KD1R 3V7RA 3VJPA 1N9SA 2O4XB 4QQ6A 4DOWA 3HRTA 2F2WA 2JUFA 3QXEB 1M9SA 4N0AC 5DLOA 4RTUA 2YUPA 2VXFA 1Q82U 3OYNA 2A37A 1ABQA 2X51A 2RMOA 3WVEB 1GL5A 4PJOC 4F7UA 8AT1B 1VQ8T 1I07A 1WHJA 5HKCA 1N6AA 1IZ6A 3MKDA 4EMKA 4J9DA 1M8VA 2DZCA 2DTOA 5FU7B 1T0HA 3CBOA 4HCZA 3U23A 1KQSP 3S3NA 3I55A 5LJ3f 1K73U 1BIBA 4IUQA 5GMKl 1KQSS 4J9HA 3RMQA 1U8RA 2MYSA 1K4US 2DFUA 2ZPEB 1TG0A 1XNIA 2LQ8A 2EVRA 1XQHA 2BZXA 3MP8A 1ZBJA 4FCYA 3LH5A 3JB9H 3G1JA 5HK3A 3RNJA 3V7CA 4K11A 4L5GA 1AZGB 4J9EA 2CT4A 3OYKA 5LJ3j 2EAYA 1WIEA 2K5FA 2D9TA 5LJ3d 4M78C 2K79A 3FLGA 2HQEA 3CCMT 4XAXB 2CGHA 1NJIU 2KGTA 3OS1A 5FROA 1PSFA 3NGPA 2QTXA 1MHNA 3V8JA 2C0TA 2J7IA 2KXCA 2HL5C 5A2QE 3M5AA 2O9SA 2CP3A 1QVGA 2NUTB 1VQPA 1YCSB 2GBQA 4HA8A 3CMEQ 1JEGA 2D6FA 2K5LA 3OY9A 3FC3A 4ZGDB 3OBYA 2P84A 6AT1B 2KRSA 2RHXA 3L2WA 5GAMd 3ME9A 4EMHA 1UJYA 1NBEB 2QEXA 4KRTA 1VQNA 3KUFA 1WHGA 2HKNA 3L42A 4ME7A 1BB9A 2HQXA 1AEYA 1OEBA 1VUBA 2AIRB 1UHCA 1X01A 2JN0A 1SF9A 1UG1A 2VASA 2YDLA 4LDYA 3VUZA 5KYYA 3GLXA 4M75G 5AT1B 2VC8A 1TTHB 1Z9QA 2QXFA 2ZPFB 4BDYA 1WHKA 1QP2A 4LN2A 2IPOB 1AD5A 4FSXA 3CD6A 3CCJA 4M78A 3C4SA 3H0FA 5CQXA 1B07A 1VQ4A 5J26A 4LDXA 1DJ7B 3DLMA 5LJ5g 5GANe 1HSQA 3CCET 1NYGA 4JRPA 2F2VA 4PK4A 3QDFA 2DVJA 4Z8AA 1ACMB 1KC8R 2QDYB 1IB8A 3CC2T 5LJ5d 4EPCA 2DTIA 2RHIA 5D7UA 3T9NA 2A08A 3ASKA 2KSSA 2YUOA 2A7YA 2EWNA 3OYBA 2LCSA 5GAOq 2X4XA 3A98A 3MEVA 5I21A 3RESA 3NHNA 3OS5A 4ESRA 5GANd 5LJ5j 3M56A 1O75A 5KYXA 1VQ8Q 2D8JA 2OJ2A 1WNLA 5HCKA 2CS7A 1I0CA 3OYYA 4O5VA 4RMOA 3JB9I 3NFCA 3UDCA 2QQSA 2K3XA 4JDSA 1AZEA 4LD9K 4E2FB 5I22A 2EJ9A 1KD1C 2CH4A 3SWNC 1GCQA 2DO3A 3M57A 3G4SA 5KYWB 4M7AG 3CCVA 1KD1U 1OV3A 2JS0A 4PJMA 4MMLA 1Q7YR 1OYXA 1RUWA 1H92A 1NG2A 4J9IA 1SG5A 3CMAT 4VUBA 1S72A 4NL3A 4PJOD 3HKSA 3CC4Q 1E6GA 2X4JA 3CEYA 1NM7A 2BE7D 2QA4T 4GLMA 3M0QA 1F1BB 1Q82C 1K1ZA 3I55T 4EDUA 4M7DG 7AT1B 1QWFA 3EFOB 4JS5A 2DL5A 3OW2S 4OP0A 3KBGA 5GAMe 3CCLA 1R77A 2PQWA 4AFZC 2CP6A 2EGCA 3RR6A 2DPPB 2DXTA 5CCAA 1YITA 4R0KA 1BK2A 2FZCB 4Q5WA 3G71T 4HCCA 1WXBA 4OMLA 5GANg 3RMSA 2ZGWA 5GANf 1E7OA 1X6GA 1BCMA 5CO7A 2HQHA 2E3IA 3IQLA 3H41A 3QIIA 1VQ7Q 1T3SA 3VYGA 2RJDA 1WPYA 4QQDA 3EAEA 1YI2A 1IHVA 3NTHA 2MIOA 1BI2A 1S72Q 2ED1A 2K2MA 1Q7YU 4ATOA 5LJ5h 2PVOB 3EGDA 3TVTA 2KROA 1O9SA 1W6XA 1GXIE 2PUKB 3DB4A 4IIOA 1VA7A 4D6WA 2XI9A 1PSEA 1UEBA 3CCJQ 4WTOB 2GCXA 2P0PA 3LYIA 4KGXB 1UE9A 1Q95G 2IG0A 4QVCA 4M78E 1U5SA 4C92B 5GAN8 2E64A 2COZA 2PVGB 1LCKA 4DOVA 2LCLA 3WXMB 5LJ5e 5D6WA 4BE1A 3MHXA 2KXDA 1U3OA 1ZUUA 1LVKA 4JJDA 3G4ST 5CKFA 2ZZDA 1MGQA 4XU1A 1VQOT 3OYJA 2L3QA 3MJXA 2CUBA 2FO0A 4KGZB 4M77F 1X75C 2F2XA 1U1SA 3JCMd 4KH1B 4UC4A 2YRVA 2ENMA 2JOYA 4PJOE 1I81A 1K76A 1UGPB 3PMTA 3LWHA 2DJZA 1M1KR 4FT2A 3A1PA 4R56A 4M75F 3M0RA 4ZN3A 2OAUA 1MV3A 2CSIA 3CCEA 2MAMA 4C0FA 4C5EA 3BW1A 5CQYA 2E4HA 3JCMQ 1NPPA 2ATCB 1UGSB 4OB2B 2C06A 4EIKA 2EKOA 1K9MC 3X28B 1VQOQ 1PKTA 4F7UB 1LOJA 3M58A 4J9GA 2OTJQ 1QKXA 4KULA 3JSCA 4RG2A 1KK7A 2FZKB 3A8HB 4M78B 1OX9A 5GAN5 4NOYA 2E10A 3X26B 1MMAA 1YNZA 4ZGJB 2RJEA 5KYXB 2HCKA 4XTZA 5C0MA 1BIAA 4ZGEB 1UECA 1JJ2A 2VV5A 3F70A 5HY6A 3CCVT 5GAN2 3S6WA 2AZVA 4AFQC 2DBKA 4AT1B 2GTJA 2DIGA 1YHQT 3L2RA 3DLLA 5I2SA 1SRMA 1S72T 1ZSZB 2DYBA 4AG2C 4M7DB 5GANh 1X6OA 2BE9B 3QWYA 2K9GA 1IGQA 1I5OB 1WA7A 2AHJB 2F5KA 2E5QA 4BI8B 3VS4A 2HMAA 1VQMQ 1B7TA 3CPWP 2V8IA 2GTOA 4DBQA 3BFMA 4F04B 2LQWA 2OTJT 3HTRA 4CI0C 1ZA1B 2YHTA 2FRWA 3E1SA 3SHWA 1Q81R 4DBHA 1OPLA 2XKOC 4C0DC 4BACA 2EIFA 5D6YA 3I56A 1QVGS 2X3WD 3TREA 1U06A 2DL7A 2KK4A 1M90R 1PC0A 4A4GA 2QQBA 3PFSA 2MOXA 2O2OA 2X4WA 1E6HA 2RO0A 5IXFA 2LTOA 3MCAB 1LJOA 4F7UE 2QA4Q 1Y7XA 2JZ2A 4HKEA 3RIRA 1KHCA 5CK9A 2EYWA 4M7AE 4LDWA 2EYXA 3FIFA 1YIJT 2KT8A 3S3MA 4IIMA 1XTDA 3SDZA 2X3XD 5AYFA 3FDRA 3CPWS 1AWXA 2JMAA 1WQ7A 2GFUA 1ZBXA 2QTVA 2B8AA 3SFMA 2C0OA 4V2SA 3MEUA 4XQ3A 5CKEA 1SRLA 4IKFA 2DXBA 2FVUA 1WHHA 1RAEB 2X35A 2WSFE 4M77E 2LJ0A 5LJ5f 1BKBA 3V7SA 2H3JA 2QA4A 1D3BA 1WQWA 3PVQA 2MF2A 3PGGA 3QKJA 1KFZA 2YXYA 3JB9F 1IHWA 2H3EB 1PRMC 2EKHA 2LX7A 1KSWA 3X24B 2KAFA 4PFOA 2NUZA 2CZ6B 2O9VA 2CREA 5GMKi 1IGUA 1G3SA 4DEYA 1M3AA 3CMEA 2O4XA 4LE9A 1QCFA 2DL8A 3JB9J 4C92E 4PJOA 2RPNA 2QAZA 1X69A 2XMFA 1YJNQ 3FJPA 1HYOA 2COWA 1VQ7T 2HSPA 4HVVA 3VS2A 1UTIA 1Y96B 4F16A 2E1HA 2DILA 2ZAEA 3I9QA 4OMNA 1YWPA 2KNBB 4FU6A 1K8AC 3V8LA 3VV0A 3EH1A 5FWBA 1GBRA 2OTLQ 4GY5A 3CC7Q 2L3PA 1G83A 2PZ1A 1VIFA 1MMDA 4KGVB 2A3LA 4RTWA 1SKUB 4RCCA 4HVUA 3UATA 3MPUB 4C8QG 3C94A 3FRNA 3LH0A 4LD6A 4OB3B 1RAGB 1OULA 1K8AU 2LQKA 2VGNA 1G2BA 1RL2A 1K73R 2DM1A 1D0XA 2MK5A 4CC2A 2V8KA 3QWXX 2EQJA 4OMOA 5GAOr 3QPHA 4C92F 1BCOA 4C8QD 3JCMJ 2M9UA 4MZPA 4X9DA 4JRQA 2EQMA 3J80E 1ZLMA 3CMET 2L3RA 4C0GA 2D0QB 1VQ4T 3JCMW 2E12A 1SPKA 4MDWA 1NJIR 2JMCA 4C8QB 2F1LA 5KE2A 3CCMQ 4C0ZA 2E70A 4ZTFA 2YRCA 3M0TA 2OAWA 3OW2A 1IRXA 2LC4A 3QUIA 4BY6C 2L5QA 3MO8A 4LUEA 2OTJA 3CCQQ 1VQ8A 1TSFA 1Q7YC 1HD3A 3Q1JA 4L6V5 1BI0A 1Y71A 2KYBA 3I56T 4II1A 3E19A 2LNVA 2R5AA 2QEXT 1N5ZA 3X25B 3CC7A 1K73C 2QK0A 2MWPA 1VQ7A 1D3BB 4P5NA 4E7JA 3CCEQ 2DNUA 3VRYA 1RI0A 4EMKB 4PJOF 1M3CA 4E6RA 4PLIA 4PJLA 1WDXA 3AHUA 3H0IA 2L8DA 4QKUA 4X9CA 4XU2A 1FYNA 1RAHB 2JS2A 1TH7A 3CCLQ 4F7UF 2D1XA 1ZSGA 1VQMT 1KHIA 2J6OA 2LP5A 3OYEA 2EJGA 1YCYA 4BI3A 5CKDA 5CVIA 4LUDA 1WZOA 2ROLA 3X20B 3NMZC 2HAXA 1T3LA 3CCJT 3JCMP 1WJSA 3EGUA 4KUDK 9ATCB 2LJ3A 3OQ5A 2I2LA 5D6XA 3R6OA 4A54A 2A28A 2LQNA 1MUZA 1R8OB 3A8OB 2NWMA 2DRMA 1VQPT 2VUBA 2FB7A 2VWFA 4E7SA 1KQ1A 1TUGB 1T0JA 1BU1A 4JJBA 1CKBA 1D1CA 1YP5A 4C92D 1QQJA 3CXCP 3LGFA 3C12A 2FL7A 2P4TA 1LNXA 3EHRA 3M0SA 2JXBA 3VKIA 3BDLA 5GAN4 1RADB 3OYCA 2LX9A 1C6VX 2RK2A 2EPDA 2P0QA 3QYGB 4OMMA 4OMFB 1Y0MA 5GANj 2RQWA 4BUGA 3OYIA 1V76A 3PIPA 3CD6Q 5GJVB 2RM4A 2CDTA 4PLLA 2BZYA 2XK0A 2FEIA 2EYQA 3LW5E 5FU6B 4M77A 1PD1A 2KMTA 4CRIA 1V1CA 3M0UA 1K0XA 2GNCA 5GMKj 1RACB 3CC4A 4BB7A 1WLPB 2C0IA 5I2MA 4IUUA 3VUBA 4PNOA 4A4FA 1SHFA 3CPFA 1X2QA 1M8MA 4M75A 2DZ9A 3M0PA 3OMCA 1OI1A 5A0GA 3CMAQ 4M77G 2V1RA 1N27A 2Y4XA 1VQLA 4A4HA 4FSSA 2LDMA 3BE3A 2NUPB 3EG9B 1SEMA 2LVMA 3L2ZA 1OPKA 3G6EQ 2DYIA 4IURA 3CCRA 2F5TX 1ZSZC 5GAMg 1RAFB 5A0LA 3OB9A 1G8XA 4C8QF 1X2KA 4AG1C 1C0MA 4D8KA 4KBMB 2PNIA 1VQ5A 3OYDA 3CCSA 3E9FA 2YRDA 4J6YA 4QVDA 3RBBB 3JB9D 1W2BP 2MPXC 4FW2A 5A0DA 3P8HA 1W4SA 1M2VA 1Y57A 1N9RA 2ESWA 2VYTA 5IHNA 5GAN7 1TXQA 2KT1A 3OMGA 5LJ3g 4XTWA 2DD5A 5GAMj 4C0DB 2PTKA 4AFUC 2EFIA 2EGAA 2JTFA 3CC2Q 1JQQA 2QEXQ 3UPUA 4M7DD 2CP0A 4RCBA 5DY9A 1XOVA 2O88A 5GAN3 1QMCA 5KYNA 2CZ1B 2DF6A 1TWBA 2H8HA 3RKYA 2M1HA 1UDLA 4OMPA 1N8RC 3H6ZA 2RHYA 1Y96A 3OBWA 1UGRB 4PL6A 1RAAB 2LNHB 3PNWC 1WXTA 5KYYB 3GF5A 2FYKA 4XTYA 3QDRB 4M78G 4E7KA 1KC8U 5GMKm 2KRMA 3GNFB 3QJYA 3CCSQ 5IHIA 2DVEA 4OB0B 1G3TA 1S1NA 1B34B 4C5HA 1JJ2P 3KXTA 1JO8A 2DX1A 3UF4A 3VRZA 1YJ9Q 4Z88A 1B34A 2D0NA 2SEMA 2KEAA 4PJNA 3SEMA 3MEWA 3JCMh 5KH6A 3D7SB 3G6EA 3QZ9B 1H3HA 2RJFA 1UHFA 4IUTA 4Y28E 2HZYA 2KQWA 3OW2P 3EGXA 2BKDN 3EG0A 5GMKh 4HCBA 1QP3A 1YBYA 4FYXB 1JXMA 2RA2A 5IXBA 2AT1B 4BE0A 2G3RA 1VQPQ 4HT8A 2DXUA 2GQVA 2NUTA 1QVFP 1FXXA 2AKKA 5J39A 4ELYC 3INZA 1VIEA 3EG2A 4F17A 1GFDA 1ZHIA 4JPBW 3H9NA 2HEQA 2QQ9A 2CT3A 2MWOA 1RLPC 1KQ2A 3CCST 4KUIA 4C92C 4LDVA 3DKMA 3QG1A 3LX7A 4XTUA 4FT4A 2R57A 3UA7A 2QDLA 4C8QA 5KCHA 1BBZA 2O31A 2GF7A 1I4K1 3EHQA 5GAOm 2CH4W 2JTEA 4C8QC 1JBMA 1YIJA 1X27A 2ECZA 1EZZB 1I5LA 1KIKA 4J9BA 3R6NA 5L23A 2RB6A 1NZ9A 2XICA 3H8ZA 3LGLA 3PE0A 1M90C 4XK8E 4FYVB 1QWEA 4IUPA 3N5BB 3CQTA 4J6WA 4JZ4A 3O8VA 3QHSA 4FYWB 2PU9B 2AZSA 3CCQT 1QVFA 2DIQA 2YT6A 2KRNA 1M30A 1HJDA 1V29B 1K9MU 4M7AC 4B9XA 4OMQA 2BIVA 5CIUA 2A36A 2HSEB 3PTAA 4RTVA 2FPFA 1M90U 3OYMA 1VQLT 1WJRA 3I35A 3HRSA 4BDZA 3OYLA 1TUCA 4HT9A 1EX4A 2RJCA 3JCMc 4M7DC 2LJ1A 2XIDA 4C8QE 5LJ3h 4RTTA 2YSQA 2I0NA 5EG2A 3G6ET 5KYUA 3ER0A 1G3YA 4XU3A 4A4EA 3HPWA 2XD0A 2NLUA 4M7DA 4JLGA 1PM3A 4C5IA 1AWJA 2KDSA 1PCXA 2E6NA 1OU9A 1JRIA 1GFCA 2QQAA 1BYMA 4YTLA 2ED0A 2KE9A 2CSQA 4PJJA 2DLPA 3TSWA 2JTMA 1Q82R 2RQRA 5CKHA 4OF1A 2RK1A 2JM9A 2W10A 5GAN6 2DL3A 4J9CA 2R58A 1WGSA 4J6XA 4JZ3A 2MMPA 3JCMb 3OYAA 5FLXE 1M2VB 2V26A 1LPLA 3O5ZA 4A53A 4PJOB 3REAB 2YUNA 2FPEA 2GQIA 2EQUA 2GGRA 5IN1A 2K4YA 1WX6A 3CCQA 2RN8A 4M77D 2PVDB 2ZPHB 2JNGA 1M1KU 2RI2A 1GRIA 2X9HA 3HHTB 1VQ6A 3E2UA 4O6JA 3LWIA 4QQGA 2KBTA 3HSBA 3NPFA 5CR2A 1VQNT 4BD3A 2DERA 1KG1A 4PFPA 3UWNA 4RUGA 1G3WA 1PWTA 4M75D 1W2BA 2ZCFB 1D0YA 1PG5B 3A8LB 2P4RA 5J3BA 2ZPIB 2DETA 2KVQG 5I11A 1YHQQ 5L8RE 2XDDA 2RD1A 1RLQC 4M75B 3VS1A 3CCVQ 2DBMA 3RKWA 1WFWA 2YWWA 3EG1A 3CPWA 2CP2A 3E9GA 1ARKA 4A63B 2DRKA 2QI2A 5HK0A 2K6DA 1CKAA 1AWWA 2YLBA 3A8MB 4A4KA 1W1FA 4M75C 2DKGA 2ROTA 1QKWA 1WI7A 4C92G 3EGXB 4J8OA 1NPRA 4BY6B 1GCPA 3TEEA 2L2PA 1TUDA 2ZPBB 2L0AA 1MNDA 2DXCA 2EW3A
chains in the Genus database with same CATH topology
1YP5A 2AK5A 4ORZA 1MV0B 2L3QA 4RTYA 2CUBA 1GBQA 2FO0A 3KFVA 1K9AA 3ULRB 1H8KA 4DEXA 2F2XA 3EHRA 2SRCA 3M0SA 4QT7A 2JXBA 2EYYA 2B86A 4Z89A 2ENMA 1K76A 1NYFA 1OOTA 2EPDA 1SHGA 5GJWB 4OMMA 2ABLA 1PNJA 1Y0MA 2RQWA 2IIMA 5IH2A 2RQVA 3JV3A 2FPDA 1KJWA 3M0RA 5GJVB 2CDTA 2BZYA 2EGEA 2LMJA 2FEIA 1MV3A 2CSIA 1V1CA 3M0UA 1K0XA 2GNCA 1UJ0A 2J05A 1J3TA 1WLPB 2C0IA 2FRYA 3ZL7C 1YWOA 4WCIA 2JW4A 1K0SA 4EIKA 1SHFA 2LZ6B 1X2QA 1M8MA 5FWCA 1PKTA 1VYUA 3M0PA 3H0HA 4J9GA 1QKXA 2V1RA 1NEGA 2VVKA 4M4ZA 1SSHA 2K7AA 4FSSA 1SEMA 3VS0A 2M51A 1UUEA 2F2WA 1OPKA 1FMKA 1YNZA 4RTUA 2HCKA 2YUPA 2A37A 1ABQA 2RMOA 1UECA 1GL5A 1X2KA 3C0CA 4AG1C 4D8KA 4HVWA 2PNIA 2AZVA 4AFQC 1NEBA 1I07A 2V1QA 2DBKA 1VYVA 2JT4A 2GTJA 3RBBB 4J9DA 1SRMA 2DYBA 3VS7A 4AG2C 1Y57A 1PHTA 2ESWA 3PVLA 5IHNA 3QWYA 1T0HA 2K9GA 2KT1A 2RQTA 3U23A 1WA7A 3TSZA 2PTKA 2J6KA 1PKSA 3VS4A 4AFUC 2M0YA 2EGAA 2OI3A 4J9HA 1JQQA 2GTOA 2K3BA 1K4US 4RTXA 2LQWA 1UFFA 1TG0A 2FRWA 3SHWA 1XOVA 2EVRA 2BZXA 1ZBJA 2O88A 1OPLA 1YN8A 3LH5A 2DF6A 2DA9A 2H8HA 3RNJA 3VS6A 2J6FA 4K11A 1UDLA 4OMPA 2X3WD 1AZGB 4J9EA 1U06A 2CT4A 2DL7A 1CSKA 1EFNA 2W0ZA 2G6FX 2LNHB 4RTZA 1WXTA 1ZUYA 1WIEA 2MOXA 2O2OA 1Z9ZA 2RF0A 2K79A 1E6HA 5IXFA 2KRMA 2KGTA 3UA6A 3NGPA 2EYWA 4HCKA 2C0TA 2J7IA 2EYXA 2KXCA 5IHIA 2O9SA 1M3BA 1RI9A 3EG3A 1S1NA 4F14A 1X6BA 1YCSB 2GBQA 1JO8A 2DX1A 2KT8A 3UF4A 3VRZA 1NLPC 4Z88A 1JEGA 3I5RA 2MCNA 2D0NA 2SEMA 2KEAA 4IIMA 3SEMA 2KRSA 2DL4A 2X3XD 1H3HA 1PRLC 1UHFA 1AWXA 1UJYA 2JMAA 2EBPA 4KRTA 1M27C 3EG0A 2C0OA 1ZUKA 2BTTA 1JXMA 1BB9A 1SRLA 2D8HA 5IXBA 1AWOA 1AEYA 1OEBA 2EQIA 1UHCA 2AKKA 1UG1A 2LJ0A 3EG2A 2YDLA 4F17A 1GFDA 4JPBW 3PVQA 2HEQA 3VS5A 2CT3A 1KFZA 1RLPC 1PRMC 4J9FA 1Z9QA 5IHKA 2EKHA 2LX7A 1KSWA 1ABOA 4D8DA 2NUZA 2BZ8A 4LN2A 3THKA 2O9VA 2CREA 3UA7A 2DMOA 2QDLA 4CC4B 1AD5A 3H0FA 1WXUA 1BBZA 2O31A 4DEYA 1M3AA 4LE9A 1QCFA 2DL8A 3EHQA 1B07A 2CH4W 2JTEA 2RPNA 1X69A 2XMFA 3GBQA 1X27A 2ECZA 1KIKA 1HSQA 2HSPA 4HVVA 3VS2A 1GCQC 1UTIA 4F16A 1NYGA 4J9BA 3R6NA 5L23A 2DILA 2F2VA 3I9QA 5FW9A 4OMNA 4Y92A 1YWPA 2KNBB 1NLOC 2CUDA 4AFSC 2DVJA 4Z8AA 3PE0A 1QWEA 1UGVA 2E5KA 3CQTA 2A08A 5FWBA 1GBRA 4JZ4A 2YUOA 2LCSA 1W70A 3A98A 1X43A 4GBQA 2AZSA 1G83A 2L3PA 2PZ1A 3NHNA 4ESRA 2YT6A 2KRNA 4RTWA 1M30A 1HJDA 4HVUA 3UATA 3FJ5A 4OMQA 2A36A 2KYMA 2RNAA 2D8JA 4RTVA 2FPFA 2OJ2A 5HCKA 1I0CA 4CC3A 1G2BA 3I35A 1I1JA 1TUCA 2DM1A 1AZEA 2DE0X 1QLYA 5I22A 2LJ1A 4RTTA 2YSQA 2I0NA 1WYXA 4CC2A 2CH4A 1GCQA 2J06A 3QWXX 2DJQA 4CC7A 4OMOA 1OV3A 2JS0A 1JU5C 1AWJA 1GFCA 1RUWA 1H92A 4JJCA 2RQUA 1NG2A 1ZLMA 4J9IA 2ED0A 2KE9A 2CSQA 2DLPA 3TSWA 2RQRA 1E6GA 2JM9A 1SPKA 2W10A 2DL3A 1NM7A 2JMCA 4J9CA 4GLMA 3M0QA 4JZ3A 1K1ZA 2HBWA 1QWFA 3M0TA 2OAWA 3O5ZA 2DL5A 2FG0A 2YUNA 1VYTA 3REAB 5EC7A 4HXJA 1ZX6A 5ECAA 2FPEA 4LUEA 2GQIA 2GGRA 4AFZC 2EGCA 1WX6A 1A0NB 4R0KA 1BK2A 2RN8A 3VS3A 1WXBA 4OMLA 2HDAA 1AOJA 1AVZC 1HD3A 1GRIA 2KYBA 2KR3A 2EYZA 1E7OA 1X6GA 2KBTA 1N5ZA 3NPFA 4ZNXA 3IQLA 3H41A 4RUGA 2DNUA 3VRYA 1PWTA 1T3SA 1M3CA 4E6RA 2AKLA 1WDXA 2MIOA 4X1VA 3H0IA 2P4RA 1JXOA 2ED1A 2K2MA 1FYNA 2JS2A 5I11A 4LNPA 2JM8A 1RLQC 2D1XA 3TVTA 1ZSGA 2KROA 1W6XA 3VS1A 2J6OA 2DBMA 1B3QA 4IIOA 1WFWA 1VA7A 2LP5A 3EG1A 1ARKA 4A63B 2DRKA 1UE9A 2K6DA 4LUDA 3I5SA 2ROLA 3NMZC 1T3LA 1CKAA 1U5SA 1AWWA 1IO6A 3EGUA 1W1FA 2LJ3A 2ROTA 2A28A 1QKWA 1WI7A 2YUQA 2LQNA 1MUZA 1LCKA 2NWMA 2DRMA 2VKNA 1GCPA 2KXDA 2VWFA 1U3OA 1ZUUA 2L2PA 1TUDA 1T0JA 2L3SA 4JJDA 1BU1A 2L0AA 4JJBA 1CKBA 3REBB 2EW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YP5 A;  2AK5 A;  4ORZ A;  1MV0 B;  2L3Q A;  4RTY A;  2CUB A;  1GBQ A;  2FO0 A;  3KFV A;  1K9A A;  3ULR B;  1H8K A;  4DEX A;  2F2X A;  3EHR A;  2SRC A;  3M0S A;  4QT7 A;  2JXB A;  2EYY A;  2B86 A;  4Z89 A;  2ENM A;  1K76 A;  1NYF A;  1OOT A;  2EPD A;  1SHG A;  5GJW B;  4OMM A;  2ABL A;  1PNJ A;  1Y0M A;  2RQW A;  2IIM A;  5IH2 A;  2RQV A;  3JV3 A;  2FPD A;  1KJW A;  3M0R A;  5GJV B;  2CDT A;  2BZY A;  2EGE A;  2LMJ A;  2FEI A;  1MV3 A;  2CSI A;  1V1C A;  3M0U A;  1K0X A;  2GNC A;  1UJ0 A;  2J05 A;  1J3T A;  1WLP B;  2C0I A;  2FRY A;  3ZL7 C;  1YWO A;  4WCI A;  2JW4 A;  1K0S A;  4EIK A;  1SHF A;  2LZ6 B;  1X2Q A;  1M8M A;  5FWC A;  1PKT A;  1VYU A;  3M0P A;  3H0H A;  4J9G A;  1QKX A;  2V1R A;  1NEG A;  2VVK A;  4M4Z A;  1SSH A;  2K7A A;  4FSS A;  1SEM A;  3VS0 A;  2M51 A;  1UUE A;  2F2W A;  1OPK A;  1FMK A;  1YNZ A;  4RTU A;  2HCK A;  2YUP A;  2A37 A;  1ABQ A;  2RMO A;  1UEC A;  1GL5 A;  1X2K A;  3C0C A;  4AG1 C;  4D8K A;  4HVW A;  2PNI A;  2AZV A;  4AFQ C;  1NEB A;  1I07 A;  2V1Q A;  2DBK A;  1VYV A;  2JT4 A;  2GTJ A;  3RBB B;  4J9D A;  1SRM A;  2DYB A;  3VS7 A;  4AG2 C;  1Y57 A;  1PHT A;  2ESW A;  3PVL A;  5IHN A;  3QWY A;  1T0H A;  2K9G A;  2KT1 A;  2RQT A;  3U23 A;  1WA7 A;  3TSZ A;  2PTK A;  2J6K A;  1PKS A;  3VS4 A;  4AFU C;  2M0Y A;  2EGA A;  2OI3 A;  4J9H A;  1JQQ A;  2GTO A;  2K3B A;  1K4U S;  4RTX A;  2LQW A;  1UFF A;  1TG0 A;  2FRW A;  3SHW A;  1XOV A;  2EVR A;  2BZX A;  1ZBJ A;  2O88 A;  1OPL A;  1YN8 A;  3LH5 A;  2DF6 A;  2DA9 A;  2H8H A;  3RNJ A;  3VS6 A;  2J6F A;  4K11 A;  1UDL A;  4OMP A;  2X3W D;  1AZG B;  4J9E A;  1U06 A;  2CT4 A;  2DL7 A;  1CSK A;  1EFN A;  2W0Z A;  2G6F X;  2LNH B;  4RTZ A;  1WXT A;  1ZUY A;  1WIE A;  2MOX A;  2O2O A;  1Z9Z A;  2RF0 A;  2K79 A;  1E6H A;  5IXF A;  2KRM A;  2KGT A;  3UA6 A;  3NGP A;  2EYW A;  4HCK A;  2C0T A;  2J7I A;  2EYX A;  2KXC A;  5IHI A;  2O9S A;  1M3B A;  1RI9 A;  3EG3 A;  1S1N A;  4F14 A;  1X6B A;  1YCS B;  2GBQ A;  1JO8 A;  2DX1 A;  2KT8 A;  3UF4 A;  3VRZ A;  1NLP C;  4Z88 A;  1JEG A;  3I5R A;  2MCN A;  2D0N A;  2SEM A;  2KEA A;  4IIM A;  3SEM A;  2KRS A;  2DL4 A;  2X3X D;  1H3H A;  1PRL C;  1UHF A;  1AWX A;  1UJY A;  2JMA A;  2EBP A;  4KRT A;  1M27 C;  3EG0 A;  2C0O A;  1ZUK A;  2BTT A;  1JXM A;  1BB9 A;  1SRL A;  2D8H A;  5IXB A;  1AWO A;  1AEY A;  1OEB A;  2EQI A;  1UHC A;  2AKK A;  1UG1 A;  2LJ0 A;  3EG2 A;  2YDL A;  4F17 A;  1GFD A;  4JPB W;  3PVQ A;  2HEQ A;  3VS5 A;  2CT3 A;  1KFZ A;  1RLP C;  1PRM C;  4J9F A;  1Z9Q A;  5IHK A;  2EKH A;  2LX7 A;  1KSW A;  1ABO A;  4D8D A;  2NUZ A;  2BZ8 A;  4LN2 A;  3THK A;  2O9V A;  2CRE A;  3UA7 A;  2DMO A;  2QDL A;  4CC4 B;  1AD5 A;  3H0F A;  1WXU A;  1BBZ A;  2O31 A;  4DEY A;  1M3A A;  4LE9 A;  1QCF A;  2DL8 A;  3EHQ A;  1B07 A;  2CH4 W;  2JTE A;  2RPN A;  1X69 A;  2XMF A;  3GBQ A;  1X27 A;  2ECZ A;  1KIK A;  1HSQ A;  2HSP A;  4HVV A;  3VS2 A;  1GCQ C;  1UTI A;  4F16 A;  1NYG A;  4J9B A;  3R6N A;  5L23 A;  2DIL A;  2F2V A;  3I9Q A;  5FW9 A;  4OMN A;  4Y92 A;  1YWP A;  2KNB B;  1NLO C;  2CUD A;  4AFS C;  2DVJ A;  4Z8A A;  3PE0 A;  1QWE A;  1UGV A;  2E5K A;  3CQT A;  2A08 A;  5FWB A;  1GBR A;  4JZ4 A;  2YUO A;  2LCS A;  1W70 A;  3A98 A;  1X43 A;  4GBQ A;  2AZS A;  1G83 A;  2L3P A;  2PZ1 A;  3NHN A;  4ESR A;  2YT6 A;  2KRN A;  4RTW A;  1M30 A;  1HJD A;  4HVU A;  3UAT A;  3FJ5 A;  4OMQ A;  2A36 A;  2KYM A;  2RNA A;  2D8J A;  4RTV A;  2FPF A;  2OJ2 A;  5HCK A;  1I0C A;  4CC3 A;  1G2B A;  3I35 A;  1I1J A;  1TUC A;  2DM1 A;  1AZE A;  2DE0 X;  1QLY A;  5I22 A;  2LJ1 A;  4RTT A;  2YSQ A;  2I0N A;  1WYX A;  4CC2 A;  2CH4 A;  1GCQ A;  2J06 A;  3QWX X;  2DJQ A;  4CC7 A;  4OMO A;  1OV3 A;  2JS0 A;  1JU5 C;  1AWJ A;  1GFC A;  1RUW A;  1H92 A;  4JJC A;  2RQU A;  1NG2 A;  1ZLM A;  4J9I A;  2ED0 A;  2KE9 A;  2CSQ A;  2DLP A;  3TSW A;  2RQR A;  1E6G A;  2JM9 A;  1SPK A;  2W10 A;  2DL3 A;  1NM7 A;  2JMC A;  4J9C A;  4GLM A;  3M0Q A;  4JZ3 A;  1K1Z A;  2HBW A;  1QWF A;  3M0T A;  2OAW A;  3O5Z A;  2DL5 A;  2FG0 A;  2YUN A;  1VYT A;  3REA B;  5EC7 A;  4HXJ A;  1ZX6 A;  5ECA A;  2FPE A;  4LUE A;  2GQI A;  2GGR A;  4AFZ C;  2EGC A;  1WX6 A;  1A0N B;  4R0K A;  1BK2 A;  2RN8 A;  3VS3 A;  1WXB A;  4OML A;  2HDA A;  1AOJ A;  1AVZ C;  1HD3 A;  1GRI A;  2KYB A;  2KR3 A;  2EYZ A;  1E7O A;  1X6G A;  2KBT A;  1N5Z A;  3NPF A;  4ZNX A;  3IQL A;  3H41 A;  4RUG A;  2DNU A;  3VRY A;  1PWT A;  1T3S A;  1M3C A;  4E6R A;  2AKL A;  1WDX A;  2MIO A;  4X1V A;  3H0I A;  2P4R A;  1JXO A;  2ED1 A;  2K2M A;  1FYN A;  2JS2 A;  5I11 A;  4LNP A;  2JM8 A;  1RLQ C;  2D1X A;  3TVT A;  1ZSG A;  2KRO A;  1W6X A;  3VS1 A;  2J6O A;  2DBM A;  1B3Q A;  4IIO A;  1WFW A;  1VA7 A;  2LP5 A;  3EG1 A;  1ARK A;  4A63 B;  2DRK A;  1UE9 A;  2K6D A;  4LUD A;  3I5S A;  2ROL A;  3NMZ C;  1T3L A;  1CKA A;  1U5S A;  1AWW A;  1IO6 A;  3EGU A;  1W1F A;  2LJ3 A;  2ROT A;  2A28 A;  1QKW A;  1WI7 A;  2YUQ A;  2LQN A;  1MUZ A;  1LCK A;  2NWM A;  2DRM A;  2VKN A;  1GCP A;  2KXD A;  2VWF A;  1U3O A;  1ZUU A;  2L2P A;  1TUD A;  1T0J A;  2L3S A;  4JJD A;  1BU1 A;  2L0A A;  4JJB A;  1CKB A;  3REB B;  2EW3 A; 
#chains in the Genus database with same CATH topology
 2AK5 A;  3EFO A;  3FB9 A;  3GOX A;  4E7I A;  4ZN1 A;  1GBQ A;  1K9A A;  2O01 E;  3A5Z B;  1YJW A;  1H8K A;  1BI3 A;  1I8F A;  1VQ6 T;  1Q86 R;  2SRC A;  4Z89 A;  1ZSZ A;  4M7D F;  4M7A D;  2F69 A;  1P92 A;  1NYF A;  1OOT A;  1WHM A;  1SHG A;  5GJW B;  3I56 Q;  5IH2 A;  1YIJ Q;  2RQV A;  3JV3 A;  2FPD A;  1KJW A;  1JJ2 S;  5IAY A;  4N0A A;  2OTL A;  4M7A B;  1Q81 U;  5LL6 S;  1UJ0 A;  3CC2 A;  2BUD A;  1VQM A;  1VQK T;  4OVA A;  3CXC A;  2FRY A;  4JS4 A;  3ZL7 C;  4ZTJ A;  4RG8 A;  2XU8 A;  4KT0 E;  4WCI A;  2JW4 A;  1K0S A;  2XDP A;  2VB6 A;  5GAM f;  3SB2 A;  1D0Z A;  3CD6 T;  2DTH A;  2LZ6 B;  4MZT A;  5FWC A;  2DEQ A;  4OB1 B;  2RHZ A;  3JCM f;  1YJN A;  4L59 A;  1VQ4 Q;  3C95 A;  1HXD A;  4XTV A;  4F7U G;  1NEG A;  3EFR A;  3AT1 B;  2VVK A;  4M4Z A;  2ZPG B;  2K7A A;  3QJ6 A;  5KE3 A;  4FYY B;  3UT1 A;  1NE8 A;  3VS0 A;  2DAQ A;  3FEO A;  2M51 A;  1UUE A;  1FMK A;  1Q86 U;  3HP9 A;  1QCO A;  2LRQ A;  3C0C A;  4J7I A;  1QVG P;  1W2B S;  4HVW A;  4NS5 A;  1NEB A;  4J5Y A;  2V1Q A;  1VYV A;  1QVF S;  2JT4 A;  1H64 1;  3V8K A;  2JVV A;  3JRZ A;  1MMG A;  1FX7 A;  4TVR A;  3VS7 A;  1FWZ A;  1PHT A;  3PVL A;  3GIB A;  5DLQ E;  2L89 A;  1N8R U;  5FU6 C;  3CC7 T;  2FHD A;  4OGC A;  2OTL T;  2RQT A;  2HD0 A;  3TSZ A;  4E7H A;  5GAO n;  2J6K A;  1D09 B;  1PKS A;  2M0Y A;  2OI3 A;  1VQN Q;  4WF2 A;  3CCL T;  2K3B A;  4RTX A;  3JCM V;  1UFF A;  4XU0 A;  3G71 Q;  3G71 A;  1QVP A;  1YN8 A;  1YJN T;  1AT1 B;  2DA9 A;  3SD4 A;  3CMA A;  3M55 A;  3VS6 A;  3M53 A;  2J6F A;  3TU4 K;  3LLR A;  3P8B B;  4E7Z A;  1KQS A;  1CSK A;  1EFN A;  2W0Z A;  4QW2 A;  2G6F X;  4RTZ A;  1ZUY A;  1Z9Z A;  2RF0 A;  4E7L A;  1YJW Q;  2YLC A;  3UA6 A;  1FMV A;  4HCK A;  2RHU A;  4AMC A;  1VQ5 Q;  2E65 A;  1M3B A;  3OSS C;  5GMK e;  3CCR T;  2CYZ B;  1RI9 A;  3EG3 A;  4F14 A;  5KYU B;  1X6B A;  1NLP C;  3I5R A;  2MCN A;  2WSC E;  4LXC A;  4MMK A;  2K3Y A;  3ZBD A;  2DL4 A;  1PRL C;  4JRK A;  3BY7 A;  3MEA A;  4PKC C;  2XHC A;  2EBP A;  1M5Q 1;  1M27 C;  1NJI C;  1D1A A;  1VQ9 T;  3M54 A;  1ZUK A;  4GLK A;  3RUX A;  2BTT A;  8ATC B;  3OYH A;  4JUV A;  2COY A;  3PIO A;  2D8H A;  4M7A F;  3JCM e;  1AWO A;  2QAS A;  1OU8 A;  3TCJ A;  1VQL Q;  4R55 A;  2HKQ B;  2EQI A;  1YFN A;  4FIB A;  2QGF B;  2QYZ A;  2LT1 A;  2QGG A;  4J83 A;  2HL3 A;  3JAM E;  3CBP A;  3OSV A;  3VS5 A;  1YI2 Q;  3CCR Q;  3CCU Q;  3J7A F;  4J9F A;  5IHK A;  1ABO A;  3ZEH A;  2VGM A;  4N4G A;  4NL2 A;  4D8D A;  1YJW T;  2BZ8 A;  3THK A;  3HFN A;  3BDU A;  2EQK A;  2DMO A;  4CC4 B;  5GAM h;  1G5V A;  4RKU E;  3VYH B;  2HBP A;  3P8D A;  3PMI A;  1WXU A;  3QYH B;  1YJ9 A;  4QVZ A;  3OA6 A;  2IVW A;  3GBQ A;  5KCO A;  1UB4 A;  2Z0W A;  1RAI B;  1R0B G;  3GNG A;  2K57 A;  1GCQ C;  2DEU A;  2WAC A;  5FW9 A;  4Y92 A;  1VQO A;  3QSU A;  1NLO C;  2CUD A;  1OZ2 A;  4AFS C;  1TS9 A;  3WVD B;  3QZ5 B;  2RH2 A;  1VQK A;  3OYG A;  3HL8 A;  1UGV A;  2E5K A;  2PUO B;  3JCM X;  4M78 F;  2VXE A;  3L1A A;  3MET A;  4PJO G;  4BE2 A;  1W70 A;  1X43 A;  4GBQ A;  4N4I A;  2Y4Y A;  5LJ3 e;  1QW1 A;  5M9O A;  5DM7 R;  3JB9 G;  2EJF A;  4ANJ A;  1IXD A;  1C1A A;  4BI4 A;  4C5G A;  2CZ0 B;  2CZ7 B;  3FJ5 A;  5FRM A;  3OS0 A;  2KYM A;  2RNA A;  1XJW B;  4B6M A;  4CC3 A;  1I1J A;  2DE0 X;  3TQ7 P;  1QLY A;  4Y91 A;  3CC4 T;  3CCU T;  3NTK A;  1YI2 T;  1WYX A;  3CBM A;  4JRI A;  2J06 A;  3CXC S;  2DJQ A;  4CC7 A;  1AHJ B;  1M1G A;  3VU3 C;  2R5M A;  1JU5 C;  2E6Z A;  4E47 A;  1VQ9 A;  3EFS A;  5CKB A;  1VOM A;  3QBY A;  2QG9 B;  1K9M R;  2MI6 A;  5CAI A;  1H3Z A;  3RER A;  4JJC A;  2RQU A;  3M9Q A;  3S3O A;  1YJ9 T;  3JCM g;  3DB3 A;  1VQ9 Q;  2CP5 A;  4KH0 B;  3SWN A;  2JJ9 A;  4ELZ C;  1OZ3 A;  2XG8 D;  4M77 B;  4M7A A;  2HBW A;  1SSF A;  3L2Q A;  1EIF A;  2K2V A;  2K5I A;  2FG0 A;  2OX7 A;  1VYT A;  4N4H A;  5EC7 A;  4HXJ A;  1ZX6 A;  2RI3 A;  1OX8 A;  5ECA A;  4DBF A;  2NUP A;  3EG9 A;  1M1K C;  2XDB A;  1N8R R;  3GPL A;  3RKX A;  4MZM A;  1VQ5 T;  1A0N B;  4M77 C;  3VS3 A;  2HDA A;  1M4Z A;  1AOJ A;  1AVZ C;  2KR3 A;  2EYZ A;  3URG A;  3GP8 A;  4M75 E;  1KC8 C;  2KI7 A;  1RAB B;  2NYS A;  5FRN A;  1TU0 B;  3M4Y A;  4ZNX A;  2WSE E;  1Y07 A;  1IRE B;  3QO3 A;  3MP6 A;  1VQ6 Q;  2M16 A;  2QQR A;  4FM4 B;  4DA4 A;  2CP7 A;  3ZFJ A;  1R0C B;  1FMW A;  3CCU A;  2AKL A;  4X1V A;  5IT9 E;  4XTX A;  1JXO A;  3MP1 A;  1K8A R;  4LNP A;  1M1F A;  3G4S Q;  2JM8 A;  3SWN B;  2HNI A;  4FL6 A;  4EMK C;  1HK9 A;  4MDX A;  1MMN A;  4DQ2 A;  1B3Q A;  2X4Y A;  3EH2 A;  3L2V A;  2A0F B;  3NTI A;  4X34 A;  4IUV A;  3I5S A;  3M59 A;  5KYW A;  1IO6 A;  1M2O A;  4PFZ A;  4OGE A;  1JB0 E;  2YUQ A;  1ZQ1 A;  2DK3 A;  2RI5 A;  4JLI A;  1MNE A;  4DBR A;  2P0K A;  2VKN A;  5GAO l;  2L3S A;  4B9W A;  1UGQ B;  3REB B;  4ORZ A;  1MV0 B;  2M02 A;  4RTY A;  2KY9 A;  1PD0 A;  3KFV A;  2FZG B;  3ULR B;  4DEX A;  4QT7 A;  1BI1 A;  3J81 E;  2EYY A;  2B86 A;  4C92 A;  1YIT Q;  2LT4 A;  3HRU A;  2DD4 A;  4LDU A;  3M4G A;  1YHQ A;  2ABL A;  5FU7 C;  1PNJ A;  2IIM A;  1Q81 C;  3PT9 A;  1QCN A;  2Y90 A;  3OS2 A;  1D1B A;  1OQK A;  2E3H A;  2EGE A;  2LMJ A;  4J7F A;  3RDV A;  3CCM A;  3G7Z A;  2LCC A;  1WJQ A;  5GAO p;  4Z02 A;  1ZA2 B;  2GFA A;  1VQK Q;  4EMG A;  1YIT T;  2J05 A;  1J3T A;  2E41 A;  3I55 Q;  1YWO A;  1TOV A;  4M7D E;  3A8G B;  1WHL A;  4M78 D;  3OYF A;  3HFO A;  2M0O A;  1VYU A;  3H0H A;  2V8J A;  3EGD B;  1U1T A;  2CKK A;  4FW1 A;  5C6S A;  1SSH A;  3L2U A;  4JJN K;  1Q86 C;  1KD1 R;  3V7R A;  3VJP A;  1N9S A;  2O4X B;  4QQ6 A;  4DOW A;  3HRT A;  2F2W A;  2JUF A;  3QXE B;  1M9S A;  4N0A C;  5DLO A;  4RTU A;  2YUP A;  2VXF A;  1Q82 U;  3OYN A;  2A37 A;  1ABQ A;  2X51 A;  2RMO A;  3WVE B;  1GL5 A;  4PJO C;  4F7U A;  8AT1 B;  1VQ8 T;  1I07 A;  1WHJ A;  5HKC A;  1N6A A;  1IZ6 A;  3MKD A;  4EMK A;  4J9D A;  1M8V A;  2DZC A;  2DTO A;  5FU7 B;  1T0H A;  3CBO A;  4HCZ A;  3U23 A;  1KQS P;  3S3N A;  3I55 A;  5LJ3 f;  1K73 U;  1BIB A;  4IUQ A;  5GMK l;  1KQS S;  4J9H A;  3RMQ A;  1U8R A;  2MYS A;  1K4U S;  2DFU A;  2ZPE B;  1TG0 A;  1XNI A;  2LQ8 A;  2EVR A;  1XQH A;  2BZX A;  3MP8 A;  1ZBJ A;  4FCY A;  3LH5 A;  3JB9 H;  3G1J A;  5HK3 A;  3RNJ A;  3V7C A;  4K11 A;  4L5G A;  1AZG B;  4J9E A;  2CT4 A;  3OYK A;  5LJ3 j;  2EAY A;  1WIE A;  2K5F A;  2D9T A;  5LJ3 d;  4M78 C;  2K79 A;  3FLG A;  2HQE A;  3CCM T;  4XAX B;  2CGH A;  1NJI U;  2KGT A;  3OS1 A;  5FRO A;  1PSF A;  3NGP A;  2QTX A;  1MHN A;  3V8J A;  2C0T A;  2J7I A;  2KXC A;  2HL5 C;  5A2Q E;  3M5A A;  2O9S A;  2CP3 A;  1QVG A;  2NUT B;  1VQP A;  1YCS B;  2GBQ A;  4HA8 A;  3CME Q;  1JEG A;  2D6F A;  2K5L A;  3OY9 A;  3FC3 A;  4ZGD B;  3OBY A;  2P84 A;  6AT1 B;  2KRS A;  2RHX A;  3L2W A;  5GAM d;  3ME9 A;  4EMH A;  1UJY A;  1NBE B;  2QEX A;  4KRT A;  1VQN A;  3KUF A;  1WHG A;  2HKN A;  3L42 A;  4ME7 A;  1BB9 A;  2HQX A;  1AEY A;  1OEB A;  1VUB A;  2AIR B;  1UHC A;  1X01 A;  2JN0 A;  1SF9 A;  1UG1 A;  2VAS A;  2YDL A;  4LDY A;  3VUZ A;  5KYY A;  3GLX A;  4M75 G;  5AT1 B;  2VC8 A;  1TTH B;  1Z9Q A;  2QXF A;  2ZPF B;  4BDY A;  1WHK A;  1QP2 A;  4LN2 A;  2IPO B;  1AD5 A;  4FSX A;  3CD6 A;  3CCJ A;  4M78 A;  3C4S A;  3H0F A;  5CQX A;  1B07 A;  1VQ4 A;  5J26 A;  4LDX A;  1DJ7 B;  3DLM A;  5LJ5 g;  5GAN e;  1HSQ A;  3CCE T;  1NYG A;  4JRP A;  2F2V A;  4PK4 A;  3QDF A;  2DVJ A;  4Z8A A;  1ACM B;  1KC8 R;  2QDY B;  1IB8 A;  3CC2 T;  5LJ5 d;  4EPC A;  2DTI A;  2RHI A;  5D7U A;  3T9N A;  2A08 A;  3ASK A;  2KSS A;  2YUO A;  2A7Y A;  2EWN A;  3OYB A;  2LCS A;  5GAO q;  2X4X A;  3A98 A;  3MEV A;  5I21 A;  3RES A;  3NHN A;  3OS5 A;  4ESR A;  5GAN d;  5LJ5 j;  3M56 A;  1O75 A;  5KYX A;  1VQ8 Q;  2D8J A;  2OJ2 A;  1WNL A;  5HCK A;  2CS7 A;  1I0C A;  3OYY A;  4O5V A;  4RMO A;  3JB9 I;  3NFC A;  3UDC A;  2QQS A;  2K3X A;  4JDS A;  1AZE A;  4LD9 K;  4E2F B;  5I22 A;  2EJ9 A;  1KD1 C;  2CH4 A;  3SWN C;  1GCQ A;  2DO3 A;  3M57 A;  3G4S A;  5KYW B;  4M7A G;  3CCV A;  1KD1 U;  1OV3 A;  2JS0 A;  4PJM A;  4MML A;  1Q7Y R;  1OYX A;  1RUW A;  1H92 A;  1NG2 A;  4J9I A;  1SG5 A;  3CMA T;  4VUB A;  1S72 A;  4NL3 A;  4PJO D;  3HKS A;  3CC4 Q;  1E6G A;  2X4J A;  3CEY A;  1NM7 A;  2BE7 D;  2QA4 T;  4GLM A;  3M0Q A;  1F1B B;  1Q82 C;  1K1Z A;  3I55 T;  4EDU A;  4M7D G;  7AT1 B;  1QWF A;  3EFO B;  4JS5 A;  2DL5 A;  3OW2 S;  4OP0 A;  3KBG A;  5GAM e;  3CCL A;  1R77 A;  2PQW A;  4AFZ C;  2CP6 A;  2EGC A;  3RR6 A;  2DPP B;  2DXT A;  5CCA A;  1YIT A;  4R0K A;  1BK2 A;  2FZC B;  4Q5W A;  3G71 T;  4HCC A;  1WXB A;  4OML A;  5GAN g;  3RMS A;  2ZGW A;  5GAN f;  1E7O A;  1X6G A;  1BCM A;  5CO7 A;  2HQH A;  2E3I A;  3IQL A;  3H41 A;  3QII A;  1VQ7 Q;  1T3S A;  3VYG A;  2RJD A;  1WPY A;  4QQD A;  3EAE A;  1YI2 A;  1IHV A;  3NTH A;  2MIO A;  1BI2 A;  1S72 Q;  2ED1 A;  2K2M A;  1Q7Y U;  4ATO A;  5LJ5 h;  2PVO B;  3EGD A;  3TVT A;  2KRO A;  1O9S A;  1W6X A;  1GXI E;  2PUK B;  3DB4 A;  4IIO A;  1VA7 A;  4D6W A;  2XI9 A;  1PSE A;  1UEB A;  3CCJ Q;  4WTO B;  2GCX A;  2P0P A;  3LYI A;  4KGX B;  1UE9 A;  1Q95 G;  2IG0 A;  4QVC A;  4M78 E;  1U5S A;  4C92 B;  5GAN 8;  2E64 A;  2COZ A;  2PVG B;  1LCK A;  4DOV A;  2LCL A;  3WXM B;  5LJ5 e;  5D6W A;  4BE1 A;  3MHX A;  2KXD A;  1U3O A;  1ZUU A;  1LVK A;  4JJD A;  3G4S T;  5CKF A;  2ZZD A;  1MGQ A;  4XU1 A;  1VQO T;  3OYJ A;  2L3Q A;  3MJX A;  2CUB A;  2FO0 A;  4KGZ B;  4M77 F;  1X75 C;  2F2X A;  1U1S A;  3JCM d;  4KH1 B;  4UC4 A;  2YRV A;  2ENM A;  2JOY A;  4PJO E;  1I81 A;  1K76 A;  1UGP B;  3PMT A;  3LWH A;  2DJZ A;  1M1K R;  4FT2 A;  3A1P A;  4R56 A;  4M75 F;  3M0R A;  4ZN3 A;  2OAU A;  1MV3 A;  2CSI A;  3CCE A;  2MAM A;  4C0F A;  4C5E A;  3BW1 A;  5CQY A;  2E4H A;  3JCM Q;  1NPP A;  2ATC B;  1UGS B;  4OB2 B;  2C06 A;  4EIK A;  2EKO A;  1K9M C;  3X28 B;  1VQO Q;  1PKT A;  4F7U B;  1LOJ A;  3M58 A;  4J9G A;  2OTJ Q;  1QKX A;  4KUL A;  3JSC A;  4RG2 A;  1KK7 A;  2FZK B;  3A8H B;  4M78 B;  1OX9 A;  5GAN 5;  4NOY A;  2E10 A;  3X26 B;  1MMA A;  1YNZ A;  4ZGJ B;  2RJE A;  5KYX B;  2HCK A;  4XTZ A;  5C0M A;  1BIA A;  4ZGE B;  1UEC A;  1JJ2 A;  2VV5 A;  3F70 A;  5HY6 A;  3CCV T;  5GAN 2;  3S6W A;  2AZV A;  4AFQ C;  2DBK A;  4AT1 B;  2GTJ A;  2DIG A;  1YHQ T;  3L2R A;  3DLL A;  5I2S A;  1SRM A;  1S72 T;  1ZSZ B;  2DYB A;  4AG2 C;  4M7D B;  5GAN h;  1X6O A;  2BE9 B;  3QWY A;  2K9G A;  1IGQ A;  1I5O B;  1WA7 A;  2AHJ B;  2F5K A;  2E5Q A;  4BI8 B;  3VS4 A;  2HMA A;  1VQM Q;  1B7T A;  3CPW P;  2V8I A;  2GTO A;  4DBQ A;  3BFM A;  4F04 B;  2LQW A;  2OTJ T;  3HTR A;  4CI0 C;  1ZA1 B;  2YHT A;  2FRW A;  3E1S A;  3SHW A;  1Q81 R;  4DBH A;  1OPL A;  2XKO C;  4C0D C;  4BAC A;  2EIF A;  5D6Y A;  3I56 A;  1QVG S;  2X3W D;  3TRE A;  1U06 A;  2DL7 A;  2KK4 A;  1M90 R;  1PC0 A;  4A4G A;  2QQB A;  3PFS A;  2MOX A;  2O2O A;  2X4W A;  1E6H A;  2RO0 A;  5IXF A;  2LTO A;  3MCA B;  1LJO A;  4F7U E;  2QA4 Q;  1Y7X A;  2JZ2 A;  4HKE A;  3RIR A;  1KHC A;  5CK9 A;  2EYW A;  4M7A E;  4LDW A;  2EYX A;  3FIF A;  1YIJ T;  2KT8 A;  3S3M A;  4IIM A;  1XTD A;  3SDZ A;  2X3X D;  5AYF A;  3FDR A;  3CPW S;  1AWX A;  2JMA A;  1WQ7 A;  2GFU A;  1ZBX A;  2QTV A;  2B8A A;  3SFM A;  2C0O A;  4V2S A;  3MEU A;  4XQ3 A;  5CKE A;  1SRL A;  4IKF A;  2DXB A;  2FVU A;  1WHH A;  1RAE B;  2X35 A;  2WSF E;  4M77 E;  2LJ0 A;  5LJ5 f;  1BKB A;  3V7S A;  2H3J A;  2QA4 A;  1D3B A;  1WQW A;  3PVQ A;  2MF2 A;  3PGG A;  3QKJ A;  1KFZ A;  2YXY A;  3JB9 F;  1IHW A;  2H3E B;  1PRM C;  2EKH A;  2LX7 A;  1KSW A;  3X24 B;  2KAF A;  4PFO A;  2NUZ A;  2CZ6 B;  2O9V A;  2CRE A;  5GMK i;  1IGU A;  1G3S A;  4DEY A;  1M3A A;  3CME A;  2O4X A;  4LE9 A;  1QCF A;  2DL8 A;  3JB9 J;  4C92 E;  4PJO A;  2RPN A;  2QAZ A;  1X69 A;  2XMF A;  1YJN Q;  3FJP A;  1HYO A;  2COW A;  1VQ7 T;  2HSP A;  4HVV A;  3VS2 A;  1UTI A;  1Y96 B;  4F16 A;  2E1H A;  2DIL A;  2ZAE A;  3I9Q A;  4OMN A;  1YWP A;  2KNB B;  4FU6 A;  1K8A C;  3V8L A;  3VV0 A;  3EH1 A;  5FWB A;  1GBR A;  2OTL Q;  4GY5 A;  3CC7 Q;  2L3P A;  1G83 A;  2PZ1 A;  1VIF A;  1MMD A;  4KGV B;  2A3L A;  4RTW A;  1SKU B;  4RCC A;  4HVU A;  3UAT A;  3MPU B;  4C8Q G;  3C94 A;  3FRN A;  3LH0 A;  4LD6 A;  4OB3 B;  1RAG B;  1OUL A;  1K8A U;  2LQK A;  2VGN A;  1G2B A;  1RL2 A;  1K73 R;  2DM1 A;  1D0X A;  2MK5 A;  4CC2 A;  2V8K A;  3QWX X;  2EQJ A;  4OMO A;  5GAO r;  3QPH A;  4C92 F;  1BCO A;  4C8Q D;  3JCM J;  2M9U A;  4MZP A;  4X9D A;  4JRQ A;  2EQM A;  3J80 E;  1ZLM A;  3CME T;  2L3R A;  4C0G A;  2D0Q B;  1VQ4 T;  3JCM W;  2E12 A;  1SPK A;  4MDW A;  1NJI R;  2JMC A;  4C8Q B;  2F1L A;  5KE2 A;  3CCM Q;  4C0Z A;  2E70 A;  4ZTF A;  2YRC A;  3M0T A;  2OAW A;  3OW2 A;  1IRX A;  2LC4 A;  3QUI A;  4BY6 C;  2L5Q A;  3MO8 A;  4LUE A;  2OTJ A;  3CCQ Q;  1VQ8 A;  1TSF A;  1Q7Y C;  1HD3 A;  3Q1J A;  4L6V 5;  1BI0 A;  1Y71 A;  2KYB A;  3I56 T;  4II1 A;  3E19 A;  2LNV A;  2R5A A;  2QEX T;  1N5Z A;  3X25 B;  3CC7 A;  1K73 C;  2QK0 A;  2MWP A;  1VQ7 A;  1D3B B;  4P5N A;  4E7J A;  3CCE Q;  2DNU A;  3VRY A;  1RI0 A;  4EMK B;  4PJO F;  1M3C A;  4E6R A;  4PLI A;  4PJL A;  1WDX A;  3AHU A;  3H0I A;  2L8D A;  4QKU A;  4X9C A;  4XU2 A;  1FYN A;  1RAH B;  2JS2 A;  1TH7 A;  3CCL Q;  4F7U F;  2D1X A;  1ZSG A;  1VQM T;  1KHI A;  2J6O A;  2LP5 A;  3OYE A;  2EJG A;  1YCY A;  4BI3 A;  5CKD A;  5CVI A;  4LUD A;  1WZO A;  2ROL A;  3X20 B;  3NMZ C;  2HAX A;  1T3L A;  3CCJ T;  3JCM P;  1WJS A;  3EGU A;  4KUD K;  9ATC B;  2LJ3 A;  3OQ5 A;  2I2L A;  5D6X A;  3R6O A;  4A54 A;  2A28 A;  2LQN A;  1MUZ A;  1R8O B;  3A8O B;  2NWM A;  2DRM A;  1VQP T;  2VUB A;  2FB7 A;  2VWF A;  4E7S A;  1KQ1 A;  1TUG B;  1T0J A;  1BU1 A;  4JJB A;  1CKB A;  1D1C A;  1YP5 A;  4C92 D;  1QQJ A;  3CXC P;  3LGF A;  3C12 A;  2FL7 A;  2P4T A;  1LNX A;  3EHR A;  3M0S A;  2JXB A;  3VKI A;  3BDL A;  5GAN 4;  1RAD B;  3OYC A;  2LX9 A;  1C6V X;  2RK2 A;  2EPD A;  2P0Q A;  3QYG B;  4OMM A;  4OMF B;  1Y0M A;  5GAN j;  2RQW A;  4BUG A;  3OYI A;  1V76 A;  3PIP A;  3CD6 Q;  5GJV B;  2RM4 A;  2CDT A;  4PLL A;  2BZY A;  2XK0 A;  2FEI A;  2EYQ A;  3LW5 E;  5FU6 B;  4M77 A;  1PD1 A;  2KMT A;  4CRI A;  1V1C A;  3M0U A;  1K0X A;  2GNC A;  5GMK j;  1RAC B;  3CC4 A;  4BB7 A;  1WLP B;  2C0I A;  5I2M A;  4IUU A;  3VUB A;  4PNO A;  4A4F A;  1SHF A;  3CPF A;  1X2Q A;  1M8M A;  4M75 A;  2DZ9 A;  3M0P A;  3OMC A;  1OI1 A;  5A0G A;  3CMA Q;  4M77 G;  2V1R A;  1N27 A;  2Y4X A;  1VQL A;  4A4H A;  4FSS A;  2LDM A;  3BE3 A;  2NUP B;  3EG9 B;  1SEM A;  2LVM A;  3L2Z A;  1OPK A;  3G6E Q;  2DYI A;  4IUR A;  3CCR A;  2F5T X;  1ZSZ C;  5GAM g;  1RAF B;  5A0L A;  3OB9 A;  1G8X A;  4C8Q F;  1X2K A;  4AG1 C;  1C0M A;  4D8K A;  4KBM B;  2PNI A;  1VQ5 A;  3OYD A;  3CCS A;  3E9F A;  2YRD A;  4J6Y A;  4QVD A;  3RBB B;  3JB9 D;  1W2B P;  2MPX C;  4FW2 A;  5A0D A;  3P8H A;  1W4S A;  1M2V A;  1Y57 A;  1N9R A;  2ESW A;  2VYT A;  5IHN A;  5GAN 7;  1TXQ A;  2KT1 A;  3OMG A;  5LJ3 g;  4XTW A;  2DD5 A;  5GAM j;  4C0D B;  2PTK A;  4AFU C;  2EFI A;  2EGA A;  2JTF A;  3CC2 Q;  1JQQ A;  2QEX Q;  3UPU A;  4M7D D;  2CP0 A;  4RCB A;  5DY9 A;  1XOV A;  2O88 A;  5GAN 3;  1QMC A;  5KYN A;  2CZ1 B;  2DF6 A;  1TWB A;  2H8H A;  3RKY A;  2M1H A;  1UDL A;  4OMP A;  1N8R C;  3H6Z A;  2RHY A;  1Y96 A;  3OBW A;  1UGR B;  4PL6 A;  1RAA B;  2LNH B;  3PNW C;  1WXT A;  5KYY B;  3GF5 A;  2FYK A;  4XTY A;  3QDR B;  4M78 G;  4E7K A;  1KC8 U;  5GMK m;  2KRM A;  3GNF B;  3QJY A;  3CCS Q;  5IHI A;  2DVE A;  4OB0 B;  1G3T A;  1S1N A;  1B34 B;  4C5H A;  1JJ2 P;  3KXT A;  1JO8 A;  2DX1 A;  3UF4 A;  3VRZ A;  1YJ9 Q;  4Z88 A;  1B34 A;  2D0N A;  2SEM A;  2KEA A;  4PJN A;  3SEM A;  3MEW A;  3JCM h;  5KH6 A;  3D7S B;  3G6E A;  3QZ9 B;  1H3H A;  2RJF A;  1UHF A;  4IUT A;  4Y28 E;  2HZY A;  2KQW A;  3OW2 P;  3EGX A;  2BKD N;  3EG0 A;  5GMK h;  4HCB A;  1QP3 A;  1YBY A;  4FYX B;  1JXM A;  2RA2 A;  5IXB A;  2AT1 B;  4BE0 A;  2G3R A;  1VQP Q;  4HT8 A;  2DXU A;  2GQV A;  2NUT A;  1QVF P;  1FXX A;  2AKK A;  5J39 A;  4ELY C;  3INZ A;  1VIE A;  3EG2 A;  4F17 A;  1GFD A;  1ZHI A;  4JPB W;  3H9N A;  2HEQ A;  2QQ9 A;  2CT3 A;  2MWO A;  1RLP C;  1KQ2 A;  3CCS T;  4KUI A;  4C92 C;  4LDV A;  3DKM A;  3QG1 A;  3LX7 A;  4XTU A;  4FT4 A;  2R57 A;  3UA7 A;  2QDL A;  4C8Q A;  5KCH A;  1BBZ A;  2O31 A;  2GF7 A;  1I4K 1;  3EHQ A;  5GAO m;  2CH4 W;  2JTE A;  4C8Q C;  1JBM A;  1YIJ A;  1X27 A;  2ECZ A;  1EZZ B;  1I5L A;  1KIK A;  4J9B A;  3R6N A;  5L23 A;  2RB6 A;  1NZ9 A;  2XIC A;  3H8Z A;  3LGL A;  3PE0 A;  1M90 C;  4XK8 E;  4FYV B;  1QWE A;  4IUP A;  3N5B B;  3CQT A;  4J6W A;  4JZ4 A;  3O8V A;  3QHS A;  4FYW B;  2PU9 B;  2AZS A;  3CCQ T;  1QVF A;  2DIQ A;  2YT6 A;  2KRN A;  1M30 A;  1HJD A;  1V29 B;  1K9M U;  4M7A C;  4B9X A;  4OMQ A;  2BIV A;  5CIU A;  2A36 A;  2HSE B;  3PTA A;  4RTV A;  2FPF A;  1M90 U;  3OYM A;  1VQL T;  1WJR A;  3I35 A;  3HRS A;  4BDZ A;  3OYL A;  1TUC A;  4HT9 A;  1EX4 A;  2RJC A;  3JCM c;  4M7D C;  2LJ1 A;  2XID A;  4C8Q E;  5LJ3 h;  4RTT A;  2YSQ A;  2I0N A;  5EG2 A;  3G6E T;  5KYU A;  3ER0 A;  1G3Y A;  4XU3 A;  4A4E A;  3HPW A;  2XD0 A;  2NLU A;  4M7D A;  4JLG A;  1PM3 A;  4C5I A;  1AWJ A;  2KDS A;  1PCX A;  2E6N A;  1OU9 A;  1JRI A;  1GFC A;  2QQA A;  1BYM A;  4YTL A;  2ED0 A;  2KE9 A;  2CSQ A;  4PJJ A;  2DLP A;  3TSW A;  2JTM A;  1Q82 R;  2RQR A;  5CKH A;  4OF1 A;  2RK1 A;  2JM9 A;  2W10 A;  5GAN 6;  2DL3 A;  4J9C A;  2R58 A;  1WGS A;  4J6X A;  4JZ3 A;  2MMP A;  3JCM b;  3OYA A;  5FLX E;  1M2V B;  2V26 A;  1LPL A;  3O5Z A;  4A53 A;  4PJO B;  3REA B;  2YUN A;  2FPE A;  2GQI A;  2EQU A;  2GGR A;  5IN1 A;  2K4Y A;  1WX6 A;  3CCQ A;  2RN8 A;  4M77 D;  2PVD B;  2ZPH B;  2JNG A;  1M1K U;  2RI2 A;  1GRI A;  2X9H A;  3HHT B;  1VQ6 A;  3E2U A;  4O6J A;  3LWI A;  4QQG A;  2KBT A;  3HSB A;  3NPF A;  5CR2 A;  1VQN T;  4BD3 A;  2DER A;  1KG1 A;  4PFP A;  3UWN A;  4RUG A;  1G3W A;  1PWT A;  4M75 D;  1W2B A;  2ZCF B;  1D0Y A;  1PG5 B;  3A8L B;  2P4R A;  5J3B A;  2ZPI B;  2DET A;  2KVQ G;  5I11 A;  1YHQ Q;  5L8R E;  2XDD A;  2RD1 A;  1RLQ C;  4M75 B;  3VS1 A;  3CCV Q;  2DBM A;  3RKW A;  1WFW A;  2YWW A;  3EG1 A;  3CPW A;  2CP2 A;  3E9G A;  1ARK A;  4A63 B;  2DRK A;  2QI2 A;  5HK0 A;  2K6D A;  1CKA A;  1AWW A;  2YLB A;  3A8M B;  4A4K A;  1W1F A;  4M75 C;  2DKG A;  2ROT A;  1QKW A;  1WI7 A;  4C92 G;  3EGX B;  4J8O A;  1NPR A;  4BY6 B;  1GCP A;  3TEE A;  2L2P A;  1TUD A;  2ZPB B;  2L0A A;  1MND A;  2DXC A;  2EW3 A; 
#chains in the Genus database with same CATH homology
 1YP5 A;  2AK5 A;  4ORZ A;  1MV0 B;  2L3Q A;  4RTY A;  2CUB A;  1GBQ A;  2FO0 A;  3KFV A;  1K9A A;  3ULR B;  1H8K A;  4DEX A;  2F2X A;  3EHR A;  2SRC A;  3M0S A;  4QT7 A;  2JXB A;  2EYY A;  2B86 A;  4Z89 A;  2ENM A;  1K76 A;  1NYF A;  1OOT A;  2EPD A;  1SHG A;  5GJW B;  4OMM A;  2ABL A;  1PNJ A;  1Y0M A;  2RQW A;  2IIM A;  5IH2 A;  2RQV A;  3JV3 A;  2FPD A;  1KJW A;  3M0R A;  5GJV B;  2CDT A;  2BZY A;  2EGE A;  2LMJ A;  2FEI A;  1MV3 A;  2CSI A;  1V1C A;  3M0U A;  1K0X A;  2GNC A;  1UJ0 A;  2J05 A;  1J3T A;  1WLP B;  2C0I A;  2FRY A;  3ZL7 C;  1YWO A;  4WCI A;  2JW4 A;  1K0S A;  4EIK A;  1SHF A;  2LZ6 B;  1X2Q A;  1M8M A;  5FWC A;  1PKT A;  1VYU A;  3M0P A;  3H0H A;  4J9G A;  1QKX A;  2V1R A;  1NEG A;  2VVK A;  4M4Z A;  1SSH A;  2K7A A;  4FSS A;  1SEM A;  3VS0 A;  2M51 A;  1UUE A;  2F2W A;  1OPK A;  1FMK A;  1YNZ A;  4RTU A;  2HCK A;  2YUP A;  2A37 A;  1ABQ A;  2RMO A;  1UEC A;  1GL5 A;  1X2K A;  3C0C A;  4AG1 C;  4D8K A;  4HVW A;  2PNI A;  2AZV A;  4AFQ C;  1NEB A;  1I07 A;  2V1Q A;  2DBK A;  1VYV A;  2JT4 A;  2GTJ A;  3RBB B;  4J9D A;  1SRM A;  2DYB A;  3VS7 A;  4AG2 C;  1Y57 A;  1PHT A;  2ESW A;  3PVL A;  5IHN A;  3QWY A;  1T0H A;  2K9G A;  2KT1 A;  2RQT A;  3U23 A;  1WA7 A;  3TSZ A;  2PTK A;  2J6K A;  1PKS A;  3VS4 A;  4AFU C;  2M0Y A;  2EGA A;  2OI3 A;  4J9H A;  1JQQ A;  2GTO A;  2K3B A;  1K4U S;  4RTX A;  2LQW A;  1UFF A;  1TG0 A;  2FRW A;  3SHW A;  1XOV A;  2EVR A;  2BZX A;  1ZBJ A;  2O88 A;  1OPL A;  1YN8 A;  3LH5 A;  2DF6 A;  2DA9 A;  2H8H A;  3RNJ A;  3VS6 A;  2J6F A;  4K11 A;  1UDL A;  4OMP A;  2X3W D;  1AZG B;  4J9E A;  1U06 A;  2CT4 A;  2DL7 A;  1CSK A;  1EFN A;  2W0Z A;  2G6F X;  2LNH B;  4RTZ A;  1WXT A;  1ZUY A;  1WIE A;  2MOX A;  2O2O A;  1Z9Z A;  2RF0 A;  2K79 A;  1E6H A;  5IXF A;  2KRM A;  2KGT A;  3UA6 A;  3NGP A;  2EYW A;  4HCK A;  2C0T A;  2J7I A;  2EYX A;  2KXC A;  5IHI A;  2O9S A;  1M3B A;  1RI9 A;  3EG3 A;  1S1N A;  4F14 A;  1X6B A;  1YCS B;  2GBQ A;  1JO8 A;  2DX1 A;  2KT8 A;  3UF4 A;  3VRZ A;  1NLP C;  4Z88 A;  1JEG A;  3I5R A;  2MCN A;  2D0N A;  2SEM A;  2KEA A;  4IIM A;  3SEM A;  2KRS A;  2DL4 A;  2X3X D;  1H3H A;  1PRL C;  1UHF A;  1AWX A;  1UJY A;  2JMA A;  2EBP A;  4KRT A;  1M27 C;  3EG0 A;  2C0O A;  1ZUK A;  2BTT A;  1JXM A;  1BB9 A;  1SRL A;  2D8H A;  5IXB A;  1AWO A;  1AEY A;  1OEB A;  2EQI A;  1UHC A;  2AKK A;  1UG1 A;  2LJ0 A;  3EG2 A;  2YDL A;  4F17 A;  1GFD A;  4JPB W;  3PVQ A;  2HEQ A;  3VS5 A;  2CT3 A;  1KFZ A;  1RLP C;  1PRM C;  4J9F A;  1Z9Q A;  5IHK A;  2EKH A;  2LX7 A;  1KSW A;  1ABO A;  4D8D A;  2NUZ A;  2BZ8 A;  4LN2 A;  3THK A;  2O9V A;  2CRE A;  3UA7 A;  2DMO A;  2QDL A;  4CC4 B;  1AD5 A;  3H0F A;  1WXU A;  1BBZ A;  2O31 A;  4DEY A;  1M3A A;  4LE9 A;  1QCF A;  2DL8 A;  3EHQ A;  1B07 A;  2CH4 W;  2JTE A;  2RPN A;  1X69 A;  2XMF A;  3GBQ A;  1X27 A;  2ECZ A;  1KIK A;  1HSQ A;  2HSP A;  4HVV A;  3VS2 A;  1GCQ C;  1UTI A;  4F16 A;  1NYG A;  4J9B A;  3R6N A;  5L23 A;  2DIL A;  2F2V A;  3I9Q A;  5FW9 A;  4OMN A;  4Y92 A;  1YWP A;  2KNB B;  1NLO C;  2CUD A;  4AFS C;  2DVJ A;  4Z8A A;  3PE0 A;  1QWE A;  1UGV A;  2E5K A;  3CQT A;  2A08 A;  5FWB A;  1GBR A;  4JZ4 A;  2YUO A;  2LCS A;  1W70 A;  3A98 A;  1X43 A;  4GBQ A;  2AZS A;  1G83 A;  2L3P A;  2PZ1 A;  3NHN A;  4ESR A;  2YT6 A;  2KRN A;  4RTW A;  1M30 A;  1HJD A;  4HVU A;  3UAT A;  3FJ5 A;  4OMQ A;  2A36 A;  2KYM A;  2RNA A;  2D8J A;  4RTV A;  2FPF A;  2OJ2 A;  5HCK A;  1I0C A;  4CC3 A;  1G2B A;  3I35 A;  1I1J A;  1TUC A;  2DM1 A;  1AZE A;  2DE0 X;  1QLY A;  5I22 A;  2LJ1 A;  4RTT A;  2YSQ A;  2I0N A;  1WYX A;  4CC2 A;  2CH4 A;  1GCQ A;  2J06 A;  3QWX X;  2DJQ A;  4CC7 A;  4OMO A;  1OV3 A;  2JS0 A;  1JU5 C;  1AWJ A;  1GFC A;  1RUW A;  1H92 A;  4JJC A;  2RQU A;  1NG2 A;  1ZLM A;  4J9I A;  2ED0 A;  2KE9 A;  2CSQ A;  2DLP A;  3TSW A;  2RQR A;  1E6G A;  2JM9 A;  1SPK A;  2W10 A;  2DL3 A;  1NM7 A;  2JMC A;  4J9C A;  4GLM A;  3M0Q A;  4JZ3 A;  1K1Z A;  2HBW A;  1QWF A;  3M0T A;  2OAW A;  3O5Z A;  2DL5 A;  2FG0 A;  2YUN A;  1VYT A;  3REA B;  5EC7 A;  4HXJ A;  1ZX6 A;  5ECA A;  2FPE A;  4LUE A;  2GQI A;  2GGR A;  4AFZ C;  2EGC A;  1WX6 A;  1A0N B;  4R0K A;  1BK2 A;  2RN8 A;  3VS3 A;  1WXB A;  4OML A;  2HDA A;  1AOJ A;  1AVZ C;  1HD3 A;  1GRI A;  2KYB A;  2KR3 A;  2EYZ A;  1E7O A;  1X6G A;  2KBT A;  1N5Z A;  3NPF A;  4ZNX A;  3IQL A;  3H41 A;  4RUG A;  2DNU A;  3VRY A;  1PWT A;  1T3S A;  1M3C A;  4E6R A;  2AKL A;  1WDX A;  2MIO A;  4X1V A;  3H0I A;  2P4R A;  1JXO A;  2ED1 A;  2K2M A;  1FYN A;  2JS2 A;  5I11 A;  4LNP A;  2JM8 A;  1RLQ C;  2D1X A;  3TVT A;  1ZSG A;  2KRO A;  1W6X A;  3VS1 A;  2J6O A;  2DBM A;  1B3Q A;  4IIO A;  1WFW A;  1VA7 A;  2LP5 A;  3EG1 A;  1ARK A;  4A63 B;  2DRK A;  1UE9 A;  2K6D A;  4LUD A;  3I5S A;  2ROL A;  3NMZ C;  1T3L A;  1CKA A;  1U5S A;  1AWW A;  1IO6 A;  3EGU A;  1W1F A;  2LJ3 A;  2ROT A;  2A28 A;  1QKW A;  1WI7 A;  2YUQ A;  2LQN A;  1MUZ A;  1LCK A;  2NWM A;  2DRM A;  2VKN A;  1GCP A;  2KXD A;  2VWF A;  1U3O A;  1ZUU A;  2L2P A;  1TUD A;  1T0J A;  2L3S A;  4JJD A;  1BU1 A;  2L0A A;  4JJB A;  1CKB A;  3REB B;  2EW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...